U.S. patent application number 13/851404 was filed with the patent office on 2013-08-22 for dimeric alpha interferon pegylated site-specifically shows enhanced and prolonged efficacy in vivo.
This patent application is currently assigned to IBC PHARMACEUTICALS, INC.. The applicant listed for this patent is IBC PHARMACEUTICALS, INC.. Invention is credited to Chien-Hsing Chang, David M. Goldenberg, William J. McBride, Edmund A. Rossi.
Application Number | 20130217091 13/851404 |
Document ID | / |
Family ID | 45064642 |
Filed Date | 2013-08-22 |
United States Patent
Application |
20130217091 |
Kind Code |
A1 |
Chang; Chien-Hsing ; et
al. |
August 22, 2013 |
Dimeric Alpha Interferon PEGylated Site-Specifically Shows Enhanced
and Prolonged Efficacy in Vivo
Abstract
The present invention concerns methods and compositions for
PEGylated complexes of defined stoichiometry and structure.
Preferably, the PEGylated complex is formed using dock-and-lock
technology, by attaching a therapeutic agent to a DDD sequence and
a PEG moiety to an AD sequence, allowing the DDD sequence to bind
to the AD sequence in a 2:1 stoichiometry, to form PEGylated
complexes with two therapeutic agents and one PEG moiety.
Alternatively, the therapeutic agent may be attached to the AD
sequence and the PEG to the DDD sequence to form PEGylated
complexes with two PEG moieties and one therapeutic agent. In more
preferred embodiments, the therapeutic agent may comprise any
peptide or protein of physiologic or therapeutic activity,
preferably a cytokine, more preferably interferon-.alpha.2b. The
PEGylated complexes exhibit a significantly slower rate of
clearance when injected into a subject and are of use for treatment
of a wide variety of diseases.
Inventors: |
Chang; Chien-Hsing;
(Downingtown, PA) ; Goldenberg; David M.;
(Mendham, NJ) ; McBride; William J.; (Boonton,
NJ) ; Rossi; Edmund A.; (Woodland Park, NJ) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
IBC PHARMACEUTICALS, INC.; |
|
|
US |
|
|
Assignee: |
IBC PHARMACEUTICALS, INC.
Morris Plains
NJ
|
Family ID: |
45064642 |
Appl. No.: |
13/851404 |
Filed: |
March 27, 2013 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
13412816 |
Mar 6, 2012 |
8435540 |
|
|
13851404 |
|
|
|
|
13178092 |
Jul 7, 2011 |
8158129 |
|
|
13412816 |
|
|
|
|
12731781 |
Mar 25, 2010 |
8003111 |
|
|
13178092 |
|
|
|
|
12396965 |
Mar 3, 2009 |
7871622 |
|
|
12731781 |
|
|
|
|
11391584 |
Mar 28, 2006 |
7521056 |
|
|
12396965 |
|
|
|
|
12417917 |
Apr 3, 2009 |
7906121 |
|
|
12731781 |
|
|
|
|
11478021 |
Jun 29, 2006 |
7534866 |
|
|
12417917 |
|
|
|
|
12396605 |
Mar 3, 2009 |
7858070 |
|
|
12731781 |
|
|
|
|
11633729 |
Dec 5, 2006 |
7527787 |
|
|
12396605 |
|
|
|
|
PCT/US2006/010762 |
Mar 24, 2006 |
|
|
|
11633729 |
|
|
|
|
PCT/US2006/012084 |
Mar 29, 2006 |
|
|
|
PCT/US2006/010762 |
|
|
|
|
PCT/US2006/025499 |
Jun 29, 2006 |
|
|
|
PCT/US2006/012084 |
|
|
|
|
11389358 |
Mar 24, 2006 |
7550143 |
|
|
PCT/US2006/025499 |
|
|
|
|
12418877 |
Apr 6, 2009 |
7906118 |
|
|
12731781 |
|
|
|
|
12644146 |
Dec 22, 2009 |
7981398 |
|
|
12731781 |
|
|
|
|
11925408 |
Oct 26, 2007 |
7666400 |
|
|
12644146 |
|
|
|
|
60668603 |
Apr 6, 2005 |
|
|
|
60728292 |
Oct 19, 2005 |
|
|
|
60751196 |
Dec 16, 2005 |
|
|
|
60782332 |
Mar 14, 2006 |
|
|
|
60864530 |
Nov 6, 2006 |
|
|
|
61043932 |
Apr 10, 2008 |
|
|
|
61104916 |
Oct 13, 2008 |
|
|
|
61119542 |
Dec 3, 2008 |
|
|
|
61163666 |
Mar 26, 2009 |
|
|
|
Current U.S.
Class: |
435/188 |
Current CPC
Class: |
A61P 27/02 20180101;
C07K 16/3007 20130101; C07K 2317/31 20130101; C07K 2319/00
20130101; A61P 13/12 20180101; A61P 37/00 20180101; B82Y 10/00
20130101; A61P 19/02 20180101; A61P 1/00 20180101; C07K 2317/73
20130101; A61K 47/64 20170801; A61P 1/04 20180101; C07K 16/005
20130101; A61P 7/00 20180101; A61P 7/02 20180101; A61P 7/04
20180101; A61P 19/04 20180101; A61P 37/06 20180101; A61P 5/38
20180101; A61P 9/00 20180101; C07K 2319/70 20130101; C07K 16/468
20130101; A61P 25/00 20180101; C12N 9/1205 20130101; Y02A 50/386
20180101; A61P 21/04 20180101; C07K 16/00 20130101; A61P 17/06
20180101; A61P 17/00 20180101; A61P 31/12 20180101; B82Y 30/00
20130101; C07K 16/283 20130101; A61P 29/00 20180101; C07K 2317/55
20130101; A61K 47/60 20170801; A61P 1/16 20180101; A61P 3/10
20180101; A61P 35/00 20180101; A61P 9/10 20180101; A61K 39/395
20130101 |
Class at
Publication: |
435/188 |
International
Class: |
C12N 9/12 20060101
C12N009/12 |
Claims
1. A fusion protein comprising a) an interferon; and b) a
dimerization and docking domain (DDD) moiety from human protein
kinase A (PKA) regulatory subunit RI.alpha., RI.beta., RII.alpha.
or RII.beta..
2. The fusion protein of claim 1, wherein the interferon is
selected from the group consisting of interferon-alpha
(IFN-.alpha.), IFN-.beta., IFN-.gamma. and IFN-.lamda..
3. The fusion protein of claim 1, wherein the interferon is
IFN-.alpha..
4. The fusion protein of claim 1, wherein the interferon is
IFN-.beta..
5. The fusion protein of claim 1, wherein the interferon is
IFN-.gamma..
6. The fusion protein of claim 1, wherein the interferon is
IFN-.lamda..
7. A dimer comprising two copies of a fusion protein according to
claim 1, wherein the two DDD moieties bind together to form the
dimer.
8. A fusion protein comprising a) an interferon; and b) an
anchoring domain (AD) moiety from an A-kinase anchoring protein
(AKAP).
9. The fusion protein of claim 8, wherein the interferon is
selected from the group consisting of IFN-.alpha., IFN-.beta.,
IFN-.gamma. and IFN-.lamda..
10. The fusion protein of claim 8, wherein the interferon is
IFN-.alpha..
11. The fusion protein of claim 8, wherein the interferon is
IFN-.beta..
12. The fusion protein of claim 8, wherein the interferon is
IFN-.gamma..
13. The fusion protein of claim 8, wherein the interferon is
IFN-.lamda..
Description
RELATED APPLICATIONS
[0001] The present application is a divisional of U.S. Ser. No.
13/412,816, filed Mar. 6, 2012, which was a divisional of U.S. Ser.
No. 13/178,092 (now issued U.S. Pat. No. 8,158,129), filed Jul. 7,
2011, which was a continuation-in-part of U.S. Ser. No. 12/731,781
(now issued U.S. Pat. No. 8,003,111), filed Mar. 25, 2010, which
was a continuation-in-part of U.S. Ser. No. 12/396,965 (now issued
U.S. Pat. No. 7,871,622), filed Mar. 3, 2009, which was a
divisional of U.S. Ser. No. 11/391,584 (now issued U.S. Pat. No.
7,521,056), filed Mar. 28, 2006, which claimed the benefit of U.S.
Provisional Patent Applications 60/668,603, filed Apr. 6, 2005;
60/728,292, filed Oct. 19, 2005; 60/751,196, filed Dec. 16, 2005;
and 60/782,332, filed Mar. 14, 2006. U.S. Ser. No. 12/731,781 was a
continuation-in-part of U.S. Ser. No. 12/417,917 (now issued U.S.
Pat. No. 7,906,121), filed Apr. 3, 2009, which was a divisional of
U.S. Ser. No. 11/478,021 (now issued U.S. Pat. No. 7,534,866),
filed Jun. 29, 2006.
[0002] U.S. Ser. No. 12/731,781 was also a continuation-in-part of
U.S. Ser. No. 12/396,605 (now issued U.S. Pat. No. 7,858,070),
filed Mar. 3, 2009, which was a divisional of U.S. Ser. No.
11/633,729 (now issued U.S. Pat. No. 7,527,787), filed Dec. 5,
2006, which was a continuation-in-part of PCT/US06/010762, filed
Mar. 24, 2006, PCT/US06/012084, filed Mar. 29, 2006,
PCT/US06/025499, filed Jun. 29, 2006, U.S. Ser. No. 11/389,358 (now
issued U.S. Pat. No. 7,550,143), filed Mar. 24, 2006, and claimed
the benefit of U.S. Provisional Patent Application 60/864,530,
filed Nov. 6, 2006.
[0003] U.S. Ser. No. 12/731,781 was also a continuation-in-part of
U.S. Ser. No. 12/418,877 (now issued U.S. Pat. No. 7,906,118),
filed Apr. 6, 2009, which claimed the benefit of U.S. Provisional
Patent Applications 61/043,932, filed Apr. 10, 2008, 61/104,916,
filed Oct. 13, 2008, and 61/119,542, filed Dec. 3, 2008. U.S. Ser.
No. 12/731,781 was also a continuation-in-part of U.S. Ser. No.
12/644,146 (now issued U.S. Pat. No. 7,981,398), filed Dec. 22,
2009, which was a divisional of U.S. Ser. No. 11/925,408 (now
issued U.S. Pat. No. 7,666,400), filed Oct. 26, 2007. U.S. Ser. No.
12/731,781 claimed the benefit under 35 U.S.C. 119(e) of U.S.
Provisional Patent Application 61/163,666, filed Mar. 26, 2009. The
text of each priority application cited above is incorporated
herein by reference in its entirety.
SEQUENCE LISTING
[0004] The instant application contains a Sequence Listing which
has been submitted via EFS-Web and is hereby incorporated by
reference in its entirety. Said ASCII copy, created on Mar. 24,
2010, is named IBC123US.txt and is 14,095 bytes in size.
BACKGROUND
[0005] 1. Field of the Invention
[0006] The present invention relates to compositions and methods of
therapeutic use of PEGylated cytokines, such as interferon-alpha
(IFN-.alpha.), more preferably IFN-.alpha.2b. However, the skilled
artisan will realize that the invention is not so limited and more
broadly covers PEGylated forms of other immunomodulators or
different therapeutic agents. Preferably, the PEGylated
compositions are made using the dock-and-lock (DNL) technique, as
exemplified in U.S. Pat. Nos. 7,521,056; 7,527,787; 7,534,866;
7,550,143 and 7,666,400, the Examples section of each of which is
incorporated herein by reference. The PEGylated cytokines,
immunomodulators and other therapeutic agents retain in vitro
activity and preferably show enhanced in vivo efficacy and
increased serum half-life. Additional advantages of the PEGylated
products may also include lower immunogenicity, decreased dosing
frequency, increased solubility, enhanced stability, and reduced
renal clearance.
[0007] 2. Related Art
[0008] Interferon
[0009] Interferon-.alpha. (IFN.alpha.) has been reported to have
anti-tumor activity in both animal models of cancer (Ferrantini et
al., 1994, J Immunol 153:4604-15) and human cancer patients
(Gutterman et al., 1980, Ann Intern Med 93:399-406). IFN.alpha. can
exert a variety of direct anti-tumor effects, including
down-regulation of oncogenes, up-regulation of tumor suppressors,
enhancement of immune recognition via increased expression of tumor
surface MHC class I proteins, potentiation of apoptosis, and
sensitization to chemotherapeutic agents (Gutterman et al., 1994,
PNAS USA 91:1198-205; Matarrese et al., 2002, Am J Pathol
160:1507-20; Mecchia et al., 2000, Gene Ther 7:167-79; Sabaawy et
al., 1999, Int J Oncol 14:1143-51; Takaoka et al, 2003, Nature
424:516-23). For some tumors, IFN.alpha. can have a direct and
potent anti-proliferative effect through activation of STAT1
(Grimley et al., 1998 Blood 91:3017-27).
[0010] Indirectly, IFN.alpha. can inhibit angiogenesis (Sidky and
Borden, 1987, Cancer Res 47:5155-61) and stimulate host immune
cells, which may be vital to the overall antitumor response but has
been largely under-appreciated (Belardelli et al., 1996, Immunol
Today 17:369-72). IFN.alpha. has a pleiotropic influence on immune
responses through effects on myeloid cells (Raefsky et al, 1985, J
Immunol 135:2507-12; Luft et al, 1998, J Immunol 161:1947-53),
T-cells (Carrero et al, 2006, J Exp Med 203:933-40; Pilling et al.,
1999, Eur J Immunol 29:1041-50), and B-cells (Le et al, 2001,
Immunity 14:461-70). As an important modulator of the innate immune
system, IFN.alpha. induces the rapid differentiation and activation
of dendritic cells (Belardelli et al, 2004, Cancer Res 64:6827-30;
Paquette et al., 1998, J Leukoc Biol 64:358-67; Santini et al.,
2000, J Exp med 191:1777-88) and enhances the cytotoxicity,
migration, cytokine production and antibody-dependent cellular
cytotoxicity (ADCC) of NK cells (Biron et al., 1999, Annu Rev
Immunol 17:189-220; Brunda et al. 1984, Cancer Res 44:597-601).
[0011] The therapeutic effectiveness of IFNs has been validated to
date by the approval of IFN-.alpha.2 for treating hairy cell
leukemia, chronic myelogenous leukemia, malignant melanoma,
follicular lymphoma, condylomata acuminata, AIDs-related Kaposi
sarcoma, and chronic hepatitis B and C; IFN-.beta. for treating
multiple sclerosis; and IFN-.gamma. for treating chronic
granulomatous disease and malignant osteopetrosis. Despite a vast
literature on this group of autocrine and paracrine cytokines,
their functions in health and disease are still being elucidated,
including more effective and novel forms being introduced
clinically (Pestka, 2007, J. Biol. Chem. 282:20047-51; Vilcek,
2006, Immunity 25:343-48).
[0012] Therapy of viral infection with IFNs has been reported for a
wide variety of viral species. The combination of IFN-.alpha. and
IFN-.gamma. or IFN-.beta. and IFN-.gamma. was reported to inhibit
replication of dengue virus (Diamond & Harris, 2001, Virology
289:297-311). Low dose prophylactic oral administration of
IFN-.alpha. protected against a lethal challenge with influenza
virus (Belharz et al., 2007, Biochem Biophys Res Commun
355:740-44). Similarly, prophylactic IFN-.alpha.-2 reduced
rhinovirus-induced infection (Morey & Blackwell, 1989, Aviat
Space Environ Med 60:1028). The combination of IFN-.alpha.-6 and
IFN-.beta. was reported to synergistically reduce infection with
cytomegalovirus when administered prophylactically. A synergistic
effect of IFN-.beta. and IFN-.gamma. was also reported for reducing
acyclovir-resistant herpes simplex viral infection (Huang et al.,
2010, J Gen Virol 91:591-98). IFN-.gamma. was observed to inhibit
DNA synthesis of vaccinia virus in macrophages (Melkova &
Esteban, 1994, Virology 198:731-35). An IFN-.gamma. mimetic peptide
prevented encephalomyocarditis virus infection in both tissue
culture and in vivo in mice (Mujtaba et al., 2006, Clin Vaccine
Immunol 13:944-52).
[0013] The promise of IFN.alpha. as a cancer therapeutic has been
hindered primarily due to its short circulating half-life and
systemic toxicity. As demonstrated by PEGINTRON.RTM. (Grace et al.,
2001, J. Interferon Cytokine Res 21:1103-15) and PEGASYS.RTM.
(Bailon et al., 2001, Bioconjugate Chem 12:195-202), the efficacy
of IFNs can be enhanced by improving their bioavailability with
PEGylation, with the resulting conjugate exhibiting an increased
serum half-life (Harris and Chess, 2003, Nat Rev Drug Discov
2:214-21). Additional advantages of PEGylation in general include
reduced immunogenicity, decreased dosing frequency, increased
solubility, enhanced resistance to proteolysis, and exclusion of
renal clearance.
[0014] PEGylation
[0015] Because the most common reactive sites on proteins
(including peptides) for attaching PEG are the .epsilon. amino
groups of lysine and the .alpha. amino group of the N-terminal
residue, early methods of PEGylation resulted in modification of
multiple sites, yielding not only monoPEGylated conjugates
consisting of mixtures of positional isomers, such as
PEGINTRON.RTM..TM. (Grace et al., J. Biol. Chem. 2005; 280:6327)
and PEGASYS.RTM..RTM. (Dhalluin et al., Bioconjugate Chem. 2005;
16:504), but also adducts comprising more than one PEG chain.
Site-specific attachment of a single PEG to the a amino group of
the N-terminal residue was reported to be the predominant product
upon reacting PEG-aldehyde (PEG-ALD) at low pH with IFN-.beta.1b
(Basu et al., Bioconjugate Chem. 2006; 17:618) or IFN-.beta.1a
(Pepinsky et al., J. Pharmacol. Exp. Ther. 2001, 297:1059). Similar
strategies were applied to prepare N-terminally linked PEG to G-CSF
(Kinstler et al., Pharm. Res. 1996; 13:996) or type I soluble tumor
necrosis factor receptor (Kerwin et al., Protein Sci. 2002;
11:1825). More recently, a solid-phase process for PEGylation of
the N-terminus of recombinant interferon alpha-2a was reported (Lee
et al., Bioconjug. Chem. Oct. 18, 2007, epub).
[0016] Site-directed PEGylation of a free cysteine residue
introduced into a target protein has also been achieved with
PEG-maleimide (PEG-MAL) for several recombinant constructs
including IL-2 (Goodson and Katre, Biotechnology. 1990:8:343);
IFN-.alpha.2 (Rosendahl et al., Bioconjugate Chem. 2005; 16:200);
GM-CSF (Doherty et al., Bioconjugate Chem. 2005; 16:1291); scFv
(Yang et al., Protein Eng. 2003; 16:761), and miniantibodies
(Kubetzko et al., J. Biol. Chem.; 2006; 201:35186). A popular
approach for improving the therapeutic efficacy of an enzyme has
been to prepare conjugates containing multiple PEG of small size,
as known for methioninase (Yang et al., Cancer Res. 2004; 64:6673);
L-methionine .gamma.-lyase (Takakura et al., Cancer Res.
2006:66:2807): arginine deaminase (Wang et al., Bioconjugate Chem.
2006; 17:1447); adenosine deaminase (Davis et al., Clin. Exp.
Immunol. 1981, 46:649); L-asparaginase (Bendich et al., Clin. Exp.
Immunol. 1982, 48:273); and liver catalase (Abuchowski et al., J.
Biol. Chem. 1977, 252:3582).
[0017] PEGylations of bovine serum albumin (Abuchowski et al., J.
