U.S. patent application number 17/034822 was filed with the patent office on 2022-01-27 for inhibitors of cyclin-dependent kinase 7 (cdk7).
This patent application is currently assigned to Dana-Farber Cancer Institute, Inc.. The applicant listed for this patent is Dana-Farber Cancer Institute, Inc.. Invention is credited to Nathanael S. Gray, Nicholas Paul Kwiatkowski, Yanke Liang, Tinghu Zhang.
Application Number | 20220024929 17/034822 |
Document ID | / |
Family ID | |
Filed Date | 2022-01-27 |
United States Patent
Application |
20220024929 |
Kind Code |
A9 |
Gray; Nathanael S. ; et
al. |
January 27, 2022 |
INHIBITORS OF CYCLIN-DEPENDENT KINASE 7 (CDK7)
Abstract
The present invention provides novel compounds of Formula (I),
and pharmaceutically acceptable salts, solvates, hydrates,
polymorphs, co-crystals, tautomers, stereoisomers, isotopically
labeled derivatives, prodrugs, and compositions thereof. Also
provided are methods and kits involving the inventive compounds or
compositions for treating and/or preventing proliferative diseases
(e.g., cancers (e.g., leukemia, acute lymphoblastic leukemia,
lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma, breast
cancer, Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma,
lung cancer, colorectal cancer), benign neoplasms, diseases
associated with angiogenesis, inflammatory diseases,
autoinflammatory diseases, and autoimmune diseases) in a subject.
Treatment of a subject with a proliferative disease using a
compound or composition of the invention may inhibit the aberrant
activity of a kinase, such as a cyclin-dependent kinase (CDK)
(e.g., cyclin-dependent kinase 7 (CDK7)), and therefore, induce
cellular apoptosis and/or inhibit transcription in the subject.
##STR00001##
Inventors: |
Gray; Nathanael S.; (Boston,
MA) ; Liang; Yanke; (Belmont, MA) ; Zhang;
Tinghu; (Brookline, MA) ; Kwiatkowski; Nicholas
Paul; (Brookline, MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Dana-Farber Cancer Institute, Inc. |
Boston |
MA |
US |
|
|
Assignee: |
Dana-Farber Cancer Institute,
Inc.
Boston
MA
|
Prior
Publication: |
|
Document Identifier |
Publication Date |
|
US 20210115051 A1 |
April 22, 2021 |
|
|
Appl. No.: |
17/034822 |
Filed: |
September 28, 2020 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15538763 |
Jun 22, 2017 |
10870651 |
|
|
PCT/US2015/000297 |
Dec 23, 2015 |
|
|
|
17034822 |
|
|
|
|
62096040 |
Dec 23, 2014 |
|
|
|
International
Class: |
C07D 487/04 20060101
C07D487/04; C07D 487/10 20060101 C07D487/10; A61P 35/00 20060101
A61P035/00; A61K 31/454 20060101 A61K031/454; A61K 31/4162 20060101
A61K031/4162; A61K 45/06 20060101 A61K045/06 |
Goverment Interests
GOVERNMENT SUPPORT
[0002] This invention was made with government support under grant
number 1 R01 CA 179483-01A1 awarded by the National Institutes of
Health. The government has certain rights in the invention.
Claims
1-58. (canceled)
59. A method of treating a proliferative disease in a subject in
need thereof, the method comprising administering to the subject a
therapeutically effective amount of a compound of Formula (I):
##STR00291## or a pharmaceutically acceptable salt, solvate,
hydrate, tautomer, stereoisomer, isotopically labeled derivative,
or prodrug thereof, or a pharmaceutical composition comprising a
therapeutically effective amount of a compound of Formula (I) and a
pharmaceutically acceptable excipient; wherein: R.sup.1 is
--NR.sup.aR.sup.b, --CHR.sup.aR.sup.b, or --OR.sup.a, wherein each
of R.sup.a and R.sup.b is independently hydrogen, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, a nitrogen protecting group when attached
to a nitrogen atom, or an oxygen protecting group when attached to
an oxygen atom, or Ra and R.sup.b are joined to form an optionally
substituted carbocyclic, optionally substituted heterocyclic,
optionally substituted aryl, or optionally substituted heteroaryl
ring; each of R.sup.3 and R.sup.4 is independently hydrogen,
halogen, optionally substituted C.sub.1-C.sub.6 alkyl, or
optionally substituted aryl, or R.sup.3 and R.sup.4 are joined to
form an optionally substituted C.sub.3-C.sub.6 carbocyclyl ring;
R.sup.5 is independently hydrogen, optionally substituted
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group; L.sup.1 is
--NR.sup.L1--, --NR.sup.L1C(.dbd.O)--, --C(.dbd.O)NR.sup.L1--,
--O--, or --S--, wherein R.sup.L1 is hydrogen, optionally
substituted C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group;
Ring A is optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, or
optionally substituted heteroaryl; L.sup.2 is a bond,
--C(.dbd.O)--, --NR.sup.L2--, --C(.dbd.O)NR.sup.L2--,
--NR.sup.L2C(.dbd.O)--, --O--, or --S--, wherein R.sup.L2 is
hydrogen, optionally substituted C.sub.1-C.sub.6 alkyl, or a
nitrogen protection group; Ring B is absent, optionally substituted
carbocyclyl, optionally substituted heterocyclyl, optionally
substituted aryl, or optionally substituted heteroaryl; and R.sup.2
is any of Formulae (i-1)-(i-42): ##STR00292## ##STR00293##
##STR00294## ##STR00295## wherein: L.sup.3 is a bond or an
optionally substituted C.sub.1-4 hydrocarbon chain, optionally
wherein one or more carbon units of the hydrocarbon chain are
independently replaced with --C.dbd.O--, --O--, --S--,
--NR.sup.L3a--, --NR.sup.L3aC(.dbd.O)--, --C(.dbd.O)NR.sup.L3a--,
--SC(.dbd.O)--, --C(.dbd.O)S--, --OC(.dbd.O)--, --C(.dbd.O)O--,
--NR.sup.L3aC(.dbd.S)--, --C(.dbd.S)NR.sup.L3a--,
trans-CR.sup.L3b=CR.sup.L3b--, cis-CR.sup.L3b.dbd.CR.sup.L3b--,
--C.ident.C--, --S(.dbd.O)--, --S(.dbd.O)O--, --OS(.dbd.O)--,
--S(.dbd.O)NR.sup.L3a--, --NR.sup.L3aS(.dbd.O)--,
--S(.dbd.O).sub.2--, --S(.dbd.O).sub.2O--, --OS(.dbd.O).sub.2--,
--S(.dbd.O).sub.2NR.sup.L3a--, or --NR.sup.L3aS(.dbd.O).sub.2--,
wherein R.sup.L3a is hydrogen, substituted or unsubstituted
C.sub.1-6 alkyl, or a nitrogen protecting group, and wherein each
occurrence of R.sup.L3b is independently hydrogen, halogen,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
or optionally substituted heteroaryl, or two R.sup.L3b groups are
joined to form an optionally substituted carbocyclic or optionally
substituted heterocyclic ring; L.sup.4 is a bond or an optionally
substituted, branched or unbranched C.sub.1-6 hydrocarbon chain;
each of R.sup.E1, R.sup.E2, and R.sup.E3 is independently hydrogen,
halogen, optionally substituted alkyl, optionally substituted
alkenyl, optionally substituted alkynyl, optionally substituted
carbocyclyl, optionally substituted heterocyclyl, optionally
substituted aryl, optionally substituted heteroaryl, --CN,
--CH.sub.2OR.sup.EE, --CH.sub.2N(R.sup.EE).sub.2,
--CH.sub.2SR.sup.EE, --OR.sup.EE, --N(R.sup.EE).sub.2,
--Si(R.sup.EE).sub.3, and --SR.sup.EE, wherein each occurrence of
R.sup.EE is independently hydrogen, optionally substituted alkyl,
optionally substituted alkoxy, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
or optionally substituted heteroaryl, or two R.sup.EE groups are
joined to form an optionally substituted heterocyclic ring; or
R.sup.E1 and R.sup.E3, or R.sup.E2 and R.sup.E3, or R.sup.E1 and
R.sup.E2 are joined to form an optionally substituted carbocyclic
or optionally substituted heterocyclic ring; R.sup.E4 is a leaving
group; R.sup.E5 is halogen; R.sup.E6 is hydrogen, substituted or
unsubstituted C.sub.1-6 alkyl, or a nitrogen protecting group; each
instance of Y is independently O, S, or NR.sup.E7, wherein R.sup.E7
is hydrogen, substituted or unsubstituted C.sub.1-6 alkyl, or a
nitrogen protecting group; a is 1 or 2; and each instance of z is
independently 0, 1, 2, 3, 4, 5, or 6, as valency permits.
60. The method of claim 59, wherein the subject is a mammal.
61. The method of claim 59, wherein the subject is a human.
62. The method of claim 59, wherein the proliferative disease is
associated with overexpression or aberrant activity of a
cyclin-dependent kinase (CDK).
63. The method of claim 62, wherein the proliferative disease is
associated with overexpression or aberrant activity of
cyclin-dependent kinase 7 (CDK7).
64-66. (canceled)
67. The method of claim 59, wherein the proliferative disease is
cancer.
68. The method of claim 59, wherein the proliferative disease is
associated with overexpression of a Myc protein.
69. The method of claim 67, wherein the proliferative disease is
leukemia, chronic lymphocytic leukemia (CLL), acute lymphoblastic
leukemia (ALL), melanoma, Burkitt's lymphoma, multiple myeloma,
bone cancer, colorectal cancer, osteosarcoma, breast cancer, triple
negative breast cancer (TNBC), Ewing's sarcoma, brain cancer,
neuroblastoma, lung cancer, small cell lung cancer (SCLC), or
non-small cell lung cancer (NSCLC).
70-85. (canceled)
86. The method of claim 59, wherein the proliferative disease is a
benign neoplasm, an inflammatory disease, rheumatoid arthritis, an
autoinflammatory disease, or an autoimmune disease.
87-91. (canceled)
92. A method of inhibiting the activity of a cyclin-dependent
kinase (CDK) in a biological sample or subject, the method
comprising administering to the subject or contacting the
biological sample with a therapeutically effective amount of a
compound of Formula (I): ##STR00296## or a pharmaceutically
acceptable salt, solvate hydrate tautomer, stereoisomer,
isotopically labeled derivative, or prodrug thereof, or a
pharmaceutical composition comprising a therapeutically effective
amount of a compound of Formula (I) and a pharmaceutically
acceptable excipient; wherein: R.sup.1 is --NR.sup.aR.sup.b,
--CHR.sup.aR.sup.b, or --OR.sup.a, wherein each of R.sup.a and
R.sup.b is independently hydrogen, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, optionally substituted
heteroaryl, a nitrogen protecting group when attached to a nitrogen
atom, or an oxygen protecting group when attached to an oxygen
atom, or Ra and R.sup.b are joined to form an optionally
substituted carbocyclic, optionally substituted heterocyclic,
optionally substituted aryl, or optionally substituted heteroaryl
ring; each of R.sup.3 and R.sup.4 is independently hydrogen,
halogen, optionally substituted C.sub.1-C.sub.6 alkyl, or
optionally substituted aryl, or R.sup.3 and R.sup.4 are joined to
form an optionally substituted C.sub.3-C.sub.6 carbocyclyl ring;
R.sup.5 is independently hydrogen, optionally substituted
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group; L.sup.1 is
--NR.sup.L1--, --NR.sup.L1C(.dbd.O)--, --C(.dbd.O)NR.sup.L1--,
--O--, or --S--, wherein R.sup.L1 is hydrogen, optionally
substituted C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group;
Ring A is optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, or
optionally substituted heteroaryl; L.sup.2 is a bond,
--C(.dbd.O)--, --NR.sup.L2--, --C(.dbd.O)NR.sup.L2--,
--NR.sup.L2C(.dbd.O)--, --O--, or --S--, wherein R.sup.L2 is
hydrogen, optionally substituted C.sub.1-C.sub.6 alkyl, or a
nitrogen protection group; Ring B is absent, optionally substituted
carbocyclyl, optionally substituted heterocyclyl, optionally
substituted aryl, or optionally substituted heteroaryl; and R.sup.2
is any of Formulae (i-1)-(i-42): ##STR00297## ##STR00298##
##STR00299## ##STR00300## wherein: L.sup.3 is a bond or an
optionally substituted C.sub.1-4 hydrocarbon chain, optionally
wherein one or more carbon units of the hydrocarbon chain are
independently replaced with --C.dbd.O--, --O--, --S--,
--NR.sup.L3a--, --NR.sup.L3aC(.dbd.O)--, --C(.dbd.O)NR.sup.L3a--,
--SC(.dbd.O)--, --C(.dbd.O)S--, --OC(.dbd.O)--, --C(.dbd.O)O--,
--NR.sup.L3aC(.dbd.S)--, --C(.dbd.S)NR.sup.L3a--,
trans-CR.sup.L3b=CR.sup.L3b--, cis-CR.sup.L3b.dbd.CR.sup.L3b--,
--C.ident.C--, --S(.dbd.O)--, --S(.dbd.O)O--, --OS(.dbd.O)--,
--S(.dbd.O)NR.sup.L3a--, --NR.sup.L3aS(.dbd.O)--,
--S(.dbd.O).sub.2--, --S(.dbd.O).sub.2O--, --OS(.dbd.O).sub.2--,
--S(.dbd.O).sub.2NR.sup.L3a--, or --NR.sup.L3aS(.dbd.O).sub.2--,
wherein R.sup.L3a is hydrogen, substituted or unsubstituted
C.sub.1-6 alkyl, or a nitrogen protecting group, and wherein each
occurrence of R.sup.L3b is independently hydrogen, halogen,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
or optionally substituted heteroaryl, or two R.sup.L3b groups are
joined to form an optionally substituted carbocyclic or optionally
substituted heterocyclic ring; L.sup.4 is a bond or an optionally
substituted, branched or unbranched C.sub.1-6 hydrocarbon chain;
each of R.sup.E1, R.sup.E2, and R.sup.E3 is independently hydrogen,
halogen, optionally substituted alkyl, optionally substituted
alkenyl, optionally substituted alkynyl, optionally substituted
carbocyclyl, optionally substituted heterocyclyl, optionally
substituted aryl, optionally substituted heteroaryl, --CN,
--CH.sub.2OR.sup.EE, --CH.sub.2N(R.sup.EE).sub.2,
--CH.sub.2SR.sup.EE, --OR.sup.EE, --N(R.sup.EE).sub.2,
--Si(R.sup.EE).sub.3, and --SR.sup.EE, wherein each occurrence of
R.sup.EE is independently hydrogen, optionally substituted alkyl,
optionally substituted alkoxy, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
or optionally substituted heteroaryl, or two R.sup.EE groups are
joined to form an optionally substituted heterocyclic ring; or
R.sup.E1 and R.sup.E3, or R.sup.E2 and R.sup.E3, or R.sup.E1 and
R.sup.E2 are joined to form an optionally substituted carbocyclic
or optionally substituted heterocyclic ring; R.sup.E4 is a leaving
group; R.sup.E5 is halogen; R.sup.E6 is hydrogen, substituted or
unsubstituted C.sub.1-6 alkyl, or a nitrogen protecting group; each
instance of Y is independently O, S, or NR.sup.E7, wherein R.sup.E7
is hydrogen, substituted or unsubstituted C.sub.1-6 alkyl, or a
nitrogen protecting group; a is 1 or 2; and each instance of z is
independently 0, 1, 2, 3, 4, 5, or 6, as valency permits.
