U.S. patent number 10,350,162 [Application Number 13/855,346] was granted by the patent office on 2019-07-16 for methods and compositions for oral administration of exenatide.
This patent grant is currently assigned to Oramed Ltd.. The grantee listed for this patent is Oramed Ltd.. Invention is credited to Miriam Kidron.
![](/patent/grant/10350162/US10350162-20190716-D00001.png)
![](/patent/grant/10350162/US10350162-20190716-D00002.png)
United States Patent |
10,350,162 |
Kidron |
July 16, 2019 |
Methods and compositions for oral administration of exenatide
Abstract
This invention provides compositions comprising a byetta, fish
oil, and a protease inhibitor, method for treating diabetes
mellitus, comprising administering same, and methods for oral or
rectal administration of a byetta.
Inventors: |
Kidron; Miriam (Jerusalem,
IL) |
Applicant: |
Name |
City |
State |
Country |
Type |
Oramed Ltd. |
Jerusalem |
N/A |
IL |
|
|
Assignee: |
Oramed Ltd. (Jerusalem,
IL)
|
Family
ID: |
41265104 |
Appl.
No.: |
13/855,346 |
Filed: |
April 2, 2013 |
Prior Publication Data
|
|
|
|
Document
Identifier |
Publication Date |
|
US 20130195939 A1 |
Aug 1, 2013 |
|
Related U.S. Patent Documents
|
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
Issue Date |
|
|
12990097 |
|
|
|
|
|
PCT/IL2009/000461 |
May 3, 2009 |
|
|
|
|
61071538 |
May 5, 2008 |
|
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K
38/56 (20130101); A61P 9/10 (20180101); A61K
9/4866 (20130101); A61P 9/12 (20180101); A61P
5/48 (20180101); A61P 3/10 (20180101); A61K
9/2846 (20130101); A61K 31/22 (20130101); A61P
3/04 (20180101); A61P 43/00 (20180101); A61K
31/202 (20130101); A61K 9/0031 (20130101); A61P
5/50 (20180101); A61K 38/26 (20130101); A61K
38/57 (20130101); A61K 9/0053 (20130101); A61P
1/00 (20180101); A61P 19/02 (20180101); A61K
31/202 (20130101); A61K 2300/00 (20130101); A61K
38/26 (20130101); A61K 2300/00 (20130101); A61K
38/57 (20130101); A61K 2300/00 (20130101) |
Current International
Class: |
A61K
9/48 (20060101); A61K 31/202 (20060101); A61K
31/22 (20060101); A61K 9/28 (20060101); A61K
9/00 (20060101); A61K 38/26 (20060101); A61K
38/56 (20060101); A61K 38/57 (20060101) |
References Cited
[Referenced By]
U.S. Patent Documents
Foreign Patent Documents
|
|
|
|
|
|
|
1223200 |
|
Jun 1987 |
|
CA |
|
2621577 |
|
Mar 2007 |
|
CA |
|
101095942 |
|
Feb 2008 |
|
CN |
|
0351651 |
|
Jan 1990 |
|
EP |
|
68769 |
|
Feb 1986 |
|
IL |
|
02-250823 |
|
Oct 1990 |
|
JP |
|
09-208485 |
|
Aug 1997 |
|
JP |
|
10-330287 |
|
Dec 1998 |
|
JP |
|
00-050793 |
|
Feb 2000 |
|
JP |
|
2001-240558 |
|
Apr 2001 |
|
JP |
|
2001-240558 |
|
Sep 2001 |
|
JP |
|
2005-525308 |
|
Aug 2005 |
|
JP |
|
2011-515458 |
|
May 2011 |
|
JP |
|
01-0069433 |
|
Jul 2001 |
|
KR |
|
2001/0069322 |
|
Jul 2001 |
|
KR |
|
2104715 |
|
Feb 1998 |
|
RU |
|
WO 91/14454 |
|
Oct 1991 |
|
WO |
|
WO 97/03688 |
|
Feb 1997 |
|
WO |
|
WO 00/24424 |
|
Jul 2000 |
|
WO |
|
WO 03/057170 |
|
Jul 2003 |
|
WO |
|
WO 2007/029238 |
|
Mar 2007 |
|
WO |
|
WO 09/118722 |
|
Oct 2009 |
|
WO |
|
WO 2009/136392 |
|
Nov 2009 |
|
WO |
|
Other References
Joslin Diabetes Center (retrieved from
http://www.joslin.org/info/will_diabetes_go_away.html on Apr. 22,
2015, 2 pages). cited by examiner .
WebMD (retrieved from
http://www.webmd.com/diabetes/is-there-a-diabetes-cure on Apr. 22,
2015, 3 pages). cited by examiner .
Cure talk (retrieved from
http://trialx.com/curetalk/2012/05/type-2-diabetes-difficult-to-treat-in--
children-new-study/ on Apr. 22, 2015, 2 pages). cited by examiner
.
The Observer (retrieved from
http://observer.com/2014/02/tough-to-swallow-paper-trail-behind-breakthro-
ugh-leads-to-penny-stock-profiteers/ on Apr. 22, 2015, 5 pages).
cited by examiner .
Agarwal, et al.; "Oral Delivery of Proteins: Effect of Chicken and
Duck Ovomucoid on the Stability of Insulin in the Presence of
.alpha.-Chymotrypsin and Trypsin"; Pharm. Pharmacol. Commun.;
(2000); 6: 223-227. cited by applicant .
Bar-On, H., et al.; "Enteral Administration of Inslin in the Rat";
Br. J. Pharmac. (1981); 73: 21-24. cited by applicant .
Bendayan, et al.; "Morpho-cytochemical and biochemical evidence for
insulin absorption by the rat ileal epithelium"; Diabetologia
(1990); 33: 197-204. cited by applicant .
Bendayan, et al.; "Biochemical and morpho-cytochemical evidence for
the intestinal absorption of insulin in control and diabetic rats.
Comparison between the effectiveness of duodenal and colon mucosa";
Diabetologia (1994); 37: 119-126. cited by applicant .
Carino, et al.; "Oral insulin delivery"; Advanced Drug Delivery
Review (1999); 35: 249-257. cited by applicant .
Cernea, et al.; "Comparison of pharmacokinetic and harmacodynamics
properties of single-dose oral insulin spray and subcutaneous
insulin injection in healthy subjects using the euglycemic clamp
technique"; Clinical Therapeutics (2004); 26(12): 2084-2091. cited
by applicant .
Cernea, et al.; "Dose-Response Relationship of Oral Insulin Spray
in Healthy Subjects"; Diabetes Care (2005); 28(6): 1353-1357. cited
by applicant .
Cernea, et al.; "Dose-Response Relationship of an Oral Insulin
Spray in Six Patients with Type 1 Diabetes: A Single-Center,
Randomized, Single-Blind, 5-Way Crossover Study"; Clinical
Therapeutics (2005); 27(10): 1562-1570. cited by applicant .
Cole, et al.; "Challenges and opportunities in the encapsulation of
liquid and semi-solid formulations into capsules for oral
administration"; Advanced Drug Delivery Reviews (2008); 60:
747-756. cited by applicant .
Cournarie, et al.; "Insulin-loaded W/O/W multiple emulsions:
comparison of the performances of systems prepared with
medium-chain-triglycerides and fish oil"; Euro. J. of Pharmaceutics
and BioPharmaceutics; (2004); 58(3): 477-482. cited by applicant
.
Gowthamarajan & Kulkarni; Oral Insulin--Fact or
Fiction--Possibilities of Achieving Oral Delivery for Insulin;
Resonance (2003); 38-46. cited by applicant .
Hays, et al.; "Prevention and Treatment of Type 2 Diabetes: Current
Role of Lifestyle, Natural Product, and Pharmacological
Interventions"; Pharmacol. Ther. (2008); 118(2): 181-191. cited by
applicant .
Heine, et al.; "Exenatide versus Insulin Glargine in Patients with
Suboptimally Controlled Type 2 Diabetes"; American College of
Physicians--Annals of Internal Medicine 2005; 143(8): 559-569.
cited by applicant .
Iyer, et al.; "Oral insulin--a review of current status"; Diabetes,
Obesity and Metabolism (2010); 12: 179-185. cited by applicant
.
Kidron, et al.; "A novel per-oral insulin formulation: proof of
concept study in non-diabetic subjects"; Diabetic Medicine (2004);
21: 354-357. cited by applicant .
Kidron, et al.; "Extended exposure to an oral insulin formulation
yields decreased insulin secretion in Type II diabetes subjects";
Diabetes Technology Meeting Nov. 11-13, 2010. cited by applicant
.
Lasserson, et al.; "Optimal insulin regimens in type 2 diabetes
mellitus: systematic review and meta-analyses"; Diabetologia
(2009); 52: 1990-2000. cited by applicant .
Li and Deng; "Oil-based formulation for oral delivery of insulin";
J. Pharmacy Pharmacol 2004; 56: 1101-1107. cited by applicant .
Ma, et al.; "In vitro and in vivo evaluation of a novel oral
insulin formulation"; Acta Pharmacologica Sinica (2006); 27(10):
1382-1388. cited by applicant .
Mack, et al. "Antiobestiy action of peripheral exenatide
(exendin-4) in rodents: effects on food intake, body weight,
metabolic status and side-effect measures"; International Journal
of Obesity (2006); 30: 1332-1340. cited by applicant .
Maher, S. et al.; "Safety and efficacy of sodium caprate in
promoting oral drug absorption: from in vitro to the clinic";
Advanced Drug Delivery Reviews; (2009); 61: 1427-1449. cited by
applicant .
Miyagawa, Jun-ichiro; Med Sci Digest 2008 34(4):147-150. cited by
applicant .
Morishita, et al.; "Hypoglycemic effect of novel oral microspheres
of insulin with protease inhibitor in normal and diabetic rats";
Int. J. of Pharma; (1992); 78: 9-16. cited by applicant .
Nissan, et al.; "Intestinal absorption of low molecular weight
heparin in animals and human subjects"; Haemostasis (2000); 30:
225-232. cited by applicant .
Onuki, et al.; "In vivo effects of highly purified docosahexaenoic
acid on rectal insulin absorption"; Int. J. of Pharmaceutics;
(2000); 198(2): 147-156. cited by applicant .
Ray Dirks Research; "Novo Nordisk Sitting on $2 Billion in Cash May
Look to Acquire Oramed or ISIS for Oral Insulin"; May 31, 2012.
cited by applicant .
Raz, et al.; "Rectal Administration of Insulin"; Israel Journal of
Medical Sciences (1984); 20: 173-175. cited by applicant .