Biol. Chem. 1977; 252:3578); hemoglobin (Manjula et al.,
Bioconjugate Chem. 2003; 14:464); visomant (Mosharraf et al., Int.
J. Pharm. 2007; 336:215); small molecules such as inhibitors of
integrin .alpha.4.beta.1 (Pepinsky et al., J. Pharmacol. Exp. Ther.
2005, 312:742); lymphoma-targeting peptides (DeNardo et al., Clin.
Cancer. Res. 2003; 9(Suppl.):3854s); anti-VEGF aptamer (Bunka and
Stockley, Nat. Rev. Microbiol. 2006; 4:588) and
oligodeoxynucleotides (Fisher et al., Drug Metab. Dispos. 2004;
32:983) have also been described. The feasibility of reversible or
releasable PEGylation, wherein covalently attached PEG can be
cleaved in vivo, has been shown with a variety of degradable
linkages, exemplified by linking PEG-SH to IFN-.alpha.2 with a
2-sulfo-9-fluorenylmethoxycarbonyl-containing bifunctional reagent
(Peleg-Shulman et al., 2004, J Med Chem 47:4897-4904), by attaching
linear or branched PEG-BCN3 to lysozyme or IFN-.beta.1b (Zhao et
al., 2006, Bioconjugate Chem 17:341-51), or by conjugating PEG to
lysozyme via a dithiobenzyl urethane linkage (Zalipsky et al.,
2007, Bioconjugate Chem 18:1869-78). Recently, a strategy for
site-specific PEGylation of disulfide bonds has been reported
(Shaunak et al., 2006, Nat Chem Biol 2:312-13), but its use may be
limited to only those proteins with native disulfide bonds that are
suitably oriented for such modification.
[0018] There exists a need for a general method of PEGylation that
would produce a monoPEGylated or a biPEGylated conjugate linked
site-specifically to a predetermined location of a therapeutic
agent such as a cytokine, which retains the bioactivity of the
unmodified agent. A further need exists for PEG-cytokine conjugates
that exhibit improved in vivo efficacy, decreased toxicity and/or
superior pharmacokinetic properties.
SUMMARY OF THE INVENTION
[0019] The present invention discloses methods and compositions for
producing PEGylated compounds that can be selected to contain
either one or two PEG residues, attached at a selected location of
a therapeutic agent, such as a cytokine, preferably IFN-.alpha.2b.
The PEGylated cytokines are prepared using the Dock-and-Lock method
(Chang et al., 2007, Clin Cancer Res 13:5586s-91s), which generates
stable and defined conjugates suitable for in vivo
applications.
[0020] In preferred embodiments, the agents are monoPEGylated. In
more preferred embodiments, the agent to be PEGylated may be
attached to a DDD (dimerization and docking domain) sequence and a
PEG moiety may be attached to an AD (anchor domain) sequence as
described in more detail below. Dimers of the DDD sequence bind
with high affinity to monomers of the AD sequence, resulting in
formation of a monoPEGylated therapeutic agent dimer. The
stoichiometry of binding and location of the PEG residue are
determined by the specificity of the DDD/AD interaction, with a
preferred trimeric structure comprising two DDD moieties attached
to one AD moiety. However, the skilled artisan will realize that
other types of DNL complexes with different structures and
different ratios of cytokine to PEG may be constructed and used
within the scope of the claimed methods and compositions, such as
those disclosed in U.S. Pat. Nos. 7,521,056; 7,527,787; 7,534,866;
7,550,143 and 7,666,400.
[0021] In more preferred embodiments, the monoPEGylated complex may
be covalently stabilized by introduction of cysteine residues at
appropriate locations in the DDD and AD sequences, to form
disulfide bonds that stabilize the complex. In other embodiments,
the PEG reagents may be capped at one end with a linear or branched
methoxy group (m-PEG). Either linear PEG or branched PEG molecules,
as known in the art, may be utilized.
[0022] In other preferred embodiments, the PEGylated complex made
by the DNL method shows a rate of clearance from serum that is at
least an order of magnitude slower than the unPEGylated therapeutic
agent. In certain alternative embodiments, the PEGylated complex
may be alternatively constructed with the PEG moiety attached to
the DDD sequence and the therapeutic agent attached to the AD
sequence, resulting in a stoichiometry of 2 PEG to 1 therapeutic
agent, such as a cytokine, per complex.
[0023] The skilled artisan will realize that virtually any
physiologically or therapeutically active agent to be administered
in vivo may be stabilized by PEGylation, including but not limited
to enzymes, cytokines, chemokines, growth factors, peptides,
aptamers, hemoglobin, antibodies and fragments thereof. Exemplary
agents include MIF, HMGB-1 (high mobility group box protein 1),
TNF-.alpha., IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9,
IL-10, IL-11, IL-12, IL-13, IL-15, IL-16, IL-17, IL-18, IL-19,
IL-21, IL-23, IL-24, CCL19, CCL21, IL-8, MCP-1, RANTES, MIP-1A,
MIP-1B, ENA-78, MCP-1, IP-10, Gro-.beta., Eotaxin,
interferon-.alpha., -.beta., -.lamda., G-CSF, GM-CSF, SCF, PDGF,
MSF, Flt-3 ligand, erythropoietin, thrombopoietin, hGH, CNTF,
leptin, oncostatin M, VEGF, EGF, FGF, PlGF, insulin, hGH,
calcitonin, Factor VIII, IGF, somatostatin, tissue plasminogen
activator, and LIF.
[0024] The PEGylated complexes are suitable for use in a wide
variety of therapeutic and diagnostic applications. Methods of use
of PEGylated DNL complexes may include detection, diagnosis and/or
treatment of a disease or other medical condition. Such conditions
may include, but are not limited to, cancer, hyperplasia, diabetes,
diabetic retinopathy, macular degeneration, inflammatory bowel
disease, Crohn's disease, ulcerative colitis, rheumatoid arthritis,
sarcoidosis, asthma, edema, pulmonary hypertension, psoriasis,
corneal graft rejection, neovascular glaucoma, Osler-Webber
Syndrome, myocardial angiogenesis, plaque neovascularization,
restenosis, neointima formation after vascular trauma,
telangiectasia, hemophiliac joints, angiofibroma, fibrosis
associated with chronic inflammation, lung fibrosis, deep venous
thrombosis or wound granulation.
[0025] In particular embodiments, the disclosed methods and
compositions may be of use to treat autoimmune disease, such as
acute idiopathic thrombocytopenic purpura, chronic idiopathic
thrombocytopenic purpura, dermatomyositis, Sydenham's chorea,
myasthenia gravis, systemic lupus erythematosus, lupus nephritis,
rheumatic fever, polyglandular syndromes, bullous pemphigoid,
juvenile diabetes mellitus, Henoch-Schonlein purpura,
post-streptococcal nephritis, erythema nodosum, Takayasu's
arteritis, Addison's disease, rheumatoid arthritis, multiple
sclerosis, sarcoidosis, ulcerative colitis, erythema multiforme,
IgA nephropathy, polyarteritis nodosa, ankylosing spondylitis,
Goodpasture's syndrome, thromboangitis obliterans, Sjogren's
syndrome, primary biliary cirrhosis, Hashimoto's thyroiditis,
thyrotoxicosis, scleroderma, chronic active hepatitis,
polymyositis/dermatomyositis, polychondritis, pemphigus vulgaris,
Wegener's granulomatosis, membranous nephropathy, amyotrophic
lateral sclerosis, tabes dorsalis, giant cell
arteritis/polymyalgia, pernicious anemia, rapidly progressive
glomerulonephritis, psoriasis or fibrosing alveolitis.
[0026] Exemplary types of tumors that may be treated include acute
lymphoblastic leukemia, acute myelogenous leukemia, biliary cancer,
breast cancer, cervical cancer, chronic lymphocytic leukemia,
chronic myelogenous leukemia, colorectal cancer, endometrial
cancer, esophageal, gastric, head and neck cancer, Hodgkin's
lymphoma, lung cancer, medullary thyroid cancer, non-Hodgkin's
lymphoma, multiple myeloma, renal cancer, ovarian cancer,
pancreatic cancer, glioma, melanoma, liver cancer, prostate cancer,
and urinary bladder cancer.
[0027] Various viral infections may be treated, including but not
limited to human immunodeficiency virus (HIV), herpes virus, herpes
simplex virus, vaccinia virus, cytomegalovirus, rabies virus,
influenza virus, rhinovirus, hepatitis B virus, hepatitis C virus,
Sendai virus, feline leukemia virus, Reo virus, polio virus, human
serum parvo-like virus, simian virus 40, respiratory syncytial
virus, mouse mammary tumor virus, Varicella-Zoster virus, Dengue
virus, rubella virus, measles virus, adenovirus, human T-cell
leukemia viruses, Epstein-Barr virus, murine leukemia virus, mumps
virus, vesicular stomatitis virus, Sindbis virus, lymphocytic
choriomeningitis virus, wart virus and blue tongue virus; or the
bacterium is selected from the group consisting of Streptococcus
agalactiae, Legionella pneumophila, Streptococcus pyogenes,
Escherichia coli, Neisseria gonorrhoeae, Neisseria meningitidis,
Pneumococcus, Hemophilus influenzae B, Treponema pallidum, Lyme
disease spirochetes, Pseudomonas aeruginosa, Mycobacterium leprae,
Brucella abortus, Mycobacterium tuberculosis or Clostridium
tetani.
BRIEF DESCRIPTION OF THE DRAWINGS
[0028] FIG. 1. Schematic structures of (A) IMP421, (FIG. 1A
discloses SEQ ID NO: 22) (B) IFN.alpha.2b-DDD2-pdHL2 (FIG. 1B
discloses SEQ ID NO: 31 and 6H is disclosed as SEQ ID NO: 30).
[0029] FIG. 2. Reducing (R) and nonreducing (NR) SDS-PAGE analysis
of the conjugation and purification of .alpha.2b-362 and
.alpha.2b-413. Gels were stained with Coomassie blue (A and D),
imaged with direct fluorescence (B and E) or transferred to PVDF
membranes and probed by immunoblotting with anti-IFN-.alpha. (C).
Arrowheads show the positions of .alpha.2b-362 (black),
.alpha.2b-413 (gray), IFN.alpha.2b-DDD2 (red), IMP362 (green) and
IMP413 (blue). Lane 1, IFN.alpha.2b-DDD2; Lane 2, the reaction
mixture of .alpha.2b-362 before purification; Lane 3, unbound
fraction of .alpha.2b-362; Lane 4, wash fraction of .alpha.2b-362
(0.25 M NaCl elution); Lane 5, purified .alpha.2b-362 (0.5 M NaCl
elution); Lane 6, purified 2b-413; Lane M, pre-stained molecular
weight markers; Lane E, ECL molecular weight markers.
[0030] FIG. 3. In vitro bioactivity assays. (A) Reduction of viral
cytopathic effect (CPE) was performed with encephalomyocarditis
virus (EMCV) challenge of A549 cells to determine the anti-viral
specific activity of each test compound. The anti-viral titer was
determined by comparison of EC.sub.50 values with that of an
IFN.alpha.standard. (B) Anti-tumor activity was determined by
measuring the inhibition of Daudi proliferation in vitro.
Dose-response curves were generated from a 4-day MTS assay. The
percent of the signal obtained from untreated cells was plotted vs.
the log of the concentration in ng/ml. EC50 values were obtained
with Graph Pad Prism software. Data shown are representative of
multiple repeated experiments.
[0031] FIG. 4. Pharmacokinetic (PK) properties were evaluated in
Swiss-Webster mice following a single i.v. injection of each agent
at equimolar protein dose, with concentrations in serum at various
time points determined by ELISA. The data shown represent the mean
values from two animals.
[0032] FIG. 5. Anti-tumor efficacy in Daudi models. Units of
activity were based on in vitro anti-proliferation assay. Injection
times are indicated with arrows and median survival is shown for
each treatment regimen. (A) Three different doses of each test
compound were given s.c. weekly for 4 weeks one day after
inoculating Daudi cells. (B) Three different dosing schedules
(q7dx4, q2wk.times.4, and q3wk.times.4) were evaluated in groups of
6-7 mice administered 4.times.14,000 U s.c. of PEGINTRON.RTM. or
.alpha.2b-413. (C) Two different dosing schedules (q7dx4 and
q4wk.times.4) were evaluated in groups of 10 mice administered
4.times.14,000 U s.c. of PEGINTRON.RTM. or .alpha.2b-413.
[0033] FIG. 6. Purity of .alpha.2b-457 examined by reducing (R) and
nonreducing (NR) SDS-PAGE. Lane 1, CM-purified .alpha.2b-457; Lane
2, CM-column fraction -250 mM wash; Lane 3, CM-column
fraction-unbound; Lane 4, .alpha.2b-413; Lane M, molecular weight
markers.
[0034] FIG. 7. In vitro bioactivities of .alpha.2b-457. (A)
Anti-proliferative activity determined by inhibiting Daudi growth.
(B) Anti-viral activity determined by CPE. (C) Specific activity
determined by reporter gene assay.
[0035] FIG. 8. Blood clearance of .alpha.2b-413 and .alpha.2b-457
after a single s.c. injection in male Swiss-Webster mice.
[0036] FIG. 9. Anti-tumor efficacy of .alpha.2b-457, .alpha.2b-413,
and PEGINTRON.RTM. in Daudi models. Two different doses of each
agent were given s.c. once every 4 weeks. Not all groups received
all four injections. Treatment started one day after inoculating
Daudi cells.
DOCK AND LOCK (DNL) METHOD
[0037] The DNL method is based on the specific protein/protein
interactions between the regulatory (R) subunits of cAMP-dependent
protein kinase (PKA) and the anchoring domain (AD) of A-kinase
anchoring proteins (AKAPs) (Baillie et al., FEBS Letters. 2005;
579: 3264. Wong and Scott, Nat. Rev. Mol. Cell. Biol. 2004; 5:
959). PKA, which plays a central role in the signal transduction
pathway triggered by the binding of cAMP to the R subunits of PKA,
was first isolated from rabbit skeletal muscle in 1968 (Walsh et
al., J. Biol. Chem. 1968; 243:3763). The structure of the
holoenzyme consists of two catalytic subunits held in an inactive
form by the R subunits (Taylor, J. Biol. Chem. 1989; 264:8443).
Isozymes of PKA are found with two types of R subunits (RI and
RII), and each type has .alpha. and .beta. isoforms (Scott,
Pharmacol. Ther. 1991; 50:123). The R subunits have been isolated
only as stable dimers and the dimerization domain has been shown to
consist of the first 44 amino-terminal residues (Newlon et al.,
Nat. Struct. Biol. 1999; 6:222). Binding of cAMP to the R subunits
leads to the release of active catalytic subunits for a broad
spectrum of serine/threonine kinase activities, which are oriented
toward selected substrates through the compartmentalization of PKA
via its docking with AKAPs (Scott et al., J. Biol. Chem. 1990;
265:21561)
[0038] Since the first AKAP, microtubule-associated protein-2, was
characterized in 1984 (Lohmann et al., Proc. Natl. Acad. Sci. USA.
1984; 81:6723), more than 50 AKAPs that localize to various
sub-cellular sites, including plasma membrane, actin cytoskeleton,
nucleus, mitochondria, and endoplasmic reticulum, have been
identified with diverse structures in species ranging from yeast to
humans (Wong and Scott, Nat. Rev. Mol. Cell. Biol. 2004; 5:959).
The AD of AKAPs for PKA is an amphipathic helix of 14-18 residues
(Carr et al., J. Biol. Chem. 1991; 266:14188) and any such known AD
sequence may be utilized to form a DNL complex. The amino acid
sequences of the AD are quite varied among individual AKAPs, with
the binding affinities reported for RII dimers ranging from 2 to 90
nM (Alto et al., Proc. Natl. Acad. Sci. USA. 2003; 100:4445).
Interestingly, AKAPs will only bind to dimeric R subunits. For
human RII.alpha., the AD binds to a hydrophobic surface formed by
the 23 amino-terminal residues (Colledge and Scott, Trends Cell
Biol. 1999; 6:216). Thus, the dimerization domain and AKAP binding
domain of human RII.alpha. are both located within the same
N-terminal 44 amino acid sequence (Newlon et al., Nat. Struct.
Biol. 1999; 6:222; Newlon et al., EMBO J. 2001; 20:1651), which is
termed the DDD herein.
DDD of Human RII.alpha. and AD of AKAPs as Linker Modules
[0039] We have developed a platform technology to utilize the DDD
of human RII.alpha. and the AD of AKAPs as an excellent pair of
linker modules for docking any two entities, referred to hereafter
as A and B, into a noncovalent complex, which could be further
locked into a stably tethered structure through the introduction of
cysteine residues into both the DDD and AD at strategic positions
to facilitate the formation of disulfide bonds. The general
methodology of the "dock-and-lock" approach is as follows. Entity A
is constructed by linking a DDD sequence to a precursor of A,
resulting in a first component hereafter referred to as a. Because
the DDD sequence would effect the spontaneous formation of a dimer,
A would thus be composed of a.sub.2. Entity B is constructed by
linking an AD sequence to a precursor of B, resulting in a second
component hereafter referred to as b. The dimeric motif of DDD
contained in a.sub.2 will create a docking site for binding to the
AD sequence contained in b, thus facilitating a ready association
of a.sub.2 and b to form a binary, trimeric complex composed of
a.sub.2b. This binding event is made irreversible with a subsequent
reaction to covalently secure the two entities via disulfide
bridges, which occurs very efficiently based on the principle of
effective local concentration because the initial binding
interactions bring the reactive thiol groups placed onto both the
DDD and AD into proximity (Chmura et al., Proc. Natl. Acad. Sci.
USA. 2001; 98:8480) to ligate site-specifically.
[0040] By attaching the DDD and AD away from the functional groups
of the two precursors, such site-specific ligations are also
expected to preserve the original activities of the two precursors.
This approach is modular in nature and potentially can be applied
to link, site-specifically and covalently, a wide range of
substances, including peptides, proteins, nucleic acids, cytokines
and PEG.
DDD and AD Sequence Variants
[0041] In certain embodiments, the AD and DDD sequences
incorporated into the cytokine-PEG DNL complex comprise the amino
acid sequences of DDD1 (SEQ ID NO:1) and AD1 (SEQ ID NO:3) below.
In more preferred embodiments, the AD and DDD sequences comprise
the amino acid sequences of DDD2 (SEQ ID NO:2) and AD2 (SEQ ID
NO:4), which are designed to promote disulfide bond formation
between the DDD and AD moieties.
TABLE-US-00001 DDD1 (SEQ ID NO: 1)
SHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA DDD2 (SEQ ID NO: 2)
CGHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA AD1 (SEQ ID NO:3)
QIEYLAKQIVDNAIQQA AD2 (SEQ ID NO: 4) CGQIEYLAKQIVDNAIQQAGC
[0042] However, in alternative embodiments sequence variants AD
and/or DDD moieties may be utilized in construction of the
cytokine-PEG DNL complexes. The structure-function relationships of
the AD and DDD domains have been the subject of investigation.
(See, e.g., Burns-Hamuro et al., 2005, Protein Sci 14:2982-92; Carr
et al., 2001, J Biol Chem 276:17332-38; Alto et al., 2003, Proc
Natl Acad Sci USA 100:4445-50; Hundsrucker et al., 2006, Biochem J
396:297-306; Stokka et al., 2006, Biochem J 400:493-99; Gold et
al., 2006, Mol Cell 24:383-95; Kinderman et al., 2006, Mol Cell
24:397-408, the entire text of each of which is incorporated herein
by reference.)