93-94. (canceled)
95. A method of inhibiting transcription in a biological sample or
subject, the method comprising: administering to the subject or
contacting the biological sample with a therapeutically effective
amount of a compound of Formula (I): ##STR00301## or a
pharmaceutically acceptable salt, solvate, hydrate, tautomer,
stereoisomer, isotopically labeled derivative, or prodrug thereof,
or a pharmaceutical composition comprising a therapeutically
effective amount of a compound of Formula (I) and a
pharmaceutically acceptable excipient; wherein: R.sup.1 is
--NR.sup.aR.sup.b, --CHR.sup.aR.sup.b, or --OR.sup.a, wherein each
of R.sup.a and R.sup.b is independently hydrogen, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, a nitrogen protecting group when attached
to a nitrogen atom, or an oxygen protecting group when attached to
an oxygen atom, or R.sup.a and R.sup.b are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring; each of R.sup.3 and R.sup.4 is
independently hydrogen, halogen, optionally substituted
C.sub.1-C.sub.6 alkyl, or optionally substituted aryl, or R.sup.3
and R.sup.4 are joined to form an optionally substituted
C.sub.3-C.sub.6 carbocyclyl ring; R.sup.5 is independently
hydrogen, optionally substituted C.sub.1-C.sub.6 alkyl, or a
nitrogen protecting group; L.sup.1 is --NR.sup.L1--,
--NR.sup.L1C(.dbd.O)--, --C(.dbd.O)NR.sup.L1--, --O--, or --S--,
wherein R.sup.L1 is hydrogen, optionally substituted
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group; Ring A is
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, or optionally
substituted heteroaryl; L.sup.2 is a bond, --C(.dbd.O)--,
--NR.sup.L2--, --C(.dbd.O)NR.sup.L2--, --NR.sup.L2C(.dbd.O)--,
--O--, or --S--, wherein R.sup.L2 is hydrogen, optionally
substituted C.sub.1-C.sub.6 alkyl, or a nitrogen protection group;
Ring B is absent, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, or
optionally substituted heteroaryl; and R.sup.2 is any of Formulae
(i-1)-(i-42): ##STR00302## ##STR00303## ##STR00304## ##STR00305##
wherein: L.sup.3 is a bond or an optionally substituted C.sub.1-4
hydrocarbon chain, optionally wherein one or more carbon units of
the hydrocarbon chain are independently replaced with --C.dbd.O--,
--O--, --S--, --NR.sup.L3a--, --NR.sup.L3aC(.dbd.O)--,
--C(.dbd.O)NR.sup.L3a--, --SC(.dbd.O)--, --C(.dbd.O)S--,
--OC(.dbd.O)--, --C(.dbd.O)O--, --NR.sup.L3aC(.dbd.S)--,
--C(.dbd.S)NR.sup.L3a--, trans-CR.sup.L3b=CR.sup.L3b--,
cis-CR.sup.L3b.dbd.CR.sup.L3b--, --C.ident.C--, --S(.dbd.O)--,
--S(.dbd.O)O--, --OS(.dbd.O)--, --S(.dbd.O)NR.sup.L3a--,
--NR.sup.L3aS(.dbd.O)--, --S(.dbd.O).sub.2--, --S(.dbd.O).sub.2O--,
--OS(.dbd.O).sub.2--, --S(.dbd.O).sub.2NR.sup.L3a--, or
--NR.sup.L3aS(.dbd.O).sub.2--, wherein R.sup.L3a is hydrogen,
substituted or unsubstituted C.sub.1-6 alkyl, or a nitrogen
protecting group, and wherein each occurrence of R.sup.L3b is
independently hydrogen, halogen, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, or optionally
substituted heteroaryl, or two R.sup.L3b groups are joined to form
an optionally substituted carbocyclic or optionally substituted
heterocyclic ring; L.sup.4 is a bond or an optionally substituted,
branched or unbranched C.sub.1-6 hydrocarbon chain; each of
R.sup.E1, R.sup.E2, and R.sup.E3 is independently hydrogen,
halogen, optionally substituted alkyl, optionally substituted
alkenyl, optionally substituted alkynyl, optionally substituted
carbocyclyl, optionally substituted heterocyclyl, optionally
substituted aryl, optionally substituted heteroaryl, --CN,
--CH.sub.2OR.sup.EE, --CH.sub.2N(R.sup.EE).sub.2,
--CH.sub.2SR.sup.EE, --OR.sup.EE, --N(R.sup.EE).sub.2,
--Si(R.sup.EE).sub.3, and --SR.sup.EE, wherein each occurrence of
R.sup.EE is independently hydrogen, optionally substituted alkyl,
optionally substituted alkoxy, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
or optionally substituted heteroaryl, or two R.sup.EE groups are
joined to form an optionally substituted heterocyclic ring; or
R.sup.E1 and R.sup.E3, or R.sup.E2 and R.sup.E3, or R.sup.E1 and
R.sup.E2 are joined to form an optionally substituted carbocyclic
or optionally substituted heterocyclic ring; R.sup.E4 is a leaving
group; R.sup.E5 is halogen; R.sup.E6 is hydrogen, substituted or
unsubstituted C.sub.1-6 alkyl, or a nitrogen protecting group; each
instance of Y is independently O, S, or NR.sup.E7, wherein R.sup.E7
is hydrogen, substituted or unsubstituted C.sub.1-6 alkyl, or a
nitrogen protecting group; a is 1 or 2; and each instance of z is
independently 0, 1, 2, 3, 4, 5, or 6, as valency permits.
96. (canceled)
97. A method of inhibiting cell growth in a biological sample or
subject, the method comprising: administering to the subject or
contacting the biological sample with a therapeutically effective
amount of a compound of Formula (I): ##STR00306## or a
pharmaceutically acceptable salt, solvate, hydrate, tautomer,
stereoisomer, isotopically labeled derivative, or prodrug thereof,
or a pharmaceutical composition comprising a therapeutically
effective amount of a compound of Formula (I) and a
pharmaceutically acceptable excipient; wherein: R.sup.1 is
--NR.sup.aR.sup.b, --CHR.sup.aR.sup.b or --OR.sup.a, wherein each
of R.sup.a and R.sup.b is independently hydrogen, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, a nitrogen protecting group when attached
to a nitrogen atom, or an oxygen protecting group when attached to
an oxygen atom, or R.sup.a and R.sup.b are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring; each of R.sup.3 and R.sup.4 is
independently hydrogen, halogen, optionally substituted
C.sub.1-C.sub.6 alkyl, or optionally substituted aryl, or R.sup.3
and R.sup.4 are joined to form an optionally substituted
C.sub.3-C.sub.6 carbocyclyl ring; R.sup.5 is independently
hydrogen, optionally substituted C.sub.1-C.sub.6 alkyl, or a
nitrogen protecting group; L.sup.1 is --NR.sup.L1--,
--NR.sup.L1C(.dbd.O)--, --C(.dbd.O)NR.sup.L1--, --O--, or --S--,
wherein R.sup.L1 is hydrogen, optionally substituted
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group; Ring A is
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, or optionally
substituted heteroaryl; L.sup.2 is a bond, --C(.dbd.O)--,
--NR.sup.L2--, --C(.dbd.O)NR.sup.L2--, --NR.sup.L2C(.dbd.O)--,
--O--, or --S--, wherein R.sup.L2 is hydrogen, optionally
substituted C.sub.1-C.sub.6 alkyl, or a nitrogen protection group;
Ring B is absent, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, or
optionally substituted heteroaryl; and R.sup.2 is any of Formulae
(i-1)-(i-42): ##STR00307## ##STR00308## ##STR00309## ##STR00310##
wherein: L.sup.3 is a bond or an optionally substituted C.sub.1-4
hydrocarbon chain, optionally wherein one or more carbon units of
the hydrocarbon chain are independently replaced with --C.dbd.O--,
--O--, --S--, --NR.sup.L3a--, --NR.sup.L3aC(.dbd.O)--,
--C(.dbd.O)NR.sup.L3a--, --SC(.dbd.O)--, --C(.dbd.O)S--,
--OC(.dbd.O)--, --C(.dbd.O)O--, --NR.sup.L3aC(.dbd.S)--,
--C(.dbd.S)NR.sup.L3a--, trans-CR.sup.L3b=CR.sup.L3b--,
cis-CR.sup.L3b--, .dbd.CR.sup.L3b--, --C.ident.C--, --S(.dbd.O)--,
--S(.dbd.O)O--, --OS(.dbd.O)--, --S(.dbd.O)NR.sup.L3a--,
--NR.sup.L3aS(.dbd.O)--, --S(.dbd.O).sub.2--, --S(.dbd.O).sub.2O--,
--OS(.dbd.O).sub.2--, --S(.dbd.O).sub.2NR.sup.L3a--, or
--NR.sup.L3aS(.dbd.O).sub.2--, wherein R.sup.L3a is hydrogen,
substituted or unsubstituted C.sub.1-6 alkyl, or a nitrogen
protecting group, and wherein each occurrence of R.sup.L3b is
independently hydrogen, halogen, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, or optionally
substituted heteroaryl, or two R.sup.L3b groups are joined to form
an optionally substituted carbocyclic or optionally substituted
heterocyclic ring; L.sup.4 is a bond or an optionally substituted,
branched or unbranched C.sub.1-6 hydrocarbon chain; each of
R.sup.E1, R.sup.E2, and R.sup.E3 is independently hydrogen,
halogen, optionally substituted alkyl, optionally substituted
alkenyl, optionally substituted alkynyl, optionally substituted
carbocyclyl, optionally substituted heterocyclyl, optionally
substituted aryl, optionally substituted heteroaryl, --CN,
--CH.sub.2OR.sup.EE, --CH.sub.2N(R.sup.EE).sub.2,
--CH.sub.2SR.sup.EE, --OR.sup.EE, --N(R.sup.EE).sub.2,
--Si(R.sup.EE).sub.3, and --SR.sup.EE, wherein each occurrence of
R.sup.EE is independently hydrogen, optionally substituted alkyl,
optionally substituted alkoxy, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
or optionally substituted heteroaryl, or two R.sup.EE groups are
joined to form an optionally substituted heterocyclic ring; or
R.sup.E1 and R.sup.E3, or R.sup.E2 and R.sup.E3, or R.sup.E1 and
R.sup.E2 are joined to form an optionally substituted carbocyclic
or optionally substituted heterocyclic ring; R.sup.E4 is a leaving
group; R.sup.E5 is halogen; R.sup.E6 is hydrogen, substituted or
unsubstituted C.sub.1-6 alkyl, or a nitrogen protecting group; each
instance of Y is independently O, S, or NR.sup.E7, wherein R.sup.E7
is hydrogen, substituted or unsubstituted C.sub.1-6 alkyl, or a
nitrogen protecting group; a is 1 or 2; and each instance of z is
independently 0, 1, 2, 3, 4, 5, or 6, as valency permits.
98-105. (canceled)
106. The method of claim 59, wherein R.sup.1 is: ##STR00311##
107. The method of claim 59, wherein R.sup.3 and R.sup.4 are both
--CH.sub.3.
108. The method of claim 59, wherein L.sup.1 is
--NH(C.dbd.O)--.
109. The method of claim 59, wherein Ring A is optionally
substituted carbocyclyl or optionally substituted aryl.
110. The method of claim 59, wherein Ring A is optionally
substituted heterocyclyl or optionally substituted heteroaryl.
111. The method of claim 59, wherein Ring A is: ##STR00312##
wherein each ring atom is optionally substituted, as valency
permits.
112. The method of claim 59, wherein L.sup.2 is a bond, and Ring B
is absent.
113. The method of claim 59, wherein R.sup.2 is of Formula (i-1):
##STR00313##
114. The method of claim 59, wherein R.sup.2 is: ##STR00314##
115. The method of claim 59, wherein the compound is of formula:
##STR00315## ##STR00316## ##STR00317## ##STR00318## ##STR00319##
##STR00320## ##STR00321## ##STR00322## ##STR00323## ##STR00324##
##STR00325## ##STR00326## ##STR00327## ##STR00328## ##STR00329## or
a pharmaceutically acceptable salt, solvate, hydrate, stereoisomer,
tautomer, isotopically labeled derivative, or prodrug thereof.
Description
RELATED APPLICATIONS
[0001] This application is a divisional of and claims priority
under 35 U.S.C. .sctn. 120 to U.S. patent application U.S. Ser. No.
15/538,763, filed Jun. 22, 2017, which is a national stage filing
under 35 U.S.C. .sctn. 371 of International PCT Application,
PCT/US2015/000297, filed Dec. 23, 2015, which claims priority under
35 U.S.C. .sctn. 119(e) to U.S. Provisional Application, U.S. Ser.
No. 62/096,040, filed on Dec. 23, 2014, each of which is
incorporated herein by reference.
BACKGROUND OF THE INVENTION
[0003] The members of the cyclin-dependent kinase (CDK) family play
critical regulatory roles in cell proliferation. There are
currently 20 known mammalian CDKs. While CDK7-CDK13 have been
linked to transcription, only CDK1, 2, 4, and 6 show demonstrable
association with the cell cycle. Unique among the mammalian CDKs,
CDK7 has consolidated kinase activities, regulating both the cell
cycle and transcription. In the cytosol, CDK7 exists as a
heterotrimeric complex and is believed to function as a
CDK1/2-activating kinase (CAK), whereby phosphorylation of
conserved residues in CDK1/2 by CDK7 is required for full catalytic
CDK activity and cell cycle progression (Desai et al., "Effects of
phosphorylation by CAK on cyclin binding by CDCl.sub.2 and CDK2."
Mol. Cell Biol. 15, 345-350 (1995); Kaldis et al., "Analysis of CAK
activities from human cells." Eur. J. Biochem. 267, 4213-4221
(2000); Larochelle et al., "Requirements for CDK7 in the assembly
of CDK1/cyclin B and activation of CDK2 revealed by chemical
genetics in human cells." Mol. Cell 25, 839-850 (2007)). In the
nucleus, CDK7 forms the kinase core of the RNA polymerase (RNAP) II
general transcription factor complex and is charged with
phosphorylating the C-terminal domain (CTD) of RNAP II, a requisite
step in gene transcriptional initiation (Serizawa. et al.,
"Association of CDK-activating kinase subunits with transcription
factor TFIIH." Nature 374, 280-282 (1995); Shiekhattar et al.,
"CDK-activating kinase complex is a component of human
transcription factor TFIIH." Nature 374, 283-287 (1995); Drapkin et
al., "Human cyclin-dependent kinase-activating kinase exists in
three distinct complexes." Proc. Natl. Acad. Sci. U.S.A. 93,
6488-6493 (1996); Liu. et al., "Two cyclin-dependent kinases
promote RNA polymerase II transcription and formation of the
scaffold complex." Mol. Cell Biol. 24, 1721-1735 (2004); Akhtar et
al., "TFIIH kinase places bivalent marks on the carboxy-terminal
domain of RNA polymerase II." Mol. Cell 34, 387-393 (2009);
Glover-Cutter et al., "TFIIH-associated CDK7 kinase functions in
phosphorylation of C-terminal domain Ser7 residues,
promoter-proximal pausing, and termination by RNA polymerase II."
Mol. Cell Biol. 29, 5455-5464 (2009)). Together, the two functions
of CDK7, i.e., CAK and CTD phosphorylation, support critical facets
of cellular proliferation, cell cycling, and transcription.
[0004] Disruption of RNAP II CTD phosphorylation has been shown to
preferentially affect proteins with short half-lives, including
those of the anti-apoptotic BCL-2 family (Konig et al., "The novel
cyclin-dependent kinase inhibitor flavopiridol downregulates Bc1-2
and induces growth arrest and apoptosis in chronic B-cell leukemia
lines." Blood 1, 4307-4312 (1997); Gojo et al., "The
cyclin-dependent kinase inhibitor flavopiridol induces apoptosis in
multiple myeloma cells through transcriptional repression and
down-regulation of Mc1-1." Clin. Cancer Res. 8, 3527-3538 (2002)).