Sherman, "Oramed Enrolls First Patient in its Phase 2a U.S. Oral
Insulin Clinical Trial"; Jul. 8, 2013. cited by applicant .
Silva-Cunha et al.; "W/O/W multiple emulsions of insulin containing
a protease inhibitor and an absorption enhancer: preparation,
characterization and determination of stability towards proteases
in vitro"; Int. J. of Pharmaceutics; (1997); 158(1): 79-89. cited
by applicant .
Ziv, et al.; "Bile Salts Promote the Absorption of Insulin from the
Rat Colon"; Life Sciences (1981); 29: 803-809. cited by applicant
.
Ziv, et al.; "Absorption of Protein via the Intestinal Wall a
Quantitative Model"; Biochemical Pharmacology (1987); 36(7):
1035-1039. cited by applicant .
Ziv, et al.; "Oral administration of insulin in solid form to
nondiabetic and diabetic dogs"; Journal of Pharmaceutical Sciences
(1994); 83(6): 792-794. cited by applicant .
International Search Report and Written Opinion for International
Application No. PCT/IL2009/000461 dated Sep. 25, 2009. cited by
applicant .
International Preliminary Report on Patentability for International
Application No. PCT/IL2009/000461 dated Nov. 9, 2010. cited by
applicant .
[No Author Listed] Worthington Biochemical Corporation (2016;
Trypsin inhibitors C.A.S.: 9035-81-1. On the web at
worthington-biochem.com/Ti/default.html. cited by applicant .
Birk, Trypsin and chymotrypsin inhibitors from soybeans.Methods
Enzymol. 1976;45:700-7. cited by applicant .
Chiquette et al., Treatment with exenatide once weekly or twice
daily for 30 weeks is associated with changes in several
cardiovascular risk markers. Vasc Health Risk Manag. 2012;8:621-9.
doi: 10.2147/VHRM.S37969. Epub Nov. 12, 2012. cited by applicant
.
Eldor et al., A Single-Blind, Two-Period Study to Assess the Safety
and Pharmacodynamics of an Orally Delivered GLP-1 Analog
(Exenatide) in Healthy SubjectsAmerican Diabetes Association 70th
Annual Scientific Sessions, Jun. 25-29, 2010A, Orlando, Florida.
cited by applicant .
Eldor et al., Open-label study to assess the safety and
pharmacodynamics of five oral insulin formulations in healthy
subjects.Diabetes Obes Metab. Mar. 2010;12(3):219-23. doi:
10.1111/j.1463-1326.2009.01153.x. cited by applicant .
Eldor et al., Novel glucagon-like peptide-1 analog delivered orally
reduces postprandial glucose excursions in porcine and canine
models. J Diabetes Sci Technol. Nov. 1, 2010;4(6):1516-23. cited by
applicant .
Gershanik et al., Self-dispersing lipid formulations for improving
oral absorption of lipophilic drugs. European Journal of
Pharmaceuticals and Biopharmaceutics. 2000;50:179-188. cited by
applicant .
Griffin,Calculation of HLB Values of Non-Ionic Surfactants. J Soc
Cosmetic Chemists 5:259 (1954). cited by applicant .
Koide et al., Studies on soybean trypsin inhibitors. 3. Amino-acid
sequences of the carboxyl-terminal region and the complete
amino-acid sequence of soybean trypsin inhibitor (Kunitz).Eur J
Biochem. Feb. 1, 1973;32(3):417-31. cited by applicant .
Koide et al., The amino acid sequence of soybean trypsin inhibitor.
J. Biochem. 1972;71:165-7. cited by applicant .
Martinez-Colubi et al., Switching to darunavir/ritonavir
monotherapy (DRV/r mx): effect on kidney function and lipid
profile. J Int AIDS Soc. Nov. 11, 2012;15(6):18348.
doi:10.7448/IAS.15.6.18348. cited by applicant .
Miyashita et al., Hepatoprotective effect of tamoxifen on steatosis
and non-alcoholic steatohepatitis in mouse models. J Toxicol Sci.
2012;37(5):931-42. cited by applicant .
Morishita et al. Novel oral microspheres of insulin with protease
inhibitor protecting from enzymatic degradation. International
Journal of Pharmaceutics. 78 (1992) 1-7. cited by applicant .
Nadeau et al., Treatment of non-alcoholic fatty liver disease with
metformin versus lifestyle intervention in insulin-resistant
adolescents. Pediatr Diabetes. Feb. 2009;10(1):5-13. doi:
10.1111/j.1399-5448.2008.00450.x. Epub Aug. 20, 2008. cited by
applicant .
Ozawa et al., The reactive site of trypsin inhibitors.J Biol Chem.
Sep. 10, 1966;241(17):3955-61. cited by applicant .
Park et al., Oral protein delivery: Current status and future
prospect. Reactive and Functional Polymers. 71 (2011) 280-287.
cited by applicant .
Ryan et al., Assessment of the severity of hypoglycemia and
glycemic lability in type 1 diabetic subjects undergoing islet
transplantation. Diabetes. Apr. 2004;53(4):955-62. cited by
applicant .
Shyangdan et al., Insulin sensitisers in the treatment of
non-alcoholic fatty liver disease: a systematic review. Health
Technol Assess. Nov. 2011;15(38):1-110. doi: 10.3310/hta15380.
cited by applicant .
Siepmann et al., Blends of aqueous polymer dispersions used for
pellet coating: importance of the particle size. J Control Release.
Jul. 20, 2005;105(3):226-39. cited by applicant .
Sprecher et al., Molecular cloning, expression, and partial
characterization of two novel members of the ovalbumin family of
serine proteinase inhibitors. J Biol Chem. Dec. 15,
1995;270(50):29854-61. cited by applicant .
Sun et al., Gene structure, chromosomal localization, and
expression of the murine homologue of human proteinase inhibitor 6
(PI-6) suggests divergence of PI-6 from the ovalbumin serpins. J
Biol Chem. Jul. 7, 1995;270(27):16089-96. cited by applicant .
Tesauro et al., Effects of GLP-1 on forearm vasodilator function
and glucose disposal during hyperinsulinemia in the metabolic
syndrome.Diabetes Care. Mar. 2013;36(3):683-9. doi:
10.2337/dc12-0763. Epub Oct. 15, 2012. cited by applicant .
Umezawa, Structures and activities of protease inhibitors of
microbial origin.Methods Enzymol. 1976;45:678-95. cited by
applicant .
Yeboah et al., A rapid purification method for soybean Bowman-Birk
protease inhibitor using hydrophobic interaction chromatography.
Protein Expression and Purification. 1996;7:309-14. cited by
applicant.
|
Primary Examiner: Skowronek; Karlheinz R.
Assistant Examiner: Niebauer; Ronald T
Attorney, Agent or Firm: Sterne, Kessler, Goldstein &
Fox P.L.L.C.
Parent Case Text
RELATED APPLICATION
This application is divisional of U.S. patent application Ser. No.
12/990,097, filed Oct. 28, 2010, which is a U.S.C. 371 National
Phase Application of International Application No.
PCT/IL2009/000461, filed May 3, 2009, which claims priority from
U.S. Provisional Patent Application No. 61/071,538, filed May 5,
2008, the contents of which are incorporated herein by reference.
Claims
What is claimed is:
1. A method for slowing the progression and/or ameliorating the
symptoms of diabetes mellitus in a subject, comprising
administering orally to said subject a pharmaceutical composition
comprising an exenatide having at least 95% identity to
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (SEQ ID NO: 1), wherein the
exenatide has glucagon-like peptide (GLP-1) agonist activity, a
protease inhibitor selected from Soybean Trypsin Inhibitor (SBTI)
and aprotinin, EDTA, and an omega-3 fatty acid, thereby slowing the
progression and/or ameliorating the symptoms of diabetes mellitus,
wherein the composition does not comprise both SBTI and
aprotinin.
2. The method of claim 1, wherein said omega-3 fatty acid is
derived from fish oil.
3. The method of claim 1, wherein said protease inhibitor is
soybean trypsin inhibitor (SBTI).
4. The method of claim 1, wherein said pharmaceutical composition
further comprises a coating that inhibits digestion of said
composition in a stomach of a subject.
5. The method of claim 4, wherein said coating is an enteric
coating.
6. The method of claim 1, wherein said pharmaceutical composition
further comprises a gelatin coating.
7. The method of claim 1, wherein said protease inhibitor is
aprotinin.
8. The method of claim 1, wherein the sequence of said exenatide is
identical to SEQ ID NO: 1.
9. The method of claim 1, wherein said omega-3 fatty acid is
provided in the form of a fish oil.
10. The method of claim 1, wherein the progression of diabetes
mellitus is slowed in the subject.
11. The method of claim 1, wherein the symptoms of diabetes
mellitus are ameliorated in the subject.
Description
FIELD OF INVENTION
This invention provides oral compositions comprising Exenatide, and
a method for administering same.
BACKGROUND OF THE INVENTION
Due to improved biotechnology, the accessibility of biologically
active peptides to the pharmaceutical industry has increased
considerably. However, a limiting factor in the development of
peptide drugs is the relative ineffectiveness when given perorally.
Almost all peptide drugs are parenterally administered, although
parenterally administered peptide drugs are often connected with
low patient compliance.
Exenatide is a glucagon-like peptide (GLP-1) agonist that was
approved by the Food and Drug Administration for adjunctive therapy
when patients with type 2 diabetes have not been optimally
controlled on metformin. It is an incretin mimetic and potentiates
exenatide secretion while inhibiting glucagon secretion and slowing
gastric emptying.
Exenatide (marketed as Byetta) is manufactured and marketed by
Amylin Pharmaceuticals and Eli Lilly and Company. Exenatide is a
synthetic version of exendin-4, a hormone in the saliva of the Gila
monster, a lizard native to several Southwestern American states.
Typical human responses to exenatide include improvements in the
initial rapid release of endogenous insulin, suppression of
pancreatic glucagon release, delayed gastric emptying, and reduced
appetite--all of which function to lower blood glucose. Unlike
sulfonylureas and meglitinides, exenatide increases insulin
synthesis and secretion in the presence of glucose only, lessening
the risk of hypoglycemia. Byetta is also being used by some
physicians to treat insulin resistance.
Exenatide augments pancreas response (i.e. increases insulin
secretion) in response to eating meals; the result is the release
of a higher, more appropriate amount of insulin that helps lower
the rise in blood sugar from eating. Once blood sugar levels
decrease closer to normal values, the pancreas response to produce
insulin is reduced; however, other drugs (like injectable insulin)
are effective at lowering blood sugar, but can "overshoot" their
target and cause blood sugar to become too low, resulting in the
dangerous condition of hypoglycemia.