[0043] For example, Kinderman et al. (2006) examined the crystal
structure of the AD-DDD binding interaction and concluded that the
human DDD sequence contained a number of conserved amino acid
residues that were important in either dimer formation or AKAP
binding, underlined below in SEQ ID NO:1. (See FIG. 1 of Kinderman
et al., 2006, incorporated herein by reference.) The skilled
artisan will realize that in designing sequence variants of the DDD
sequence, one would desirably avoid changing any of the underlined
residues, while conservative amino acid substitutions might be made
for residues that are less critical for dimerization and AKAP
binding. Thus, a potential alternative DDD sequence of use for
construction of DNL complexes is shown in SEQ ID NO:5, wherein "X"
represents a conservative amino acid substitution. Conservative
amino acid substitutions are discussed in more detail below, but
could involve for example substitution of an aspartate residue for
a glutamate residue, or a leucine or valine residue for an
isoleucine residue, etc. Such conservative amino acid substitutions
are well known in the art.
TABLE-US-00002 Human DDD sequence from protein kinase A (SEQ ID NO:
1) SHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA (SEQ ID NO: 5)
XXIXIXXXLXXLLXXYXVXVLXXXXXXLVXFXVXYFXXLXXXXX
[0044] Alto et al. (2003) performed a bioinformatic analysis of the
AD sequence of various AKAP proteins to design an RII selective AD
sequence called AKAP-IS (SEQ ID NO:3), with a binding constant for
DDD of 0.4 nM. The AKAP-IS sequence was designed as a peptide
antagonist of AKAP binding to PKA. Residues in the AKAP-IS sequence
where substitutions tended to decrease binding to DDD are
underlined in SEQ ID NO:3. Therefore, the skilled artisan will
realize that variants which may function for DNL constructs are
indicated by SEQ ID NO:6, where "X" is a conservative amino acid
substitution.
TABLE-US-00003 AKAP-IS sequence (SEQ ID NO: 3) QIEYLAKQIVDNAIQQA
(SEQ ID NO: 6) XXXXXAXXIVXXAIXXX
[0045] Similarly, Gold (2006) utilized crystallography and peptide
screening to develop a SuperAKAP-IS sequence (SEQ ID NO:7),
exhibiting a five order of magnitude higher selectivity for the RH
isoform of PKA compared with the RI isoform. Underlined residues
indicate the positions of amino acid substitutions, relative to the
AKAP-IS sequence, that increased binding to the DDD moiety of
RII.alpha.. In this sequence, the N-terminal Q residue is numbered
as residue number 4 and the C-terminal A residue is residue number
20. Residues where substitutions could be made to affect the
affinity for RII.alpha. were residues 8, 11, 15, 16, 18, 19 and 20
(Gold et al., 2006). It is contemplated that in certain alternative
embodiments, the SuperAKAP-IS sequence may be substituted for the
AKAP-IS AD moiety sequence to prepare cytokine-PEG DNL constructs.
Other alternative sequences that might be substituted for the
AKAP-IS AD sequence are shown in SEQ ID NO:8-10. Substitutions
relative to the AKAP-IS sequence are underlined. It is anticipated
that, as with the AKAP-IS sequence shown in SEQ ID NO:3, the AD
moiety may also include the additional N-terminal residues cysteine
and glycine and C-terminal residues glycine and cysteine, as shown
in SEQ ID NO:4.
TABLE-US-00004 SuperAKAP-IS (SEQ ID NO: 7) QIEYVAKQIVDYAIHQA
Alternative AKAP sequences (SEQ ID NO: 8) QIEYKAKQIVDHAIHQA (SEQ ID
NO: 9) QIEYHAKQIVDHAIHQA (SEQ ID NO: 10) QIEYVAKQIVDHAIHQA
[0046] Stokka et al. (2006) also developed peptide competitors of
AKAP binding to PKA, shown in SEQ ID NO:11-13. The peptide
antagonists were designated as Ht31 (SEQ ID NO:11), RIAD (SEQ ID
NO:12) and PV-38 (SEQ ID NO:13). The Ht-31 peptide exhibited a
greater affinity for the RH isoform of PKA, while the RIAD and
PV-38 showed higher affinity for RI.
TABLE-US-00005 Ht31 (SEQ ID NO: 11) DLIEEAASRIVDAVIEQVKAAGAY RIAD
(SEQ ID NO:12) LEQYANQLADQIIKEATE PV-38 (SEQ ID NO:13)
FEELAWKIAKMIWSDVFQQC
[0047] Hundsrucker et al. (2006) developed still other peptide
competitors for AKAP binding to PKA, with a binding constant as low
as 0.4 nM to the DDD of the RII form of PKA. The sequences of
various AKAP antagonistic peptides is provided in Table 1 of
Hundsrucker et al. (incorporated herein by reference). Residues
that were highly conserved among the AD domains of different AKAP
proteins are indicated below by underlining with reference to the
AKAP IS sequence (SEQ ID NO:3). The residues are the same as
observed by Alto et al. (2003), with the addition of the C-terminal
alanine residue. (See FIG. 4 of Hundsrucker et al. (2006),
incorporated herein by reference.) The sequences of peptide
antagonists with particularly high affinities for the RH DDD
sequence are shown in SEQ ID NO:14-16.
TABLE-US-00006 AKAP-IS (SEQ ID NO: 3) QIEYLAKQIVDNAIQQA
AKAP7.delta.-wt-pep (SEQ ID NO: 14) PEDAELVRLSKRLVENAVLKAVQQY
AKAP7.delta.-L304T-pep (SEQ ID NO: 15) PEDAELVRTSKRLVENAVLKAVQQY
AKAP7.delta.-L308D-pep (SEQ ID NO: 16)
PEDAELVRLSKRDVENAVLKAVQQY
[0048] Carr et al. (2001) examined the degree of sequence homology
between different AKAP-binding DDD sequences from human and
non-human proteins and identified residues in the DDD sequences
that appeared to be the most highly conserved among different DDD
moieties. These are indicated below by underlining with reference
to the human PKA RII.alpha. DDD sequence of SEQ ID NO:1. Residues
that were particularly conserved are further indicated by italics.
The residues overlap with, but are not identical to those suggested
by Kinderman et al. (2006) to be important for binding to AKAP
proteins. Thus, a potential DDD sequence is indicated in SEQ ID
NO:17, wherein "X" represents a conservative amino acid
substitution.
TABLE-US-00007 (SEQ ID NO: 1)
SHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA (SEQ ID NO: 17)
XHIXIPXGLXELLQGYTXEVLRXQPXDLVEFAXXYFXXLXEXRX
[0049] The skilled artisan will realize that in general, those
amino acid residues that are highly conserved in the DDD and AD
sequences from different proteins are ones that it may be preferred
to remain constant in making amino acid substitutions, while
residues that are less highly conserved may be more easily varied
to produce sequence variants of the AD and/or DDD sequences
described herein.
[0050] In addition to sequence variants of the DDD and/or AD
moieties, in certain embodiments it may be preferred to introduce
sequence variations in the antibody moiety or the linker peptide
sequence joining the antibody with the AD sequence. In one
illustrative example, three possible variants of fusion protein
sequences, are shown in SEQ ID NO:18-20.
TABLE-US-00008 (L) (SEQ ID NO: 18) QKSLSLSPGLGSGGGGSGGCG (A) (SEQ
ID NO: 19) QKSLSLSPGAGSGGGGSGGCG (-) (SEQ ID NO: 20)
QKSLSLSPGGSGGGGSGGCG
PEGylation by DNL
[0051] In a preferred method, the therapeutic agent to be PEGylated
is linked to a DDD sequence to generate the DDD module. A PEG
reagent of a desirable molecular size is derivatized with a related
AD sequence and the resulting PEG-AD module is combined with the
DDD module to produce the PEGylated conjugate that consists of a
single PEG tethered site-specifically to two copies of the
therapeutic agent via the disulfide bonds formed between DDD and
AD. The PEG reagents may be capped at one end with a methoxy group
(m-PEG), can be linear or branched, and may contain one of the
following functional groups: propionic aldehyde, butyric aldehyde,
ortho-pyridylthioester (OPTE), N-hydroxysuccinimide (NHS),
thiazolidine-2-thione, succinimidyl carbonate (SC), maleimide, or
ortho-pyridyldisulfide (OPPS). Among the agents that may be of
interest for PEGylation are cytokines, enzymes, chemokines, growth
factors, peptides, aptamers, hemoglobins, antibodies and fragments.
The method is not limiting and a wide variety of agents may be
PEGylated using the disclosed methods and compositions.
Cytokines and Other Immunomodulators
[0052] In certain preferred embodiments, the effector moiety is an
immunomodulator. An immunomodulator is an agent that when present,
alters, suppresses or stimulates the body's immune system.
Immunomodulators of use may include a cytokine, a stem cell growth
factor, a lymphotoxin, a hematopoietic factor, a colony stimulating
factor (CSF), an interferon (IFN), erythropoietin, thrombopoietin
and a combination thereof. Specifically useful are lymphotoxins
such as tumor necrosis factor (TNF), hematopoietic factors, such as
interleukin (IL), colony stimulating factor, such as
granulocyte-colony stimulating factor (G-CSF) or granulocyte
macrophage-colony stimulating factor (GM-CSF), interferon, such as
interferons-.alpha., -.beta. or -.gamma., and stem cell growth
factor, such as that designated "S1 factor".
[0053] In more preferred embodiments, the effector moieties are
cytokines, such as lymphokines, monokines, growth factors and
traditional polypeptide hormones. Included among the cytokines are
growth hormones such as human growth hormone, N-methionyl human
growth hormone, and bovine growth hormone; parathyroid hormone;
thyroxine; insulin; proinsulin; relaxin; prorelaxin; glycoprotein
hormones such as follicle stimulating hormone (FSH), thyroid
stimulating hormone (TSH), and luteinizing hormone (LH); placenta
growth factor (PlGF), hepatic growth factor; prostaglandin,
fibroblast growth factor; prolactin; placental lactogen, OB
protein; tumor necrosis factor-.alpha. and -.beta.;
mullerian-inhibiting substance; mouse gonadotropin-associated
peptide; inhibin; activin; vascular endothelial growth factor;
integrin; thrombopoietin (TPO); nerve growth factors such as
NGF-.beta.; platelet-growth factor; transforming growth factors
(TGFs) such as TGF-.alpha. and TGF-.beta.; insulin-like growth
factor-I and -II; erythropoietin (EPO); osteoinductive factors;
interferons such as interferon-.alpha., -.beta., and -.gamma.;
colony stimulating factors (CSFs) such as macrophage-CSF (M-CSF);
interleukins (ILs) such as IL-1, IL-1.alpha., IL-2, IL-3, IL-4,
IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12; IL-13, IL-14,
IL-15, IL-16, IL-17, IL-18, IL-21, IL-25, LIF, kit-ligand or FLT-3,
angiostatin, thrombospondin, endostatin, tumor necrosis factor
(TNF, such as TNF-.alpha.) and LT. In a particularly preferred
embodiment, the cytokine is IFN-.alpha.2b.
[0054] The amino acid sequences of protein or peptide
immunomodulators, such as cytokines, are well known in the art and
any such known sequences may be used in the practice of the instant
invention. The skilled artisan is aware of numerous sources of
public information on cytokine sequence. For example, the NCBI
database contains both protein and encoding nucleic acid sequences
for a large number of cytokines and immunomodulators, such as
erythropoietin (GenBank NM 000799), IL-1 beta (GenPept AAH08678),
GM-CSF (GenPept AAA52578), TNF-.alpha. (GenPept CAA26669),
interferon-alpha (GenPept AAA52716.1), interferon-alpha 2b (GenPept
AAP20099.1) and virtually any of the peptide or protein
immunomodulators listed above. It is a matter of routine for the
skilled artisan to identify an appropriate amino acid and/or
nucleic acid sequence for essentially any protein or peptide
effector moiety of interest. Commercial sources of cytokines are
also available and may be used, such as the full-length human
IFN-.alpha.2b cDNA clone (Invitrogen Ultimate ORF human clone
cat#HORF01Clone ID IOH35221).
Antibodies
[0055] In certain embodiments, an antibody or antigen binding
fragment thereof may be incorporated into a DNL construct, such as
by PEGylation of an antibody or fragment, or by attachment of an
antibody or fragment to a cytokine for targeted delivery of the
cytokine. Any known antibody or antigen-binding fragment thereof
may be incorporated into a DNL construct. In preferred embodiments,
the complex is of use for cancer therapy and the antibody binds to
a tumor associated antigen (TAA). A variety of tumor-associated
antigens are known in the art, including but not limited to
carbonic anhydrase IX, CCCL19, CCCL21, CSAp, CD1, CD1a, CD2, CD3,
CD4, CD5, CD8, CD11A, CD14, CD15, CD16, CD18, CD19, IGF-1R, CD20,
CD21, CD22, CD23, CD25, CD29, CD30, CD32b, CD33, CD37, CD38, CD40,
CD40L, CD45, CD46, CD52, CD54, CD55, CD59, CD64, CD66a-e, CD67,
CD70, CD74, CD79a, CD80, CD83, CD95, CD126, CD133, CD138, CD147,
CD154, AFP, PSMA, CEACAM5, CEACAM-6, B7, ED-B of fibronectin,
Factor H, FHL-1, Flt-3, folate receptor, GROB, HMGB-1, hypoxia
inducible factor (RIF), HM1.24, insulin-like growth factor-1
(ILGF-1), IFN-.gamma., IFN-.beta., IL-2, IL-4R, IL-6R, IL-13R,
IL-15R, IL-17R, IL-18R, IL-6, IL-8, IL-12, IL-15, IL-17, IL-18,
IL-25, IP-10, MAGE, mCRP, MCP-1, MIP-1A, MIP-1B, MIF, MUC1, MUC2,
MUC3, MUC4, MUC5, PAM4 antigen, NCA-95, NCA-90, Ia, HM1.24, EGP-1,
EGP-2, HLA-DR, tenascin, Le(y), RANTES, T101, TAC, Tn antigen,
Thomson-Friedenreich antigens, tumor necrosis antigens,
TNF-.alpha., TRAIL receptor (R1 and R2), VEGFR, EGFR, P1GF,
complement factors C3, C3a, C3b, C5a, C5, and an oncogene product.
Other types of target antigen are of use for antibody-based therapy
of different disease states and DNL constructs incorporating
antibodies that target any such alternative antigen may be
utilized.
[0056] Exemplary anti-cancer antibodies that may be utilized in DNL
constructs include, but are not limited to, hR1 (anti-IGF-1R, U.S.
Provisional Patent Application Ser. No. 61/145,896, filed Jan. 20,
2009) hPAM4 (anti-MUC1, U.S. Pat. No. 7,282,567), hA20 (anti-CD20,
U.S. Pat. No. 7,251,164), hA19 (anti-CD19, U.S. Pat. No.
7,109,304), hIMMU31 (anti-AFP, U.S. Pat. No. 7,300,655), hLL1
(anti-CD74, U.S. Pat. No. 7,312,318), hLL2 (anti-CD22, U.S. Pat.
No. 7,074,403), hMu-9 (anti-CSAp, U.S. Pat. No. 7,387,773), hL243
(anti-HLA-DR, U.S. Pat. No. 7,612,180), hMN-14 (anti-CEA, U.S. Pat.
No. 6,676,924), hMN-15 (anti-CEA, U.S. patent application Ser. No.
10/672,278), hRS7 (anti-EGP-1, U.S. Pat. No. 7,238,785) and hMN-3
(anti-CEA, U.S. Pat. No. 7,541,440) the Examples section of each
cited patent or application incorporated herein by reference. The
skilled artisan will realize that this list is not limiting and any
other known anti-TAA antibody may be incorporated into the DNL
constructs.
[0057] Antigen-binding antibody fragments are well known in the
art, such as F(ab').sub.2, F(ab).sub.2, Fab', Fab, Fv, scFv and the
like, and any such known fragment may be used. As used herein, an
antigen-binding antibody fragment refers to any fragment of an
antibody that binds with the same antigen that is recognized by the
intact or parent antibody. Techniques for preparing AD and/or DDD
conjugates of virtually any antibody or fragment of interest are
known (e.g., U.S. Pat. No. 7,527,787).
[0058] An antibody or fragment thereof may be used which is not
conjugated to a therapeutic agent is referred to as a "naked"
antibody or fragment thereof. In alternative embodiments,
antibodies or fragments may be conjugated to one or more
therapeutic and/or diagnostic agents. A wide variety of such
therapeutic and diagnostic agents are known in the art, as
discussed in more detail below, and any such known therapeutic or
diagnostic agent may be used.
[0059] Techniques for preparing monoclonal antibodies against
virtually any target antigen are well known in the art. See, for
example, Kohler and Milstein, Nature 256: 495 (1975), and Coligan
et al. (eds.), CURRENT PROTOCOLS IN IMMUNOLOGY, VOL. 1, pages
2.5.1-2.6.7 (John Wiley & Sons 1991). Briefly, monoclonal
antibodies can be obtained by injecting mice with a composition
comprising an antigen, removing the spleen to obtain B-lymphocytes,
fusing the B-lymphocytes with myeloma cells to produce hybridomas,
cloning the hybridomas, selecting positive clones which produce
antibodies to the antigen, culturing the clones that produce
antibodies to the antigen, and isolating the antibodies from the
hybridoma cultures.
[0060] MAbs can be isolated and purified from hybridoma cultures by
a variety of well-established techniques. Such isolation techniques
include affinity chromatography with Protein-A Sepharose,
size-exclusion chromatography, and ion-exchange chromatography.
See, for example, Coligan at pages 2.7.1-2.7.12 and pages
2.9.1-2.9.3. Also, see Baines et al., "Purification of
Immunoglobulin G (IgG)," in METHODS IN MOLECULAR BIOLOGY, VOL. 10,
pages 79-104 (The Humana Press, Inc. 1992).
[0061] After the initial raising of antibodies to the immunogen,
the antibodies can be sequenced and subsequently prepared by
recombinant techniques. Humanization and chimerization of murine
antibodies and antibody fragments are well known to those skilled
in the art. The use of antibody components derived from humanized,
chimeric or human antibodies obviates potential problems associated
with the immunogenicity of murine constant regions.
[0062] Chimeric Antibodies
[0063] A chimeric antibody is a recombinant protein in which the
variable regions of a human antibody have been replaced by the
variable regions of, for example, a mouse antibody, including the
complementarity-determining regions (CDRs) of the mouse antibody.
Chimeric antibodies exhibit decreased immunogenicity and increased
stability when administered to a subject. General techniques for
cloning murine immunoglobulin variable domains are disclosed, for
example, in Orlandi et al., Proc. Nat'l Acad. Sci. USA 86: 3833
(1989). Techniques for constructing chimeric antibodies are well
known to those of skill in the art. As an example, Leung et al.,
Hybridoma 13:469 (1994), produced an LL2 chimera by combining DNA
sequences encoding the V.sub..kappa. and V.sub.H domains of murine
LL2, an anti-CD22 monoclonal antibody, with respective human
.kappa. and IgG.sub.1 constant region domains.
[0064] Humanized Antibodies
[0065] Techniques for producing humanized MAbs are well known in
the art (see, e.g., Jones et al., Nature 321: 522 (1986), Riechmann
et al., Nature 332: 323 (1988), Verhoeyen et al., Science 239: 1534
(1988), Carter et al., Proc. Nat'l Acad. Sci. USA 89: 4285 (1992),
Sandhu, Crit. Rev. Biotech. 12: 437 (1992), and Singer et al., J.
Immun. 150: 2844 (1993)). A chimeric or murine monoclonal antibody
may be humanized by transferring the mouse CDRs from the heavy and
light variable chains of the mouse immunoglobulin into the
corresponding variable domains of a human antibody. The mouse
framework regions (FR) in the chimeric monoclonal antibody are also
replaced with human FR sequences. As simply transferring mouse CDRs
into human FRs often results in a reduction or even loss of
antibody affinity, additional modification might be required in
order to restore the original affinity of the murine antibody. This
can be accomplished by the replacement of one or more human
residues in the FR regions with their murine counterparts to obtain
an antibody that possesses good binding affinity to its epitope.