Cancer cells have demonstrated ability to circumvent pro-cell death
signaling through up-regulation of BCL-2 family members (Llambi et
al., "Apoptosis and oncogenesis: give and take in the BCL-2
family." Curr. Opin. Genet. Dev. 21, 12-20 (2011)). Therefore,
inhibition of human CDK7 kinase activity is likely to result in
anti-proliferative activity, and pharmacological inhibition is
thought to be useful in treating proliferative disorders, including
cancer. Indeed, flavopiridol, a non-selective pan-CDK inhibitor
that targets CTD kinases, has demonstrated efficacy for the
treatment of chronic lymphocytic leukemia (CLL) but suffers from a
poor toxicity profile (Lin et al., "Phase II study of flavopiridol
in relapsed chronic lymphocytic leukemia demonstrating high
response rates in genetically high-risk disease." J. Clin. Oncol.
27, 6012-6018 (2009); Christian et al., "Flavopiridol in chronic
lymphocytic leukemia: a concise review." Clin. Lymphoma Myeloma 9
Suppl. 3, S179-S185 (2009)). A selective CDK7 inhibitor may hold
promise as a therapeutic agent for the treatment of CLL and other
cancers.
SUMMARY OF THE INVENTION
[0005] The present invention provides compounds of Formula (I), and
pharmaceutically acceptable salts, solvates, hydrates, polymorphs,
co-crystals, tautomers, stereoisomers, isotopically labeled
derivatives, prodrugs, and compositions thereof. The compounds of
Formula (I), and pharmaceutically acceptable salts, solvates,
hydrates, polymorphs, co-crystals, tautomers, stereoisomers,
isotopically labeled derivatives, prodrugs, and compositions
thereof, may inhibit the activity of a kinase. In certain
embodiments, the inhibited kinase is a CDK. In certain embodiments,
the kinase is CDK7. In certain embodiments, the compound of Formula
(I) is selective for CDK7 compared to other kinases (e.g., CDK12
and CDK13). The present invention further provides methods of using
the inventive compounds, and pharmaceutically acceptable salts,
solvates, hydrates, polymorphs, co-crystals, tautomers,
stereoisomers, isotopically labeled derivatives, prodrugs, and
compositions thereof, to study the inhibition of a kinase (e.g.,
CDK7) and as therapeutics for the prevention and/or treatment of
diseases associated with the overexpression and/or aberrant
activity of a kinase (e.g., CDK7). In certain embodiments, the
inventive compounds are used for the prevention and/or treatment of
proliferative diseases (e.g., cancers (e.g., leukemia, acute
lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma,
multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma,
brain cancer, neuroblastoma, lung cancer, colorectal cancer),
benign neoplasms, diseases associated with angiogenesis,
inflammatory diseases, autoinflammatory diseases, and autoimmune
diseases) in a subject.
[0006] In certain embodiments, the compounds of Formula (I) may
selectively inhibit the activity of CDK7 compared to CDK13. Since
the discovery of selective inhibitors of CDK7 has been hampered by
the high sequence and structural similarities of the kinase domain
of CDK family members, the development of selective inhibitors of
the transcriptional cyclin-dependent kinases (tCDKs) will allow
dissection of their individual contributions to the regulation of
transcription and evaluation of their therapeutic potential.
Without wishing to be bound by any particular theory, the inventive
compounds' selectivity for CDK7 may be due to the compounds'
ability to covalently modify the cysteine residue (Cys312) of CDK7.
Cys312 of CDK7 is largely unique among the CDKs and other
kinases.
[0007] In one aspect, the present invention provides compounds of
Formula (I):
##STR00002##
and pharmaceutically acceptable salts, solvates, hydrates,
polymorphs, co-crystals, tautomers, stereoisomers, isotopically
labeled derivatives, and prodrugs thereof, wherein R.sup.1,
R.sup.2, R.sup.3, R.sup.4, R.sup.5, linker L.sup.1, linker L.sup.2,
Ring A, and Ring B are as defined herein.
[0008] In certain embodiments, a compound of Formula (I) is of
Formula (II):
##STR00003##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein R.sup.1, R.sup.2, linker
L.sup.2, Ring A, and Ring B are as defined herein.
[0009] In certain embodiments, a compound of Formula (I) is of
Formula (III):
##STR00004##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein R.sup.1, R.sup.2, linker
L.sup.2, Ring A, and Ring B are as defined herein.
[0010] In certain embodiments, a compound of Formula (I) is of
Formula (V-a), (V-b), (V-c), or (V-d):
##STR00005##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein R.sup.2, R.sup.1a,
R.sup.1N, R.sup.2N, linker L.sup.2, Ring A, and Ring B are as
defined herein.
[0011] In certain embodiments, a compound of Formula (I) is of
Formula (IX-a), (IX-b), (IX-C), or (IX-d):
##STR00006##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein R.sup.1, linker L.sup.2,
Ring A, and Ring B are as defined herein.
[0012] In another aspect, the present disclosure provides
pharmaceutical compositions including a compound described herein,
and optionally a pharmaceutically acceptable excipient. In certain
embodiments, the pharmaceutical compositions described herein
include a therapeutically or prophylactically effective amount of a
compound described herein. The pharmaceutical composition may be
useful for treating a proliferative disease in a subject in need
thereof, preventing a proliferative disease in a subject in need
thereof, inhibiting the activity of a protein kinase in a subject,
biological sample, tissue, or cell, and/or inducing apoptosis in a
cell.
[0013] In another aspect, the present invention provides methods
for treating and/or preventing a proliferative disease. Exemplary
proliferative diseases which may be treated include cancer (e.g.,
leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's
lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's
sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer,
colorectal cancer), benign neoplasm, diseases associated with
angiogenesis, inflammatory diseases, autoinflammatory diseases, and
autoimmune diseases.
[0014] Another aspect of the invention relates to methods of
inhibiting the activity of a kinase (e.g., CDK (e.g., CDK7)) in a
biological sample or subject. In certain embodiments, the method
involves the selective inhibition of CDK7.
[0015] Also provided by the present invention are methods of
inhibiting transcription in a biological sample or subject. The
transcription of genes affected by the activity of CDK7 may be
inhibited by the compounds of the invention.
[0016] The present invention also provides methods of inhibiting
cell growth in a biological sample or subject. In still another
aspect, the present invention provides methods of inducing
apoptosis of a cell in a biological sample or a subject.
[0017] In yet another aspect, the present invention provides
compounds of Formula (I), and pharmaceutically acceptable salts,
solvates, hydrates, polymorphs, co-crystals, tautomers,
stereoisomers, isotopically labeled derivatives, prodrugs, and
compositions thereof, for use in the treatment of a proliferative
disease (e.g., cancer) in a subject.
[0018] Another aspect of the present disclosure relates to kits
comprising a container with a compound, or pharmaceutical
composition thereof, as described herein. The kits described herein
may include a single dose or multiple doses of the compound or
pharmaceutical composition. The kits may be useful in a method of
the disclosure. In certain embodiments, the kit further includes
instructions for using the compound or pharmaceutical composition.
A kit described herein may also include information (e.g.
prescribing information) as required by a regulatory agency such as
the U.S. Food and Drug Administration (FDA).
[0019] The present invention describes methods for administering to
the subject an effective amount of a compound, or pharmaceutical
composition thereof, as described herein. Also described are
methods for a cell with an effective amount of a compound, or
pharmaceutical composition thereof, as described herein. In certain
embodiments, a method described herein further includes
administering to the subject an additional pharmaceutical agent. In
certain embodiments, a method described herein further includes
contacting the cell with an additional pharmaceutical agent. A
method described herein may further include performing
radiotherapy, immunotherapy, and/or transplantation on the
subject.
[0020] In yet another aspect, the present disclosure provides
compounds, and pharmaceutical compositions thereof, as described
herein for use in a method of the disclosure.
[0021] The details of one or more embodiments of the invention are
set forth herein. Other features, objects, and advantages of the
invention will be apparent from the Detailed Description, the
Examples, and the Claims.
BRIEF DESCRIPTION OF THE DRAWINGS
[0022] The accompanying drawing, which are incorporated in and
constitute a part of this specification, illustrate several
embodiments of the invention and together with the description,
serve to explain the principles of the invention.
[0023] FIGS. 1A-1H show the total ion chromatograms (TIC; A,E) and
extracted ion chromatograms (XIC; B-D, F-H) for CDK7 peptides
recorded during analysis of CAK complexes treated with DMSO (A-D)
or Compound 101 (E-H). FIG. 1A: TIC; DMSO. FIG. 1B: XIC; DMSO. FIG.
1C: XIC; DMSO. FIG. 1D: XIC; DMSO. FIG. 1E: TIC; compound 101. FIG.
1F: XIC; compound 101. FIG. 1G: XIC; compound 101. FIG. 1H: XIC;
compound 101.
[0024] FIG. 2 shows an MS spectrum (m/z 686-690) recorded during
analysis of peptides derived from CDK7 treated with Compound 101.
Signal at m/z 687.7498 corresponds to YFSNRPGPTPGCQLPRPNCPVETLK,
with Cys312 labeled with Compound 101.
DEFINITIONS
[0025] Definitions of specific functional groups and chemical terms
are described in more detail below. The chemical elements are
identified in accordance with the Periodic Table of the Elements,
CAS version, Handbook of Chemistry and Physics, 75.sup.th Ed.,
inside cover, and specific functional groups are generally defined
as described therein. Additionally, general principles of organic
chemistry, as well as specific functional moieties and reactivity,
are described in Thomas Sorrell, Organic Chemistry, University
Science Books, Sausalito, 1999; Smith and March, March's Advanced
Organic Chemistry, 5.sup.th Edition, John Wiley & Sons, Inc.,
New York, 2001; Larock, Comprehensive Organic Transformations, VCH
Publishers, Inc., New York, 1989; and Carruthers, Some Modern
Methods of Organic Synthesis, 3.sup.rd Edition, Cambridge
University Press, Cambridge, 1987. The disclosure is not intended
to be limited in any manner by the exemplary listing of
substituents described herein.
[0026] Compounds described herein can comprise one or more
asymmetric centers, and thus can exist in various isomeric forms,
e.g., enantiomers and/or diastereomers. For example, the compounds
described herein can be in the form of an individual enantiomer,
diastereomer or geometric isomer, or can be in the form of a
mixture of stereoisomers, including racemic mixtures and mixtures
enriched in one or more stereoisomer. Isomers can be isolated from
mixtures by methods known to those skilled in the art, including
chiral high pressure liquid chromatography (HPLC) and the formation
and crystallization of chiral salts; or preferred isomers can be
prepared by asymmetric syntheses. See, for example, Jacques et al.,
Enantiomers, Racemates and Resolutions (Wiley Interscience, New
York, 1981); Wilen et al., Tetrahedron 33:2725 (1977); Eliel,
Stereochemistry of Carbon Compounds (McGraw-Hill, N Y, 1962); and
Wilen, Tables of Resolving Agents and Optical Resolutions p. 268
(E. L. Eliel, Ed., Univ. of Notre Dame Press, Notre Dame, Ind.
1972). The disclosure additionally encompasses compounds described
herein as individual isomers substantially free of other isomers,
and alternatively, as mixtures of various isomers.
[0027] When a range of values is listed, it is intended to
encompass each value and sub-range within the range. For example
"C.sub.1-6" is intended to encompass, C.sub.1, C.sub.2, C.sub.3,
C.sub.4, C.sub.5, C.sub.6, C.sub.1-6, C.sub.1-5, C.sub.1-4,
C.sub.1-3, C.sub.1-2, C.sub.2-6, C.sub.2-5, C.sub.2-4, C.sub.2-3,
C.sub.3-6, C.sub.3-5, C.sub.3-4, C.sub.4-6, C.sub.4-5, and
C.sub.5-6.
[0028] The term "aliphatic" includes both saturated and
unsaturated, straight chain (i.e., unbranched), branched, acyclic,
cyclic, or polycyclic aliphatic hydrocarbons, which are optionally
substituted with one or more functional groups. As will be
appreciated by one of ordinary skill in the art, "aliphatic" is
intended herein to include, but is not limited to, alkyl, alkenyl,
alkynyl, cycloalkyl, cycloalkenyl, and cycloalkynyl moieties. Thus,
the term "alkyl" includes straight, branched and cyclic alkyl
groups. An analogous convention applies to other generic terms such
as "alkenyl", "alkynyl", and the like. Furthermore, the terms
"alkyl", "alkenyl", "alkynyl", and the like encompass both
substituted and unsubstituted groups. In certain embodiments,
"lower alkyl" is used to indicate those alkyl groups (cyclic,
acyclic, substituted, unsubstituted, branched or unbranched) having
1-6 carbon atoms.
[0029] In certain embodiments, the alkyl, alkenyl, and alkynyl
groups employed in the disclosure contain 1-20 aliphatic carbon
atoms. In certain other embodiments, the alkyl, alkenyl, and
alkynyl groups employed in the disclosure contain 1-10 aliphatic
carbon atoms. In yet other embodiments, the alkyl, alkenyl, and
alkynyl groups employed in the disclosure contain 1-8 aliphatic
carbon atoms. In still other embodiments, the alkyl, alkenyl, and
alkynyl groups employed in the disclosure contain 1-6 aliphatic
carbon atoms. In yet other embodiments, the alkyl, alkenyl, and
alkynyl groups employed in the disclosure contain 1-4 carbon atoms.
Illustrative aliphatic groups thus include, but are not limited to,
for example, methyl, ethyl, n-propyl, isopropyl, cyclopropyl,
--CH.sub.2-cyclopropyl, vinyl, allyl, n-butyl, sec-butyl, isobutyl,
tert-butyl, cyclobutyl, --CH.sub.2-cyclobutyl, n-pentyl,
sec-pentyl, isopentyl, tert-pentyl, cyclopentyl,
--CH.sub.2-cyclopentyl, n-hexyl, sec-hexyl, cyclohexyl,
--CH.sub.2-cyclohexyl moieties and the like, which again, may bear
one or more substituents. Alkenyl groups include, but are not
limited to, for example, ethenyl, propenyl, butenyl,
1-methyl-2-buten-1-yl, and the like. Representative alkynyl groups
include, but are not limited to, ethynyl, 2-propynyl (propargyl),
1-propynyl, and the like.
[0030] The term "alkyl" refers to a radical of a straight-chain or
branched saturated hydrocarbon group having from 1 to 10 carbon
atoms ("C.sub.1-10 alkyl"). In some embodiments, an alkyl group has
1 to 9 carbon atoms ("C.sub.1-9 alkyl"). In some embodiments, an
alkyl group has 1 to 8 carbon atoms ("C.sub.1-8 alkyl"). In some
embodiments, an alkyl group has 1 to 7 carbon atoms ("C.sub.1-7
alkyl"). In some embodiments, an alkyl group has 1 to 6 carbon
atoms ("C.sub.1-6 alkyl"). In some embodiments, an alkyl group has
1 to 5 carbon atoms ("C.sub.1-5 alkyl"). In some embodiments, an
alkyl group has 1 to 4 carbon atoms ("C.sub.1-4 alkyl"). In some
embodiments, an alkyl group has 1 to 3 carbon atoms ("C.sub.1-3
alkyl"). In some embodiments, an alkyl group has 1 to 2 carbon
atoms ("C.sub.1-2 alkyl"). In some embodiments, an alkyl group has
1 carbon atom ("C.sub.1 alkyl"). In some embodiments, an alkyl
group has 2 to 6 carbon atoms ("C.sub.2-6 alkyl"). Examples of
C.sub.1-6 alkyl groups include methyl (C.sub.1), ethyl (C.sub.2),
propyl (C.sub.3) (e.g., n-propyl, isopropyl), butyl (C.sub.4)
(e.g., n-butyl, tert-butyl, sec-butyl, iso-butyl), pentyl (C.sub.5)
(e.g., n-pentyl, 3-pentanyl, amyl, neopentyl, 3-methyl-2-butanyl,
tertiary amyl), and hexyl (C.sub.6) (e.g., n-hexyl). Additional
examples of alkyl groups include n-heptyl (C.sub.7), n-octyl
(C.sub.8), and the like. Unless otherwise specified, each instance
of an alkyl group is independently unsubstituted (an "unsubstituted
alkyl") or substituted (a "substituted alkyl") with one or more
substituents (e.g., halogen, such as F). In certain embodiments,
the alkyl group is an unsubstituted C.sub.1-10 alkyl (such as
unsubstituted C.sub.1-6 alkyl, e.g., --CH.sub.3). In certain
embodiments, the alkyl group is a substituted C.sub.1-10 alkyl
(such as substituted C.sub.1-6 alkyl, e.g., --CF.sub.3).