Exenatide also suppresses pancreatic release of glucagon in
response to eating, which helps stop the liver from overproducing
sugar when it is unneeded, which prevents hyperglycemia (high blood
sugar levels).
Exenatide helps slow down gastric emptying and thus decreases the
rate at which meal-derived glucose appears in the bloodstream.
Exenatide has a subtle yet prolonged effect to reduce appetite and
thus may prevent weight gain. Most people using Exenatide slowly
lose weight, and generally the greatest weight loss is achieved by
people who are the most overweight at the beginning of exenatide
therapy. Clinical trials have demonstrated that the weight reducing
effect continues at the same rate through 2.25 years of continued
use. When separated into weight loss quartiles, the highest 25%
experience substantial weight loss and the lowest 25% experience no
loss or small weight gain.
Exenatide reduces liver fat content. Fat accumulation in the liver
or non-alcoholic fatty liver disease (NAFLD) is strongly related
with several metabolic disorders, in particular low HDL cholesterol
and high triglycerides, present in patients with type 2 diabetes.
It became apparent that exenatide reduced liver fat in mice and
more recently in man.
Exenatide is a polypeptide consisting of 39 amino acids with a
molecular weight of 4186.6. Ex vivo human placental perfusion
studies detected minimal levels on the fetal side (fetal: maternal
ratio 0.017).
Exenatide is currently administered as a subcutaneous injection,
generally concomitantly with a sulfonylurea or metformin. Although
it has a modest effect on lowering fasting glucose levels, it
markedly reduces postprandial glucose.
The present invention addresses the need for an alternate solution
for administration of exenatide.
SUMMARY OF THE INVENTION
This invention provides, in one embodiment, a composition
comprising an exenatide and a protease inhibitor, wherein the
composition is an oral pharmaceutical composition or a rectal
pharmaceutical composition.
In another embodiment, the present invention provides a method for
oral or rectal administration of exenatide to a subject, whereby a
substantial fraction of exenatide retains its activity after
absorption, through an intestinal mucosal barrier or through a
rectal tissue of said subject, comprising administering orally or
rectally to a subject a pharmaceutical composition comprising said
exenatide.
In another embodiment, the present invention provides a method for
treating diabetes mellitus in a subject, comprising administering
orally or rectally to a subject a pharmaceutical composition
comprising exenatide, thereby treating diabetes mellitus.
In another embodiment, the present invention provides a method for
reducing food intake in a subject, comprising administering orally
or rectally to a subject a pharmaceutical composition comprising
exenatide, thereby reducing food intake in a subject.
In another embodiment, the present invention provides a method for
reducing gastric motility in a subject, comprising administering
orally or rectally to a subject a pharmaceutical composition
comprising exenatide, thereby reducing gastric motility in a
subject.
In another embodiment, the present invention provides a method for
lowering plasma glucagon in a subject, comprising administering
orally or rectally to said subject a pharmaceutical composition
comprising exenatide, thereby lowering plasma glucagon in a
subject.
BRIEF DESCRIPTION OF THE FIGURES
FIG. 1 is a graph showing the blood glucose lowering effect of an
Exendin-4-oral dosage form compared to control in dogs.
FIG. 2 is a graph comparing the blood glucose lowering effect of an
Exendin-4 in a rectal dosage form (hard gelatin capsule, 100 .mu.g
Exendin 4), injectable dosage forms (2.5 .mu.g Byetta GeneScript
and 2.5 .mu.g Byetta Commercial), and control in dogs, the values
are calculated as .DELTA. time 0 (the concentration of blood
glucose at time 0 was deducted from each value obtained at a given
time).
FIG. 3 is a graph comparing the blood glucose lowering effect of an
Exendin-4 in an oral dosage form (100 .mu.g Exendin 4), control,
and injectable dosage forms (2.5 .mu.g Byetta GeneScript and 2.5
.mu.g Byetta Commercial) in dogs (the concentration of blood
glucose at time 0 was deducted from each value obtained at a given
time).
FIG. 4 is a bar graph showing the glucose excursion above the
pre-OGTT glucose level over a 150 min interval (incremental area
under the curve (AUC).sub.0-150).
DETAILED DESCRIPTION OF THE INVENTION
This invention provides compositions and methods comprising
exenatide and an omega-3 fatty acid. In another embodiment, the
present invention provides compositions and methods comprising
exenatide and a protease inhibitor. In another embodiment, the
present invention provides compositions and methods comprising
exenatide and an enhancer such as EDTA and salts thereof such as
Na-EDTA. In another embodiment, the present invention provides
compositions and methods comprising exenatide and Na-EDTA. In
another embodiment, the present invention provides compositions and
methods comprising exenatide, omega-3 fatty acid, and Na-EDTA. In
another embodiment, the present invention provides oral
compositions comprising exenatide. In another embodiment, the
present invention provides oral compositions comprising exenatide
and Na-EDTA. In another embodiment, the present invention provides
oral compositions comprising exenatide, omega-3 fatty acid, and
Na-EDTA. In another embodiment, the present invention provides
rectal compositions comprising exenatide and Na-EDTA. In another
embodiment, the present invention provides rectal compositions
comprising exenatide, omega-3 fatty acid, and Na-EDTA. In one
embodiment, the present invention provides a composition comprising
exenatide and an omega-3 fatty acid. As provided herein (Examples),
such compositions have utility in the oral administration of
exenatide, whereby the exenatide is absorbed by the intestines into
the bloodstream in an active form.
In another embodiment, byetta is the proprietary name for the
active ingredient exenatide. In another embodiment, exenatide is
designated AC2993 and is a synthetic exendin-4. In another
embodiment, exenatide is a 39-amino acid peptide. In another
embodiment, exenatide comprises the amino acid sequence:
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (SEQ ID NO: 1). In another
embodiment, exenatide containing the amino acid sequence of SEQ ID
NO: 1. In another embodiment, exenatide comprises an amino acid
sequence having at least 70% identity to SEQ ID NO: 1. In another
embodiment, exenatide comprises an amino acid sequence having at
least 80% identity to SEQ ID NO: 1. In another embodiment,
exenatide comprises an amino acid sequence having at least 90%
identity to SEQ ID NO: 1. In another embodiment, exenatide
comprises an amino acid sequence having at least 95% identity to
SEQ ID NO: 1. In another embodiment, exenatide comprises an amino
acid sequence having at least 99% identity to SEQ ID NO: 1.
In another embodiment, exenatide oral or rectal formulation of the
invention is effective for diabetic therapy. In another embodiment,
exenatide oral or rectal formulation of the invention enhances
insulin secretion. In another embodiment, exenatide enhances
glucose-dependent insulin secretion. In another embodiment,
exenatide oral or rectal formulation of the invention suppresses
high glucagon secretion. In another embodiment, exenatide oral or
rectal formulation of the invention slows of gastric-emptying rate.
In another embodiment, exenatide oral or rectal formulation of the
invention binds to the pancreatic glucagon-like peptide-1 (GLP-1)
receptor. In another embodiment, exenatide oral or rectal
formulation of the invention reduces food intake. In another
embodiment, exenatide oral or rectal formulation of the invention
causes weight loss. In another embodiment, exenatide oral or rectal
formulation of the invention comprises an insulin-sensitizing
effect. In another embodiment, exenatide oral or rectal formulation
of the invention improves glycemic control among patients with type
2 diabetes. In another embodiment, exenatide oral or rectal
formulation of the invention improves glycemic control among
patients with type 2 diabetes treated with sulfonylureas or
metformin, alone or in combination.
In another embodiment, exenatide is Exendin-4 comprising 53% amino
acid sequence overlap with mammalian GLP-1. In another embodiment,
oral or rectal formulation comprising exenatide is resistant to
DPP-IV degradation. In another embodiment, oral or rectal
formulation comprising exenatide reduces postprandial glycemia. In
another embodiment, oral or rectal formulation comprising exenatide
induces the release of insulin and Amylin. In another embodiment,
oral or rectal formulation comprising exenatide is not associated
with weight gain. In another embodiment, oral or rectal formulation
comprising exenatide reduces postprandial serum triglyceride
concentrations. In another embodiment, oral or rectal formulation
comprising exenatide cause less adverse events than an injectable
formulation comprising exenatide. In another embodiment, treatment
with oral or rectal formulation comprising exenatide does not cause
nausea. In another embodiment, treatment with oral or rectal
formulation comprising exenatide cause only mild nausea. In another
embodiment, treatment with oral or rectal formulation comprising
exenatide does not cause gastroparesis.
In another embodiment, the amount of Exenatide in a formulation as
described herein is 10 mcg to 1 mg. In another embodiment, the
amount of Exenatide in a formulation as described herein is 10 mcg
to 25 mcg. In another embodiment, the amount of Exenatide in a
formulation as described herein is 25 mcg to 50 mcg. In another
embodiment, the amount of Exenatide in a formulation as described
herein is 50 mcg to 60 mcg. In another embodiment, the amount of
Exenatide in a formulation as described herein is 60 mcg to 70 mcg.
In another embodiment, the amount of Exenatide in a formulation as
described herein is 70 mcg to 80 mcg. In another embodiment, the
amount of Exenatide in a formulation as described herein is 80 mcg
to 90 mcg. In another embodiment, the amount of Exenatide in a
formulation as described herein is 90 mcg to 100 mcg. In another
embodiment, the amount of Exenatide in a formulation as described
herein is 100 mcg to 110 mcg. In another embodiment, the amount of
Exenatide in a formulation as described herein is 110 mcg to 125
mcg. In another embodiment, the amount of Exenatide in a
formulation as described herein is 125 mcg to 150 mcg. In another
embodiment, the amount of Exenatide in a formulation as described
herein is 150 mcg to 175 mcg. In another embodiment, the amount of
Exenatide in a formulation as described herein is 175 mcg to 200
mcg. In another embodiment, the amount of Exenatide in a
formulation as described herein is 200 meg to 220 mcg. In another
embodiment, the amount of Exenatide in a formulation as described
herein is 220 mcg to 240 mcg. In another embodiment, the amount of
Exenatide in a formulation as described herein is 240 mcg to 260
mcg. In another embodiment, the amount of Exenatide in a
formulation as described herein is 260 mcg to 300 mcg.