See, for example, Tempest et al., Biotechnology 9:266 (1991) and
Verhoeyen et al., Science 239: 1534 (1988). Generally, those human
FR amino acid residues that differ from their murine counterparts
and are located close to or touching one or more CDR amino acid
residues would be candidates for substitution.
[0066] Human Antibodies
[0067] Methods for producing fully human antibodies using either
combinatorial approaches or transgenic animals transformed with
human immunoglobulin loci are known in the art (e.g., Mancini et
al., 2004, New Microbiol. 27:315-28; Conrad and Scheller, 2005,
Comb. Chem. High Throughput Screen. 8:117-26; Brekke and Loset,
2003, Curr. Opin. Phamacol. 3:544-50). A fully human antibody also
can be constructed by genetic or chromosomal transfection methods,
as well as phage display technology, all of which are known in the
art. See for example, McCafferty et al., Nature 348:552-553 (1990).
Such fully human antibodies are expected to exhibit even fewer side
effects than chimeric or humanized antibodies and to function in
vivo as essentially endogenous human antibodies. In certain
embodiments, the claimed methods and procedures may utilize human
antibodies produced by such techniques.
[0068] In one alternative, the phage display technique may be used
to generate human antibodies (e.g., Dantas-Barbosa et al., 2005,
Genet. Mol. Res. 4:126-40). Human antibodies may be generated from
normal humans or from humans that exhibit a particular disease
state, such as cancer (Dantas-Barbosa et al., 2005). The advantage
to constructing human antibodies from a diseased individual is that
the circulating antibody repertoire may be biased towards
antibodies against disease-associated antigens.
[0069] In one non-limiting example of this methodology,
Dantas-Barbosa et al. (2005) constructed a phage display library of
human Fab antibody fragments from osteosarcoma patients. Generally,
total RNA was obtained from circulating blood lymphocytes (Id.).
Recombinant Fab were cloned from the .mu., .gamma. and .kappa.
chain antibody repertoires and inserted into a phage display
library (Id.). RNAs were converted to cDNAs and used to make Fab
cDNA libraries using specific primers against the heavy and light
chain immunoglobulin sequences (Marks et al., 1991, J. Mol. Biol.
222:581-97). Library construction was performed according to
Andris-Widhopf et al. (2000, In: Phage Display Laboratory Manual,
Barbas et al. (eds), 1.sup.st edition, Cold Spring Harbor
Laboratory Press, Cold Spring Harbor, N.Y. pp. 9.1 to 9.22). The
final Fab fragments were digested with restriction endonucleases
and inserted into the bacteriophage genome to make the phage
display library. Such libraries may be screened by standard phage
display methods, as known in the art (see, e.g., Pasqualini and
Ruoslahti, 1996, Nature 380:364-366; Pasqualini, 1999, The Quart.
J. Nucl. Med. 43:159-162).
[0070] Phage display can be performed in a variety of formats, for
their review, see e.g. Johnson and Chiswell, Current Opinion in
Structural Biology 3:5564-571 (1993). Human antibodies may also be
generated by in vitro activated B-cells. See U.S. Pat. Nos.
5,567,610 and 5,229,275, incorporated herein by reference in their
entirety. The skilled artisan will realize that these techniques
are exemplary and any known method for making and screening human
antibodies or antibody fragments may be utilized.
[0071] In another alternative, transgenic animals that have been
genetically engineered to produce human antibodies may be used to
generate antibodies against essentially any immunogenic target,
using standard immunization protocols. Methods for obtaining human
antibodies from transgenic mice are disclosed by Green et al.,
Nature Genet. 7:13 (1994), Lonberg et al., Nature 368:856 (1994),
and Taylor et al., Int. Immun. 6:579 (1994). A non-limiting example
of such a system is the XenoMouse.RTM. (e.g., Green et al., 1999,
J. Immunol. Methods 231:11-23) from Abgenix (Fremont, Calif.). In
the XenoMouse.RTM. and similar animals, the mouse antibody genes
have been inactivated and replaced by functional human antibody
genes, while the remainder of the mouse immune system remains
intact.
[0072] The XenoMouse.RTM. was transformed with germline-configured
YACs (yeast artificial chromosomes) that contained portions of the
human IgH and Igkappa loci, including the majority of the variable
region sequences, along accessory genes and regulatory sequences.
The human variable region repertoire may be used to generate
antibody producing B-cells, which may be processed into hybridomas
by known techniques. A XenoMouse.RTM. immunized with a target
antigen will produce human antibodies by the normal immune
response, which may be harvested and/or produced by standard
techniques discussed above. A variety of strains of XenoMouse.RTM.
are available, each of which is capable of producing a different
class of antibody. Transgenically produced human antibodies have
been shown to have therapeutic potential, while retaining the
pharmacokinetic properties of normal human antibodies (Green et
al., 1999). The skilled artisan will realize that the claimed
compositions and methods are not limited to use of the
XenoMouse.RTM. system but may utilize any transgenic animal that
has been genetically engineered to produce human antibodies.
[0073] Antibody Fragments
[0074] Antibody fragments which recognize specific epitopes can be
generated by known techniques. Antibody fragments are antigen
binding portions of an antibody, such as F(ab').sub.2, Fab',
F(ab).sub.2, Fab, Fv, sFv and the like. F(ab').sub.2 fragments can
be produced by pepsin digestion of the antibody molecule and Fab'
fragments can be generated by reducing disulfide bridges of the
F(ab').sub.2 fragments. Alternatively, Fab' expression libraries
can be constructed (Huse et al., 1989, Science, 246:1274-1281) to
allow rapid and easy identification of monoclonal Fab' fragments
with the desired specificity. F(ab).sub.2 fragments may be
generated by papain digestion of an antibody and Fab fragments
obtained by disulfide reduction.
[0075] A single chain Fv molecule (scFv) comprises a VL domain and
a VH domain. The VL and VH domains associate to form a target
binding site. These two domains are further covalently linked by a
peptide linker (L). Methods for making scFv molecules and designing
suitable peptide linkers are described in U.S. Pat. No. 4,704,692,
U.S. Pat. No. 4,946,778, R. Raag and M. Whitlow, "Single Chain
Fvs." FASEB Vol 9:73-80 (1995) and R. E. Bird and B. W. Walker,
"Single Chain Antibody Variable Regions," TIBTECH, Vol 9: 132-137
(1991).
[0076] Techniques for producing single domain antibodies (DABs) are
also known in the art, as disclosed for example in Cossins et al.
(2006, Prot Express Purif 51:253-259), incorporated herein by
reference.
[0077] An antibody fragment can be prepared by proteolytic
hydrolysis of the full length antibody or by expression in E. coli
or another host of the DNA coding for the fragment. An antibody
fragment can be obtained by pepsin or papain digestion of full
length antibodies by conventional methods. These methods are
described, for example, by Goldenberg, U.S. Pat. Nos. 4,036,945 and
4,331,647 and references contained therein. Also, see Nisonoff et
al., Arch Biochem. Biophys. 89: 230 (1960); Porter, Biochem. J. 73:
119 (1959), Edelman et al., in METHODS IN ENZYMOLOGY VOL. 1, page
422 (Academic Press 1967), and Coligan at pages 2.8.1-2.8.10 and
2.10.-2.10.4.
[0078] Known Antibodies
[0079] Antibodies of use may be commercially obtained from a wide
variety of known sources. For example, a variety of antibody
secreting hybridoma lines are available from the American Type
Culture Collection (ATCC, Manassas, Va.). A large number of
antibodies against various disease targets, including but not
limited to tumor-associated antigens, have been deposited at the
ATCC and/or have published variable region sequences and are
available for use in the claimed methods and compositions. See,
e.g., U.S. Pat. Nos. 7,312,318; 7,282,567; 7,151,164; 7,074,403;
7,060,802; 7,056,509; 7,049,060; 7,045,132; 7,041,803; 7,041,802;
7,041,293; 7,038,018; 7,037,498; 7,012,133; 7,001,598; 6,998,468;
6,994,976; 6,994,852; 6,989,241; 6,974,863; 6,965,018; 6,964,854;
6,962,981; 6,962,813; 6,956,107; 6,951,924; 6,949,244; 6,946,129;
6,943,020; 6,939,547; 6,921,645; 6,921,645; 6,921,533; 6,919,433;
6,919,078; 6,916,475; 6,905,681; 6,899,879; 6,893,625; 6,887,468;
6,887,466; 6,884,594; 6,881,405; 6,878,812; 6,875,580; 6,872,568;
6,867,006; 6,864,062; 6,861,511; 6,861,227; 6,861,226; 6,838,282;
6,835,549; 6,835,370; 6,824,780; 6,824,778; 6,812,206; 6,793,924;
6,783,758; 6,770,450; 6,767,711; 6,764,688; 6,764,681; 6,764,679;
6,743,898; 6,733,981; 6,730,307; 6,720,155; 6,716,966; 6,709,653;
6,693,176; 6,692,908; 6,689,607; 6,689,362; 6,689,355; 6,682,737;
6,682,736; 6,682,734; 6,673,344; 6,653,104; 6,652,852; 6,635,482;
6,630,144; 6,610,833; 6,610,294; 6,605,441; 6,605,279; 6,596,852;
6,592,868; 6,576,745; 6,572,856; 6,566,076; 6,562,618; 6,545,130;
6,544,749; 6,534,058; 6,528,625; 6,528,269; 6,521,227; 6,518,404;
6,511,665; 6,491,915; 6,488,930; 6,482,598; 6,482,408; 6,479,247;
6,468,531; 6,468,529; 6,465,173; 6,461,823; 6,458,356; 6,455,044;
6,455,040, 6,451,310; 6,444,206; 6,441,143; 6,432,404; 6,432,402;
6,419,928; 6,413,726; 6,406,694; 6,403,770; 6,403,091; 6,395,276;
6,395,274; 6,387,350; 6,383,759; 6,383,484; 6,376,654; 6,372,215;
6,359,126; 6,355,481; 6,355,444; 6,355,245; 6,355,244; 6,346,246;
6,344,198; 6,340,571; 6,340,459; 6,331,175; 6,306,393; 6,254,868;
6,187,287; 6,183,744; 6,129,914; 6,120,767; 6,096,289; 6,077,499;
5,922,302; 5,874,540; 5,814,440; 5,798,229; 5,789,554; 5,776,456;
5,736,119; 5,716,595; 5,677,136; 5,587,459; 5,443,953, 5,525,338.
These are exemplary only and a wide variety of other antibodies and
their hybridomas are known in the art. The skilled artisan will
realize that antibody sequences or antibody-secreting hybridomas
against almost any disease-associated antigen may be obtained by a
simple search of the ATCC, NCBI and/or USPTO databases for
antibodies against a selected disease-associated target of
interest. The antigen binding domains of the cloned antibodies may
be amplified, excised, ligated into an expression vector,
transfected into an adapted host cell and used for protein
production, using standard techniques well known in the art.
Amino Acid Substitutions
[0080] In certain embodiments, the disclosed methods and
compositions may involve production and use of proteins or peptides
with one or more substituted amino acid residues. In a non-limiting
example, the DDD and/or AD sequences used to make the cytokine-PEG
DNL constructs may be further optimized, for example to increase
the DDD-AD binding affinity.
[0081] The skilled artisan will be aware that, in general, amino
acid substitutions typically involve the replacement of an amino
acid with another amino acid of relatively similar properties
(i.e., conservative amino acid substitutions). The properties of
the various amino acids and effect of amino acid substitution on
protein structure and function have been the subject of extensive
study and knowledge in the art.
[0082] For example, the hydropathic index of amino acids may be
considered (Kyte & Doolittle, 1982, J. Mol. Biol.,
157:105-132). The relative hydropathic character of the amino acid
contributes to the secondary structure of the resultant protein,
which in turn defines the interaction of the protein with other
molecules. Each amino acid has been assigned a hydropathic index on
the basis of its hydrophobicity and charge characteristics (Kyte
& Doolittle, 1982), these are: isoleucine (+4.5); valine
(+4.2); leucine (+3.8); phenylalanine (+2.8); cysteine/cystine
(+2.5); methionine (+1.9); alanine (+1.8); glycine (-0.4);
threonine (-0.7); serine (-0.8); tryptophan (-0.9); tyrosine
(-1.3); proline (-1.6); histidine (-3.2); glutamate (-3.5);
glutamine (-3.5); aspartate (-3.5); asparagine (-3.5); lysine
(-3.9); and arginine (-4.5). In making conservative substitutions,
the use of amino acids whose hydropathic indices are within .+-.2
is preferred, within .+-.1 are more preferred, and within .+-.0.5
are even more preferred.
[0083] Amino acid substitution may also take into account the
hydrophilicity of the amino acid residue (e.g., U.S. Pat. No.
4,554,101). Hydrophilicity values have been assigned to amino acid
residues: arginine (+3.0); lysine (+3.0); aspartate (+3.0);
glutamate (+3.0); serine (+0.3); asparagine (+0.2); glutamine
(+0.2); glycine (0); threonine (-0.4); proline (-0.5 .+-0.1);
alanine (-0.5); histidine (-0.5); cysteine (-1.0); methionine
(-1.3); valine (-1.5); leucine (-1.8); isoleucine (-1.8); tyrosine
(-2.3); phenylalanine (-2.5); tryptophan (-3.4). Replacement of
amino acids with others of similar hydrophilicity is preferred.
[0084] Other considerations include the size of the amino acid side
chain. For example, it would generally not be preferred to replace
an amino acid with a compact side chain, such as glycine or serine,
with an amino acid with a bulky side chain, e.g., tryptophan or
tyrosine. The effect of various amino acid residues on protein
secondary structure is also a consideration. Through empirical
study, the effect of different amino acid residues on the tendency
of protein domains to adopt an alpha-helical, beta-sheet or reverse
turn secondary structure has been determined and is known in the
art (see, e.g., Chou & Fasman, 1974, Biochemistry, 13:222-245;
1978, Ann. Rev. Biochem., 47: 251-276; 1979, Biophys. J.,
26:367-384).
[0085] Based on such considerations and extensive empirical study,
tables of conservative amino acid substitutions have been
constructed and are known in the art. For example: arginine and
lysine; glutamate and aspartate; serine and threonine; glutamine
and asparagine; and valine, leucine and isoleucine. Alternatively:
Ala (A) leu, ile, val; Arg (R) gln, asn, lys; Asn (N) his, asp,
lys, arg, gln; Asp (D) asn, glu; Cys (C) ala, ser; Gln (Q) glu,
asn; Glu (E) gln, asp; Gly (G) ala; His (H) asn, gln, lys, arg; Ile
(I) val, met, ala, phe, leu; Leu (L) val, met, ala, phe, ile; Lys
(K) gln, asn, arg; Met (M) phe, ile, leu; Phe (F) leu, val, ile,
ala, tyr; Pro (P) ala; Ser (S), thr; Thr (T) ser; Trp (W) phe, tyr;
Tyr (Y) trp, phe, thr, ser; Val (V) ile, leu, met, phe, ala.
[0086] Other considerations for amino acid substitutions include
whether or not the residue is located in the interior of a protein
or is solvent exposed. For interior residues, conservative
substitutions would include: Asp and Asn; Ser and Thr; Ser and Ala;
Thr and Ala; Ala and Gly; Ile and Val; Val and Leu; Leu and Ile;
Leu and Met; Phe and Tyr; Tyr and Trp. (See, e.g., PROWL website at
rockefeller.edu) For solvent exposed residues, conservative
substitutions would include: Asp and Asn; Asp and Glu; Glu and Gln;
Glu and Ala; Gly and Asn; Ala and Pro; Ala and Gly; Ala and Ser;
Ala and Lys; Ser and Thr; Lys and Arg; Val and Leu; Leu and Ile;
Ile and Val; Phe and Tyr. (Id.) Various matrices have been
constructed to assist in selection of amino acid substitutions,
such as the PAM250 scoring matrix, Dayhoff matrix, Grantham matrix,
McLachlan matrix, Doolittle matrix, Henikoff matrix, Miyata matrix,
Fitch matrix, Jones matrix, Rao matrix, Levin matrix and Risler
matrix (Idem.)
[0087] In determining amino acid substitutions, one may also
consider the existence of intermolecular or intramolecular bonds,
such as formation of ionic bonds (salt bridges) between positively
charged residues (e.g., His, Arg, Lys) and negatively charged
residues (e.g., Asp, Glu) or disulfide bonds between nearby
cysteine residues.
[0088] Methods of substituting any amino acid for any other amino
acid in an encoded protein sequence are well known and a matter of
routine experimentation for the skilled artisan, for example by the
technique of site-directed mutagenesis or by synthesis and assembly
of oligonucleotides encoding an amino acid substitution and
splicing into an expression vector construct.
Therapeutic Agents
[0089] In various embodiments, therapeutic agents such as cytotoxic
agents, anti-angiogenic agents, pro-apoptotic agents, antibiotics,
hormones, hormone antagonists, chemokines, drugs, prodrugs, toxins,
enzymes or other agents may be used as adjunct therapies to the
cytokine-PEG DNL constructs described herein. Drugs of use may
possess a pharmaceutical property selected from the group
consisting of antimitotic, antikinase, alkylating, antimetabolite,
antibiotic, alkaloid, anti-angiogenic, pro-apoptotic agents and
combinations thereof.
[0090] Exemplary drugs of use may include 5-fluorouracil, aplidin,
azaribine, anastrozole, anthracyclines, bendamustine, bleomycin,
bortezomib, bryostatin-1, busulfan, calicheamycin, camptothecin,
carboplatin, 10-hydroxycamptothecin, carmustine, celebrex,
chlorambucil, cisplatin (CDDP), Cox-2 inhibitors, irinotecan
(CPT-11), SN-38, carboplatin, cladribine, camptothecans,
cyclophosphamide, cytarabine, dacarbazine, docetaxel, dactinomycin,
daunorubicin, doxorubicin, 2-pyrrolinodoxorubicine (2P-DOX),
cyano-morpholino doxorubicin, doxorubicin glucuronide, epirubicin
glucuronide, estramustine, epipodophyllotoxin, estrogen receptor
binding agents, etoposide (VP16), etoposide glucuronide, etoposide
phosphate, floxuridine (FUdR), 3',5'-O-dioleoyl-FudR (FUdR-dO),
fludarabine, flutamide, farnesyl-protein transferase inhibitors,
gemcitabine, hydroxyurea, idarubicin, ifosfamide, L-asparaginase,
lenolidamide, leucovorin, lomustine, mechlorethamine, melphalan,
mercaptopurine, 6-mercaptopurine, methotrexate, mitoxantrone,
mithramycin, mitomycin, mitotane, navelbine, nitrosourea,
plicamycin, procarbazine, paclitaxel, pentostatin, PSI-341,
raloxifene, semustine, streptozocin, tamoxifen, taxol, temazolomide
(an aqueous form of DTIC), transplatinum, thalidomide, thioguanine,
thiotepa, teniposide, topotecan, uracil mustard, vinorelbine,
vinblastine, vincristine and vinca alkaloids.
[0091] Toxins of use may include ricin, abrin, alpha toxin,
saporin, ribonuclease (RNase), e.g., onconase, DNase I,
Staphylococcal enterotoxin-A, pokeweed antiviral protein, gelonin,
diphtheria toxin, Pseudomonas exotoxin, and Pseudomonas
endotoxin.
[0092] Chemokines of use may include RANTES, MCAF, MIP1-Beta and
IP-10.