[0031] "Alkenyl" refers to a radical of a straight-chain or
branched hydrocarbon group having from 2 to 20 carbon atoms, one or
more carbon-carbon double bonds, and no triple bonds ("C.sub.2-20
alkenyl"). In some embodiments, an alkenyl group has 2 to 10 carbon
atoms ("C.sub.2-10 alkenyl"). In some embodiments, an alkenyl group
has 2 to 9 carbon atoms ("C.sub.2-9 alkenyl"). In some embodiments,
an alkenyl group has 2 to 8 carbon atoms ("C.sub.2-8 alkenyl"). In
some embodiments, an alkenyl group has 2 to 7 carbon atoms
("C.sub.2-7 alkenyl"). In some embodiments, an alkenyl group has 2
to 6 carbon atoms ("C.sub.2-6 alkenyl"). In some embodiments, an
alkenyl group has 2 to 5 carbon atoms ("C.sub.2-5 alkenyl"). In
some embodiments, an alkenyl group has 2 to 4 carbon atoms
("C.sub.2-4 alkenyl"). In some embodiments, an alkenyl group has 2
to 3 carbon atoms ("C.sub.2-3 alkenyl"). In some embodiments, an
alkenyl group has 2 carbon atoms ("C.sub.2 alkenyl"). The one or
more carbon-carbon double bonds can be internal (such as in
2-butenyl) or terminal (such as in 1-butenyl). Examples of
C.sub.2-4 alkenyl groups include ethenyl (C.sub.2), 1-propenyl
(C.sub.3), 2-propenyl (C.sub.3), 1-butenyl (C.sub.4), 2-butenyl
(C.sub.4), butadienyl (C.sub.4), and the like. Examples of
C.sub.2-6 alkenyl groups include the aforementioned C.sub.2-4
alkenyl groups as well as pentenyl (C.sub.5), pentadienyl
(C.sub.5), hexenyl (C.sub.6), and the like. Additional examples of
alkenyl include heptenyl (C.sub.7), octenyl (C.sub.8), octatrienyl
(C.sub.8), and the like. Unless otherwise specified, each instance
of an alkenyl group is independently optionally substituted, i.e.,
unsubstituted (an "unsubstituted alkenyl") or substituted (a
"substituted alkenyl") with one or more substituents. In certain
embodiments, the alkenyl group is unsubstituted C.sub.2-10 alkenyl.
In certain embodiments, the alkenyl group is substituted C.sub.2-10
alkenyl. In an alkenyl group, a C.dbd.C double bond for which the
stereochemistry is not specified (e.g., --CH.dbd.CHCH.sub.3 or)
##STR00007##
may be an (E)- or (Z)-double bond.
[0032] "Alkynyl" refers to a radical of a straight-chain or
branched hydrocarbon group having from 2 to 20 carbon atoms, one or
more carbon-carbon triple bonds, and optionally one or more double
bonds ("C.sub.2-20 alkynyl"). In some embodiments, an alkynyl group
has 2 to 10 carbon atoms ("C.sub.2-10 alkynyl"). In some
embodiments, an alkynyl group has 2 to 9 carbon atoms ("C.sub.2-9
alkynyl"). In some embodiments, an alkynyl group has 2 to 8 carbon
atoms ("C.sub.2-8 alkynyl"). In some embodiments, an alkynyl group
has 2 to 7 carbon atoms ("C.sub.2-7 alkynyl"). In some embodiments,
an alkynyl group has 2 to 6 carbon atoms ("C.sub.2-6 alkynyl"). In
some embodiments, an alkynyl group has 2 to 5 carbon atoms
("C.sub.2-5 alkynyl"). In some embodiments, an alkynyl group has 2
to 4 carbon atoms ("C.sub.2-4 alkynyl"). In some embodiments, an
alkynyl group has 2 to 3 carbon atoms ("C.sub.2-3 alkynyl"). In
some embodiments, an alkynyl group has 2 carbon atoms ("C.sub.2
alkynyl"). The one or more carbon-carbon triple bonds can be
internal (such as in 2-butynyl) or terminal (such as in 1-butynyl).
Examples of C.sub.2-4 alkynyl groups include, without limitation,
ethynyl (C.sub.2), 1-propynyl (C.sub.3), 2-propynyl (C.sub.3),
1-butynyl (C.sub.4), 2-butynyl (C.sub.4), and the like. Examples of
C.sub.2-6 alkenyl groups include the aforementioned C.sub.2-4
alkynyl groups as well as pentynyl (C.sub.5), hexynyl (C.sub.6),
and the like. Additional examples of alkynyl include heptynyl
(C.sub.7), octynyl (C.sub.8), and the like. Unless otherwise
specified, each instance of an alkynyl group is independently
optionally substituted, i.e., unsubstituted (an "unsubstituted
alkynyl") or substituted (a "substituted alkynyl") with one or more
substituents. In certain embodiments, the alkynyl group is
unsubstituted C.sub.2-10 alkynyl. In certain embodiments, the
alkynyl group is substituted C.sub.2-10 alkynyl.
[0033] "Carbocyclyl" or "carbocyclic" refers to a radical of a
non-aromatic cyclic hydrocarbon group having from 3 to 10 ring
carbon atoms ("C.sub.3-10 carbocyclyl") and zero heteroatoms in the
non-aromatic ring system. In some embodiments, a carbocyclyl group
has 3 to 8 ring carbon atoms ("C.sub.3-8 carbocyclyl"). In some
embodiments, a carbocyclyl group has 3 to 6 ring carbon atoms
("C.sub.3-6 carbocyclyl"). In some embodiments, a carbocyclyl group
has 3 to 6 ring carbon atoms ("C.sub.3-6 carbocyclyl"). In some
embodiments, a carbocyclyl group has 5 to 10 ring carbon atoms
("C.sub.5-10 carbocyclyl"). Exemplary C.sub.3-6 carbocyclyl groups
include, without limitation, cyclopropyl (C.sub.3), cyclopropenyl
(C.sub.3), cyclobutyl (C.sub.4), cyclobutenyl (C.sub.4),
cyclopentyl (C.sub.5), cyclopentenyl (C.sub.5), cyclohexyl
(C.sub.6), cyclohexenyl (C.sub.6), cyclohexadienyl (C.sub.6), and
the like. Exemplary C.sub.3-8 carbocyclyl groups include, without
limitation, the aforementioned C.sub.3-6 carbocyclyl groups as well
as cycloheptyl (C.sub.7), cycloheptenyl (C.sub.7), cycloheptadienyl
(C.sub.7), cycloheptatrienyl (C.sub.7), cyclooctyl (C.sub.8),
cyclooctenyl (C.sub.8), bicyclo[2.2.1]heptanyl (C.sub.7),
bicyclo[2.2.2]octanyl (C.sub.8), and the like. Exemplary C.sub.3-10
carbocyclyl groups include, without limitation, the aforementioned
C.sub.3-8 carbocyclyl groups as well as cyclononyl (C.sub.9),
cyclononenyl (C.sub.9), cyclodecyl (C.sub.10), cyclodecenyl
(C.sub.10), octahydro-1H-indenyl (C.sub.9), decahydronaphthalenyl
(Cm), spiro[4.5]decanyl (Cm), and the like. As the foregoing
examples illustrate, in certain embodiments, the carbocyclyl group
is either monocyclic ("monocyclic carbocyclyl") or contain a fused,
bridged or spiro ring system such as a bicyclic system ("bicyclic
carbocyclyl") and can be saturated or can be partially unsaturated.
"Carbocyclyl" also includes ring systems wherein the carbocyclic
ring, as defined above, is fused with one or more aryl or
heteroaryl groups wherein the point of attachment is on the
carbocyclic ring, and in such instances, the number of carbons
continue to designate the number of carbons in the carbocyclic ring
system. Unless otherwise specified, each instance of a carbocyclyl
group is independently optionally substituted, i.e., unsubstituted
(an "unsubstituted carbocyclyl") or substituted (a "substituted
carbocyclyl") with one or more substituents. In certain
embodiments, the carbocyclyl group is unsubstituted C.sub.3-10
carbocyclyl. In certain embodiments, the carbocyclyl group is
substituted C.sub.3-10 carbocyclyl.
[0034] In some embodiments, "carbocyclyl" is a monocyclic,
saturated carbocyclyl group having from 3 to 10 ring carbon atoms
("C.sub.3-10 cycloalkyl"). In some embodiments, a cycloalkyl group
has 3 to 8 ring carbon atoms ("C.sub.3-8 cycloalkyl"). In some
embodiments, a cycloalkyl group has 3 to 6 ring carbon atoms
("C.sub.3-6 cycloalkyl"). In some embodiments, a cycloalkyl group
has 5 to 6 ring carbon atoms ("C.sub.5-6 cycloalkyl"). In some
embodiments, a cycloalkyl group has 5 to 10 ring carbon atoms
("C.sub.5-10 cycloalkyl"). Examples of C.sub.5-6 cycloalkyl groups
include cyclopentyl (C.sub.5) and cyclohexyl (C.sub.5). Examples of
C.sub.3-6 cycloalkyl groups include the aforementioned C.sub.5-6
cycloalkyl groups as well as cyclopropyl (C.sub.3) and cyclobutyl
(C.sub.4). Examples of C.sub.3-8 cycloalkyl groups include the
aforementioned C.sub.3-6 cycloalkyl groups as well as cycloheptyl
(C.sub.7) and cyclooctyl (C.sub.8). Unless otherwise specified,
each instance of a cycloalkyl group is independently unsubstituted
(an "unsubstituted cycloalkyl") or substituted (a "substituted
cycloalkyl") with one or more substituents. In certain embodiments,
the cycloalkyl group is unsubstituted C.sub.3-10 cycloalkyl. In
certain embodiments, the cycloalkyl group is substituted C.sub.3-10
cycloalkyl.
[0035] "Heterocyclyl" or "heterocyclic" refers to a radical of a 3-
to 10-membered non-aromatic ring system having ring carbon atoms
and 1 to 4 ring heteroatoms, wherein each heteroatom is
independently selected from nitrogen, oxygen, sulfur, boron,
phosphorus, and silicon ("3-10 membered heterocyclyl"). In
heterocyclyl groups that contain one or more nitrogen atoms, the
point of attachment can be a carbon or nitrogen atom, as valency
permits. A heterocyclyl group can either be monocyclic ("monocyclic
heterocyclyl") or a fused, bridged, or spiro ring system, such as a
bicyclic system ("bicyclic heterocyclyl"), and can be saturated or
can be partially unsaturated. Heterocyclyl bicyclic ring systems
can include one or more heteroatoms in one or both rings.
"Heterocyclyl" also includes ring systems wherein the heterocyclic
ring, as defined above, is fused with one or more carbocyclyl
groups wherein the point of attachment is either on the carbocyclyl
or heterocyclic ring, or ring systems wherein the heterocyclic
ring, as defined above, is fused with one or more aryl or
heteroaryl groups, wherein the point of attachment is on the
heterocyclic ring, and in such instances, the number of ring
members continue to designate the number of ring members in the
heterocyclic ring system. Unless otherwise specified, each instance
of heterocyclyl is independently optionally substituted, i.e.,
unsubstituted (an "unsubstituted heterocyclyl") or substituted (a
"substituted heterocyclyl") with one or more substituents. In
certain embodiments, the heterocyclyl group is unsubstituted 3-10
membered heterocyclyl. In certain embodiments, the heterocyclyl
group is substituted 3-10 membered heterocyclyl.
[0036] In some embodiments, a heterocyclyl group is a 5-10
membered, non-aromatic ring system having ring carbon atoms and 1-4
ring heteroatoms, wherein each heteroatom is independently selected
from nitrogen, oxygen, sulfur, boron, phosphorus, and silicon
("5-10 membered heterocyclyl"). In some embodiments, a heterocyclyl
group is a 5-8 membered non-aromatic ring system having ring carbon
atoms and 1-4 ring heteroatoms, wherein each heteroatom is
independently selected from nitrogen, oxygen, and sulfur ("5-8
membered heterocyclyl"). In some embodiments, a heterocyclyl group
is a 5-6 membered non-aromatic ring system having ring carbon atoms
and 1-4 ring heteroatoms, wherein each heteroatom is independently
selected from nitrogen, oxygen, and sulfur ("5-6 membered
heterocyclyl"). In some embodiments, the 5-6 membered heterocyclyl
has 1-3 ring heteroatoms selected from nitrogen, oxygen, and
sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1-2
ring heteroatoms selected from nitrogen, oxygen, and sulfur. In
some embodiments, the 5-6 membered heterocyclyl has one ring
heteroatom selected from nitrogen, oxygen, and sulfur.
[0037] Exemplary 3-membered heterocyclyl groups containing one
heteroatom include, without limitation, azirdinyl, oxiranyl,
thiiranyl. Exemplary 4-membered heterocyclyl groups containing one
heteroatom include, without limitation, azetidinyl, oxetanyl and
thietanyl. Exemplary 5-membered heterocyclyl groups containing one
heteroatom include, without limitation, tetrahydrofuranyl,
dihydrofuranyl, tetrahydrothiophenyl, dihydrothiophenyl,
pyrrolidinyl, dihydropyrrolyl, and pyrrolyl-2,5-dione. Exemplary
5-membered heterocyclyl groups containing two heteroatoms include,
without limitation, dioxolanyl, oxasulfuranyl, disulfuranyl, and
oxazolidin-2-one. Exemplary 5-membered heterocyclyl groups
containing three heteroatoms include, without limitation,
triazolinyl, oxadiazolinyl, and thiadiazolinyl. Exemplary
6-membered heterocyclyl groups containing one heteroatom include,
without limitation, piperidinyl, tetrahydropyranyl,
dihydropyridinyl, and thianyl. Exemplary 6-membered heterocyclyl
groups containing two heteroatoms include, without limitation,
piperazinyl, morpholinyl, dithianyl, and dioxanyl. Exemplary
6-membered heterocyclyl groups containing two heteroatoms include,
without limitation, triazinanyl. Exemplary 7-membered heterocyclyl
groups containing one heteroatom include, without limitation,
azepanyl, oxepanyl and thiepanyl. Exemplary 8-membered heterocyclyl
groups containing one heteroatom include, without limitation,
azocanyl, oxecanyl and thiocanyl. Exemplary 5-membered heterocyclyl
groups fused to a C.sub.6 aryl ring (also referred to herein as a
5,6-bicyclic heterocyclic ring) include, without limitation,
indolinyl, isoindolinyl, dihydrobenzofuranyl, dihydrobenzothienyl,
benzoxazolinonyl, and the like. Exemplary 6-membered heterocyclyl
groups fused to an aryl ring (also referred to herein as a
6,6-bicyclic heterocyclic ring) include, without limitation,
tetrahydroquinolinyl, tetrahydroisoquinolinyl, and the like.