In another embodiment, the amount of Exenatide in a formulation as
described herein is 300 mcg to 350 mcg. In another embodiment, the
amount of Exenatide in a formulation as described herein is 350 mcg
to 400 mcg. In another embodiment, the amount of Exenatide in a
formulation as described herein is 400 mcg to 450 mcg. In another
embodiment, the amount of Exenatide in a formulation as described
herein is 450 mcg to 500 mcg. In another embodiment, the amount of
Exenatide in a formulation as described herein is 550 mcg to 600
mcg. In another embodiment, the amount of Exenatide in a
formulation as described herein is 600 mcg to 700 mcg. In another
embodiment, the amount of Exenatide in a formulation as described
herein is 700 mcg to 800 mcg. In another embodiment, the amount of
Exenatide in a formulation as described, herein is 800 mcg to 900
mcg. In another embodiment, the amount of Exenatide in a
formulation as described herein is 900 mcg to 1 mg.
In another embodiment, the Exenatide formulation as described
herein is taken once a day. In another embodiment, the Exenatide
formulation as described herein is taken twice a day. In another
embodiment, the Exenatide formulation as described herein is taken
three times a day. In another embodiment, the Exenatide formulation
as described herein is taken four times a day. In another
embodiment, the Exenatide formulation as described herein is taken
five times a day. In another embodiment, one of skill in the art
determines the dosage of Exenatide formulation as described herein.
In another embodiment, one of skill in the art determines the daily
dose of a Exenatide formulation as described herein. In another
embodiment, one of skill in the art determines the daily dosing
regimen of a Exenatide formulation as described herein.
In another embodiment, the Exenatide formulation as described
herein is taken at least 15 minutes before a meal. In another
embodiment, the Exenatide formulation as described herein is taken
at least 30 minutes before a meal. In another embodiment, the
Exenatide formulation as described herein is taken at least 45
minutes before a meal. In another embodiment, the Exenatide
formulation as described herein is taken at least 60 minutes before
a meal. In another embodiment, the Exenatide formulation as
described herein is taken at least 75 minutes before a meal. In
another embodiment, the Exenatide formulation as described herein
is taken at least 90 minutes before a meal. In another embodiment,
the Exenatide formulation as described herein is taken at least 100
minutes before a meal. In another embodiment, the Exenatide
formulation as described herein is taken at least 120 minutes
before a meal. In another embodiment, the Exenatide formulation as
described herein is taken at least 150 minutes before a meal. In
another embodiment, the Exenatide formulation as described herein
is taken at least 180 minutes before a meal.
In another embodiment, the Exenatide formulation as described
herein reduces the side effects associated with an injectable
dosage form comprising Exenatide. In another embodiment, the
Exenatide formulation as described herein reduces nausea as a side
effect which is associated with an injectable dosage form
comprising Exenatide. In another embodiment, the Exenatide
formulation as described herein does not induce nausea as a side
effect which is associated with an injectable dosage form
comprising Exenatide.
In another embodiment, the use of sustained release dosage forms
(e.g. sustained release micro encapsulation) enables the treatment
frequency to be reduced to once or twice a day. In another
embodiment, the exenatide dosage is increased correspondingly with
decreasing frequency of administration.
Each amount of exenatide represents a separate embodiment of the
present invention. Methods of measuring exenatide levels are well
known in the art. In another embodiment, levels of C peptide are
measured as well, to determine the relative contributions of
endogenous and exogenous exenatide to observed rises in exenatide
levels. In another embodiment, exenatide levels are measured by any
other method known in the art. Each possibility represents a
separate embodiment of the present invention.
In some embodiments, omega-3 fatty acid is derived from vegetable
sources such as the seeds of chia, perilla, flax, walnuts,
purslane, lingonberry, seabuckthorn, and hemp. In some embodiments,
omega-3 fatty acids can also be found in the fruit of the acai
palm. In another embodiment, the omega-3 fatty acid has been
provided in the form of a synthetic omega-3 fatty acid. In one
embodiment, the omega-3 fatty acid of methods and compositions of
the present invention has been provided to the composition in the
form of a fish oil. In another embodiment, the omega-3 fatty acid
has been provided in the form of canola oil. In another embodiment,
the omega-3 fatty acid has been provided in the form of flaxseed
oil. In another embodiment, the omega-3 fatty acid has been
provided in the form of any other omega-3 fatty acid-rich source
known in the art. In another embodiment, the omega-3 fatty acid has
been provided in the form of a synthetic omega-3 fatty acid. Each
form of omega-3 fatty acids represents a separate embodiment of the
present invention.
In another embodiment, the omega-3 fatty acid of methods and
compositions of the present invention is an omega-3 polyunsaturated
fatty acid. In another embodiment, the omega-3 fatty acid is DHA,
an omega-3, polyunsaturated, 22-carbon fatty acid also referred to
as 4, 7, 10, 13, 16, 19-docosahexaenoic acid. In another
embodiment, the omega-3 fatty acid is .alpha.-linolenic acid (9,
12, 15-octadecatrienoic acid). In another embodiment, the omega-3
fatty acid is stearidonic acid (6, 9, 12, 15-octadecatetraenoic
acid). In another embodiment, the omega-3 fatty acid is
eicosatrienoic acid (ETA; 11, 14, 17-eicosatrienoic acid). In
another embodiment, the omega-3 fatty acid is eicsoatetraenoic acid
(8, 11, 14, 17-eicosatetraenoic acid). In one embodiment, the
omega-3 fatty acid is eicosapentaenoic acid (EPA; 5, 8, 11, 14,
17-eicosapentaenoic acid). In another embodiment, the omega-3 fatty
acid is eicosahexaenoic acid (also referred to as "EPA"; 5, 7, 9,
11, 14, 17-eicosahexaenoic acid). In another embodiment, the
omega-3 fatty acid is docosapentaenoic acid (DPA; 7, 10, 13, 16,
19-docosapenatenoic acid). In another embodiment, the omega-3 fatty
acid is tetracosahexaenoic acid (6, 9, 12, 15, 18,
21-tetracosahexaenoic acid). In another embodiment, the omega-3
fatty acid is any other omega-3 fatty acid known in the art. Each
omega-3 fatty acid represents a separate embodiment of the present
invention.
In another embodiment, compositions of the present invention
further comprise a protease inhibitor. In another embodiment,
compositions of the present invention further comprise a
combination of at least two protease inhibitors. As provided
herein, protease inhibitors enhance the ability of omega-3 fatty
acids to protect exenatide and facilitate its absorption in the
intestine.
In some embodiments, protease inhibitor inhibits the function of
peptidases. In one embodiment, protease inhibitors enhance the
ability of omega-3 fatty acids to protect the protein of the
present invention and facilitate its absorption in the intestine.
In some embodiments, the protease inhibitor of the present
invention is a protein. In some embodiments, protease inhibitors
comprise cysteine protease inhibitors, serine protease inhibitors
(serpins), trypsin inhibitors, threonine protease inhibitors,
aspartic protease inhibitors, metallo protease inhibitors. In some
embodiments, protease inhibitors comprise suicide inhibitor,
transition state inhibitor, or chelating agents.
In one embodiment, the protease inhibitor is soybean trypsin
inhibitor (SBTI). In another embodiment, the protease inhibitor is
AEBSF-HCl. In another embodiment, the inhibitor is
(epsilon)-aminocaproic acid. In another embodiment, the inhibitor
is (alpha) 1-antichymotypsin. In another embodiment, the inhibitor
is antipain. In another embodiment, the inhibitor is antithrombin
III. In another embodiment, the inhibitor is (alpha) 1-antitrypsin
([alpha] 1-proteinase inhibitor). In another embodiment, the
inhibitor is APMSF-HCl (4-amidinophenyl-methane sulfonyl-fluoride).
In another embodiment, the inhibitor is sprotinin. In another
embodiment, the inhibitor is benzamidine-HCl. In another
embodiment, the inhibitor is chymostatin. In another embodiment,
the inhibitor is DPP (diisopropylfluoro-phosphate). In another
embodiment, the inhibitor is leupeptin. In another embodiment, the
inhibitor is PEFABLOC.RTM. SC (4-(2-Aminoethyl)-benzenesulfonyl
fluoride hydrochloride). In another embodiment, the inhibitor is
PMSF (phenylmethyl sulfonyl fluoride). In another embodiment, the
inhibitor is TLCK (1-Chloro-3-tosylamido-7-amino-2-heptanone HCl).
In another embodiment, the inhibitor is TPCK
(1-Chloro-3-tosylamido-4-phenyl-2-butanone). In another embodiment,
the inhibitor is trypsin inhibitor from egg white (Ovomucoid). In
another embodiment, the inhibitor is trypsin inhibitor from
soybean. In another embodiment, the inhibitor is aprotinin. In
another embodiment, the inhibitor is pentamidine isethionate. In
another embodiment, the inhibitor is pepstatin. In another
embodiment, the inhibitor is guanidium. In another embodiment, the
inhibitor is alpha2-macroglobulin. In another embodiment, the
inhibitor is a chelating agent of zinc. In another embodiment, the
inhibitor is iodoacetate. In another embodiment, the inhibitor is
zinc. Each possibility represents a separate embodiment of the
present invention.
In another embodiment, the amount of protease inhibitor utilized in
methods and compositions of the present invention is 0.1 mg/dosage
unit. In another embodiment, the amount of protease inhibitor is
0.2 mg/dosage unit. In another embodiment, the amount is 0.3
mg/dosage unit. In another embodiment, the amount is 0.4 mg/dosage
unit. In another embodiment, the amount is 0.6 mg/dosage unit. In
another embodiment, the amount is 0.8 mg/dosage unit. In another
embodiment, the amount is 1 mg/dosage unit. In another embodiment,
the amount is 1.5 mg/dosage unit. In another embodiment, the amount
is 2 mg/dosage unit. In another embodiment, the amount is 2.5
mg/dosage unit. In another embodiment, the amount is 3 mg/dosage
unit. In another embodiment, the amount is 5 mg/dosage unit. In
another embodiment, the amount is 7 mg/dosage unit. In another
embodiment, the amount is 10 mg/dosage unit. In another embodiment,
the amount is 12 mg/dosage unit. In another embodiment, the amount
is 15 mg/dosage unit. In another embodiment, the amount is 20
mg/dosage unit. In another embodiment, the amount is 30 mg/dosage
unit. In another embodiment, the amount is 50 mg/dosage unit. In
another embodiment, the amount is 70 mg/dosage unit. In another
embodiment, the amount is 100 mg/dosage unit.