[0093] In certain embodiments, anti-angiogenic agents, such as
angiostatin, baculostatin, canstatin, maspin, anti-VEGF antibodies,
anti-P1GF peptides and antibodies, anti-vascular growth factor
antibodies, anti-Flk-1 antibodies, anti-Flt-1 antibodies and
peptides, anti-Kras antibodies, anti-cMET antibodies, anti-MIF
(macrophage migration-inhibitory factor) antibodies, laminin
peptides, fibronectin peptides, plasminogen activator inhibitors,
tissue metalloproteinase inhibitors, interferons, interleukin-12,
IP-10, Gro-13, thrombospondin, 2-methoxyoestradiol,
proliferin-related protein, carboxiamidotriazole, CM101,
Marimastat, pentosan polysulphate, angiopoietin-2,
interferon-alpha, herbimycin A, PNU145156E, 16K prolactin fragment,
Linomide (roquinimex), thalidomide, pentoxifylline, genistein,
TNP-470, endostatin, paclitaxel, accutin, angiostatin, cidofovir,
vincristine, bleomycin, AGM-1470, platelet factor 4 or minocycline
may be of use.
[0094] Other useful therapeutic agents may comprise
oligonucleotides, especially antisense oligonucleotides that
preferably are directed against oncogenes and oncogene products,
such as bcl-2 or p53. A preferred form of therapeutic
oligonucleotide is siRNA.
Diagnostic Agents
[0095] Diagnostic agents are preferably selected from the group
consisting of a radionuclide, a radiological contrast agent, a
paramagnetic ion, a metal, a fluorescent label, a chemiluminescent
label, an ultrasound contrast agent and a photoactive agent. Such
diagnostic agents are well known and any such known diagnostic
agent may be used. Non-limiting examples of diagnostic agents may
include a radionuclide such as .sup.110In, .sup.111In, .sup.18F,
.sup.52Fe, .sup.62Cu, .sup.64Cu, .sup.67Cu, .sup.67Ga, .sup.68Ga,
.sup.86Y, .sup.90Y, .sup.89Zr, .sup.94mTc, .sup.94Tc, .sup.99mTc,
.sup.120I, .sup.123I, .sup.124I, .sup.125I, .sup.131I,
.sup.154-158Gd, .sup.32P, .sup.11C, .sup.13N, .sup.15O, .sup.186Re,
.sup.188Re, .sup.51Mn, .sup.52mMn, .sup.55Co, .sup.72As, .sup.75Br,
.sup.76Br, .sup.82mRb, .sup.83Sr, or other gamma-, beta-, or
positron-emitters. Paramagnetic ions of use may include chromium
(III), manganese (II), iron (III), iron (II), cobalt (II), nickel
(II), copper (II), neodymium (III), samarium (III), ytterbium
(III), gadolinium (III), vanadium (II), terbium (III), dysprosium
(III), holmium (III) or erbium (III). Metal contrast agents may
include lanthanum (III), gold (III), lead (II) or bismuth (III).
Ultrasound contrast agents may comprise liposomes, such as gas
filled liposomes. Radiopaque diagnostic agents may be selected from
compounds, barium compounds, gallium compounds, and thallium
compounds. A wide variety of fluorescent labels are known in the
art, including but not limited to fluorescein isothiocyanate,
rhodamine, phycoerytherin, phycocyanin, allophycocyanin,
o-phthaldehyde and fluorescamine. Chemiluminescent labels of use
may include luminol, isoluminol, an aromatic acridinium ester, an
imidazole, an acridinium salt or an oxalate ester.
Conjugation Techniques
[0096] In certain embodiments, the cytokine-PEG DNL construct may
be conjugated to one or more therapeutic or diagnostic agents. For
example, .sup.131I can be incorporated into a tyrosine of a protein
or peptide, or a drug attached to an epsilon amino group of a
lysine residue. Therapeutic and diagnostic agents also can be
attached, for example to reduced SH groups. Many methods for making
covalent or non-covalent conjugates of therapeutic or diagnostic
agents with proteins or peptides are known in the art and any such
known method may be utilized.
[0097] A therapeutic or diagnostic agent can be attached using a
heterobifunctional cross-linker, such as N-succinyl
3-(2-pyridyldithio)propionate (SPDP). Yu et al., Int. J. Cancer 56:
244 (1994). General techniques for such conjugation are well-known
in the art. See, for example, Wong, CHEMISTRY OF PROTEIN
CONJUGATION AND CROSS-LINKING (CRC Press 1991); Upeslacis et al.,
"Modification of Antibodies by Chemical Methods," in MONOCLONAL
ANTIBODIES: PRINCIPLES AND APPLICATIONS, Birch et al. (eds.), pages
187-230 (Wiley-Liss, Inc. 1995); Price, "Production and
Characterization of Synthetic Peptide-Derived Antibodies," in
MONOCLONAL ANTIBODIES: PRODUCTION, ENGINEERING AND CLINICAL
APPLICATION, Ritter et al. (eds.), pages 60-84 (Cambridge
University Press 1995).
[0098] In some embodiments, a chelating agent may be attached to a
protein or peptide and used to chelate a therapeutic or diagnostic
agent, such as a radionuclide. Exemplary chelators include but are
not limited to DIVA (such as Mx-DTPA), DOTA, TETA, NETA or NOTA.
Methods of conjugation and use of chelating agents to attach metals
or other ligands to proteins or peptides are well known in the art
(see, e.g., U.S. Pat. No. 7,563,433, the Examples section of which
is incorporated herein by reference). Particularly useful
metal-chelate combinations include 2-benzyl-DTPA and its monomethyl
and cyclohexyl analogs, used with diagnostic isotopes in the
general energy range of 60 to 4,000 keV, such as .sup.125I,
.sup.131I, .sup.123I, .sup.124I, .sup.62Cu, .sup.64Cu, .sup.18F,
.sup.111In, .sup.67Ga, .sup.68Ga, .sup.99mTc, .sup.94mTc, .sup.11C,
.sup.13N, .sup.15O or .sup.76Br for radioimaging. The same
chelates, when complexed with non-radioactive metals, such as
manganese, iron and gadolinium are useful for MRI. Macrocyclic
chelates such as NOTA, DOTA, and TETA are of use with a variety of
metals and radiometals, most particularly with radionuclides of
gallium, yttrium and copper, respectively. Such metal-chelate
complexes can be made very stable by tailoring the ring size to the
metal of interest. Other ring-type chelates such as macrocyclic
polyethers, which are of interest for stably binding nuclides, such
as .sup.223Ra for RAIT are encompassed.
[0099] More recently, methods of .sup.18F-labeling of use in PET
scanning techniques have been disclosed, for example by reaction of
F-18 with a metal or other atom, such as aluminum. The .sup.18F--Al
conjugate may be complexed with chelating groups, such as DOTA,
NOTA or NETA that are attached directly to antibodies or used to
label targetable constructs in pre-targeting methods. Such F-18
labeling techniques are disclosed in U.S. Pat. No. 7,563,433.
Methods of Therapeutic Treatment
[0100] Various embodiments concern methods of treating a cancer in
a subject, such as a mammal, including humans, domestic or
companion pets, such as dogs and cats, comprising administering to
the subject a therapeutically effective amount of a cytokine-PEG
DNL construct. The administration of cytokine-PEG DNL construct can
be supplemented by administering concurrently or sequentially a
therapeutically effective amount of an antibody that binds to or is
reactive with an antigen on the surface of the target cell.
Preferred additional MAbs comprise at least one humanized, chimeric
or human MAb selected from the group consisting of a MAb reactive
with CD4, CD5, CD8, CD14, CD15, CD16, CD19, IGF-1R, CD20, CD21,
CD22, CD23, CD25, CD30, CD32b, CD33, CD37, CD38, CD40, CD40L, CD45,
CD46, CD52, CD54, CD70, CD74, CD79a, CD80, CD95, CD126, CD133,
CD138, CD154, CEACAM5, CEACAM6, B7, AFP, PSMA, EGP-1, EGP-2,
carbonic anhydrase IX, PAM4 antigen, MUC1, MUC2, MUC3, MUC4, MUC5,
Ia, MIF, HM1.24, HLA-DR, tenascin, Flt-3, VEGFR, P1GF, ILGF, IL-6,
IL-25, tenascin, TRAIL-R1, TRAIL-R2, complement factor C5, oncogene
product, or a combination thereof.
[0101] The cytokine-PEG DNL construct therapy can be further
supplemented with the administration, either concurrently or
sequentially, of at least one therapeutic agent. For example, "CVB"
(1.5 g/m.sup.2 cyclophosphamide, 200-400 mg/m.sup.2 etoposide, and
150-200 mg/m.sup.2 carmustine) is a regimen used to treat
non-Hodgkin's lymphoma. Patti et al., Eur. J. Haematol. 51: 18
(1993). Other suitable combination chemotherapeutic regimens are
well-known to those of skill in the art. See, for example, Freedman
et al., "Non-Hodgkin's Lymphomas," in CANCER MEDICINE, VOLUME 2,
3rd Edition, Holland et al. (eds.), pages 2028-2068 (Lea &
Febiger 1993). As an illustration, first generation
chemotherapeutic regimens for treatment of intermediate-grade
non-Hodgkin's lymphoma (NHL) include C-MOPP (cyclophosphamide,
vincristine, procarbazine and prednisone) and CHOP
(cyclophosphamide, doxorubicin, vincristine, and prednisone). A
useful second generation chemotherapeutic regimen is m-BACOD
(methotrexate, bleomycin, doxorubicin, cyclophosphamide,
vincristine, dexamethasone and leucovorin), while a suitable third
generation regimen is MACOP-B (methotrexate, doxorubicin,
cyclophosphamide, vincristine, prednisone, bleomycin and
leucovorin). Additional useful drugs include phenyl butyrate,
bendamustine, and bryostatin-1.
[0102] The cytokine-PEG DNL construct can be formulated according
to known methods to prepare pharmaceutically useful compositions,
whereby the cytokine-PEG DNL construct is combined in a mixture
with a pharmaceutically suitable excipient. Sterile
phosphate-buffered saline is one example of a pharmaceutically
suitable excipient. Other suitable excipients are well-known to
those in the art. See, for example, Ansel et al., PHARMACEUTICAL
DOSAGE FORMS AND DRUG DELIVERY SYSTEMS, 5th Edition (Lea &
Febiger 1990), and Gennaro (ed.), REMINGTON'S PHARMACEUTICAL
SCIENCES, 18th Edition (Mack Publishing Company 1990), and revised
editions thereof.
[0103] The cytokine-PEG DNL construct can be formulated for
intravenous administration via, for example, bolus injection or
continuous infusion. Preferably, cytokine-PEG DNL construct is
infused over a period of less than about 4 hours, and more
preferably, over a period of less than about 3 hours. For example,
the first 25-50 mg could be infused within 30 minutes, preferably
even 15 min, and the remainder infused over the next 2-3 hrs.
Formulations for injection can be presented in unit dosage form,
e.g., in ampoules or in multi-dose containers, with an added
preservative. The compositions can take such forms as suspensions,
solutions or emulsions in oily or aqueous vehicles, and can contain
formulatory agents such as suspending, stabilizing and/or
dispersing agents. Alternatively, the active ingredient can be in
powder form for constitution with a suitable vehicle, e.g., sterile
pyrogen-free water, before use.
[0104] Additional pharmaceutical methods may be employed to control
the duration of action of the cytokine-PEG DNL construct. Control
release preparations can be prepared through the use of polymers to
complex or adsorb the cytokine-PEG DNL construct. For example,
biocompatible polymers include matrices of poly(ethylene-co-vinyl
acetate) and matrices of a polyanhydride copolymer of a stearic
acid dimer and sebacic acid. Sherwood et al., Bio/Technology 10:
1446 (1992). The rate of release from such a matrix depends upon
the molecular weight of the cytokine-PEG DNL construct, the amount
of cytokine-PEG DNL construct within the matrix, and the size of
dispersed particles. Saltzman et al., Biophys. J. 55: 163 (1989);
Sherwood et al., supra. Other solid dosage forms are described in
Ansel et al., PHARMACEUTICAL DOSAGE FORMS AND DRUG DELIVERY
SYSTEMS, 5th Edition (Lea & Febiger 1990), and Gennaro (ed.),
REMINGTON'S PHARMACEUTICAL SCIENCES, 18th Edition (Mack Publishing
Company 1990), and revised editions thereof.
[0105] The cytokine-PEG DNL construct may also be administered to a
mammal subcutaneously or even by other parenteral routes. Moreover,
the administration may be by continuous infusion or by single or
multiple boluses. Preferably, the cytokine-PEG DNL construct is
infused over a period of less than about 4 hours, and more
preferably, over a period of less than about 3 hours.
[0106] More generally, the dosage of an administered cytokine-PEG
DNL construct for humans will vary depending upon such factors as
the patient's age, weight, height, sex, general medical condition
and previous medical history. The dosage may be repeated as needed,
for example, once per week for 4-10 weeks, once per week for 8
weeks, or once per week for 4 weeks. It may also be given less
frequently, such as every other week for several months, or monthly
or quarterly for many months, as needed in a maintenance therapy.
Alternatively, a cytokine-PEG DNL construct may be administered as
one dosage every 2 or 3 weeks, repeated for a total of at least 3
dosages. Or, the construct may be administered twice per week for
4-6 weeks. The dosing schedule can optionally be repeated at other
intervals and dosage may be given through various parenteral
routes, with appropriate adjustment of the dose and schedule.
[0107] In preferred embodiments, the cytokine-PEG DNL constructs
are of use for therapy of cancer. Examples of cancers include, but
are not limited to, carcinoma, lymphoma, glioblastoma, melanoma,
sarcoma, and leukemia, myeloma, or lymphoid malignancies. More
particular examples of such cancers are noted below and include:
squamous cell cancer (e.g., epithelial squamous cell cancer), Ewing
sarcoma, Wilms tumor, astrocytomas, lung cancer including
small-cell lung cancer, non-small cell lung cancer, adenocarcinoma
of the lung and squamous carcinoma of the lung, cancer of the
peritoneum, hepatocellular cancer, gastric or stomach cancer
including gastrointestinal cancer, pancreatic cancer, glioblastoma
multiforme, cervical cancer, ovarian cancer, liver cancer, bladder
cancer, hepatoma, hepatocellular carcinoma, neuroendocrine tumors,
medullary thyroid cancer, differentiated thyroid carcinoma, breast
cancer, ovarian cancer, colon cancer, rectal cancer, endometrial
cancer or uterine carcinoma, salivary gland carcinoma, kidney or
renal cancer, prostate cancer, vulvar cancer, anal carcinoma,
penile carcinoma, as well as head-and-neck cancer. The term
"cancer" includes primary malignant cells or tumors (e.g., those
whose cells have not migrated to sites in the subject's body other
than the site of the original malignancy or tumor) and secondary
malignant cells or tumors (e.g., those arising from metastasis, the
migration of malignant cells or tumor cells to secondary sites that
are different from the site of the original tumor).
[0108] Other examples of cancers or malignancies include, but are
not limited to: Acute Childhood Lymphoblastic Leukemia, Acute
Lymphoblastic Leukemia, Acute Lymphocytic Leukemia, Acute Myeloid
Leukemia, Adrenocortical Carcinoma, Adult (Primary) Hepatocellular
Cancer, Adult (Primary) Liver Cancer, Adult Acute Lymphocytic
Leukemia, Adult Acute Myeloid Leukemia, Adult Hodgkin's Lymphoma,
Adult Lymphocytic Leukemia, Adult Non-Hodgkin's Lymphoma, Adult
Primary Liver Cancer, Adult Soft Tissue Sarcoma, AIDS-Related
Lymphoma, AIDS-Related Malignancies, Anal Cancer, Astrocytoma, Bile
Duct Cancer, Bladder Cancer, Bone Cancer, Brain Stem Glioma, Brain
Tumors, Breast Cancer, Cancer of the Renal Pelvis and Ureter,
Central Nervous System (Primary) Lymphoma, Central Nervous System
Lymphoma, Cerebellar Astrocytoma, Cerebral Astrocytoma, Cervical
Cancer, Childhood (Primary) Hepatocellular Cancer, Childhood
(Primary) Liver Cancer, Childhood Acute Lymphoblastic Leukemia,
Childhood Acute Myeloid Leukemia, Childhood Brain Stem Glioma,
Childhood Cerebellar Astrocytoma, Childhood Cerebral Astrocytoma,
Childhood Extracranial Germ Cell Tumors, Childhood Hodgkin's
Disease, Childhood Hodgkin's Lymphoma, Childhood Hypothalamic and
Visual Pathway Glioma, Childhood Lymphoblastic Leukemia, Childhood
Medulloblastoma, Childhood Non-Hodgkin's Lymphoma, Childhood Pineal
and Supratentorial Primitive Neuroectodermal Tumors, Childhood
Primary Liver Cancer, Childhood Rhabdomyosarcoma, Childhood Soft
Tissue Sarcoma, Childhood Visual Pathway and Hypothalamic Glioma,
Chronic Lymphocytic Leukemia, Chronic Myelogenous Leukemia, Colon
Cancer, Cutaneous T-Cell Lymphoma, Endocrine Pancreas Islet Cell
Carcinoma, Endometrial Cancer, Ependymoma, Epithelial Cancer,
Esophageal Cancer, Ewing's Sarcoma and Related Tumors, Exocrine
Pancreatic Cancer, Extracranial Germ Cell Tumor, Extragonadal Germ
Cell Tumor, Extrahepatic Bile Duct Cancer, Eye Cancer, Female
Breast Cancer, Gaucher's Disease, Gallbladder Cancer, Gastric
Cancer, Gastrointestinal Carcinoid Tumor, Gastrointestinal Tumors,
Germ Cell Tumors, Gestational Trophoblastic Tumor, Hairy Cell
Leukemia, Head and Neck Cancer, Hepatocellular Cancer, Hodgkin's
Lymphoma, Hypergammaglobulinemia, Hypopharyngeal Cancer, Intestinal
Cancers, Intraocular Melanoma, Islet Cell Carcinoma, Islet Cell
Pancreatic Cancer, Kaposi's Sarcoma, Kidney Cancer, Laryngeal
Cancer, Lip and Oral Cavity Cancer, Liver Cancer, Lung Cancer,
Lymphoproliferative Disorders, Macroglobulinemia, Male Breast
Cancer, Malignant Mesothelioma, Malignant Thymoma, Medulloblastoma,
Melanoma, Mesothelioma, Metastatic Occult Primary Squamous Neck
Cancer, Metastatic Primary Squamous Neck Cancer, Metastatic
Squamous Neck Cancer, Multiple Myeloma, Multiple Myeloma/Plasma
Cell Neoplasm, Myelodysplastic Syndrome, Myelogenous Leukemia,
Myeloid Leukemia, Myeloproliferative Disorders, Nasal Cavity and
Paranasal Sinus Cancer, Nasopharyngeal Cancer, Neuroblastoma,
Non-Hodgkin's Lymphoma, Nonmelanoma Skin Cancer, Non-Small Cell
Lung Cancer, Occult Primary Metastatic Squamous Neck Cancer,
Oropharyngeal Cancer, Osteo-/Malignant Fibrous Sarcoma,
Osteosarcoma/Malignant Fibrous Histiocytoma, Osteosarcoma/Malignant
Fibrous Histiocytoma of Bone, Ovarian Epithelial Cancer, Ovarian
Germ Cell Tumor, Ovarian Low Malignant Potential Tumor, Pancreatic
Cancer, Paraproteinemias, Polycythemia vera, Parathyroid Cancer,
Penile Cancer, Pheochromocytoma, Pituitary Tumor, Primary Central
Nervous System Lymphoma, Primary Liver Cancer, Prostate Cancer,
Rectal Cancer, Renal Cell Cancer, Renal Pelvis and Ureter Cancer,
Retinoblastoma, Rhabdomyosarcoma, Salivary Gland Cancer,
Sarcoidosis Sarcomas, Sezary Syndrome, Skin Cancer, Small Cell Lung
Cancer, Small Intestine Cancer, Soft Tissue Sarcoma, Squamous Neck
Cancer, Stomach Cancer, Supratentorial Primitive Neuroectodermal
and Pineal Tumors, T-Cell Lymphoma, Testicular Cancer, Thymoma,
Thyroid Cancer, Transitional Cell Cancer of the Renal Pelvis and
Ureter, Transitional Renal Pelvis and Ureter Cancer, Trophoblastic
Tumors, Ureter and Renal Pelvis Cell Cancer, Urethral Cancer,
Uterine Cancer, Uterine Sarcoma, Vaginal Cancer, Visual Pathway and
Hypothalamic Glioma, Vulvar Cancer, Waldenstrom's
Macroglobulinemia, Wilms' Tumor, and any other hyperproliferative
disease, besides neoplasia, located in an organ system listed
above.