[0038] "Aryl" refers to a radical of a monocyclic or polycyclic
(e.g., bicyclic or tricyclic) 4n+2 aromatic ring system (e.g.,
having 6, 10, or 14 pi electrons shared in a cyclic array) having
6-14 ring carbon atoms and zero heteroatoms provided in the
aromatic ring system ("C.sub.6-14 aryl"). In some embodiments, an
aryl group has six ring carbon atoms ("C.sub.6 aryl"; e.g.,
phenyl). In some embodiments, an aryl group has ten ring carbon
atoms ("C.sub.10 aryl"; e.g., naphthyl such as 1-naphthyl and
2-naphthyl). In some embodiments, an aryl group has fourteen ring
carbon atoms ("C.sub.14 aryl"; e.g., anthracyl). "Aryl" also
includes ring systems wherein the aryl ring, as defined above, is
fused with one or more carbocyclyl or heterocyclyl groups, wherein
the radical or point of attachment is on the aryl ring, and in such
instances, the number of carbon atoms continue to designate the
number of carbon atoms in the aryl ring system. Unless otherwise
specified, each instance of an aryl group is independently
optionally substituted, i.e., unsubstituted (an "unsubstituted
aryl") or substituted (a "substituted aryl") with one or more
substituents. In certain embodiments, the aryl group is
unsubstituted C.sub.6-14 aryl. In certain embodiments, the aryl
group is substituted C.sub.6-14 aryl.
[0039] "Aralkyl" refers to an optionally substituted alkyl group
substituted by an optionally substituted aryl group. In certain
embodiments, the aralkyl is optionally substituted benzyl. In
certain embodiments, the aralkyl is benzyl. In certain embodiments,
the aralkyl is optionally substituted phenethyl. In certain
embodiments, the aralkyl is phenethyl.
[0040] "Heteroaryl" refers to a radical of a 5-10 membered,
monocyclic or bicyclic 4n+2 aromatic ring system (e.g., having 6 or
10 pi electrons shared in a cyclic array) having ring carbon atoms
and 1-4 ring heteroatoms provided in the aromatic ring system,
wherein each heteroatom is independently selected from nitrogen,
oxygen and sulfur ("5-10 membered heteroaryl"). In heteroaryl
groups that contain one or more nitrogen atoms, the point of
attachment can be a carbon or nitrogen atom, as valency permits.
Heteroaryl bicyclic ring systems can include one or more
heteroatoms in one or both rings. "Heteroaryl" includes ring
systems wherein the heteroaryl ring, as defined above, is fused
with one or more carbocyclyl or heterocyclyl groups wherein the
point of attachment is on the heteroaryl ring, and in such
instances, the number of ring members continue to designate the
number of ring members in the heteroaryl ring system. "Heteroaryl"
also includes ring systems wherein the heteroaryl ring, as defined
above, is fused with one or more aryl groups wherein the point of
attachment is either on the aryl or heteroaryl ring, and in such
instances, the number of ring members designates the number of ring
members in the fused (aryl/heteroaryl) ring system. Bicyclic
heteroaryl groups wherein one ring does not contain a heteroatom
(e.g., indolyl, quinolinyl, carbazolyl, and the like) the point of
attachment can be on either ring, i.e., either the ring bearing a
heteroatom (e.g., 2-indolyl) or the ring that does not contain a
heteroatom (e.g., 5-indolyl).
[0041] In some embodiments, a heteroaryl group is a 5-10 membered
aromatic ring system having ring carbon atoms and 1-4 ring
heteroatoms provided in the aromatic ring system, wherein each
heteroatom is independently selected from nitrogen, oxygen, and
sulfur ("5-10 membered heteroaryl"). In some embodiments, a
heteroaryl group is a 5-8 membered aromatic ring system having ring
carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring
system, wherein each heteroatom is independently selected from
nitrogen, oxygen, and sulfur ("5-8 membered heteroaryl"). In some
embodiments, a heteroaryl group is a 5-6 membered aromatic ring
system having ring carbon atoms and 1-4 ring heteroatoms provided
in the aromatic ring system, wherein each heteroatom is
independently selected from nitrogen, oxygen, and sulfur ("5-6
membered heteroaryl"). In some embodiments, the 5-6 membered
heteroaryl has 1-3 ring heteroatoms selected from nitrogen, oxygen,
and sulfur. In some embodiments, the 5-6 membered heteroaryl has
1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In
some embodiments, the 5-6 membered heteroaryl has 1 ring heteroatom
selected from nitrogen, oxygen, and sulfur. Unless otherwise
specified, each instance of a heteroaryl group is independently
optionally substituted, i.e., unsubstituted (an "unsubstituted
heteroaryl") or substituted (a "substituted heteroaryl") with one
or more substituents. In certain embodiments, the heteroaryl group
is unsubstituted 5-14 membered heteroaryl. In certain embodiments,
the heteroaryl group is substituted 5-14 membered heteroaryl.
[0042] Exemplary 5-membered heteroaryl groups containing one
heteroatom include, without limitation, pyrrolyl, furanyl, and
thiophenyl. Exemplary 5-membered heteroaryl groups containing two
heteroatoms include, without limitation, imidazolyl, pyrazolyl,
oxazolyl, isoxazolyl, thiazolyl, and isothiazolyl. Exemplary
5-membered heteroaryl groups containing three heteroatoms include,
without limitation, triazolyl, oxadiazolyl, and thiadiazolyl.
Exemplary 5-membered heteroaryl groups containing four heteroatoms
include, without limitation, tetrazolyl. Exemplary 6-membered
heteroaryl groups containing one heteroatom include, without
limitation, pyridinyl. Exemplary 6-membered heteroaryl groups
containing two heteroatoms include, without limitation,
pyridazinyl, pyrimidinyl, and pyrazinyl. Exemplary 6-membered
heteroaryl groups containing three or four heteroatoms include,
without limitation, triazinyl and tetrazinyl, respectively.
Exemplary 7-membered heteroaryl groups containing one heteroatom
include, without limitation, azepinyl, oxepinyl, and thiepinyl.
Exemplary 5,6-bicyclic heteroaryl groups include, without
limitation, indolyl, isoindolyl, indazolyl, benzotriazolyl,
benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl,
benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl,
benzthiazolyl, benzisothiazolyl, benzthiadiazolyl, indolizinyl, and
purinyl. Exemplary 6,6-bicyclic heteroaryl groups include, without
limitation, naphthyridinyl, pteridinyl, quinolinyl, isoquinolinyl,
cinnolinyl, quinoxalinyl, phthalazinyl, and quinazolinyl.
[0043] "Heteroaralkyl" is a subset of alkyl and heteroaryl and
refers to an optionally substituted alkyl group substituted by an
optionally substituted heteroaryl group.
[0044] "Unsaturated" or "partially unsaturated" refers to a group
that includes at least one double or triple bond. A "partially
unsaturated" ring system is further intended to encompass rings
having multiple sites of unsaturation, but is not intended to
include aromatic groups (e.g., aryl or heteroaryl groups).
Likewise, "saturated" refers to a group that does not contain a
double or triple bond, i.e., contains all single bonds.
[0045] Alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl,
and heteroaryl groups, which are divalent linking groups, are
further referred to using the suffix -ene, e.g., alkylene,
alkenylene, alkynylene, carbocyclylene, heterocyclylene, arylene,
and heteroarylene.
[0046] An atom, moiety, or group described herein may be
unsubstituted or substituted, as valency permits, unless otherwise
provided expressly. The term "optionally substituted" refers to
substituted or unsubstituted.
[0047] A group is optionally substituted unless expressly provided
otherwise. The term "optionally substituted" refers to being
substituted or unsubstituted. In certain embodiments, alkyl,
alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl
groups are optionally substituted (e.g., "substituted" or
"unsubstituted" alkyl, "substituted" or "unsubstituted" alkenyl,
"substituted" or "unsubstituted" alkynyl, "substituted" or
"unsubstituted" carbocyclyl, "substituted" or "unsubstituted"
heterocyclyl, "substituted" or "unsubstituted" aryl or
"substituted" or "unsubstituted" heteroaryl group). In general, the
term "substituted", whether preceded by the term "optionally" or
not, means that at least one hydrogen present on a group (e.g., a
carbon or nitrogen atom) is replaced with a permissible
substituent, e.g., a substituent which upon substitution results in
a stable compound, e.g., a compound which does not spontaneously
undergo transformation such as by rearrangement, cyclization,
elimination, or other reaction. Unless otherwise indicated, a
"substituted" group has a substituent at one or more substitutable
positions of the group, and when more than one position in any
given structure is substituted, the substituent is either the same
or different at each position. The term "substituted" is
contemplated to include substitution with all permissible
substituents of organic compounds, any of the substituents
described herein that results in the formation of a stable
compound. The present disclosure contemplates any and all such
combinations in order to arrive at a stable compound. For purposes
of this disclosure, heteroatoms such as nitrogen may have hydrogen
substituents and/or any suitable substituent as described herein
which satisfy the valencies of the heteroatoms and results in the
formation of a stable moiety. In certain embodiments, the
substituent is a carbon atom substituent. In certain embodiments,
the substituent is a nitrogen atom substituent. In certain
embodiments, the substituent is an oxygen atom substituent. In
certain embodiments, the substituent is a sulfur atom
substituent.
[0048] Exemplary carbon atom substituents include, but are not
limited to, halogen, --CN, --NO.sub.2, --N.sub.3, --SO.sub.2H,
--SO.sub.3H, --OH, --OR.sup.aa, --ON(R.sup.bb).sub.2,
N(R.sup.bb).sub.2, --N(R.sup.bb).sub.3.sup.+X.sup.-,
--N(OR.sup.cc)R.sup.bb, --SH, --SR.sup.aa, --SSR.sup.cc,
--C(.dbd.O)R.sup.aa, --CO.sub.2H, --CHO, --C(OR.sup.cc).sub.2,
--CO.sub.2R.sup.aa, --OC(.dbd.O)R.sup.aa, --OCO.sub.2R.sup.aa,
--C(.dbd.O)N(R.sup.bb).sub.2, --OC(.dbd.O)N(R.sup.bb).sub.2,
--NR.sup.bbC(.dbd.O)R.sup.aa, --NR.sup.bbCO.sub.2R.sup.aa,
--NR.sup.bbC(.dbd.O)N(R.sup.bb).sub.2, --C(.dbd.NR.sup.bb)R.sup.aa,
--C(.dbd.NR.sup.bb)OR.sup.aa, --OC(.dbd.NR.sup.bb)R.sup.aa,
--OC(.dbd.NR.sup.bb)OR.sup.aa,
--C(.dbd.NR.sup.bb)N(R.sup.bb).sub.2,
--OC(.dbd.NR.sup.bb)N(R.sup.bb).sub.2, NR.sup.bbc
(--NR.sup.bb)N(R.sup.bb).sub.2, C(.dbd.O)NR.sup.bbSO.sub.2R.sup.aa,
--NR.sup.bbSO.sub.2R.sup.aa, --SO.sub.2N(R.sup.bb).sub.2,
--SO.sub.2R.sup.aa, --SO.sub.2OR.sup.aa, --OSO.sub.2R.sup.aa,
--S(.dbd.O)R.sup.aa, --OS(.dbd.O)R.sup.aa, --Si(R.sup.aa).sub.3,
--OSi(R.sup.aa).sub.3, --C(.dbd.S)N(R.sup.bb).sub.2,
--C(.dbd.O)SR.sup.aa, --C(.dbd.S)SR.sup.aa, --SC(.dbd.S)SR.sup.aa,
--SC(.dbd.O)SR.sup.aa, --OC(.dbd.O)SR.sup.aa,
--SC(.dbd.O)OR.sup.aa, --SC(.dbd.O)R.sup.aa,
--P(.dbd.O)(R.sup.aa).sub.2, --P(.dbd.O)(OR.sup.cc).sub.2,
--OP(.dbd.O)(R.sup.aa).sub.2, --OP(.dbd.O)(OR.sup.cc).sub.2,
--P(.dbd.O)(N(R.sup.bb).sub.2).sub.2,
--OP(.dbd.O)(N(R.sup.bb).sub.2).sub.2,
NR.sup.bbP(.dbd.O)(R.sup.aa).sub.2,
--NR.sup.bbP(.dbd.O)(OR.sup.cc).sub.2,
--NR.sup.bbP(.dbd.O)(N(R.sup.bb).sub.2).sub.2, --P(R.sup.cc).sub.2,
--P(OR.sup.cc).sub.2, --P(R.sup.cc).sub.3.sup.+X.sup.-,
--P(OR.sup.cc).sub.3.sup.+X.sup.-, --P(R.sup.cc).sub.4,
--P(OR.sup.cc).sub.4, --OP(R.sup.cc).sub.2,
--OP(R.sup.cc).sub.3.sup.+X.sup.-, --OP(OR.sup.cc).sub.2,
--OP(OR.sup.cc).sub.3.sup.+X.sup.-, --OP(R.sup.cc).sub.4,
--OP(OR.sup.cc).sub.4, --B(R.sup.aa).sub.2, --B(OR.sup.cc).sub.2,
--BR.sup.aa(OR.sup.cc), C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl,
C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, C.sub.3-10 carbocyclyl,
3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl, wherein each alkyl, alkenyl, alkynyl, carbocyclyl,
heterocyclyl, aryl, and heteroaryl is independently substituted