In another embodiment, the amount of protease inhibitor is 0.1-1
mg/dosage unit. In another embodiment, the amount of protease
inhibitor is 0.2-1 mg/dosage unit. In another embodiment, the
amount is 0.3-1 mg/dosage unit. In another embodiment, the amount
is 0.5-1 mg/dosage unit. In another embodiment, the amount is 0.1-2
mg/dosage unit. In another embodiment, the amount is 0.2-2
mg/dosage unit. In another embodiment, the amount is 0.3-2
mg/dosage unit. In another embodiment, the amount is 0.5-2
mg/dosage unit. In another embodiment, the amount is 1-2 mg/dosage
unit. In another embodiment, the amount is 1-10 mg/dosage unit. In
another embodiment, the amount is 2-10 mg/dosage unit. In another
embodiment, the amount is 3-10 mg/dosage unit. In another
embodiment, the amount is 5-10 mg/dosage unit. In another
embodiment, the amount is 1-20 mg/dosage unit. In another
embodiment, the amount is 2-20 mg/dosage unit. In another
embodiment, the amount is 3-20 mg/dosage unit. In another
embodiment, the amount is 5-20 mg/dosage unit. In another
embodiment, the amount is 10-20 mg/dosage unit. In another
embodiment, the amount is 10-100 mg/dosage unit. In another
embodiment, the amount is 20-100 mg/dosage unit. In another
embodiment, the amount is 30-100 mg/dosage unit. In another
embodiment, the amount is 50-100 mg/dosage unit. In another
embodiment, the amount is 10-200 mg/dosage unit. In another
embodiment, the amount is 20-200 mg/dosage unit. In another
embodiment, the amount is 30-200 mg/dosage unit. In another
embodiment, the amount is 50-200 mg/dosage unit. In another
embodiment, the amount is 100-200 mg/dosage unit.
In another embodiment, the amount of protease inhibitor utilized in
methods and compositions of the present invention is 1000 k.i.u.
(kallikrein inactivator units)/pill. In another embodiment, the
amount is 10 k.i.u./dosage units. In another embodiment, the amount
is 12 k.i.u./dosage unit. In another embodiment, the amount is 15
k.i.u./dosage units. In another embodiment, the amount is 20
k.i.u./dosage unit. In another embodiment, the amount is 30
k.i.u./dosage units. In another embodiment, the amount is 40
k.i.u./dosage unit. In another embodiment, the amount is 50
k.i.u./dosage units. In another embodiment, the amount is 70
k.i.u./dosage units. In another embodiment, the amount is 100
k.i.u./dosage unit. In another embodiment, the amount is 150
k.i.u./dosage unit. In another embodiment, the amount is 200
k.i.u./dosage units. In another embodiment, the amount is 300
k.i.u./dosage unit. In another embodiment, the amount is 500
k.i.u./dosage units. In another embodiment, the amount is 700
k.i.u./dosage units. In another embodiment, the amount is 1500
k.i.u./dosage unit. In another embodiment, the amount is 3000
k.i.u./dosage unit. In another embodiment, the amount is 4000
kith/dosage unit. In another embodiment, the amount is 5000
k.i.u./dosage unit.
Each amount of protease inhibitor represents a separate embodiment
of the present invention.
In another embodiment, the protease targeted by the protease
inhibitor of methods and compositions of the present invention is a
serine protease. In another embodiment, the protease is trypsin. In
another embodiment, the protease is chymotrypsin. In another
embodiment, the protease is carboxypeptidase. In another
embodiment, the protease is aminopeptidase. In another embodiment,
the protease is any other protease that functions in the duodenum
or the small intestine. Each possibility represents a separate
embodiment of the present invention.
In another embodiment, compositions of the present invention
further comprise a substance that enhances absorption of the
exenatide through an intestinal mucosal barrier. Such a substance
is referred to herein as an "enhancer." As provided herein,
enhancers, when used together with omega-3 fatty acids, enhance the
ability of exenatide to be absorbed in the intestine.
In one embodiment, the enhancer is didecanoylphosphatidylcholine
(DDPC). In one embodiment, the enhancer is a chelating agent such
as ethylenediaminetetraacetic acid (EDTA) or egtazic acid EGTA. In
a preferred embodiment, EDTA is sodium-EDTA. In some embodiments,
the enhancer is NO donor. In some embodiments, the enhancer is a
bile acid, glycine-conjugated form of a bile acid, or an alkali
metal salt. In one embodiment, absorption enhancement is achieved
through utilization of a combination of .alpha.-galactosidase and
.beta.-mannanase. In some embodiments, the enhancer is a fatty acid
such as sodium caprate. In one embodiment, the enhancer is sodium
glycocholate. In one embodiment, the enhancer is sodium salicylate.
In one embodiment, the enhancer is
n-dodecyl-.beta.-D-maltopyranoside. In some embodiments,
surfactants serve as absorption enhancer. In one embodiment, the
enhancer is chitisan such as N,N,N-trimethyl chitosan chloride
(TMC).
In one embodiment, NO donors of the present invention comprise
3-(2-Hydroxy-1-(1-methylethyl)-2-nitrosohydrazino)-1-propanamine,
N-ethyl-2-(1-ethyl-hydroxy-2-nitrosohydrazino)-ethanamine, or
S-Nitroso-N-acetylpenicillamine
In another embodiment, the bile acid is cholic acid. In another
embodiment, the bile acid is chenodeoxycholic acid. In another
embodiment, the bile acid is taurocholic acid. In another
embodiment, the bile acid is taurochenodeoxycholic acid. In another
embodiment, the bile acid is glycocholic acid. In another
embodiment, the bile acid is glycochenocholic acid. In another
embodiment, the bile acid is 3 beta-monohydroxychloric acid. In
another embodiment, the bile acid is lithocholic acid. In another
embodiment, the bile acid is 5 beta-cholanic acid. In another
embodiment, the bile acid is 3,12-diol-7-one-5 beta-cholanic acid.
In another embodiment, the bile acid is 3
alpha-hydroxy-12-ketocholic acid. In another embodiment, the bile
acid is 3 beta-hydroxy-12-ketocholic acid. In another embodiment,
the bile acid is 12 alpha-3 beta-dihydrocholic acid. In another
embodiment, the bile acid is ursodesoxycholic acid.
In one embodiment, the enhancer is a nonionic surfactant. In one
embodiment, the enhancer is a nonionic polyoxyethylene ether
surface active agent (e.g one having an HLB value of 6 to 19,
wherein the average number of polyoxyethylene units is 4 to 30). In
another embodiment, the enhancer is an anionic surface active
agent. In another embodiment, the enhancer is a cationic surface
active, agent. In another embodiment, the enhancer is an ampholytic
surface active agent. In one embodiment, zwitteruionic surfactants
such as acylcarnitines serve as absorption enhancers.
In another embodiment, the amount of enhancer utilized in methods
and compositions of the present invention is 0.1 mg/dosage unit. In
another embodiment, the amount of enhancer is 0.2 mg/dosage unit.
In another embodiment, the amount is 0.3 mg/dosage unit. In another
embodiment, the amount is 0.4 mg/dosage unit. In another
embodiment, the amount is 0.6 mg/dosage unit. In another
embodiment, the amount is 0.8 mg/dosage unit. In another
embodiment, the amount is 1 mg/dosage unit. In another embodiment,
the amount is 1.5 mg/dosage unit. In another embodiment, the amount
is 2 mg/dosage unit. In another embodiment, the amount is 2.5
mg/dosage unit. In another embodiment, the amount is 3 mg/dosage
unit. In another embodiment, the amount is 5 mg/dosage unit. In
another embodiment, the amount is 7 mg/dosage unit. In another
embodiment, the amount is 10 mg/dosage unit. In another embodiment,
the amount is 12 mg/dosage unit. In another embodiment, the amount
is 15 mg/dosage unit. In another embodiment, the amount is 20
mg/dosage unit. In another embodiment, the amount is 30 mg/dosage
unit. In another embodiment, the amount is 50 mg/dosage unit. In
another embodiment, the amount is 70 mg/dosage unit. In another
embodiment, the amount is 100 mg/dosage unit.
In another embodiment, the amount of enhancer is 0.1-1 mg/dosage
unit. In another embodiment, the amount of enhancer is 0.2-1
mg/dosage unit. In another embodiment, the amount is 0.3-1
mg/dosage unit. In another embodiment, the amount is 0.5-1
mg/dosage unit. In another embodiment, the amount is 0.1-2
mg/dosage unit. In another embodiment, the amount is 0.2-2
mg/dosage unit. In another embodiment, the amount is 0.3-2
mg/dosage unit. In another embodiment, the amount is 0.5-2
mg/dosage unit. In another embodiment, the amount is 1-2 mg/dosage
unit. In another embodiment, the amount is 1-10 mg/dosage unit. In
another embodiment, the amount is 2-10 mg/dosage unit. In another
embodiment, the amount is 3-10 mg/dosage unit. In another
embodiment, the amount is 5-10 mg/dosage unit. In another
embodiment, the amount is 1-20 mg/dosage unit. In another
embodiment, the amount is 2-20 mg/dosage unit. In another
embodiment, the amount is 3-20 mg/dosage unit. In another
embodiment, the amount is 5-20 mg/dosage unit. In another
embodiment, the amount is 10-20 mg/dosage unit. In another
embodiment, the amount is 10-100 mg/dosage unit. In another
embodiment, the amount is 20-100 mg/dosage unit. In another
embodiment, the amount is 30-100 mg/dosage unit. In another
embodiment, the amount is 50-100 mg/dosage unit. In another
embodiment, the amount is 10-200 mg/dosage unit. In another
embodiment, the amount is 20-200 mg/dosage unit. In another
embodiment, the amount is 30-200 mg/dosage unit. In another
embodiment, the amount is 50-200 mg/dosage unit. In another
embodiment, the amount is 100-200 mg/dosage unit.
Each type and amount of enhancer represents a separate embodiment
of the present invention.
In another embodiment, compositions of the present invention
further comprise a coating that inhibits digestion of the
composition in the stomach of a subject.
In one embodiment, coating inhibits digestion of the composition in
the stomach of a subject. In one embodiment, the coated dosage
forms of the present invention release drug when pH move towards
alkaline range. In one embodiment, coating is a monolayer, wherein
in other embodiments coating applied in multilayers. In one
embodiment, coating is a bioadhesive polymer that selectively binds
the intestinal mucosa and thus enables drug release in the
attachment site. In one embodiment, the enteric coating is an
enteric film coating. In some embodiment, coating comprises
biodegradable polysaccharide, chitosan, aquateric aqueous, aquacoat
ECD, azo polymer, cellulose acetate phthalate, cellulose acetate
trimelliate, hydroxypropylmethyl cellulose phthalate, gelatin, poly
vinyl acetate phthalate, hydrogel, pulsincap, or a combination
thereof. In one embodiment, pH sensitive coating will be used
according to the desired release site and/or profile as known to
one skilled in the art.