[0109] The methods and compositions described and claimed herein
may be used to treat malignant or premalignant conditions and to
prevent progression to a neoplastic or malignant state, including
but not limited to those disorders described above. Such uses are
indicated in conditions known or suspected of preceding progression
to neoplasia or cancer, in particular, where non-neoplastic cell
growth consisting of hyperplasia, metaplasia, or most particularly,
dysplasia has occurred (for review of such abnormal growth
conditions, see Robbins and Angell, Basic Pathology, 2d Ed., W. B.
Saunders Co., Philadelphia, pp. 68-79 (1976)).
[0110] Dysplasia is frequently a forerunner of cancer, and is found
mainly in the epithelia. It is the most disorderly form of
non-neoplastic cell growth, involving a loss in individual cell
uniformity and in the architectural orientation of cells. Dysplasia
characteristically occurs where there exists chronic irritation or
inflammation. Dysplastic disorders which can be treated include,
but are not limited to, anhidrotic ectodermal dysplasia,
anterofacial dysplasia, asphyxiating thoracic dysplasia,
atriodigital dysplasia, bronchopulmonary dysplasia, cerebral
dysplasia, cervical dysplasia, chondroectodermal dysplasia,
cleidocranial dysplasia, congenital ectodermal dysplasia,
craniodiaphysial dysplasia, craniocarpotarsal dysplasia,
craniometaphysial dysplasia, dentin dysplasia, diaphysial
dysplasia, ectodermal dysplasia, enamel dysplasia,
encephalo-ophthalmic dysplasia, dysplasia epiphysialis hemimelia,
dysplasia epiphysialis multiplex, dysplasia epiphysialis punctata,
epithelial dysplasia, faciodigitogenital dysplasia, familial
fibrous dysplasia of jaws, familial white folded dysplasia,
fibromuscular dysplasia, fibrous dysplasia of bone, florid osseous
dysplasia, hereditary renal-retinal dysplasia, hidrotic ectodermal
dysplasia, hypohidrotic ectodermal dysplasia, lymphopenic thymic
dysplasia, mammary dysplasia, mandibulofacial dysplasia,
metaphysial dysplasia, Mondini dysplasia, monostotic fibrous
dysplasia, mucoepithelial dysplasia, multiple epiphysial dysplasia,
oculoauriculovertebral dysplasia, oculodentodigital dysplasia,
oculovertebral dysplasia, odontogenic dysplasia,
opthalmomandibulomelic dysplasia, periapical cemental dysplasia,
polyostotic fibrous dysplasia, pseudoachondroplastic
spondyloepiphysial dysplasia, retinal dysplasia, septo-optic
dysplasia, spondyloepiphysial dysplasia, and ventriculoradial
dysplasia.
[0111] Additional pre-neoplastic disorders which can be treated
include, but are not limited to, benign dysproliferative disorders
(e.g., benign tumors, fibrocystic conditions, tissue hypertrophy,
intestinal polyps or adenomas, and esophageal dysplasia),
leukoplakia, keratoses, Bowen's disease, Farmer's Skin, solar
cheilitis, and solar keratosis.
[0112] In preferred embodiments, the method of the invention is
used to inhibit growth, progression, and/or metastasis of cancers,
in particular those listed above.
[0113] Additional hyperproliferative diseases, disorders, and/or
conditions include, but are not limited to, progression, and/or
metastases of malignancies and related disorders such as leukemia
(including acute leukemias (e.g., acute lymphocytic leukemia, acute
myelocytic leukemia (including myeloblastic, promyelocytic,
myelomonocytic, monocytic, and erythroleukemia)) and chronic
leukemias (e.g., chronic myelocytic (granulocytic) leukemia and
chronic lymphocytic leukemia)), polycythemia vera, lymphomas (e.g.,
Hodgkin's disease and non-Hodgkin's disease), multiple myeloma,
Waldenstrom's macroglobulinemia, heavy chain disease, and solid
tumors including, but not limited to, sarcomas and carcinomas such
as fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma,
osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma,
lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma,
mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma,
colon carcinoma, pancreatic cancer, breast cancer, ovarian cancer,
prostate cancer, squamous cell carcinoma, basal cell carcinoma,
adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma,
papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma,
medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma,
hepatoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal
carcinoma, Wilm's tumor, cervical cancer, testicular tumor, lung
carcinoma, small cell lung carcinoma, bladder carcinoma, epithelial
carcinoma, glioma, astrocytoma, medulloblastoma, craniopharyngioma,
ependymoma, pinealoma, emangioblastoma, acoustic neuroma,
oligodendroglioma, meningioma, melanoma, neuroblastoma, and
retinoblastoma.
[0114] In still other embodiments, the PEGylated DNL complexes may
be of use to treat subjects infected with pathogenic organisms,
such as bacteria, viruses or fungi. Exemplary fungi that may be
treated include Microsporum, Trichophyton, Epidermophyton,
Sporothrix schenckii, Cryptococcus neoformans, Coccidioides
immitis, Histoplasma capsulatum, Blastomyces dermatitidis or
Candida albicans. Exemplary viruses include human immunodeficiency
virus (HIV), herpes virus, cytomegalovirus, rabies virus, influenza
virus, human papilloma virus, hepatitis B virus, hepatitis C virus,
Sendai virus, feline leukemia virus, Reo virus, polio virus, human
serum parvo-like virus, simian virus 40, respiratory syncytial
virus, mouse mammary tumor virus, Varicella-Zoster virus, Dengue
virus, rubella virus, measles virus, adenovirus, human T-cell
leukemia viruses, Epstein-Barr virus, murine leukemia virus, mumps
virus, vesicular stomatitis virus, Sindbis virus, lymphocytic
choriomeningitis virus or blue tongue virus. Exemplary bacteria
include Bacillus anthracis, Streptococcus agalactiae, Legionella
pneumophila, Streptococcus pyogenes, Escherichia coli, Neisseria
gonorrhoeae, Neisseria meningitidis, Pneumococcus spp., Hemophilus
influenzae B, Treponema pallidum, Lyme disease spirochetes,
Pseudomonas aeruginosa, Mycobacterium leprae, Brucella abortus,
Mycobacterium tuberculosis or a Mycoplasma.
Kits
[0115] Various embodiments may concern kits containing components
suitable for treating diseased tissue in a patient. Exemplary kits
may contain at least one or more cytokine-PEG constructs as
described herein. If the composition containing components for
administration is not formulated for delivery via the alimentary
canal, such as by oral delivery, a device capable of delivering the
kit components through some other route may be included. One type
of device, for applications such as parenteral delivery, is a
syringe that is used to inject the composition into the body of a
subject. Inhalation devices may also be used. In certain
embodiments, a therapeutic agent may be provided in the form of a
prefilled syringe or autoinjection pen containing a sterile, liquid
formulation or lyophilized preparation.
[0116] The kit components may be packaged together or separated
into two or more containers. In some embodiments, the containers
may be vials that contain sterile, lyophilized formulations of a
composition that are suitable for reconstitution. A kit may also
contain one or more buffers suitable for reconstitution and/or
dilution of other reagents. Other containers that may be used
include, but are not limited to, a pouch, tray, box, tube, or the
like. Kit components may be packaged and maintained sterilely
within the containers. Another component that can be included is
instructions to a person using a kit for its use.
EXAMPLES
[0117] The following examples are provided to illustrate, but not
to limit, the claims of the present invention.
Example 1
Generation of PEG-AD2 Modules
TABLE-US-00009 [0118] Synthesis of IMP350 (SEQ ID NO: 21)
CGQIEYLAKQIVDNAIQQAGC(SS-tbu)-NH.sub.2 MH.sup.+2354
[0119] IMP350 was made on a 0.1 mmol scale with Sieber Amide resin
using Fmoc methodology on a Protein Technologies PS3 peptide
synthesizer. Starting from the C-terminus the protected amino acids
used were Fmoc-Cys(t-Buthio)-OH, Fmoc-Gly-OH, Fmoc-Ala-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Ala-OH,
Fmoc-Asn(Trt)-OH, Fmoc-Asp(OBut)-OH, Fmoc-Val-OH, Fmoc-Ile-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Leu-OH,
Fmoc-Tyr(But)-OH, Fmoc-Glu(OBut)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH,
Fmoc-Gly-OH and Fmoc-Cys(Trt)-OH. The peptide was cleaved from the
resin and purified by reverse phase (RP)-HPLC.
[0120] Synthesis of PEG.sub.20-IMP350
[0121] IMP350 (0.0104 g) was mixed with 0.1022 g of mPEG-OPTE (20
kDa, Nektar Therapeutics) in 7 mL of 1 M Tris buffer at pH 7.81.
Acetonitrile, 1 mL, was then added to dissolve some suspended
material. The reaction was stirred at room temperature for 3 h and
then 0.0527 g of TCEP was added along with 0.0549 g of cysteine.
The reaction mixture was stirred for 1.5 h and then purified on a
PD-10 desalting column, which was equilibrated with 20% methanol in
water. The sample was eluted, frozen and lyophilized to obtain
0.0924 g of crude PEG.sub.20-IMP350 (MH+23508 by MALDI).
[0122] Synthesis of IMP360
TABLE-US-00010 (SEQ ID NO: 22)
CGQIEYLAKQIVDNAIQQAGC(SS-tbu)-G-EDANS MH.sup.+2660
[0123] IMP 360 was synthesized on a 0.1 mmol scale with EDANS resin
(Nova Biochem) using Fmoc methodology on a Protein Technologies PS3
peptide synthesizer. Starting from the C-terminus the protected
amino acids used were Fmoc-Cys(t-Buthio)-OH, Fmoc-Gly-OH,
Fmoc-Ala-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH,
Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH, Fmoc-Asp(OBut)-OH, Fmoc-Val-OH,
Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH,
Fmoc-Leu-OH, Fmoc-Tyr(But)-OH, Fmoc-Glu(OBut)-OH, Fmoc-Ile-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Gly-OH and Fmoc-Cys(Trt)-OH. The peptide was
cleaved from the resin and purified by RP-HPLC, and determined to
have a molecular mass of 2,660 Da.
[0124] Generation of IMP362 and IMP413
[0125] The two linear PEG-AD2 modules were prepared by coupling
IMP360 to mPEG-OPTE (Nectar Therapeutics, San Carlos, Calif.) of
20-kDa or 30-kDa, resulting in IMP362 or IMP413, respectively. To
prepare IMP362, IMP360 (11.5 mg) was mixed with 20-kDa mPEG-OPTE
(127 mg) in 7 mL of 1 M Tris-HCL, pH 7.8. Acetonitrile (1 mL) was
added to dissolve some suspended material. The reaction was stirred
at room temperature for 4 h to effect the attachment of mPEG to the
amino-terminal cysteine via an amide bond. Subsequently, 41 mg of
Tris [2-carboxyethyl] phosphine hydrochloride (TCEP) and 43 mg of
cysteine were added to de-protect the remaining cysteine. The
reaction mixtures were stirred for 1 h and desalted using PD-10
columns, which had been equilibrated with 20% methanol in water.
The samples were lyophilized to obtain approximately 150 mg of
IMP362 (MH+23713). IMP413 (MH.sup.+34499) was made similarly using
30-kDa mPEG-OPTE (190 mg).
[0126] Generation of IMP421 and IMP457
[0127] The AD2-containing peptide (IMP421, MH.sup.+2891, FIG. 1A)
was made for derivatizing mPEG2-MAL-40K (Nectar Therapeutics) to
obtain the branched PEG-AD2 module (IMP457). IMP421 was synthesized
on NovaSyn.RTM. TGR resin (487.6 mg, 0.112 mmol) by adding the
following amino acids to the resin in the order shown: Fmoc-Gly-OH,
Fmoc-Cys(t-Buthio)-OH, Fmoc-Gly-OH, Fmoc-Ala-OH, Fmoc-Gln(Trt)-OH,
Fmoc-Gln(Trt)-OH, Fmoc-Ile-OH, Fmoc-Ala-OH, Fmoc-Asn(Trt)-OH,
Fmoc-Asp(OBut)-OH, Fmoc-Val-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH,
Fmoc-Lys(Boc)-OH, Fmoc-Ala-OH, Fmoc-Leu-OH, Fmoc-Tyr(But)-OH,
Fmoc-Glu(OBut)-OH, Fmoc-Ile-OH, Fmoc-Gln(Trt)-OH, Fmoc-Gly-OH,
Fmoc-Cys(t-Buthio)-OH, Fmoc-NH-PEG.sub.3-COOH, Fmoc-Cys(Trt)-OH.
The N-terminal amino acid was protected as an acetyl derivative.
The peptide was then cleaved from the resin and purified by RP-HPLC
to yield 32.7 mg of a white solid.
[0128] IMP457 was made as follows. To a solution of IMP421 (15.2
mg, 5.26 mop and mPEG2-MAL-40K (274.5 mg, 6.86 mop in 1 mL of
acetonitrile was added 7 mL of 1 M Tris pH 7.8. After 3 h at room
temperature, the excess mPEG2-MAL-40K was quenched with L-cysteine
(49.4 mg), followed by S-S-tBu deprotection over 1 h with TCEP
(59.1 mg). The resulting solution was dispensed into two 10K
Slide-A-Lyzer dialysis cassettes (4 mL in each) and dialyzed
overnight at 2-8.degree. C. against 5 L of 5 mM Ammonium Acetate,
pH 5.0. Following three additional 5-L buffer changes, the dialyzed
solution (19.4 mL) was transferred into two 20-mL scintillation
vials, frozen and lyophilized to yield a white solid (246.7 mg).
The molecular mass as determined by MALDI-TOF was 42,982 for
mPEG2-MAL-40K and 45,500 for IMP457.
Example 2
Generation of DDD Module Based on Interferon (IFN)-.alpha.2b
[0129] Construction of IFN-.alpha.2b-DDD2-pdHL2 for Expression in
Mammalian Cells
[0130] The cDNA sequence for IFN-.alpha.2b was amplified by PCR,
resulting in a sequence comprising the following features, in which
XbaI and BamHI are restriction sites, the signal peptide is native
to IFN-.alpha.2b, and 6 His is a hexahistidine tag: XbaI--Signal
peptide--IFN.alpha.2b--6 His--BamHI (6 His is disclosed as SEQ ID
NO: 30). The resulting secreted protein will consist of
IFN-.alpha.2b fused at its C-terminus to a polypeptide consisting
of SEQ ID NO:23.
TABLE-US-00011 (SEQ ID NO: 23)
KSHHHHHHGSGGGGSGGGCGHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARA
[0131] PCR amplification was accomplished using a full length human
IFN.alpha.2b cDNA clone (Invitrogen Ultimate ORF human clone
cat#HORF01Clone ID 10H35221) as a template and the following
oligonucleotides as primers:
TABLE-US-00012 IFNA2 Xba I Left (SEQ ID NO: 24)
5'-TCTAGACACAGGACCTCATCATGGCCTTGACCTTTGCTTTACTGG-3' IFNA2 BamHI
right (SEQ ID NO: 25)
5'-GGATCCATGATGGTGATGATGGTGTGACTTTTCCTTACTTCTTAAACTTTCTTGC-3'
[0132] The PCR amplimer was cloned into the pGemT vector (Promega).
A DDD2-pdHL2 mammalian expression vector was prepared for ligation
with IFN-.alpha.2b by digestion with XbaI and Bam HI restriction
endonucleases. The IFN-.alpha.2b amplimer was excised from pGemT
with XbaI and Bam HI and ligated into the DDD2-pdHL2 vector to
generate the expression vector IFN-.alpha.2b-DDD2-pdHL2.
[0133] Mammalian Expression of IFN-.alpha.2b-DDD2
[0134] IFN.alpha.2b-DDD2-pdHL2 (30 .mu.g) was linearized by
digestion with SalI and stably transfected by electroporation (450
volts, 25 .mu.F) into Sp/ESF myeloma cells (2.8.times.10.sup.6
cells), an engineered derivative of Sp2/0 that can be grown and
transfected in serum-free medium. Transfectants were cultured in
Hybridoma SFM (Invitrogen, Carlsbad Calif.) supplemented with 0.2
.mu.M methotrexate (Calbiochem, LaJolla, Calif.) in 96-well plates,
and screened for IFN-.alpha.2b expression with a human interferon
alpha ELISA kit (PBL Interferon Source, Piscataway, N.J.) following
the manufacturers' instructions.
[0135] Purification of IFN-.alpha.2b-DDD2 from Batch Cultures Grown
in Roller Bottles
[0136] Briefly, the supernatant fluid was clarified by
centrifugation, filtered through 0.2 micron membranes, diafiltered
into 1.times. binding buffer (10 mM imidazole, 0.5 M NaCl, 50 mM
NaH.sub.2PO.sub.4, pH 7.5), concentrated 20-fold, and loaded onto a
Ni-NTA column (Qiagen). After washing with 0.02% Tween 20 in
1.times. binding buffer and then 30 mM imidazole, 0.02% Tween 20,
0.5 M NaCl, 50 mM NaH.sub.2PO.sub.4, pH 7.5, .alpha.2b-DDD2 was
eluted with 250 mM imidazole, 0.02% Tween 20, 150 mM NaCl, 50 mM
NaH.sub.2PO.sub.4, pH 7.5, and stored in the same buffer at
2-8.degree. C. until needed. The monomeric form of .alpha.2b-DDD2
consists of IFN-.alpha.2b fused at its carboxyl-terminus to a
63-residue peptide of SEQ ID NO:23.
Example 3
Preparation and Purification of .alpha.2b-362, .alpha.2b-413 and
.alpha.2b-457
[0137] Conjugations of .alpha.2b-DDD2 with IMP362, IMP413, and
IMP457 were performed to generate PEGylated .alpha.2b-362,
.alpha.2b-413, and .alpha.2b-457, respectively. In general, a
10-fold molar excess of reduced and lyophilized IMP362, IMP413, or
IMP457 (about 11 mg each) was added to 2.25 mg of .alpha.2b-DDD2 in
3.5 mL of 250 mM imidazole, 0.02% Tween 20, 150 mM NaCl, 1 mM EDTA,
50 mM NaH.sub.2PO.sub.4, pH 7.5. After 6 h at room temperature in
the dark, the reaction mixture was dialyzed against CM loading
buffer (150 mM NaCl, 20 mM NaAc, pH 4.5) at 4.degree. C. in the
dark. The PEGylated product was purified by cation exchange
chromatography using a 1-mL Hi-Trap CM-FF column (Amersham), which
was equilibrated with CM loading buffer. After sample loading, the
column was washed with CM loading buffer to baseline, followed by
washing with 15 mL of 0.25 M NaCl, 20 mM NaAc, pH 4.5. The
PEGylated product was eluted with 12.5 mL of 0.5 M NaCl, 20 mM
NaAc, pH 4.5.