with 0, 1, 2, 3, 4, or 5 R.sup.dd groups; wherein X.sup.- is a
counterion;
[0049] or two geminal hydrogens on a carbon atom are replaced with
the group .dbd.O, .dbd.S, .dbd.NN(R.sup.bb).sub.2,
.dbd.NNR.sup.bbC(.dbd.O)R.sup.aa,
.dbd.NNR.sup.bbC(.dbd.O)OR.sup.aa,
.dbd.NNR.sup.bbS(.dbd.O).sub.2R.sup.aa, .dbd.NR.sup.bb, or
.dbd.NOR.sup.cc;
[0050] each instance of R.sup.aa is, independently, selected from
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.aa groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring, wherein each alkyl, alkenyl,
alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is
independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd
groups;
[0051] each instance of R.sup.bb is, independently, selected from
hydrogen, --OH, --OR.sup.aa, --N(R.sup.cc).sub.2, --CN,
--C(.dbd.O)R.sup.aa, --C(.dbd.O)N(R.sup.cc).sub.2,
--CO.sub.2R.sup.aa, --SO.sub.2R.sup.aa,
--C(.dbd.NR.sup.cc)OR.sup.aa, --C(.dbd.NR.sup.cc)N(R.sup.cc).sub.2,
--SO.sub.2N(R.sup.cc).sub.2, --SO.sub.2R.sup.cc,
--SO.sub.2OR.sup.cc, --SOR.sup.aa, --C(.dbd.S)N(R.sup.cc).sub.2,
--C(.dbd.O)SR.sup.cc, --C(.dbd.S)SR.sup.cc,
--P(.dbd.O)(R.sup.aa).sub.2, --P(.dbd.O)(OR.sup.cc).sub.2,
--P(.dbd.O)(N(R.sup.cc).sub.2).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl, or two R.sup.bb groups are joined to form a
3-14 membered heterocyclyl or 5-14 membered heteroaryl ring,
wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl,
aryl, and heteroaryl is independently substituted with 0, 1, 2, 3,
4, or 5 R.sup.dd groups; wherein X.sup.- is a counterion;
[0052] each instance of R.sup.cc is, independently, selected from
hydrogen, C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10
alkenyl, C.sub.2-10 alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.cc groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring, wherein each alkyl, alkenyl,
alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is
independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd
groups;
[0053] each instance of R.sup.dd is, independently, selected from
halogen, --CN, --NO.sub.2, --N.sub.3, --SO.sub.2H, --SO.sub.3H,
--OH, --OR.sup.ee, --ON(R.sup.ff).sub.2, --N(R.sup.ff).sub.2,
--N(R.sup.ff).sub.3.sup.+X.sup.-, --N(OR.sup.ee)R.sup.ff, --SH,
--SR.sup.ee, --SSR.sup.ee, --C(.dbd.O)R.sup.ee, --CO.sub.2H,
--CO.sub.2R.sup.ee, --OC(.dbd.O)R.sup.ee, --OCO.sub.2R.sup.ee,
--C(.dbd.O)N(R.sup.ff).sub.2, --OC(.dbd.O)N(R.sup.ff).sub.2,
--NR.sup.ffC(.dbd.O)R.sup.ee, --NR.sup.ffCO.sub.2R.sup.ee,
--NR.sup.ffC(.dbd.O)N(R.sup.ff).sub.2,
--C(.dbd.NR.sup.ff)OR.sup.ee, --OC(.dbd.NR.sup.ff)R.sup.ee,
--OC(.dbd.NR.sup.ff)OR.sup.ee,
--C(.dbd.NR.sup.ff)N(R.sup.ff).sub.2,
--OC(.dbd.NR.sup.ff)N(R.sup.ff).sub.2,
--NR.sup.ffC(.dbd.NR.sup.ff)N(R.sup.ff).sub.2,
--NR.sup.ffSO.sub.2R.sup.ee, --SO.sub.2N(R.sup.ff).sub.2,
--SO.sub.2R.sup.ee, --SO.sub.2OR.sup.ee, --OSO.sub.2R.sup.ee,
--S(.dbd.O)R.sup.ee, --Si(R.sup.ee).sub.3, --OSi(R.sup.ee).sub.3,
--C(.dbd.S)N(R.sup.ff).sub.2, --C(.dbd.O)SR.sup.ee,
--C(.dbd.S)SR.sup.ee, --SC(.dbd.S)SR.sup.ee,
--P(.dbd.O)(OR.sup.ee).sub.2, --P(.dbd.O)(R.sup.ee).sub.2,
--OP(.dbd.O)(R.sup.ee).sub.2, --OP(.dbd.O)(OR.sup.ee).sub.2,
C.sub.1-6 alkyl, C.sub.1-6 perhaloalkyl, C.sub.2-6 alkenyl,
C.sub.2-6 alkynyl, C.sub.3-10 carbocyclyl, 3-10 membered
heterocyclyl, C.sub.6-10 aryl, 5-10 membered heteroaryl, wherein
each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and
heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5
R.sup.gg groups, or two geminal R.sup.dd substituents can be joined
to form .dbd.O or .dbd.S; wherein X.sup.- is a counterion;
[0054] each instance of R.sup.ee is, independently, selected from
C.sub.1-6 alkyl, C.sub.1-6 perhaloalkyl, C.sub.2-6 alkenyl,
C.sub.2-6 alkynyl, C.sub.3-10 carbocyclyl, C.sub.6-10 aryl, 3-10
membered heterocyclyl, and 3-10 membered heteroaryl, wherein each
alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl, and
heteroaryl is independently substituted with 0, 1, 2, 3, 4, or 5
R.sup.gg groups;
[0055] each instance of R.sup.ff is, independently, selected from
hydrogen, C.sub.1-6 alkyl, C.sub.1-6 perhaloalkyl, C.sub.2-6
alkenyl, C.sub.2-6 alkynyl, C.sub.3-10 carbocyclyl, 3-10 membered
heterocyclyl, C.sub.6-10 aryl and 5-10 membered heteroaryl, or two
R.sup.ff groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring, wherein each alkyl, alkenyl,
alkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is
independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.gg groups;
and
[0056] each instance of R.sup.gg is, independently, halogen, --CN,
--NO.sub.2, --N.sub.3, --SO.sub.2H, --SO.sub.3H, --OH, --OC.sub.1-6
alkyl, --ON(C.sub.1-6 alkyl).sub.2, --N(C.sub.1-6 alkyl).sub.2,
--N(C.sub.1-6 alkyl).sub.3.sup.+X.sup.-, --NH(C.sub.1-6
alkyl).sub.2.sup.+X.sup.-, --NH.sub.2(C.sub.1-6
alkyl).sup.+X.sup.-, --NH.sub.3.sup.+X.sup.-, --N(OC.sub.1-6
alkyl)(C.sub.1-6 alkyl), --N(OH)(C.sub.1-6 alkyl), --NH(OH), --SH,
--SC.sub.1-6 alkyl, --SS(C.sub.1-6 alkyl), --C(.dbd.O)(C.sub.1-6
alkyl), --CO.sub.2H, --CO.sub.2(C.sub.1-6 alkyl),
--OC(.dbd.O)(C.sub.1-6 alkyl), --OCO.sub.2(C.sub.1-6 alkyl),
--C(.dbd.O)NH.sub.2, --C(.dbd.O)N(C.sub.1-6 alkyl),
--OC(.dbd.O)NH(C.sub.1-6 alkyl), --NHC(.dbd.O)(C.sub.1-6 alkyl),
--N(C.sub.1-6 alkyl)C(.dbd.O)(C.sub.1-6 alkyl),
--NHCO.sub.2(C.sub.1-6 alkyl), --NHC(.dbd.O)N(C.sub.1-6
alkyl).sub.2, --NHC(.dbd.O)NH(C.sub.1-6 alkyl),
--NHC(.dbd.O)NH.sub.2, --C(.dbd.NH)O(C.sub.1-6 alkyl),
--OC(.dbd.NH)(C.sub.1-6 alkyl), --OC(.dbd.NH)OC.sub.1-6 alkyl,
--C(.dbd.NH)N(C.sub.1-6 alkyl), --C(.dbd.NH)NH(C.sub.1-6 alkyl),
--C(.dbd.NH)NH.sub.2, --OC(.dbd.NH)N(C.sub.1-6 alkyl).sub.2,
--OC(NH)NH(C.sub.1-6 alkyl), --OC(NH)NH.sub.2, --NHC(NH)N(C.sub.1-6
alkyl).sub.2, --NHC(.dbd.NH)NH.sub.2, --NHSO.sub.2(C.sub.1-6
alkyl), --SO.sub.2N(C.sub.1-6 alkyl).sub.2, --SO.sub.2NH(C.sub.1-6
alkyl), --SO.sub.2NH.sub.2, --SO.sub.2C.sub.1-6 alkyl,
--SO.sub.2OC.sub.1-6 alkyl, --OSO.sub.2C.sub.1-6 alkyl,
--SOC.sub.1-6 alkyl, --Si(C.sub.1-6 alkyl), --OSi(C.sub.1-6
alkyl).sub.3-C(.dbd.S)N(C.sub.1-6 alkyl).sub.2,
C(.dbd.S)NH(C.sub.1-6 alkyl), C(.dbd.S)NH.sub.2,
--C(.dbd.O)S(C.sub.1-6 alkyl), --C(.dbd.S)SC.sub.1-6 alkyl,
--SC(.dbd.S)SC.sub.1-6 alkyl, --P(.dbd.O).sub.2(C.sub.1-6 alkyl),
--P(.dbd.O)(C.sub.1-6 alkyl), --OP(.dbd.O)(C.sub.1-6 alkyl).sub.2,
--OP(.dbd.O)(OC.sub.1-6 alkyl).sub.2, C.sub.1-6 alkyl, C.sub.1-6
perhaloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-10
carbocyclyl, C.sub.6-10 aryl, 3-10 membered heterocyclyl, 5-10
membered heteroaryl; or two geminal R.sup.gg substituents can be
joined to form .dbd.O or .dbd.S; wherein X.sup.- is a
counterion.
[0057] A "counterion" or "anionic counterion" is a negatively
charged group associated with a cationic quaternary amino group in
order to maintain electronic neutrality. An anionic counterion may
be monovalent (i.e., including one formal negative charge). An
anionic counterion may also be multivalent (i.e., including more
than one formal negative charge), such as divalent or trivalent.
Exemplary counterions include halide ions (e.g., F.sup.-, Cl.sup.-,
Br.sup.-, I.sup.-), NO.sub.3.sup.-, ClO.sub.4.sup.-, OH.sup.-,
H.sub.2PO.sub.4.sup.-, HCO.sub.3.sup.-, HSO.sub.4.sup.-, sulfonate
ions (e.g., methansulfonate, trifluoromethanesulfonate,
p-toluenesulfonate, benzenesulfonate, 10-camphor sulfonate,
naphthalene-2-sulfonate, naphthalene-1-sulfonic acid-5-sulfonate,
ethan-1-sulfonic acid-2-sulfonate, and the like), carboxylate ions
(e.g., acetate, propanoate, benzoate, glycerate, lactate, tartrate,
glycolate, gluconate, and the like), BF.sub.4.sup.-,
PF.sub.4.sup.-, PF.sub.6.sup.-, AsF.sub.6.sup.-, SbF.sub.6.sup.-,
B[3,5-(CF.sub.3).sub.2C.sub.6H.sub.3].sub.4].sup.-,
B(C.sub.6F.sub.5).sub.4.sup.-, BPh.sub.4.sup.-,
Al(OC(CF.sub.3).sub.3).sub.4.sup.-, and carborane anions (e.g.,
CB.sub.11H.sub.12.sup.- or (HCB.sub.11Me.sub.5Br.sub.6).sup.-).
Exemplary counterions which may be multivalent include
CO.sub.3.sup.2-, HPO.sub.4.sup.2-, PO.sub.4.sup.3-,
B.sub.4O.sub.7.sup.2-, SO.sub.4.sup.2-, S.sub.2O.sub.3.sup.2-,
carboxylate anions (e.g., tartrate, citrate, fumarate, maleate,
malate, malonate, gluconate, succinate, glutarate, adipate,
pimelate, suberate, azelate, sebacate, salicylate, phthalates,
aspartate, glutamate, and the like), and carboranes.
[0058] "Halo" or "halogen" refers to fluorine (fluoro, --F),
chlorine (chloro, --Cl), bromine (bromo, --Br), or iodine (iodo,
--I).
[0059] "Acyl" refers to a moiety selected from the group consisting
of --C(.dbd.O)R.sup.aa, --CHO, --CO.sub.2R.sup.aa,
--C(.dbd.O)N(R.sup.bb).sub.2, --C(.dbd.NR.sup.bb)R.sup.aa,
--C(.dbd.NR.sup.bb)OR.sup.aa, --C(.dbd.NR.sup.bb)N(R.sup.bb).sub.2,
--C(.dbd.O)NR.sup.bbSO.sub.2R.sup.aa, --C(.dbd.S)N(R.sup.bb).sub.2,
--C(.dbd.O)SR.sup.aa, or --C(.dbd.S)SR.sup.aa, wherein R.sup.aa and
R.sup.bb are as defined herein.
[0060] Nitrogen atoms can be substituted or unsubstituted as
valency permits, and include primary, secondary, tertiary, and
quaternary nitrogen atoms. Exemplary nitrogen atom substituents
include, but are not limited to, hydrogen, --OH, --OR.sup.aa,
--N(R.sup.cc).sub.2, --CN, --C(.dbd.O)R.sup.aa,
--C(.dbd.O)N(R.sup.cc).sub.2, --CO.sub.2R.sup.aa,
--SO.sub.2R.sup.aa, --C(.dbd.NR.sup.bb)R.sup.aa,
--C(.dbd.NR.sup.cc)OR.sup.aa, --C(.dbd.NR.sup.cc)N(R.sup.cc).sub.2,
--SO.sub.2N(R.sup.cc).sub.2, --SO.sub.2R.sup.cc,
--SO.sub.2OR.sup.cc, --SOR.sup.aa, --C(.dbd.S)N(R.sup.cc).sub.2,
--C(.dbd.O)SR.sup.cc, --C(.dbd.S)SR.sup.cc, --P(.dbd.O)
(OR.sup.cc).sub.2, --P(.dbd.O)(R.sup.aa).sub.2,
--P(.dbd.O)(N(R.sup.cc).sub.2).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl, or two R.sup.cc groups attached to a nitrogen
atom are joined to form a 3-14 membered heterocyclyl or 5-14
membered heteroaryl ring, wherein each alkyl, alkenyl, alkynyl,
carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently
substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd groups, and wherein
R.sup.aa, R.sup.bb, R.sup.cc, and R.sup.dd are as defined
above.
[0061] In certain embodiments, the substituent present on a
nitrogen atom is a nitrogen protecting group (also referred to as
an amino protecting group). Nitrogen protecting groups include, but
are not limited to, --OH, --OR.sup.aa, --N(R.sup.cc).sub.2,
--C(.dbd.O)R.sup.aa, --C(.dbd.O)N(R.sup.cc).sub.2,
--CO.sub.2R.sup.aa, --SO.sub.2R.sup.aa,
--C(.dbd.NR.sup.cc)R.sup.aa, --C(.dbd.NR.sup.cc)OR.sup.aa,
--C(.dbd.NR.sup.cc)N(R.sup.cc).sub.2, --SO.sub.2N(R.sup.cc).sub.2,
--SO.sub.2R.sup.cc, --SO.sub.2OR.sup.cc, --SOR.sup.aa,
--C(.dbd.S)N(R.sup.cc).sub.2, --C(.dbd.O)SR.sup.cc,
--C(.dbd.S)SR.sup.cc, C.sub.1-10 alkyl (e.g., aralkyl,
heteroaralkyl), C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl groups, wherein each alkyl, alkenyl, alkynyl,
carbocyclyl, heterocyclyl, aralkyl, aryl, and heteroaryl is
independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd groups,
and wherein R.sup.aa, R.sup.bb, R.sup.cc and R.sup.dd are as
defined herein. Nitrogen protecting groups are well known in the
art and include those described in detail in Protecting Groups in
Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3.sup.rd
edition, John Wiley & Sons, 1999, incorporated herein by
reference.
[0062] For example, nitrogen protecting groups such as amide groups
(e.g., --C(.dbd.O)R.sup.aa) include, but are not limited to,
formamide, acetamide, chloroacetamide, trichloroacetamide,
trifluoroacetamide, phenylacetamide, 3-phenylpropanamide,
picolinamide, 3-pyridylcarboxamide, N-benzoylphenylalanyl
derivative, benzamide, p-phenylbenzamide, o-nitrophenylacetamide,
o-nitrophenoxyacetamide, acetoacetamide, (N'
dithiobenzyloxyacylamino)acetamide, 3-(p-hydroxyphenyl)propanamide,
3-(o-nitrophenyl)propanamide,
2-methyl-2-(o-nitrophenoxy)propanamide,
2-methyl-2-(o-phenylazophenoxy)propanamide, 4-chlorobutanamide,
3-methyl-3-nitrobutanamide, o-nitrocinnamide, N-acetylmethionine
derivative, o-nitrobenzamide, and
o-(benzoyloxymethyl)benzamide.