In one embodiment, the coating is an enteric coating. Methods for
enteric coating are well known in the art, and are described, for
example, in Siepmann F, Siepmann J et al, Blends of aqueous polymer
dispersions used for pellet coating: importance of the particle
size. J Control Release 2005; 105(3): 226-39; and Huyghebaert N,
Vermeire A, Remon J P. In vitro evaluation of coating polymers for
enteric coating and human ileal targeting. Int J Pharm 2005;
298(1): 26-37. Each method represents a separate embodiment of the
present invention.
In another embodiment, Eudragit.RTM., an acrylic polymer, is used
as the enteric coating. The use of acrylic polymers for the coating
of pharmaceutical preparations is well known in the art. Eudragit
Acrylic Polymers have been shown to be safe, and are neither
absorbed nor metabolized by the body, but rather are
eliminated.
In another embodiment, the coating is a gelatin coating. In another
embodiment, microencapsulation is used to protect the exenatide
against decomposition in the stomach. Methods for applying a
gelatin coating and for microencapsulation are well known in the
art. Each method represents a separate embodiment of the present
invention.
In another embodiment, the coating is a film-coating. In another
embodiment, the coating is ethylcellulose. In another embodiment,
the coating is a water-based dispersion of ethylcellulose, e.g.
hydroxypropylmethylcelullose (HPMC) E15. In another embodiment, the
coating is a gastro-resistant coatings, e.g. a polymer containing
carboxylic acid groups as a functional moiety. In another
embodiment, the coating is a monolithic matrix. In another
embodiment, the coating is a cellulose ether (e.g. hypromellose
(HPMC). Each type of coating represents a separate embodiment of
the present invention.
In another embodiment, a multiparticulate dosage forms is used to
inhibit digestion of the composition in the stomach.
Each type of coating, dosage form, etc, that inhibits digestion of
the composition in the stomach represents a separate embodiment of
the present invention.
In another embodiment, the present invention provides a method for
oral or rectal administration of a exenatide to a subject, whereby
a substantial fraction of the exenatide retains its activity after
absorption through an intestinal mucosal barrier or rectal mucosal
bather of the subject, comprising administering orally or rectally
to the subject a pharmaceutical composition comprising exenatide
and a protease inhibitor, thereby orally or rectally administering
exenatide to a subject. In another embodiment, the present
invention provides a method for oral or rectal administration of a
exenatide to a subject, whereby a substantial fraction of the
exenatide retains its activity after absorption through an
intestinal mucosal barrier or rectal mucosal barrier of the
subject, comprising administering orally or rectally to the subject
a pharmaceutical composition comprising exenatide and an omega-3
fatty acid.
In another embodiment, the present invention provides a method for
treating diabetes mellitus in a subject, comprising administering
orally or rectally to the subject a pharmaceutical composition
comprising an exenatide and an omega-3 fatty acid, thereby treating
diabetes mellitus.
In one embodiment, the diabetes mellitus is Type I diabetes. In
another embodiment, the diabetes mellitus is Type II diabetes. In
another embodiment, the diabetes mellitus is insulin-dependent
diabetes. In another embodiment, the diabetes mellitus is
non-insulin-dependent diabetes. In another embodiment, the diabetes
mellitus is any other type of diabetes known in the art. Each
possibility represents a separate embodiment of the present
invention.
In one embodiment, six treatments a day of the exenatide
composition are administered. In one embodiment, five treatments a
day of the exenatide composition are administered. In another
embodiment, four treatments a day of the exenatide composition are
administered. In another embodiment, three treatments a day of the
exenatide composition are administered. In another embodiment, two
treatments a day are administered. In another embodiment, four
treatments a day are administered. In another embodiment, one
treatment a day is administered. In another embodiment, more than
four treatments a day are administered. Each possibility represents
a separate embodiment of the present invention.
In another embodiment, following oral or rectal exenatide
administration to patients with type 2 diabetes, exenatide plasma
concentrations rise rapidly and reach median peak plasma
concentrations in 1.5-3 hours. In another embodiment, following
oral or rectal administration exenatide concentrations are
measurable for approximately 10 hours postdose.
In another embodiment, following 2 days of exenatide oral or rectal
administration a reduction in mean HbA1C is observed. In another
embodiment, following 3 days of exenatide oral or rectal
administration a reduction in mean HbA1C is observed. In another
embodiment, following 4 days of exenatide oral or rectal
administration a reduction in mean HbA1C is observed. In another
embodiment, following 5 days of exenatide oral or rectal
administration a reduction in mean HbA1C is observed.
In another embodiment, exenatide 20-300 mcg dosed administered
before a meal results in reduction in postprandial glucose
excursions. Additionally, the incidence of transient low blood
glucose was higher when patients received exenatide administered
after a meal. In another embodiment, exenatide 20-300 mcg should be
administered within the 180 minute period before the meal. In
another embodiment, exenatide 20-300 mcg should be administered
within the 150 minute period before the meal. In another
embodiment, exenatide 20-300 mcg should be administered within the
120 minute period before the meal. In another embodiment, exenatide
20-300 mcg should be administered within the 90 minute period
before the meal. In another embodiment, exenatide 20-300 mcg should
be administered within the 60 minute period before the meal. In
another embodiment, exenatide 20-300 meg should be administered
within the 30 minute period before the meal.
In another embodiment, Exenatide is indicated for treatment of type
1 diabetes mellitus. In another embodiment, Exenatide is indicated
for treatment of type 2 diabetes mellitus (DM) in combination with
metformin, and/or sulfonylureas in patients who have not achieved
adequate glycemic control on maximally tolerated doses. In another
embodiment, Exenatide is indicated for treatment of type 2 diabetes
mellitus (DM) in combination with metformin. In another embodiment,
Exenatide is indicated for treatment of type 2 diabetes mellitus
(DM) in combination with sulfonylureas. In another embodiment,
Exenatide of the invention is formulated in a single dosage four in
combination with a sulfonylurea. In another embodiment, Exenatide
of the invention is formulated in a single dosage form in
combination with metformi.
In another embodiment, Exenatide formulations of the present
invention are useful in view of their pharmacological properties.
In another embodiment, Exenatide formulations of the present
invention possess glucagon levels reduction activity. In another
embodiment, Exenatide formulations of the present invention
suppress glucagon secretion. In another embodiment, Exenatide
formulations of the present invention suppress glucagon secretion,
as evidenced by the ability to lower glucagon levels in animals and
humans. In another embodiment, Exenatide formulations of the
present invention are used to treat conditions or diseases that can
be alleviated by reducing glucagon levels and suppressing glucagon
secretion.
The compounds referenced above may form salts with various
inorganic and organic acids and bases. Such salts include salts
prepared with organic and inorganic acids, for example, HCl, HBr,
H.sub.2SO.sub.4, H.sub.3PO.sub.4, trifluoroacetic acid, acetic
acid, formic acid, methanesulfonic acid, toluenesulfonic acid,
maleic acid, fumaric acid and camphorsulfonic acid. Salts prepared
with bases include ammonium salts, alkali metal salts, e.g., sodium
and potassium salts, and alkali earth salts, e.g., calcium and
magnesium salts. Acetate, hydrochloride, and trifluoroacetate salts
are preferred. The salts may be formed by conventional means, as by
reacting the free acid or base forms of the product with one or
more equivalents of the appropriate base or acid in a solvent or
medium in which the salt is insoluble, or in a solvent such as
water which is then removed in vacuo or by freeze-drying or by
exchanging the ions of an existing salt for another ion on a
suitable ion exchange resin.
Obesity and Hypernutrition
In another embodiment, Exenatide formulations of the present
invention are useful in preventing obesity. In another embodiment,
Exenatide formulations of the present invention are useful in
preventing excess adipose tissue. In another embodiment, Exenatide
formulations of the present invention are useful in preventing
health risks associated with enhanced food intake. In another
embodiment, Exenatide formulations of the present invention are
useful in preventing diseases associated with obesity such as Type
2 diabetes, increased cardiac risk, hypertension, atherosclerosis,
degenerative arthritis, and increased incidence of complications of
surgery involving general anesthesia. In another embodiment,
Exenatide formulations of the present invention are useful in
treating diseases associated with obesity such as Type 2 diabetes,
increased cardiac risk, hypertension, atherosclerosis, degenerative
arthritis, and increased incidence of complications of surgery
involving general anesthesia. In another embodiment, Exenatide
formulations of the present invention are useful in reducing the
risk of developing diseases associated with obesity such as Type 2
diabetes, increased cardiac risk, hypertension, atherosclerosis,
degenerative arthritis, and increased incidence of complications of
surgery involving general anesthesia.
In another embodiment, Exenatide formulations of the present
invention are useful in controlling body weight. In another
embodiment, Exenatide formulations of the present invention are
useful in maintaining body weight. In another embodiment, Exenatide
formulations of the present invention are useful in reducing food
intake. In another embodiment, Exenatide formulations of the
present invention are useful in reducing food intake in obese
subjects. In another embodiment, Exenatide formulations of the
present invention are useful in decreasing the plasma glucose
level. In another embodiment, Exenatide formulations of the present
invention are useful in decreasing the plasma lipid level. In
another embodiment, Exenatide formulations of the present invention
are useful in preventing hypernutrition. In another embodiment,
Exenatide formulations of the present invention are useful in
treating hypernutrition.
In another embodiment, it can be appreciated that an effective
means to reduce food intake is a major challenge and a superior
method of treatment would be of great utility. Such a method, and
compounds and compositions comprising Exenatide which are useful
therefore, have been invented and are described and claimed herein.
Any of the methods of the present invention may utilize, in various
embodiments, any of the compositions of the present invention.
In another embodiment, the present invention provides a composition
for oral or rectal administration of exenatide, comprising an
exenatide protein and a protease inhibitor, whereby a substantial
fraction of the exenatide retains the enzymatic activity after
absorption through an intestinal mucosal barrier of a subject. In
another embodiment, the present invention provides a composition
for oral or rectal administration of exenatide, comprising an
exenatide protein and an enhancer, whereby a substantial fraction
of the exenatide retains the enzymatic activity after absorption
through an intestinal mucosal barrier of a subject. In another
embodiment, the present invention provides a composition for oral
or rectal administration of exenatide, comprising an exenatide
protein and an omega-3 fatty acid, whereby a substantial fraction
of the exenatide retains the enzymatic activity after absorption
through an intestinal mucosal barrier of a subject.