[0138] SDS-PAGE, Fluorescence Imaging, and Immunoblot
[0139] Reducing and non-reducing SDS-PAGE analyses were performed
using 4-20% gradient Tris-Glycine gels (Cambrex Bio Science
Rockland, Rockland, Me.). To normalize the samples for direct
protein mass comparison, each fraction eluted from the CM-FF column
was concentrated to 3.5 mL to match the reaction volume. Samples
were diluted with an equal volume of 2.times. sample buffer (2%
SDS, 5% glycerol, 62.5 mM Tris-HCl, pH 6.8) and heated to
95.degree. C. before was loading 10 .mu.L per lane. For reducing
gels, 5% of .beta.-2-mercaptoethanol was included in the sample
buffer. Gels were imaged by direct fluorescence to visualize bands
containing the EDANS tag using a Kodak Image Station 4000R before
staining with Coomassie blue to visualize the protein bands.
Duplicate gels were transferred to PVDF membranes for immunoblot
analysis. Blots were probed with rabbit anti-interferon alpha
polyclonal antibody (AB1434, Chemicon International) diluted
1:1,000 in 1% BSA-PBST. Signal was detected with HRP-conjugated
goat anti-rabbit IgG (Jackson Immunoresearch) and ECL (Pierce).
[0140] Characterization of .alpha.2b-362 and .alpha.2b-413
[0141] We produced a DDD2 module of IFN-.alpha.2b with a
hexa-histidine tag (SEQ ID NO: 30) in myeloma cells, and
synthesized two AD2 modules of linear PEG, one with a 20-kDa PEG,
designated IMP362, and the other with a 30-kDa PEG, designated
IMP413. In addition, each PEG-AD2 module also contained EDANS as a
fluorescent tag. The fusion protein (IFN.alpha.2b-DDD2) was reacted
with IMP362 and IMP413 in excess to yield the two PEGylated
conjugates, .alpha.2b-362 and .alpha.2b-413, respectively, which
were purified by cation exchange chromatography at pH 4.5.
[0142] The DNL process for generating .alpha.2b-362 was analyzed by
non-reducing (NR) and reducing (R) SDS-PAGE with three
visualization methods: Coomassie blue staining (FIG. 2A and FIG.
2D), fluorescence imaging (FIG. 2B and FIG. 2E) and immunoblotting
(FIG. 2C). The Coomassie blue-stained gel shown in FIG. 2A revealed
the presence of a major band of .about.110 kDa in the reaction
mixture (lane 2, NR), which was absent in the unbound (lane 3, NR)
or 0.25 M NaCl wash (lane 4, NR), but evident in the 0.5 M NaCl
fraction (lane 5, NR).
[0143] Fluorescence imaging was used to detect the EDANS tag on
IMP362 and the results shown in FIG. 2B indicate the presence of
covalently attached IMP362 in the 110-kDa band (lanes 2 and 5, NR)
as well as the presence of excess IMP362, which does not stain with
Coomassie blue, in the reaction mixture (lane 2, NR and R) and the
unbound fraction (lane 3, NR). Immunoblotting with anti-IFN-.alpha.
confirmed the inclusion of IFN-.alpha.2b in the 110-kDa band (FIG.
2C, lanes 2 and 5, NR and R). The mass of .alpha.2b-326 was
determined by MALDI-TOF to be 76,728 Da, which is consistent with a
dimeric form of IFN-.alpha.2b-DDD2 (.about.55 kDa) linked to one
IMP362 (.about.22 kDa). The observed discrepancy between the
measured mass (.about.77 kDa) by MALDI-TOF and the estimated
molecular weight (.about.110 kDa) by SDS-PAGE is due to PEG, which
is known to increase the apparent molecular weight of PEGgylated
products as determined by SDS-PAGE or SE-HPLC. In all reducing
gels, the components of .alpha.2b-362 (lane 5) are dissociated into
IMP362 and the monomeric form of .alpha.2b-DDD2, as expected. For
.alpha.2b-413, which was generated and purified similarly, both
Coomassie blue staining (FIG. 2D) and fluorescence imaging (FIG.
2E) show a major band of .about.125 kDa (lane 6, NR) migrating
behind .alpha.2b-362 (lane 5, NR). Moreover, reducing SDS-PAGE
showed only the presence of a single band corresponding to the
monomeric form of .alpha.2b-DDD2 for both .alpha.2b-362 (lane 5, R)
and .alpha.2b-413 (lane 6, R) by Coomassie blue staining, and the
two distinct bands corresponding to IMP362 (FIG. 2E, lane 5, R) and
IMP413 (FIG. 2E, lane 6, R) by fluorescence imaging. These results
demonstrated that .alpha.2b-362 and .alpha.2b-413 were generated as
designed and were substantially pure.
Example 4
Anti-Viral Effect of PEGylated IFN-.alpha.2b
[0144] The reduction of viral cytopathic effect (CPE) was
determined by an independent laboratory (PBL Interferon Source,
Piscataway, N.J.) using encephalomyocarditis virus (EMCV) and human
lung epithelial A549 cells. Plates were stained with crystal violet
and the OD was measured by spectrophotometry on a 96-well plate
reader following solubilization of the dye. The data were analyzed
with Graph Pad Prizm software (Advanced Graphics Software,
Encinitas, Calif.) using a sigmoidal fit (variable slope)
non-linear regression. The anti-viral titer was determined by
comparison of EC.sub.50 values with that of an IFN.alpha.
standard.
[0145] The biological activities of .alpha.2b-362 and .alpha.2b-413
were compared with PEGINTRON.RTM. and PEGASYS.RTM. by measuring the
cytopathic effect (CPE) of encephalomyocarditis virus (EMCV) on
human lung epithelial A549 cells and the resulting EC.sub.50 values
were calculated to determine the anti-viral specific activities
based on a validated IFN-.alpha.2b standard. As shown in FIG. 3A,
on a molar basis, .alpha.2b-362, .alpha.2b-413, and PEGINTRON.RTM.
all have similar specific activities (averaging 7.times.10.sup.12
to 9.times.10.sup.12 U/mmol) and are about 5-fold more potent than
PEGASYS.RTM.. These data indicate that site-specific PEGylation by
DNL may preserve biological activity better, particularly when
using large PEG molecules. In addition, a cell-based kit, which
utilizes a transgenic human pro-monocyte cell line carrying a
reporter gene fused to an interferon-stimulated response element,
was used to determine the specific activities of .alpha.2b-362 and
.alpha.2b-413 to be 2940 IU/pmol and 816 IU/pmol, respectively,
both of which were higher than PEGASYS.RTM. (170 IU/pmol) but lower
than PEGINTRON.RTM. (3400 IU/pmol).
Example 5
In Vitro Anti-Proliferative Effect of PEGylated IFN-.alpha.2b in
Cancer Cells
[0146] Each test compound was diluted to 500 pM in RPMI 1640 media
supplemented with 10% FBS, from which triplicate, three-fold serial
dilutions were made in 96-well tissue culture plates (50 .mu.L
sample/well). Daudi cells were diluted to 4.times.10.sup.5 cells/mL
and 50 .mu.L were added to each well (20K/well). After 4 days at
37.degree. C., MTS was added to the plates (20 .mu.L per well) and
the plates were read after 3 to 4 h with an Envision plate reader
(Perkin-Elmer, Boston Mass.) at 490 nm. Dose-response curves were
generated and EC.sub.50 values were obtained by sigmoidal fit
non-linear regression using Graph Pad Prism software. Specific
activities were determined by comparison of EC.sub.50 values with
PEGINTRON.RTM. using the specific activity provided with the
product insert.
[0147] We compared the anti-proliferative activity of .alpha.2b-362
and .alpha.2b-413 with PEGINTRON.RTM. and PEGASYS.RTM. in Daudi
lymphoma cells, with the finding (FIG. 3B) that .alpha.2b-362 and
.alpha.2b-413 had 2-3-fold lower EC.sub.50 values than
PEGINTRON.RTM. (.about.1.times.10.sup.12 U/mmol vs.
2.2.times.10.sup.12 U/mmol), but were comparable to
PEGASYS.RTM..
Example 6
Pharmacokinetics of PEGylated IFN-.alpha.ab in Mice
[0148] The initial study evaluating .alpha.2b-362, .alpha.2b-413,
PEGINTRON.RTM., and rhIFN-.alpha.2a (Chemicon IF007, Lot
06008039084) was performed in 4 different groups of adult female
Swiss-Webster mice (.about.35 g) with 2 mice in each group. Each
test compound was administered as a single bolus i.v. injection at
a mole-equivalent dose: rhIFN-.alpha.2a, 3 .mu.g; PEGINTRON.RTM., 5
.mu.g; .alpha.2b-362, 11 .mu.g; and .alpha.2b-413, 13 .mu.g. Mice
were bled via the retro-orbital method at various time-points
(pre-dose, 5-min, 2-, 8-, 24-, 48-, 72-, 96-, and 168-h
post-injection).
[0149] The subsequent study evaluating .alpha.2b-457,
.alpha.2b-413, PEGINTRON.RTM., and PEGASYS.RTM. was performed in 4
different groups of adult male Swiss-Webster mice (.about.40 g)
with 4 in each group. Each test compound was administered as a
single s.c. injection at a mole-equivalent dose (100 pmoles) in
equal volumes (250 .mu.L). Mice were bled via the retro-orbital
method at various time-points (30-min, 2-, 8-, 24-, 48-, 72-, and
96-h post-injection). For each study, the blood was allowed to
clot, centrifuged, and the serum removed for storage at -70.degree.
C. until analysis.
[0150] Concentrations of IFN-.alpha. in the serum samples were
determined using a human interferon alpha ELISA kit (PBL Interferon
Source) following the manufacturers' instructions. Briefly, the
serum samples were diluted appropriately according to the human
IFN-.alpha. standard provided in the kit. The antibody coupled to
the microtiter plate wells captures interferon. A second antibody
was then used to reveal the bound interferon, which was quantified
by anti-secondary antibody conjugated to horseradish peroxidase
(HRP) following the addition of tetramethyl benzidine (TMB)
substrate. The plates were read at 450 nm. The amount of IFN in the
serum for each animal was used to determine the various PK
parameters. These data were analyzed with WinNonLin PK software
(v5.1; Pharsight Corp.; Mountain View, Calif.) using
non-compartmental analysis (representing the best-fit model for the
data).
[0151] The pharmacokinetics (PK) of .alpha.2b-362 and .alpha.2b-413
in mice following a single i.v. injection were compared to those of
PEGINTRON.RTM. and recombinant human IFN-.alpha.2b
(rhIFN-.alpha.2b). The PK properties of each agent are summarized
in Table 1 and the elimination curves are plotted in FIG. 4. As
expected, rhIFN-.alpha.2b cleared most rapidly from the blood of
injected mice, approximately 3-fold faster than PEGINTRON.RTM. and
more than 13-fold faster than 2b-362 or 2b-413, either of which
clears about 4-fold slower than PEGINTRON.RTM., with little
difference in the elimination rates between .alpha.2b-362 and
.alpha.2b-413. As for mean residence time (MRT), a clear
correlation with size is apparent among the various agents: the
larger the molecular size, the longer the MRT. Finally, a test for
bioequivalence showed that none of the agents tested were the same
terms of PK.
TABLE-US-00013 TABLE 1 PK analysis of rhIFN.alpha.2b, PEGINTRON
.RTM., .alpha.2b-362 and .alpha.2b-413 administered as intravenous
injections to naive Swiss-Webster mice. Ani- Elimi- mal Injected
nation MRT Num- Dose C.sub.max T.sub.1/2.alpha. T.sub.1/2.beta.
AUC.sub.0.08.fwdarw..infin. Rate .sub.0.08.fwdarw..infin. ber
(pmoles) (pM) (hours) (hours) (h * pM) (1/h) (h) rhIFN.alpha.2b 1
160 16,411 0.29 10.53 7,011 2.34 0.63 2 160 21,835 0.31 7.14 10,147
2.15 0.78 Mean 160 19,123 0.30 8.84 8,579 2.25 0.71 PEG-INTRON 1
160 87,090 0.53 6.29 137,790 0.63 5.42 2 160 105,774 0.43 5.11
150,905 0.70 4.79 Mean 160 96,432 0.48 5.70 144,348 0.67 5.11
.alpha.2b-362 1 320 60,833 1.72 7.54 379,462 0.16 9.03 2 320 97,089
1.43 10.14 570,336 0.17 11.56 Mean 320 78,961 1.58 8.84 474,899
0.17 10.30 .alpha.2b-413 1 320 152,923 0.69 12.85 1,012,470 0.15
16.75 2 320 100,495 4.03 28.53 1,179,056 0.09 26.56 Mean 320
126,709 2.36 20.69 1,095,763 0.12 21.66
Example 7
In Vivo Anti-Tumor Efficacy of PEGylated IFN-.alpha.2b
[0152] Four studies were performed in eight-week-old female SCID
mice injected i.v. with 1.5.times.10.sup.7 Daudi cells per animal.
Therapy commenced 1 day after the Daudi transplantation. Mice were
observed daily for signs of distress and paralysis and were weighed
weekly. In the event a mouse lost greater than 15% of its body
weight (but <20%) it was weighed every 2 days until it either
gained back its weight to <15% loss or was sacrificed due to
>20% loss. Mice were also terminated when hind-limb paralysis
developed or if they became otherwise moribund.
[0153] For the first study there were 10 different treatment groups
of 5 mice each. Equivalent units of activity of PEGINTRON.RTM.,
.alpha.2b-362 and .alpha.2b-413 were administered once every 7 days
via s.c. injection in either the left or right flank at three
different doses (3,500, 7,000, and 14,000 IU). In the second study,
14,000 IU of PEGINTRON.RTM. or .alpha.2b-413 were administered s.c.
with varied dosing schedules: once weekly for 4 weeks (q7dx4), once
bi-weekly over 8 weeks (q2wk.times.4), and once tri-weekly over 12
weeks (q3wk.times.4). There were 7 different treatment groups of
6-7 mice each. All the mice received a total of 4 injections. The
third study was performed in four treatment groups of 10 each,
evaluating 14,000 IU of c2b-413 or PEGINTRON.RTM. given s.c. once
every four weeks vs. once weekly. In the fourth study,
.alpha.2b-457 was compared with .alpha.2b-413 and PEGINTRON.RTM. in
two different doses (20 and 10 pmol) given four weeks apart.
[0154] In the initial study, PEGINTRON.RTM., .alpha.2b-362 and
.alpha.2b-413, at equivalent units of activity based on the in
vitro growth inhibition assay, were each administered once weekly
at three different doses (3,500, 7,000, and 14,000 U), commencing 1
day after tumor inoculation. Survival curves and median survival
times (MST) are provided in FIG. 5A, which shows that
PEGINTRON.RTM., .alpha.2b-362, and .alpha.2b-413 all demonstratef
significant improvement in survival when compared to saline control
(P<0.0016), and the efficacy of .alpha.2b-362 or .alpha.2b-413
at the lowest dose (3,500 U) was similar or better than
PEGINTRON.RTM. at the highest dose (14,000 IU). Both .alpha.2b-362
and .alpha.2b-413 at the two higher doses (7,000 and 14,000 U) were
significantly superior to PEGINTRON.RTM. (P<0.0027). Moreover,
.alpha.2b-413 was significantly more active than .alpha.2b-362
(P<0.0025) when administered at equivalent doses. Although the
MST of mice treated with the 14,000 U dose was 60 days compared to
46 days of those treated with the 3,500 U dose, there were no
statistically significant differences in survival benefit among the
three doses of .alpha.2b-413 (P=0.1255). These in vivo efficacy
results correlate well with the PK data and demonstrate that the
two monopegylated dimers of IFN-.alpha.2b made by the DNL method
are more potent and longer-lasting than PEGINTRON.RTM., which
prompted us to test whether less frequent dosing would be feasible
with .alpha.2b-413.
[0155] We thus performed a second study in which PEGINTRON@ and
.alpha.2b-413 at equal units of activity were administered with
varied dosing schedules (FIG. 5B). All animals that received either
form of IFN at any of the various schedules had significantly
improved survival in comparison to saline control mice
(P<0.0009). For bi-weekly (q2wk.times.4) therapy, mice treated
with .alpha.2b-413 had significantly improved survival compared to
those treated with PEGINTRON.RTM. (MST=66 days versus 28 days;
P=0.0002). Importantly, mice treated every third week with
.alpha.2b-413 (q3wk.times.4) not only had significantly improved
survival in comparison to those treated with PEGINTRON.RTM. at the
same schedule (MST=54 days versus 28 days; P=0.0002), they also
showed longer MST than those treated with PEGINTRON.RTM. bi-weekly
(MST=28 days; P=0.0002). However, when compared with mice treated
with PEGINTRON.RTM. weekly (MST=36.5 days), the P value (0.3901) is
statistically insignificant as only one mouse survived in this
group.
[0156] In a third study (FIG. 5C), we found that administering
.alpha.2b-413 at 14,000 IU every 4 weeks increased the median
survival to 56 days from 23 days of the saline control and was more
potent than PEGINTRON.RTM. given 14,000 IU every week.
Example 8
In Vitro and In Vivo Characterization of .alpha.2b-457
[0157] For a better comparison with PEGASYS.RTM., we conjugated
IFN.alpha.2b-DDD2 to IMP457, an AD2-module of 40-kDa branched PEG,
and obtained a resulting .alpha.2b-457. Gel electrophoresis showed
that .alpha.2b-457 was of substantial purity in a 0.5 M NaCl
fraction eluted from a CM column (FIG. 6, lane 1, NR and R).
[0158] The iLite Human Interferon Alpha Cell-Based Assay Kit (PBL
Interferon Source) was used to determine specific activities
following the manufacturers' suggested protocol. Briefly, samples
were diluted in 1% BSA-PBS to 5, 1.25 and 3.125 ng/mL for
.alpha.2b-362 and .alpha.2b-413, to 10, 2.5 and 0.625 ng/mL for
.alpha.2b-457 and PEGASYS.RTM., and to 1, 0.25 and 0.0625 ng/mL for
PEGINTRON.RTM.. Each dilution was assayed in triplicate and
incubated overnight with the supplied cells. Specific activities
were extrapolated from a standard curve generated with the supplied
standard. The in vitro biological activities of .alpha.2b-457 were
determined by three different assays (FIG. 7A-7C) to be lower than
PEGINTRON.RTM., comparable to .alpha.2b-413, and considerably
higher than PEGASYS.RTM.. The PK data obtained in mice with a
single s.c. injection are shown in FIG. 8, which indicate a longer
circulating half-life of .alpha.2b-457 than either .alpha.2b-413 or
PEGASYS.RTM., with all three clearing much slower than
PEGINTRON.RTM..
[0159] Table 2 summarizes the key PK parameters calculated. The
observed differences between .alpha.2b-457 and each of
.alpha.2b-413, PEGASYS.RTM., and PEGINTRON.RTM., or between
.alpha.2b-413 and PEGASYS.RTM. or PEGINTRON.RTM., are significant
by statistical analysis (Table 3). When given once every four weeks
at a low dose of 20 pmol, .alpha.2b-457 was more effective than
PEGINTRON.RTM. given as a mole-equivalent dose once weekly.