[0063] Nitrogen protecting groups such as carbamate groups (e.g.,
--C(.dbd.O)OR.sup.aa) include, but are not limited to, methyl
carbamate, ethyl carbamate, 9-fluorenylmethyl carbamate (Fmoc),
9-(2-sulfo)fluorenylmethyl carbamate,
9-(2,7-dibromo)fluorenylmethyl carbamate,
2,7-di-t-butyl-[9-(10,10-dioxo-10,10,10,10-tetrahydrothioxanthyl)]methyl
carbamate (DBD-Tmoc), 4-methoxyphenacyl carbamate (Phenoc),
2,2,2-trichloroethyl carbamate (Troc), 2-trimethylsilylethyl
carbamate (Teoc), 2-phenylethyl carbamate (hZ),
1-(1-adamantyl)-1-methylethyl carbamate (Adpoc),
1,1-dimethyl-2-haloethyl carbamate, 1,1-dimethyl-2,2-dibromoethyl
carbamate (DB-t-BOC), 1,1-dimethyl-2,2,2-trichloroethyl carbamate
(TCBOC), 1-methyl-1-(4-biphenylyl)ethyl carbamate (Bpoc),
1-(3,5-di-t-butylphenyl)-1-methylethyl carbamate (t-Bumeoc), 2-(2'-
and 4'-pyridyl)ethyl carbamate (Pyoc),
2-(N,N-dicyclohexylcarboxamido)ethyl carbamate, t-butyl carbamate
(BOC or Boc), 1-adamantyl carbamate (Adoc), vinyl carbamate (Voc),
allyl carbamate (Alloc), 1-isopropylallyl carbamate (Ipaoc),
cinnamyl carbamate (Coc), 4-nitrocinnamyl carbamate (Noc),
8-quinolyl carbamate, N-hydroxypiperidinyl carbamate, alkyldithio
carbamate, benzyl carbamate (Cbz), p-methoxybenzyl carbamate (Moz),
p-nitobenzyl carbamate, p-bromobenzyl carbamate, p-chlorobenzyl
carbamate, 2,4-dichlorobenzyl carbamate, 4-methylsulfinylbenzyl
carbamate (Msz), 9-anthrylmethyl carbamate, diphenylmethyl
carbamate, 2-methylthioethyl carbamate, 2-methylsulfonylethyl
carbamate, 2-(p-toluenesulfonyl)ethyl carbamate,
[2-(1,3-dithianyl)]methyl carbamate (Dmoc), 4-methylthiophenyl
carbamate (Mtpc), 2,4-dimethylthiophenyl carbamate (Bmpc),
2-phosphonioethyl carbamate (Peoc), 2-triphenylphosphonioisopropyl
carbamate (Ppoc), 1,1-dimethyl-2-cyanoethyl carbamate,
m-chloro-p-acyloxybenzyl carbamate, p-(dihydroxyboryl)benzyl
carbamate, 5-benzisoxazolylmethyl carbamate,
2-(trifluoromethyl)-6-chromonylmethyl carbamate (Tcroc),
m-nitrophenyl carbamate, 3,5-dimethoxybenzyl carbamate,
o-nitrobenzyl carbamate, 3,4-dimethoxy-6-nitrobenzyl carbamate,
phenyl(o-nitrophenyl)methyl carbamate, t-amyl carbamate, S-benzyl
thiocarbamate, p-cyanobenzyl carbamate, cyclobutyl carbamate,
cyclohexyl carbamate, cyclopentyl carbamate, cyclopropylmethyl
carbamate, p-decyloxybenzyl carbamate, 2,2-dimethoxyacylvinyl
carbamate, o-(N,N-dimethylcarboxamido)benzyl carbamate,
1,1-dimethyl-3-(N,N-dimethylcarboxamido)propyl carbamate,
1,1-dimethylpropynyl carbamate, di(2-pyridyl)methyl carbamate,
2-furanylmethyl carbamate, 2-iodoethyl carbamate, isoborynl
carbamate, isobutyl carbamate, isonicotinyl carbamate,
p-(p'-methoxyphenylazo)benzyl carbamate, 1-methylcyclobutyl
carbamate, 1-methylcyclohexyl carbamate,
1-methyl-1-cyclopropylmethyl carbamate,
1-methyl-1-(3,5-dimethoxyphenyl)ethyl carbamate,
1-methyl-1-(p-phenylazophenyl)ethyl carbamate,
1-methyl-1-phenylethyl carbamate, 1-methyl-1-(4-pyridyl)ethyl
carbamate, phenyl carbamate, p-(phenylazo)benzyl carbamate,
2,4,6-tri-t-butylphenyl carbamate, 4-(trimethylammonium)benzyl
carbamate, and 2,4,6-trimethylbenzyl carbamate.
[0064] Nitrogen protecting groups such as sulfonamide groups (e.g.,
--S(.dbd.O).sub.2R.sup.aa) include, but are not limited to,
p-toluenesulfonamide (Ts), benzenesulfonamide,
2,3,6,-trimethyl-4-methoxybenzenesulfonamide (Mtr),
2,4,6-trimethoxybenzenesulfonamide (Mtb),
2,6-dimethyl-4-methoxybenzenesulfonamide (Pme),
2,3,5,6-tetramethyl-4-methoxybenzenesulfonamide (Mte),
4-methoxybenzenesulfonamide (Mbs),
2,4,6-trimethylbenzenesulfonamide (Mts),
2,6-dimethoxy-4-methylbenzenesulfonamide (iMds),
2,2,5,7,8-pentamethylchroman-6-sulfonamide (Pmc),
methanesulfonamide (Ms), .beta.-trimethylsilylethanesulfonamide
(SES), 9-anthracenesulfonamide,
4-(4',8'-dimethoxynaphthylmethyl)benzenesulfonamide (DNMBS),
benzylsulfonamide, trifluoromethylsulfonamide, and
phenacylsulfonamide.
[0065] Other nitrogen protecting groups include, but are not
limited to, phenothiazinyl-(10)-acyl derivative,
N'-p-toluenesulfonylaminoacyl derivative, N'-phenylaminothioacyl
derivative, N-benzoylphenylalanyl derivative, N-acetylmethionine
derivative, 4,5-diphenyl-3-oxazolin-2-one, N-phthalimide,
N-dithiasuccinimide (Dts), N-2,3-diphenylmaleimide,
N-2,5-dimethylpyrrole, N-1,1,4,4-tetramethyldisilylazacyclopentane
adduct (STABASE), 5-substituted
1,3-dimethyl-1,3,5-triazacyclohexan-2-one, 5-substituted
1,3-dibenzyl-1,3,5-triazacyclohexan-2-one, 1-substituted
3,5-dinitro-4-pyridone, N-methylamine, N-allylamine,
N-[2-(trimethylsilyl)ethoxy]methylamine (SEM),
N-3-acetoxypropylamine,
N-(1-isopropyl-4-nitro-2-oxo-3-pyroolin-3-yl)amine, quaternary
ammonium salts, N-benzylamine, N-di(4-methoxyphenyl)methylamine,
N-5-dibenzosuberylamine, N-triphenylmethylamine (Tr),
N-[(4-methoxyphenyl)diphenylmethyl]amine (MMTr),
N-9-phenylfluorenylamine (PhF),
N-2,7-dichloro-9-fluorenylmethyleneamine, N-ferrocenylmethylamino
(Fcm), N-2-picolylamino N'-oxide, N-1,1-dimethylthiomethyleneamine,
N-benzylideneamine, N-p-methoxybenzylideneamine,
N-diphenylmethyleneamine, N-[(2-pyridyl)mesityl]methyleneamine,
N--(N',N'-dimethylaminomethylene)amine, N,N'-isopropylidenediamine,
N-p-nitrobenzylideneamine, N-salicylideneamine,
N-5-chlorosalicylideneamine,
N-(5-chloro-2-hydroxyphenyl)phenylmethyleneamine,
N-cyclohexylideneamine, N-(5,5-dimethyl-3-oxo-1-cyclohexenyl)amine,
N-borane derivative, N-diphenylborinic acid derivative,
N-[phenyl(pentaacylchromium- or tungsten)acyl]amine, N-copper
chelate, N-zinc chelate, N-nitroamine, N-nitrosoamine, amine
N-oxide, diphenylphosphinamide (Dpp), dimethylthiophosphinamide
(Mpt), diphenylthiophosphinamide (Ppt), dialkyl phosphoramidates,
dibenzyl phosphoramidate, diphenyl phosphoramidate,
benzenesulfenamide, o-nitrobenzenesulfenamide (Nps),
2,4-dinitrobenzenesulfenamide, pentachlorobenzenesulfenamide,
2-nitro-4-methoxybenzenesulfenamide, triphenylmethylsulfenamide,
and 3-nitropyridinesulfenamide (Npys).
[0066] Exemplary oxygen atom substituents include, but are not
limited to, --R.sup.aa, --C(.dbd.O)SR.sup.aa, --C(.dbd.O)R.sup.aa,
--CO.sub.2R.sup.aa, --C(.dbd.O)N(R.sup.bb).sub.2,
--C(.dbd.NR.sup.bb)R.sup.aa, --C(.dbd.NR.sup.bb)OR.sup.aa,
--C(.dbd.NR.sup.bb)N(R.sup.bb).sub.2, --S(.dbd.O)R.sup.aa,
--SO.sub.2R.sup.aa, --Si(R.sup.aa).sub.3, --P(R.sup.cc).sub.2,
--P(R.sup.cc).sub.3.sup.+X.sup.-, --P(OR.sup.cc).sub.2,
--P(OR.sup.cc).sub.3.sup.+X.sup.-, --P(.dbd.O)(R.sup.aa).sub.2,
--P(.dbd.O)(OR.sup.cc).sub.2, and
--P(.dbd.O)(N(R.sup.bb).sub.2).sub.2, wherein X.sup.-, R.sup.aa,
R.sup.bb, and R.sup.cc are as defined herein. In certain
embodiments, the oxygen atom substituent present on an oxygen atom
is an oxygen protecting group (also referred to as a hydroxyl
protecting group). Oxygen protecting groups are well known in the
art and include those described in detail in Protecting Groups in
Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3.sup.rd
edition, John Wiley & Sons, 1999, incorporated herein by
reference. Exemplary oxygen protecting groups include, but are not
limited to, methyl, t-butyloxycarbonyl (BOC or Boc), methoxylmethyl
(MOM), methylthiomethyl (MTM), t-butylthiomethyl,
(phenyldimethylsilyl)methoxymethyl (SMOM), benzyloxymethyl (BOM),
p-methoxybenzyloxymethyl (PMBM), (4-methoxyphenoxy)methyl (p-AOM),
guaiacolmethyl (GUM), t-butoxymethyl, 4-pentenyloxymethyl (POM),
siloxymethyl, 2-methoxyethoxymethyl (MEM),
2,2,2-trichloroethoxymethyl, bis(2-chloroethoxy)methyl,
2-(trimethylsilyl)ethoxymethyl (SEMOR), tetrahydropyranyl (THP),
3-bromotetrahydropyranyl, tetrahydrothiopyranyl,
1-methoxycyclohexyl, 4-methoxytetrahydropyranyl (MTHP),
4-methoxytetrahydrothiopyranyl, 4-methoxytetrahydrothiopyranyl
S,S-dioxide, 1-[(2-chloro-4-methyl)phenyl]-4-methoxypiperidin-4-yl
(CTMP), 1,4-dioxan-2-yl, tetrahydrofuranyl, tetrahydrothiofuranyl,
2,3,3a,4,5,6,7,7a-octahydro-7,8,8-trimethyl-4,7-methanobenzofuran-2-yl,
1-ethoxyethyl, 1-(2-chloroethoxy)ethyl, 1-methyl-1-methoxyethyl,
1-methyl-1-benzyloxyethyl, 1-methyl-1-benzyloxy-2-fluoroethyl,
2,2,2-trichloroethyl, 2-trimethylsilylethyl,
2-(phenylselenyl)ethyl, t-butyl, allyl, p-chlorophenyl,
p-methoxyphenyl, 2,4-dinitrophenyl, benzyl (Bn), p-methoxybenzyl,
3,4-dimethoxybenzyl, o-nitrobenzyl, p-nitrobenzyl, p-halobenzyl,
2,6-dichlorobenzyl, p-cyanobenzyl, p-phenylbenzyl, 2-picolyl,
4-picolyl, 3-methyl-2-picolyl N-oxido, diphenylmethyl,
p,p'-dinitrobenzhydryl, 5-dibenzosuberyl, triphenylmethyl,
.alpha.-naphthyldiphenylmethyl, p-methoxyphenyldiphenylmethyl,
di(p-methoxyphenyl)phenylmethyl, tri(p-methoxyphenyl)methyl,
4-(4'-bromophenacyloxyphenyl)diphenylmethyl,
4,4',4''-tris(4,5-dichlorophthalimidophenyl)methyl,
4,4',4''-tris(levulinoyloxyphenyl)methyl,
4,4',4''-tris(benzoyloxyphenyl)methyl,
3-(imidazol-1-yl)bis(4',4''-dimethoxyphenyl)methyl,
1,1-bis(4-methoxyphenyl)-1'-pyrenylmethyl, 9-anthryl,
9-(9-phenyl)xanthenyl, 9-(9-phenyl-10-oxo)anthryl,
1,3-benzodisulfuran-2-yl, benzisothiazolyl S,S-dioxido,
trimethylsilyl (TMS), triethylsilyl (TES), triisopropylsilyl
(TIPS), dimethylisopropylsilyl (IPDMS), diethylisopropylsilyl
(DEIPS), dimethylthexylsilyl, t-butyldimethylsilyl (TBDMS),
t-butyldiphenylsilyl (TBDPS), tribenzylsilyl, tri-p-xylylsilyl,
triphenylsilyl, diphenylmethylsilyl (DPMS),
t-butylmethoxyphenylsilyl (TBMPS), formate, benzoylformate,
acetate, chloroacetate, dichloroacetate, trichloroacetate,
trifluoroacetate, methoxyacetate, triphenylmethoxyacetate,
phenoxyacetate, p-chlorophenoxyacetate, 3-phenylpropionate,
4-oxopentanoate (levulinate), 4,4-(ethylenedithio)pentanoate
(levulinoyldithioacetal), pivaloate, adamantoate, crotonate,
4-methoxycrotonate, benzoate, p-phenylbenzoate,
2,4,6-trimethylbenzoate (mesitoate), alkyl methyl carbonate,
9-fluorenylmethyl carbonate (Fmoc), alkyl ethyl carbonate, alkyl
2,2,2-trichloroethyl carbonate (Troc), 2-(trimethylsilyl)ethyl
carbonate (TMSEC), 2-(phenylsulfonyl) ethyl carbonate (Psec),
2-(triphenylphosphonio) ethyl carbonate (Peoc), alkyl isobutyl
carbonate, alkyl vinyl carbonate alkyl allyl carbonate, alkyl
p-nitrophenyl carbonate, alkyl benzyl carbonate, alkyl
p-methoxybenzyl carbonate, alkyl 3,4-dimethoxybenzyl carbonate,
alkyl o-nitrobenzyl carbonate, alkyl p-nitrobenzyl carbonate, alkyl
S-benzyl thiocarbonate, 4-ethoxy-1-napththyl carbonate, methyl
dithiocarbonate, 2-iodobenzoate, 4-azidobutyrate,
4-nitro-4-methylpentanoate, o-(dibromomethyl)benzoate,
2-formylbenzenesulfonate, 2-(methylthiomethoxy)ethyl,
4-(methylthiomethoxy)butyrate, 2-(methylthiomethoxymethyl)benzoate,
2,6-dichloro-4-methylphenoxyacetate,
2,6-dichloro-4-(1,1,3,3-tetramethylbutyl)phenoxyacetate,
2,4-bis(1,1-dimethylpropyl)phenoxyacetate, chlorodiphenylacetate,
isobutyrate, monosuccinoate, (E)-2-methyl-2-butenoate,
o-(methoxyacyl)benzoate, a-naphthoate, nitrate, alkyl
N,N,N',N'-tetramethylphosphorodiamidate, alkyl N-phenylcarbamate,
borate, dimethylphosphinothioyl, alkyl 2,4-dinitrophenylsulfenate,
sulfate, methanesulfonate (mesylate), benzylsulfonate, and tosylate
(Ts).
[0067] Exemplary sulfur atom substituents include, but are not
limited to, --R.sup.aa, --C(.dbd.O)SR.sup.aa, --C(.dbd.O)R.sup.aa,
--CO.sub.2R.sup.aa, --C(.dbd.O)N(R.sup.bb).sub.2,
--C(.dbd.NR.sup.bb)R.sup.aa, --C(.dbd.NR.sup.bb)OR.sup.aa,
--C(.dbd.NR.sup.bb)N(R.sup.bb).sub.2, --S(.dbd.O)R.sup.aa,
--SO.sub.2R.sup.aa, --Si(R.sup.aa).sub.3, --P(R.sup.cc).sub.2,
--P(R.sup.cc).sub.3.sup.+X.sup.-, --P(OR.sup.cc).sub.2,
--P(OR.sup.cc).sub.3.sup.+X.sup.-, --P(.dbd.O)(R.sup.aa).sub.2,
--P(.dbd.O)(OR.sup.cc).sub.2, and
--P(.dbd.O)(N(R.sup.bb).sub.2).sub.2, wherein R.sup.aa, R.sup.bb,
and R.sup.cc are as defined herein. In certain embodiments, the
sulfur atom substituent present on a sulfur atom is a sulfur
protecting group (also referred to as a thiol protecting group).
Sulfur protecting groups are well known in the art and include
those described in detail in Protecting Groups in Organic
Synthesis, T. W. Greene and P. G. M. Wuts, 3.sup.rd edition, John
Wiley & Sons, 1999, incorporated herein by reference.