In one embodiment, the present invention provides the use of
exenatide and a protease inhibitor in the manufacture of a
medicament for oral or rectal administration of exenatide to a
subject, whereby a substantial fraction of exenatide retains its
activity after absorption through an intestinal mucosal barrier of
the subject. In one embodiment, the present invention provides the
use of exenatide and an enhancer in the manufacture of a medicament
for oral or rectal administration of exenatide to a subject,
whereby a substantial fraction of exenatide retains its activity
after absorption through an intestinal mucosal barrier of the
subject. In one embodiment, the present invention provides the use
of exenatide and an omega-3 fatty acid in the manufacture of a
medicament for oral or rectal administration of exenatide to a
subject, whereby a substantial fraction of exenatide retains its
activity after absorption through an intestinal mucosal barrier of
the subject.
In one embodiment, the present invention provides the use of an
exenatide protein and a protease inhibitor in the manufacture of a
medicament for treating diabetes mellitus in a subject. In one
embodiment, the present invention provides the use of an exenatide
protein and an enhancer in the manufacture of a medicament for
treating diabetes mellitus in a subject. In one embodiment, the
present invention provides the use of an exenatide protein and an
omega-3 fatty acid in the manufacture of a medicament for treating
diabetes mellitus in a subject.
In another embodiment, different constituents of compositions of
the present composition are absorbed at different rates from the
intestinal lumen into the blood stream. The absorption of the bile
acid, in one embodiment, is significantly faster than the
absorption of exenatide.
For this reason, in another embodiment, a drug regimen involving
ingestion of a pair of pills at spaced intervals, e.g., a second
pill containing a higher concentration of enhancer is taken at a
defined interval (e.g. 30 minutes) after the first pill. In another
embodiment, certain of the constituents are microencapsulated to
enhance the absorption of the exenatide into the system.
In one embodiment, a treatment protocol of the present invention is
therapeutic. In another embodiment, the protocol is prophylactic.
Each possibility represents a separate embodiment of the present
invention.
In another embodiment, the present invention provides oral or
rectal administration of exenatide which is comparable to previous
injectable dosage forms of exenatide. In another embodiment, the
present invention provides superior oral or rectal administration
of exenatide compared to previous injectable dosage forms of
exenatide. In another embodiment, oral or rectal administration of
exenatide is cheaper than injectable dosage forms of exenatide. In
another embodiment, oral or rectal administration of exenatide
provides better compliance than injectable dosage forms of
exenatide. In another embodiment, oral or rectal administration of
exenatide provides fewer side effects than injectable dosage forms
of exenatide.
In another embodiment, solid carriers/diluents for use in methods
and compositions of the present invention include, but are not
limited to, a gum, a starch (e.g. corn starch, pregeletanized
starch), a sugar (e.g., lactose, mannitol, sucrose, dextrose), a
cellulosic material (e.g. microcrystalline cellulose), an acrylate
(e.g. polymethylacrylate), calcium carbonate, magnesium oxide,
talc, or mixtures thereof.
In another embodiment, the compositions further comprise binders
(e.g. acacia, cornstarch, gelatin, carbomer, ethyl cellulose, guar
gum, hydroxypropyl cellulose, hydroxypropyl methyl cellulose,
povidone), disintegrating agents (e.g. cornstarch, potato starch,
alginic acid, silicon dioxide, croscarmelose sodium, crospovidone,
guar gum, sodium starch glycolate), buffers (e.g., Tris-HCL,
acetate, phosphate) of various pH and ionic strength, additives
such as albumin or gelatin to prevent absorption to surfaces,
detergents (e.g., Tween 20, Tween 80, Pluronic F68, bile acid
salts), protease inhibitors, surfactants (e.g. sodium lauryl
sulfate), permeation enhancers, solubilizing agents (e.g.,
glycerol, polyethylene glycerol), anti-oxidants (e.g., ascorbic
acid, sodium metabisulfite, butylated hydroxyanisole), stabilizers
(e.g. hydroxypropyl cellulose, hyroxypropylmethyl cellulose),
viscosity increasing agents (e.g. carbomer, colloidal silicon
dioxide, ethyl cellulose, guar gum), sweeteners (e.g. aspartame,
citric acid), preservatives (e.g., Thimerosal, benzyl alcohol,
parabens), lubricants (e.g. stearic acid, magnesium stearate,
polyethylene glycol, sodium lauryl sulfate), flow-aids (e.g.
colloidal silicon dioxide), plasticizers (e.g. diethyl phthalate,
triethyl citrate), emulsifiers (e.g. carbomer, hydroxypropyl
cellulose, sodium lauryl sulfate), polymer coatings (e.g.,
poloxamers or poloxamines), coating and film forming agents (e.g.
ethyl cellulose, acrylates, polymethacrylates) and/or adjuvants.
Each of the above excipients represents a separate embodiment of
the present invention.
In some embodiments, the dosage forms of the present invention are
formulated to achieve an immediate release profile, an extended
release profile, or a delayed release profile. In some embodiments,
the release profile of the composition is determined by using
specific excipients that serve for example as binders,
disintegrants, fillers, or coating materials. In one embodiment,
the composition will be formulated to achieve a particular release
profile as known to one skilled in the art.
In another embodiment, the oral or rectal formulation of the
present invention is further formulated to accomplish sustained
release of Exenatide. In another embodiment, the oral or rectal
formulation of the present invention is further formulated to
accomplish immediate release of Exenatide. In another embodiment,
the oral or rectal formulation of the present invention is further
formulated to accomplish slow release of Exenatide. In another
embodiment, the oral or rectal formulation of the present invention
is further formulated to accomplish a combination of sustained and
immediate release of Exenatide. In another embodiment, the release
rate of Exenatide can be manipulated by various foimulatory methods
known to one of skill in the art of the invention.
In one embodiment, the composition is formulated as an oral dosage
form. In one embodiment, the composition is a solid oral dosage
form comprising tablets, chewable tablets, suppositories, or
capsules. In one embodiment the capsules are soft gelatin
capsules.
In other embodiments, controlled- or sustained-release coatings
utilized in methods and compositions of the present invention
include formulation in lipophilic depots (e.g. fatty acids, waxes,
oils).
The compositions also include, in another embodiment, incorporation
of the active material into or onto particulate preparations of
polymeric compounds such as polylactic acid, polglycolic acid,
hydrogels, etc, or onto liposomes, microemulsions, micelles,
unilamellar or multilamellar vesicles, erythrocyte ghosts, or
spheroplasts.) Such compositions will influence the physical state,
solubility, stability, rate of in vivo release, and rate of in vivo
clearance. In another embodiment, particulate compositions of the
active ingredients are coated with polymers (e.g. poloxamers or
poloxamines)
In another embodiment, the compositions containing the exenatide
and omega-3 fatty acid are delivered in a vesicle, e.g. a liposome
(see Langer, Science 249:1527-1533 (1990); Treat et al., in
Liposomes in the Therapy of Infectious Disease and Cancer,
Lopez-Berestein and Fidler (eds.), Liss, New York, pp. 353-365
(1989); Lopez-Berestein, ibid., pp. 317-327; see generally
ibid).
The preparation of pharmaceutical compositions that contain an
active component, for example by mixing, granulating, or
tablet-forming processes, is well understood in the art. The active
therapeutic ingredient is often mixed with excipients that are
pharmaceutically acceptable and compatible with the active
ingredient. For oral administration, the active ingredients of
compositions of the present invention are mixed with additives
customary for this purpose, such as vehicles, stabilizers, or inert
diluents, and converted by customary methods into suitable forms
for administration, such as tablets, coated tablets, hard or soft
gelatin capsules, aqueous, alcoholic or oily solutions.
In another embodiment, the formulation of the present invention
further comprises a base. In another embodiment, the base used in
the pharmaceutical composition of this invention may be those which
are known as bases of suppositories for intrarectal administration.
In some embodiments, base include oils and fats comprising
triglycerides as main companothernts such as cacao butter, palm
fat, palm kernel oil, coconut oil, fractionated coconut oil, lard
and WITEPSOL.RTM., waxes such as lanolin and reduced lanolin;
hydrocarbons such as Vaseline, squalene, squalane and liquid
paraffin; long to medium chain fatty acids such as caprylic acid,
lauric acid, stearic acid and oleic acid; higher alcohols such as
lauryl alcohol, cetanol and stearyl alcohol; fatty acid esters such
as butyl stearate and dilauryl malonate; medium to long chain
carboxylic acid esters of glycerin such as triolein and tristearin;
glycerin-substituted carboxylic acid esters such as glycerin
acetoacetate; and polyethylene glycols and its derivatives such as
macrogols and cetomacrogol. They may be used either singly or in
combination of two or more.
In some embodiments, the composition of this invention may further
include a surface-active agent, preservative, and coloring agent,
which are ordinarily used in suppositories.
In another embodiment, the unit dosage forms of the pharmaceutical
composition of this invention include a solid suppository having as
a base a solid fat which when administered to the rectum, becomes
flowable within the rectum, such as cacao butter and WITEPSOL, a
solid suppository having as a base a hydrophilic solid substance
which becomes flowable in the rectum in the same way, such as
macrogol, and a gelatin capsule suppository having a nomally liquid
substance (liquid at room temperature) such as neutral fatty acid
triglycerides and vegetable oils as a base and coated with a
gelatin film.
Each of the above additives, excipients, formulations and methods
of administration represents a separate embodiment of the present
invention.
In one embodiment, the term "treating" refers to curing a disease.
In another embodiment, "treating" refers to preventing a disease.
In another embodiment, "treating" refers to reducing the incidence
of a disease. In another embodiment, "treating" refers to
ameliorating symptoms of a disease. In another embodiment,
"treating" refers to inducing remission. In another embodiment,
"treating" refers to slowing the progression of a disease.
EXPERIMENTAL DETAILS SECTION
Animals
Male beagle dogs weighing about 9 kg were used for all experiments
described hereinbelow.
Example 1
Protection of Exenatide from Proteases and Successful
Administration Via the Duodenum in Dogs
Materials and Experimental Methods
Formulations
(1) A formulation containing 150 milligram (mg) Na-EDTA
(Sigma-Aldrich, St. Louis, Mo.), 125 mg soybean trypsin inhibitor
(SBTI; Sigma), 50 .mu.g exenatide, and 0.8 milliliter (ml) fish oil
was prepared.
A formulation containing 150 milligram (mg) Na-EDTA (Sigma-Aldrich,
St. Louis, Mo.), 125 mg soybean trypsin inhibitor (SBTI; Sigma),
100 .mu.g exenatide, and 0.8 milliliter (ml) fish oil was
prepared.
(3) A formulation containing 150 milligram (mg) Na-EDTA
(Sigma-Aldrich, St. Louis, Mo.), 125 mg soybean trypsin inhibitor
(SBTI; Sigma), 0.8 milliliter (ml) fish oil was prepared.