Administration of .alpha.2b-457 extended the median survival of
Daudi-bearing mice to 47 days from 23 days when compared to the
saline group (FIG. 9). In the same study, .alpha.2b-457 at 20 pmol
was significantly better than either .alpha.2b-413 or
PEGINTRON.RTM. at 20 pmol (MST=47 days versus 41 and 37 days,
respectively; P<0.0151). The 20 pmol dose of .alpha.2b-413 also
improved survival in comparison to PEGINTRON.RTM. (P=0.002). At 10
pmol, there was no difference between .alpha.2b-457 and
.alpha.2b-413 but both significantly improved survival over
PEGINTRON.RTM. treated mice (P<0.001)
TABLE-US-00014 TABLE 2 Comparison of PK parameters. Injected Animal
C.sub.max T.sub.max T.sub.1/2 AUC.sub.0.fwdarw..infin. Cl
MRT.sub.0.fwdarw..infin. Material # (pmol/L) (h) (h) (h*pmole/L)
(L/h) (h) .alpha.2b-457 1 4,326 24 16.9 169,119 0.0012 34.7 2 6,538
24 16.6 249,852 0.0008 33.4 3 5,424 24 16.3 192,651 0.0010 29.9 4
5,052 8 15.9 194,122 0.0010 31.6 5,335 .+-. 923 20 .+-. 8.sup. 16.4
.+-. 0.4 201,436 .+-. 34,250 0.0010 .+-. 0.0002 32.4 .+-. 2.1
.alpha.2b-413 1 3,014 24 15.5 123,440 0.0016 30.1 2 4,104 8 20.5
170,183 0.0012 30.1 3 2,888 24 11.3 92,415 0.0022 24.1 4 4,122 8
14.9 166,127 0.0012 27.0 3,532 .+-. 673 16 .+-. 9.2 15.6 .+-. 3.8
138,041 .+-. 37,044 0.0016 .+-. 0.0005 27.8 .+-. 2.9 PEGASYS .RTM.
1 1,948 24 14.5 64,294 0.0016 33.1 2 1,887 24 14.6 58,596 0.0017
33.3 3 1,902 24 15.0 59,147 0.0017 34.1 4 2,377 24 15.3 47,116
0.0013 33.5 2,029 .+-. 234 24 14.9 .+-. 0.4 64,038 .+-. 7,192
0.0016 .+-. 0.0002 33.5 .+-. 0.4 PEGINTRON .RTM. 1 1,885 8 9.4
34,063 0.0029 17.1 2 1,301 8 8.4 24,667 0.0041 15.5 3 1,609 8 9.8
32,833 0.0030 18.5 4 2,521 8 9.6 50,129 0.0020 17.3 1,829 .+-. 519
8 9.3 .+-. 0.6 35,423 .+-. 10,654 0.0030 .+-. 0.0008 17.1 .+-.
1.3
TABLE-US-00015 TABLE 3 Statistical analysis of PK parameters AUC
P-value Cmax P-value .alpha.2b-457 vs. Fraction of Fraction of
.alpha.2b-457 .alpha.2b-457 .alpha.2b-413 0.68 0.0457 0.66 0.0196
PEGASYS .RTM. 0.32 0.0027 0.38 0.0041 PEGINTRON .RTM. 0.18 0.0001
0.34 0.0006 .alpha.2b-413 vs. Fraction of Fraction of .alpha.2b-413
.alpha.2b-413 PEGASYS .RTM. 0.46 0.0202 0.57 0.0056 PEGINTRON .RTM.
0.26 0.0018 0.52 0.0071
[0160] In conclusion, we have PEGylated interferon-.alpha.2b
(IFN-.alpha.2b) by the DNL method, which is capable of exclusively
producing a class of monoPEGylated conjugates of IFN-.alpha.2b
composed of two molecules of IFN-.alpha.2b and a single PEG chain.
Three such monoPEGylated dimers of IFN-.alpha.2b retained
anti-viral and anti-tumor activity in vitro and showed improved
pharmacokinetic properties in vivo in mice, which translated into
more potent and prolonged therapeutic efficacy in the Daudi human
lymphoma model. This novel site-specific PEGylation technology
provided extended circulation half-life and increased potency.
Example 9
Generation of DDD Module Based on Granulocyte-Colony Stimulating
Factor (G-CSF)
[0161] Construction of G-CSF-DDD2-pdHL2 for Expression in Mammalian
Cells
[0162] The cDNA sequence for G-CSF was amplified by PCR, resulting
in a protein comprising G-CSF fused at its C-terminus to a
polypeptide consisting of SEQ ID NO:23. PCR amplification was
accomplished using a full-length human G-CSF cDNA clone (Invitrogen
IMAGE human cat#97002RG Clone ID 5759022) as a template and the
following oligonucleotides as primers:
TABLE-US-00016 G-CSF XbaI Left (SEQ ID NO: 26)
5'-TCTAGACACAGGACCTCATCATGGCTGGACCTGCCACCCAG-3' G-CSF BamHI-Right
(SEQ ID NO: 27) 5'-GGATCCATGATGGTGATGATGGTGTGACTTGGGCTGGGCAAGGTGG
CGTAG-3'
[0163] The PCR amplimer was cloned into the pGemT vector. A
DDD2-pdHL2 mammalian expression vector was prepared for ligation
with G-CSF by digestion with XbaI and Bam HI restriction
endonucleases. The G-CSF amplimer was excised from pGemT with XbaI
and Bam HI and ligated into the DDD2-pdHL2 vector to generate the
expression vector G-CSF-DDD2-pdHL2.
[0164] Mammalian Expression of G-CSF-DDD2
[0165] G-CSF-pdHL2 was linearized by digestion with SalI enzyme and
stably transfected into Sp/EEE myeloma cells by electroporation.
Clones were selected with media containing 0.15 MTX. Clone #4 was
shown to produce 0.15 mg/L of G-CSF-DDD2 by sandwich ELISA.
[0166] Purification of G-CSF-DDD2 from Batch Cultures Grown in
Roller Bottles
[0167] Approximately 3 mg of G-CSF-DDD2 is purified as descried in
Example 2. A selected clone is expanded to 34 roller bottles
containing a total of 20 L of Hybridoma SFM with 0.4 .mu.M MTX and
allowed to reach terminal culture. The supernatant fluid is
clarified by centrifugation, filtered (0.2 .mu.M), diafiltered into
1.times. Binding buffer (10 mM imidazole, 0.5 M NaCl, 50 mM
NaH.sub.2PO.sub.4, pH 7.5) and concentrated. The concentrate is
loaded onto a Ni-NTA column, which is washed with 0.02% Tween 20 in
1.times. binding buffer and then 30 mM imidazole, 0.02% Tween 20,
0.5 M NaCl, 50 mM NaH.sub.2PO.sub.4, pH 7.5. The product is eluted
with 250 mM imidazole, 0.02% Tween 20, 150 mM NaCl, 50 mM
NaH.sub.2PO.sub.4, pH 7.5.
Example 10
Generation of PEGylated G-CSF by DNL
[0168] A DNL complex is generated having the structure of two
copies of G-CSF coupled to a 30 kDa PEG. The DNL reaction is
performed by the addition of reduced and lyophilized IMP413 in
10-fold molar excess to G-CSF-DDD2 in PBS. After 6 h at room
temperature in the dark, the reaction mixture is purified by
immobilized metal affinity chromatography using Ni-NTA.
Example 11
Generation of DDD Module Based on Erythropoietin (EPO)
[0169] Construction of G-CSF-DDD2-pdHL2 for Expression in Mammalian
Cells
[0170] The cDNA sequence for EPO was amplified by PCR resulting in
sequences comprising EPO fused at its C-terminus to a polypeptide
consisting of SEQ ID NO:23. PCR amplification was accomplished
using a full-length human EPO cDNA clone as a template and the
following oligonucleotides as primers:
TABLE-US-00017 EPO Xba I left (SEQ ID NO: 28)
5'-TCTAGACACAGGACCTCATCATGGGGGTGCACGAATGTCC-3' EPO BamHI Right (SEQ
ID NO: 29) 5'-GGATCCATGATGGTGATGATGGTGTGACTTTCTGTCCCCTGTCCTG
CAG-3'
[0171] The PCR amplimer was cloned into the pGemT vector. A
DDD2-pdHL2 mammalian expression vector was prepared for ligation
with EPO by digestion with XbaI and Bam HI restriction
endonucleases. The EPO amplimer was excised from pGemT with XbaI
and Bam HI and ligated into the DDD2-pdHL2 vector to generate the
expression vector EPO-DDD2-pdHL2.
[0172] Mammalian Expression of EPO-DDD2
[0173] EPO-pdHL2 was linearized by digestion with Sail enzyme and
stably transfected into Sp/EEE myeloma cells by electroporation.
Clones were selected with media containing 0.15 .mu.M MTX. Clones
#41, 49 and 37 each were shown to produce .about.0.5 mg/L of EPO by
an ELISA using Nunc Immobilizer Nickel-Chelate plates to capture
the His-tagged fusion protein and detection with anti-EPO
antibody.
[0174] Purification of EPO from Batch Cultures Grown in Roller
Bottles
[0175] Approximately 2.5 mg of EPO-DDD2 is purified by IMAC from
9.6 liters of serum-free roller bottle culture as described in
Example 2. SDS-PAGE and immunoblot analysis indicate that the
purified product constitutes approximately 10% of the total protein
following IMAC (not shown). Under reducing conditions the EPO-DDD2
polypeptide is resolved as a broad band with a M.sub.r (40-45 kDa)
greater than its calculated mass (28 kDa) due to extensive and
heterogeneous glycosylation. Under non-reducing conditions the
EPO-DDD2 primarily resolves as a disulfide-linked covalent dimer
(mediated by DDD2) with a M.sub.r of 80-90 kDa.
Example 12
DNL Conjugation of EPO-DDD2 with a Fab-AD2 Module
[0176] h679 is a humanized monoclonal antibody that is highly
specific for the hapten HSG (histamine-succinyl-glycine).
Production of an h679-Fab-AD2 module has been described previously
(Rossi et. al, Proc. Natl. Acad. Sci. USA. 2006; 103:6841). A
small-scale preparation of EPO-679 (EPO-DDD2.times.h679-Fab-AD2)
was made by DNL. EPO-DDD2 (1 mg) was reacted overnight with
h679-Fab-AD2 (1 mg) in PBS containing 1 mM reduced glutathione and
2 mM oxidized glutathione. The DNL conjugate was purified by
HSG-based affinity chromatography as described previously (Rossi
et. al, Proc. Natl. Acad. Sci. USA. 2006; 103:6841). The structure
of EPO-679 comprised two EPO moieties and h679-Fab. Coomassie blue
staining of SDS-PAGE gels demonstrated the creation of EPO-679 (not
shown). The DNL product, which is resolved as a broad band with a
M.sub.r of 150-170 kDa under non-reducing conditions, is highly
purified and consists only of the three constituent polypeptides
(EPO, h679-Fd-AD2 and h679 Kappa) as demonstrated by SDS-PAGE under
reducing conditions (not shown).
Example 13
Biological Activity of EPO-DDD2 and EPO-679
[0177] EPO-DDD2 and EPO-679 were assayed for their ability to
stimulate the growth of EPO-responsive TF1 cells (ATCC) using
recombinant human EPO (Calbiochem) as a positive control. TF1 cells
were grown in RPMI 1640 media supplemented with 20% FBS without
GM-CSF supplementation in 96-well plates containing
1.times.10.sup.4 cells/well. The concentrations (units/ml) of the
EPO constructs were determined using a commercial kit (Human
erythropoietin ELISA kit, Stem Cell Research, Cat#01630). Cells
were cultured in the presence of rhEPO, EPO-DDD2 or EPO-679 at
concentrations ranging from 900 U/ml to 0.001 U/ml for 72 hours.
The viable cell densities were compared by MTS assay using 20 .mu.l
of MTS reagent/well incubated for 6 hours before measuring the
OD490 in a 96-well plate reader. Dose response curves and EC50
values were generated using Graph Pad Prism software (not shown).
Both EPO-DDD2 and EPO-679 show in vitro biological activity at
approximately 10% of the potency of rhEPO.
Example 14
Generation of PEGylated EPO by DNL
[0178] The structure of EPO-413 having two copies of EPO coupled to
a 30 kDa PEG is made. A DNL reaction is performed by the addition
of reduced and lyophilized IMP413 in 10-fold molar excess to
EPO-DDD2 in PBS. After 6 h at room temperature in the dark, the
reaction mixture is purified by immobilized metal affinity
chromatography using Ni-NTA.
Example 15
Production of 2-PEG:1-Target Agent Complexes
[0179] In alternative embodiments, it may be desirable to make
PEGylated complexes with a stoichiometry of 2 PEG moieties to 1
target agent. Such PEGylated complexes are readily made by the
methods of Examples 1-3 above, by attaching the PEG moiety to the
DDD sequence and the active agent to the AD sequence. A PEGylated
complex with a 2:1 stoichiometry of PEG to IFN-.alpha.2b is
prepared by a modification of the methods of Examples 1-3. The
complex exhibits stability in serum and shows interferon activity
that is lower than the PEGylated complex with a 1:2 stoichiometry
of PEG to IFN-.alpha.2b. However, clearance rate for the
bi-PEGylated complex is slower than the clearance rate for the
mono-PEGylated complex.
Sequence CWU 1
1
31144PRTHomo sapiens 1Ser His Ile Gln Ile Pro Pro Gly Leu Thr Glu
Leu Leu Gln Gly Tyr 1 5 10 15 Thr Val Glu Val Leu Arg Gln Gln Pro
Pro Asp Leu Val Glu Phe Ala 20 25 30 Val Glu Tyr Phe Thr Arg Leu
Arg Glu Ala Arg Ala 35 40 245PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 2Cys Gly His Ile Gln Ile
Pro Pro Gly Leu Thr Glu Leu Leu Gln Gly 1 5 10 15 Tyr Thr Val Glu
Val Leu Arg Gln Gln Pro Pro Asp Leu Val Glu Phe 20 25 30 Ala Val
Glu Tyr Phe Thr Arg Leu Arg Glu Ala Arg Ala 35 40 45
317PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 3Gln Ile Glu Tyr Leu Ala Lys Gln Ile Val Asp Asn
Ala Ile Gln Gln 1 5 10 15 Ala 421PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 4Cys Gly Gln Ile Glu Tyr
Leu Ala Lys Gln Ile Val Asp Asn Ala Ile 1 5 10 15 Gln Gln Ala Gly
Cys 20 544PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 5Xaa Xaa Ile Xaa Ile Xaa Xaa Xaa Leu Xaa Xaa
Leu Leu Xaa Xaa Tyr 1 5 10 15 Xaa Val Xaa Val Leu Xaa Xaa Xaa Xaa
Xaa Xaa Leu Val Xaa Phe Xaa 20 25 30 Val Xaa Tyr Phe Xaa Xaa Leu
Xaa Xaa Xaa Xaa Xaa 35 40 617PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 6Xaa Xaa Xaa Xaa Xaa Ala Xaa
Xaa Ile Val Xaa Xaa Ala Ile Xaa Xaa 1 5 10 15 Xaa 717PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 7Gln
Ile Glu Tyr Val Ala Lys Gln Ile Val Asp Tyr Ala Ile His Gln 1 5 10
15 Ala 817PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 8Gln Ile Glu Tyr Lys Ala Lys Gln Ile Val Asp His
Ala Ile His Gln 1 5 10 15 Ala 917PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 9Gln Ile Glu Tyr His Ala
Lys Gln Ile Val Asp His Ala Ile His Gln 1 5 10 15 Ala
1017PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 10Gln Ile Glu Tyr Val Ala Lys Gln Ile Val Asp His
Ala Ile His Gln 1 5 10 15 Ala 1124PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 11Asp Leu Ile Glu Glu Ala
Ala Ser Arg Ile Val Asp Ala Val Ile Glu 1 5 10 15 Gln Val Lys Ala
Ala Gly Ala Tyr 20 1218PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 12Leu Glu Gln Tyr Ala Asn Gln
Leu Ala Asp Gln Ile Ile Lys Glu Ala 1 5 10 15 Thr Glu
1320PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 13Phe Glu Glu Leu Ala Trp Lys Ile Ala Lys Met Ile
Trp Ser Asp Val 1 5 10 15 Phe Gln Gln Cys 20 1425PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 14Pro
Glu Asp Ala Glu Leu Val Arg Leu Ser Lys Arg Leu Val Glu Asn 1 5 10
15 Ala Val Leu Lys Ala Val Gln Gln Tyr 20 25 1525PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 15Pro
Glu Asp Ala Glu Leu Val Arg Thr Ser Lys Arg Leu Val Glu Asn 1 5 10
15 Ala Val Leu Lys Ala Val Gln Gln Tyr 20 25 1625PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 16Pro
Glu Asp Ala Glu Leu Val Arg Leu Ser Lys Arg Asp Val Glu Asn 1 5 10
15 Ala Val Leu Lys Ala Val Gln Gln Tyr 20 25 1744PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
17Xaa His Ile Xaa Ile Pro Xaa Gly Leu Xaa Glu Leu Leu Gln Gly Tyr 1
5 10 15 Thr Xaa Glu Val Leu Arg Xaa Gln Pro Xaa Asp Leu Val Glu Phe
Ala 20 25 30 Xaa Xaa Tyr Phe Xaa Xaa Leu Xaa Glu Xaa Arg Xaa 35 40
1821PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 18Gln Lys Ser Leu Ser Leu Ser Pro Gly Leu Gly Ser
Gly Gly Gly Gly 1 5 10 15 Ser Gly Gly Cys Gly 20 1921PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 19Gln
Lys Ser Leu Ser Leu Ser Pro Gly Ala Gly Ser Gly Gly Gly Gly 1 5 10
15 Ser Gly Gly Cys Gly 20 2020PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 20Gln Lys Ser Leu Ser Leu Ser
Pro Gly Gly Ser Gly Gly Gly Gly Ser 1 5 10 15 Gly Gly Cys Gly 20
2121PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 21Cys Gly Gln Ile Glu Tyr Leu Ala Lys Gln Ile Val
Asp Asn Ala Ile 1 5 10 15 Gln Gln Ala Gly Cys 20 2222PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 22Cys
Gly Gln Ile Glu Tyr Leu Ala Lys Gln Ile Val Asp Asn Ala Ile 1 5 10
15 Gln Gln Ala Gly Cys Gly 20 2363PRTArtificial SequenceDescription
of Artificial Sequence Synthetic polypeptide 23Lys Ser His His His
His His His Gly Ser Gly Gly Gly Gly Ser Gly 1 5 10 15 Gly Gly Cys
Gly His Ile Gln Ile Pro Pro Gly Leu Thr Glu Leu Leu 20 25 30 Gln
Gly Tyr Thr Val Glu Val Leu Arg Gln Gln Pro Pro Asp Leu Val 35 40
45 Glu Phe Ala Val Glu Tyr Phe Thr Arg Leu Arg Glu Ala Arg Ala 50
55 60 2445DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 24tctagacaca ggacctcatc atggccttga cctttgcttt
actgg 452555DNAArtificial SequenceDescription of Artificial
Sequence Synthetic primer 25ggatccatga tggtgatgat ggtgtgactt
ttccttactt cttaaacttt cttgc 552641DNAArtificial SequenceDescription
of Artificial Sequence Synthetic primer 26tctagacaca ggacctcatc
atggctggac ctgccaccca g 412751DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 27ggatccatga tggtgatgat
ggtgtgactt gggctgggca aggtggcgta g 512840DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
28tctagacaca ggacctcatc atgggggtgc acgaatgtcc 402949DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
29ggatccatga tggtgatgat ggtgtgactt tctgtcccct gtcctgcag
49306PRTArtificial SequenceDescription of Artificial Sequence
Synthetic 6xHis tag 30His His His His His His 1 5 3118PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 31Lys
Ser His His His His His His Gly Ser Gly Gly Gly Gly Ser Gly 1 5 10
15 Gly Gly
* * * * *