Results
To test whether exenatide can be protected from proteases and
absorbed via the duodenum, formulation 1 (treatment) or 3 (control)
were administered directly to the duodenum of about 9 kg beagle
dogs or by an endoscope to about 16 kg pigs.
All dogs and pigs were administered 40 ml of 50% glucose solution.
Blood glucose was measured every 5 minutes following
administration. As depicted below in Table 1, blood glucose levels
were significantly reduced in response to exenatide.
The ability of formula 1 to substantially reduce blood glucose
levels is also shown in FIG. 1 in dogs. Similar results were
obtained in pigs. Moreover, FIG. 3 shows that an oral dosage form
of Exendin-4_can replace injectable dosage forms of Exendin-4_(see
Example 2) in reducing blood glucose levels.
TABLE-US-00001 TABLE 1 Blood glucose concentrations following
administration of exenatide to the duodenum in experiment #1.
Glucose in milligrams/deciliter Glucose in milligrams/deciliter
Time (mg/dL) in dogs treated with (mg/dL) in dogs treated with
(min) formulation 1-Treatment formulation 3-Control 0 69 69 10 93
97 20 89 131 30 93 159 40 111 156 50 94 139 60 103 134 70 104 112
80 118 117 90 105 84 100 90 88 110 94 80 120 92 73
Thus, oral compositions comprising a protease inhibitor and Na-EDTA
can protect exenatide from proteases in the small intestine and
enable direct absorption of orally administered exenatide.
Example 2: Injectable Dosage Forms Compared to Rectal and Oral
Dosage Forms
Materials and Experimental Methods
Formulation
The following formulations were prepared: (1) An injectable
formulation comprising 2.5 .mu.g commercial byetta. (2) An
injectable formulation comprising 2.5 .mu.g GeneScript (Piscataway,
N.J.) byetta. (3) An oral formulation containing 150 milligram (mg)
Na-EDTA (Sigma-Aldrich, St. Louis, Mo.), 125 mg soybean trypsin
inhibitor (SBTI; Sigma), 50 .mu.g exenatide (GeneScript
(Piscataway, N.J.)) and 0.8 milliliter (ml) fish oil. (4) An oral
formulation containing 150 milligram (mg) Na-EDTA (Sigma-Aldrich,
St. Louis, Mo.), 125 mg soybean trypsin inhibitor (SBTI; Sigma),
0.8 milliliter (ml) fish oil. (5) A hard gelatin capsule (rectal)
containing 150 milligram (mg) Na-EDTA (Sigma-Aldrich, St. Louis,
Mo.), 125 mg soybean trypsin inhibitor (SBTI; Sigma), 50 .mu.g
exenatide (GeneScript (Piscataway, N.J.)) and in 0.8 milliliter
(ml) fish oil.
Results
To test the effectiveness of oral and rectal formulations
comprising exenatide, oral and rectal formulations were compared to
commercially available injectable formulations.
All dogs were administered 40 ml of 50% glucose solution. Blood
glucose was measured every 5 minutes following administration.
The results obtained show that oral (FIGS. 1 and 3) and rectal
(FIG. 2) dosage forms comprising Exendin-4 can unexpectedly replace
injectable dosage forms comprising Exendin-4_in terms of
controlling blood glucose levels for 2 hours after glucose
load.
These results further confirm the results of Example 1, showing
that compositions comprising a protease inhibitor and Na-EDTA can
protect exenatide from proteases in the small intestine and enable
direct absorption of orally administered exenatide.
The Exendin-4_used for the oral and rectal dosage forms was
obtained from GeneScript. The results presented (FIGS. 2 and 4)
show that Exendin-4_purchased from GeneScript is effective as the
commercial Exendin-4 (Eli Lilly, USA). In conclusion, the oral
and/or rectal routes of administration are favorable over the
injectable route of administration for many reasons that are known
to one of skill in the art. The unexpected results presented herein
demonstrate the ability to effectively administer Exendin-4_via an
oral or rectal route of administration.
Example 3: Enteral Administration of Exenatide-4; Proof of Concept
Pharmacodynamic Study in Dogs with a Formulation which Facilitates
the Absorption of Exenatide-4 Across Biological Membranes
Materials and Experimental Methods
Study was conducted in 4 beagle dogs with an average weight of 10
kg. All the dogs had a cannula residing in the jejunum through
which the drug was administered. After an overnight fast, the dogs
were given different doses of oral GLP-1 analogue or sc injection
of the analogue. Absorption of the GLP-1 analogue was assessed by
measuring the effect on glucose excursion following an oral glucose
load. Control experiment consisted of oral dosing without
administration of GLP-1 analogue. The interval between oral
administration and the oral glucose load was 30 minutes. The
primary efficacy end point was the glucose excursion above the
pre-OGTT glucose level over a 150 min interval (incremental area
under the curve (AUC).sub.0-150 min).
Results
Direct jejunal instillation of GLP-1 analogue significantly (ss)
curbed glucose excursion, post glucose load (both in comparison to
placebo and among the separate groups)
Results are shown in Table 2 and FIG. 4.
TABLE-US-00002 TABLE 2 OGTT--Glucose AUC.sub.0-150 min Mean .+-. SD
Placebo 8906 .+-. 1508 GLP-1 2.5 .mu.g sc 3656 .+-. 510 GLP-1 75
.mu.g PO 6292 .+-. 1043 GLP-1 100 .mu.g PO 5085 .+-. 931
Oral delivery of proteins and peptide drugs remains a major
challenge because of their unique physico-chemical and biologic
properties. As demonstrated herein the presented proprietary
technology can effectively and reliably transport macromolecules
including polypeptides and proteins such as exenatide across
biological membranes. Moreover, unexpectedly, the native compound
retained its biological activity on reaching the systemic
circulation.
Specifically, in the current study in dogs the results clearly
demonstrate that an oral GLP-1 analogue, exenatide, when
administered before a meal can blunt meal induced glycemic
excursion by about 40% as compared to parenteral exenatide 50%
blunting capacity. Pd effects are commonly used in a
semi-quantitative way to establish GLP-1 levels in studies
assessing DPP IV inhibition. In this study it have been
unexpectedly demonstrated that the GLP-1 analogue exenatide can be
created in an oral dosage form and that it could be ingested by the
patient shortly before a meal. These two qualities in a drug
significantly facilitate its acceptance among, patients and foster
higher patient compliance and adherence to the medication.
The results of this study in dogs showed that GLP-1 analogue
exenatide when combined with the delivery enhancers and formulated
in a capsule is absorbed and results in significant blunting of
glucose excursion after an oral OGTT. The Pharmacodynamic response
to oral exenatide ingestion was robust and reproducible and the
short interval between capsule ingestion and meal suggests that a
practical and patient friendly oral dosage form can be created. As
of now the only incretin mimetics available as oral medication are
the DPP IV inhibitors. An oral dosage form of GLP-1 analogues will
broaden the choice of available drugs from this important class of
antihyperglycemic medication.
Example 4
Oral Administration of Pills Containing Exenatide and a Protease
Inhibitor
Preparation of Tablet Cores
Tablet cores comprising exenatide and a protease inhibitor are
prepared using methods well known in the art.
Coating
The coating may be any delayed release coating known in the art.
For example, the coating may be a polymer composed of the following
ingredients: 4 mg Eudragit L-100 (Polymer of Acrylic and
Methacrylic Acid Esters) 4 mg Talc NF 0.4 mg Polyethylene Glycol
6000 NF
In one embodiment, a solution of the enteric coated polymer is
prepared by dissolving the polymer in a methylene
chloride+isopropyl alcohol mixture. The tablets are coated by
spraying the solution within a mildly warmed jar under constant
agitation. The solvent vapors are continuously aspirated.
Measurement of Levels and Activity of Recombinant Exenatide in
Subjects' Plasma
Levels of C peptide are measured as well, to determine the relative
contributions of endogenous and exogenous exenatide to observed
rises in exenatide levels.
Results
A mixture of Na-EDTA, SBTI, and exenatide and fish oil is
formulated into tablet or capsule cores, coated with an enteric
coating or gelatin coating, and administered to human subjects.
Blood glucose levels of the subjects are measured periodically as
described in the previous Examples. In addition, the subjects'
plasma levels of recombinant exenatide and its activity are tested.
The coated pills are shown to deliver functional exenatide to the
subjects, and the exenatide significantly lowers their blood
glucose levels, showing that active exenatide can be delivered to
the bloodstream via oral administration. Different types of
commercially available delayed release coatings are tested to
determine which coating provides the best delivery of exenatide,
and this coating is used in subsequent Examples.
Example 5
Optimization of Source of Omega-3 Fatty Acids
Various omega-3 fatty acids or sources of omega-3 fatty acids (e.g.
those listed above in the specification) are compared for their
ability to preserve exenatide following oral administration in
methods and compositions of the present invention. Exenatide
tablets or capsules are formulated as described in the above
Examples, except that the exenatide is combined with alternate
source instead of in fish oil. The most effective source of omega-3
fatty acids is used in subsequent Examples.
Example 6
Optimization of Protease Inhibitors
Various protease inhibitors (either non-toxic or having an
acceptable toxicity profile; e.g. those listed above in the
specification) are compared for their ability to preserve exenatide
following oral administration in methods and compositions of the
present invention. Exenatide tablets or capsules are formulated as
described in the above Examples, except that the alternate protease
inhibitors are substituted for SBTI. Amounts of the protease
inhibitors are also varied, to determine the optimal amounts. The
most effective protease inhibitor/amount is used in subsequent
Examples.
Example 7
Optimization of Enhancer
Various enhancers (e.g. those listed above in the specification)
are compared for their ability to facilitate absorption of
exenatide following oral administration in methods and compositions
of the present invention. Exenatide tablets or capsules are
formulated as described in the above Examples, except that the
alternate enhancers are substituted for EDTA. Amounts of the
enhancers are also varied, to determine the optimal amounts. The
most effective enhancer/amount is used in subsequent
experiments.
Example 8
Optimization of Type and Amount of Exenatide
Various types and amounts of exenatide e.g. those listed above in
the specification) are compared for their ability to regulate blood
sugar in methods and compositions of the present invention.
Exenatide tablets or capsules are formulated as described in the
above Examples, except that the type and amount of exenatide is
varied. The most effective type/amount of exenatide is used in
clinical trials.
SEQUENCE LISTINGS
1
1139PRTHeloderma suspectum 1His Gly Glu Gly Thr Phe Thr Ser Asp Leu
Ser Lys Gln Met Glu Glu1 5 10 15Glu Ala Val Arg Leu Phe Ile Glu Trp
Leu Lys Asn Gly Gly Pro Ser 20 25 30Ser Gly Ala Pro Pro Pro Ser
35
* * * * *
References