[0068] A "hydrocarbon chain" refers to a substituted or
unsubstituted divalent alkyl, alkenyl, or alkynyl group. A
hydrocarbon chain includes (1) one or more chains of carbon atoms
immediately between the two radicals of the hydrocarbon chain; (2)
optionally one or more hydrogen atoms on the chain(s) of carbon
atoms; and (3) optionally one or more substituents ("non-chain
substituents," which are not hydrogen) on the chain(s) of carbon
atoms. A chain of carbon atoms consists of consecutively connected
carbon atoms ("chain atoms" or "carbon units") and does not include
hydrogen atoms or heteroatoms. However, a non-chain substituent of
a hydrocarbon chain may include any atoms, including hydrogen
atoms, carbon atoms, and heteroatoms. For example, hydrocarbon
chain --C.sup.AH(C.sup.BH.sub.2C.sup.CH.sub.3)-- includes one chain
atom C.sup.A, one hydrogen atom on C.sup.A, and non-chain
substituent --(C.sup.BH.sub.2C.sup.CH.sub.3). The term "C.sub.x
hydrocarbon chain," wherein x is a positive integer, refers to a
hydrocarbon chain that includes x number of chain atom(s) between
the two radicals of the hydrocarbon chain. If there is more than
one possible value of x, the smallest possible value of x is used
for the definition of the hydrocarbon chain. For example,
--CH(C.sub.2H.sub.5)-- is a C.sub.1 hydrocarbon chain, and
##STR00008##
is a C.sub.3 hydrocarbon chain. When a range of values is used, the
meaning of the range is as described herein. For example, a
C.sub.3-10 hydrocarbon chain refers to a hydrocarbon chain where
the number of chain atoms of the shortest chain of carbon atoms
immediately between the two radicals of the hydrocarbon chain is 3,
4, 5, 6, 7, 8, 9, or 10. A hydrocarbon chain may be saturated
(e.g., --(CH.sub.2).sub.4--). A hydrocarbon chain may also be
unsaturated and include one or more C.dbd.C and/or C.ident.C bonds
anywhere in the hydrocarbon chain. For instance,
--CH.dbd.CH--(CH.sub.2).sub.2--, --CH.sub.2--C.ident.C--CH.sub.2--,
and --C.ident.C--CH.dbd.CH-- are all examples of a unsubstituted
and unsaturated hydrocarbon chain. In certain embodiments, the
hydrocarbon chain is unsubstituted (e.g., --C.ident.C-- or
--(CH.sub.2).sub.4--). In certain embodiments, the hydrocarbon
chain is substituted (e.g., --CH(C.sub.2H.sub.5)-- and
--CF.sub.2--). Any two substituents on the hydrocarbon chain may be
joined to form an optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, or
optionally substituted heteroaryl ring. For instance,
##STR00009##
are all examples of a hydrocarbon chain. In contrast, in certain
embodiments,
##STR00010##
are not within the scope of the hydrocarbon chains described
herein. When a chain atom of a C.sub.x hydrocarbon chain is
replaced with a heteroatom, the resulting group is referred to as a
C.sub.x hydrocarbon chain wherein a chain atom is replaced with a
heteroatom, as opposed to a C.sub.x-1 hydrocarbon chain. For
example,
##STR00011##
is a C.sub.3 hydrocarbon chain wherein one chain atom is replaced
with an oxygen atom.
[0069] The term "leaving group" is given its ordinary meaning in
the art of synthetic organic chemistry and refers to an atom or a
group capable of being displaced by a nucleophile. See, for
example, Smith, March Advanced Organic Chemistry 6th ed. (501-502).
Examples of suitable leaving groups include, but are not limited
to, halogen (such as F, Cl, Br, or I (iodine)), alkoxycarbonyloxy,
aryloxycarbonyloxy, alkanesulfonyloxy, arenesulfonyloxy,
alkyl-carbonyloxy (e.g., acetoxy), arylcarbonyloxy, aryloxy,
methoxy, N,O-dimethylhydroxylamino, pixyl, and haloformates.
Exemplary leaving groups include, but are not limited to, activated
substituted hydroxyl groups (e.g., --OC(.dbd.O)SR.sup.aa,
--OC(.dbd.O)R.sup.aa, --OCO.sub.2R.sup.aa,
--OC(.dbd.O)N(R.sup.bb).sub.2, --OC(.dbd.NR.sup.bb)R.sup.aa,
--OC(.dbd.NR.sup.bb)OR.sup.aa,
--OC(.dbd.NR.sup.bb)N(R.sup.bb).sub.2, --OS(.dbd.O)R.sup.aa,
--OSO.sub.2R.sup.aa, --OP(R.sup.cc).sub.2, --OP(R.sup.cc).sub.3,
--OP(.dbd.O).sub.2R.sup.aa, --OP(.dbd.O)(R.sup.aa).sub.2,
--OP(.dbd.O)(OR.sup.cc).sub.2, --OP(.dbd.O).sub.2N(R.sup.bb).sub.2,
and --OP(.dbd.O)(NR.sup.bb).sub.2, wherein R.sup.aa, R.sup.bb, and
R.sup.cc are as defined herein). In some cases, the leaving group
is a sulfonic acid ester, such as toluenesulfonate (tosylate,
--OTs), methanesulfonate (mesylate, --OMs),
p-bromobenzenesulfonyloxy (brosylate, --OBs),
--OS(.dbd.O).sub.2(CF.sub.2).sub.3CF.sub.3 (nonaflate, --ONf), or
trifluoromethanesulfonate (triflate, --OTf). In some cases, the
leaving group is a brosylate, such as p-bromobenzenesulfonyloxy. In
some cases, the leaving group is a nosylate, such as
2-nitrobenzenesulfonyloxy. The leaving group may also be a
phosphineoxide (e.g., formed during a Mitsunobu reaction) or an
internal leaving group such as an epoxide or cyclic sulfate. Other
non-limiting examples of leaving groups are water, ammonia,
alcohols, ether moieties, thioether moieties, zinc halides,
magnesium moieties, diazonium salts, and copper moieties.
Other Definitions
[0070] The term "pharmaceutically acceptable salt" refers to those
salts which are, within the scope of sound medical judgment,
suitable for use in contact with the tissues of humans and lower
animals without undue toxicity, irritation, allergic response, and
the like, and are commensurate with a reasonable benefit/risk
ratio. Pharmaceutically acceptable salts are well known in the art.
For example, Berge et al. describe pharmaceutically acceptable
salts in detail in J. Pharmaceutical Sciences, 1977, 66, 1-19,
incorporated herein by reference. Pharmaceutically acceptable salts
of the compounds described herein include those derived from
suitable inorganic and organic acids and bases. Examples of
pharmaceutically acceptable, nontoxic acid addition salts are salts
of an amino group formed with inorganic acids such as hydrochloric
acid, hydrobromic acid, phosphoric acid, sulfuric acid, and
perchloric acid or with organic acids such as acetic acid, oxalic
acid, maleic acid, tartaric acid, citric acid, succinic acid, or
malonic acid or by using other methods known in the art such as ion
exchange. Other pharmaceutically acceptable salts include adipate,
alginate, ascorbate, aspartate, benzenesulfonate, benzoate,
bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate,
cyclopentanepropionate, digluconate, dodecylsulfate,
ethanesulfonate, formate, fumarate, glucoheptonate,
glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate,
hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate,
laurate, lauryl sulfate, malate, maleate, malonate,
methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate,
oleate, oxalate, palmitate, pamoate, pectinate, persulfate,
3-phenylpropionate, phosphate, picrate, pivalate, propionate,
stearate, succinate, sulfate, tartrate, thiocyanate,
p-toluenesulfonate, undecanoate, valerate salts, and the like.
Salts derived from appropriate bases include alkali metal, alkaline
earth metal, ammonium and N.sup.+(C.sub.1-4 alkyl).sub.4.sup.-
salts. Representative alkali or alkaline earth metal salts include
sodium, lithium, potassium, calcium, magnesium, and the like.
Further pharmaceutically acceptable salts include, when
appropriate, nontoxic ammonium, quaternary ammonium, and amine
cations formed using counterions such as halide, hydroxide,
carboxylate, sulfate, phosphate, nitrate, lower alkyl sulfonate,
and aryl sulfonate.
[0071] The term "solvate" refers to forms of the compound that are
associated with a solvent, usually by a solvolysis reaction. This
physical association may include hydrogen bonding. Conventional
solvents include water, methanol, ethanol, acetic acid, DMSO, THF,
diethyl ether, and the like. The compounds described herein may be
prepared, e.g., in crystalline form, and may be solvated. Suitable
solvates include pharmaceutically acceptable solvates and further
include both stoichiometric solvates and non-stoichiometric
solvates. In certain instances, the solvate will be capable of
isolation, for example, when one or more solvent molecules are
incorporated in the crystal lattice of a crystalline solid.
"Solvate" encompasses both solution-phase and isolatable solvates.
Representative solvates include hydrates, ethanolates, and
methanolates.
[0072] The term "hydrate" refers to a compound that is associated
with water. Typically, the number of the water molecules contained
in a hydrate of a compound is in a definite ratio to the number of
the compound molecules in the hydrate. Therefore, a hydrate of a
compound may be represented, for example, by the general formula
R.x H.sub.2O, wherein R is the compound, and x is a number greater
than 0. A given compound may form more than one type of hydrate,
including, e.g., monohydrates (x is 1), lower hydrates (x is a
number greater than 0 and smaller than 1, e.g., hemihydrates (R.0.5
H.sub.2O)), and polyhydrates (x is a number greater than 1, e.g.,
dihydrates (R.2 H.sub.2O) and hexahydrates (R.6 H.sub.2O)).
[0073] The term "tautomers" or "tautomeric" refers to two or more
interconvertible compounds resulting from at least one formal
migration of a hydrogen atom and at least one change in valency
(e.g., a single bond to a double bond, a triple bond to a single
bond, or vice versa). The exact ratio of the tautomers depends on
several factors, including temperature, solvent, and pH.
Tautomerizations (i.e., the reaction providing a tautomeric pair)
may catalyzed by acid or base. Exemplary tautomerizations include
keto-to-enol, amide-to-imide, lactam-to-lactim, enamine-to-imine,
and enamine-to-(a different enamine) tautomerizations.
[0074] It is also to be understood that compounds that have the
same molecular formula but differ in the nature or sequence of
bonding of their atoms or the arrangement of their atoms in space
are termed "isomers". Isomers that differ in the arrangement of
their atoms in space are termed "stereoisomers".
[0075] Stereoisomers that are not mirror images of one another are
termed "diastereomers" and those that are non-superimposable mirror
images of each other are termed "enantiomers". When a compound has
an asymmetric center, for example, it is bonded to four different
groups, a pair of enantiomers is possible. An enantiomer can be
characterized by the absolute configuration of its asymmetric
center and is described by the R- and S-sequencing rules of Cahn
and Prelog, or by the manner in which the molecule rotates the
plane of polarized light and designated as dextrorotatory or
levorotatory (i.e., as (+) or (-)-isomers respectively). A chiral
compound can exist as either individual enantiomer or as a mixture
thereof. A mixture containing equal proportions of the enantiomers
is called a "racemic mixture".
[0076] The term "polymorphs" refers to a crystalline form of a
compound (or a salt, hydrate, or solvate thereof) in a particular
crystal packing arrangement. All polymorphs have the same elemental
composition. Different crystalline forms usually have different
X-ray diffraction patterns, infrared spectra, melting points,
density, hardness, crystal shape, optical and electrical
properties, stability, and solubility. Recrystallization solvent,
rate of crystallization, storage temperature, and other factors may
cause one crystal form to dominate. Various polymorphs of a
compound can be prepared by crystallization under different
conditions.
[0077] The term "co-crystal" refers to a crystalline structure
composed of at least two components. In certain embodiments, a
co-crystal may contain a compound of the present invention and one
or more other component, including but not limited to, atoms, ions,
molecules, or solvent molecules. In certain embodiments, a
co-crystal may contain a compound of the present invention and one
or more components related to said compound, including not limited
to, an isomer, tautomer, salt, solvate, hydrate, synthetic
precursor, synthetic derivative, fragment or impurity of said
compound.
[0078] The term "isotopically labeled derivative" or "isotopically
labeled" refers to a compound wherein one or more atoms in the
compound (or in an associated ion or molecule of a salt, hydrate,
or solvate) has been replaced with an isotope of the same element.
For the given element or position in the molecule the isotope will
be enriched, or present in a higher percentage of all atoms of the
element or of all atoms at the position in the molecule in a
sample, relative to an unlabeled variant. In certain embodiments,
the enriched isotope will be a stable isotope. In certain
embodiments, the enriched isotope will be an unstable or
radioactive isotope (e.g., a radionuclide). In certain embodiments,
the enriched isotope may be detected by a measurement technique,
including but not limited to nuclear magnetic resonance, mass
spectrometry, infrared spectroscopy, or a technique that measures
radioactive decay.
[0079] The term "prodrugs" refers to compounds that have cleavable
groups and become by solvolysis or under physiological conditions
the compounds described herein, which are pharmaceutically active
in vivo. Such examples include, but are not limited to, choline
ester derivatives and the like, N-alkylmorpholine esters and the
like. Other derivatives of the compounds described herein have
activity in both their acid and acid derivative forms, but in the
acid sensitive form often offer advantages of solubility, tissue
compatibility, or delayed release in the mammalian organism (see,
Bundgard, H., Design of Prodrugs, pp. 7-9, 21-24, Elsevier,
Amsterdam 1985). Prodrugs include acid derivatives well known to
practitioners of the art, such as, for example, esters prepared by
reaction of the parent acid with a suitable alcohol, or amides
prepared by reaction of the parent acid compound with a substituted
or unsubstituted amine, or acid anhydrides, or mixed anhydrides.
Simple aliphatic or aromatic esters, amides, and anhydrides derived
from acidic groups pendant on the compounds described herein are
particular prodrugs. In some cases it is desirable to prepare
double ester type prodrugs such as (acyloxy)alkyl esters or
((alkoxycarbonyl)oxy)alkylesters. C.sub.1-C.sub.8 alkyl,
C.sub.2-C.sub.8alkenyl, C.sub.2-C.sub.8alkynyl, aryl,
C.sub.7-C.sub.12 substituted aryl, and C.sub.7-C.sub.12 arylalkyl
esters of the compounds described herein may be preferred.
[0080] The term "inhibition", "inhibiting", "inhibit," or
"inhibitor" refer to the ability of a compound to reduce, slow,
halt or prevent activity of a particular biological process (e.g.,
activity of a bromodomain and/or a bromodomain-containing protein)
in a cell relative to vehicle.
[0081] When a compound, pharmaceutical composition, method, use, or
kit is referred to as "selectively," "specifically," or
"competitively" binding a first protein or a first chromatin, the
compound, pharmaceutical composition, method, use, or kit binds the
first protein or the first chromatin with a higher binding affinity
(e.g., not less than about 2-fold, not less than about 5-fold, not
less than about 10-fold, not less than about 30-fold, not less than
about 100-fold, not less than about 1,000-fold, or not less than
about 10,000-fold) than binding a second protein or second
chromatin that is different from the first protein and the first
chromatin. When a compound, pharmaceutical composition, method,
use, or kit is referred to as "selectively," "specifically," or
"competitively" modulating (e.g., increasing or inhibiting) the
activity of a bromodomain-containing protein, the compound,
pharmaceutical composition, method, use, or kit modulates the
activity of the bromodomain-containing protein to a greater extent
(e.g., not less than about 2-fold, not less than about 5-fold, not
less than about 10-fold, not less than about 30-fold, not less than
about 100-fold, not less than about 1,000-fold, or not less than
about 10,000-fold) than the activity of at least one protein that
is different from the bromodomain-containing protein.
[0082] The term "aberrant activity" refers to activity deviating
from normal activity, that is, abnormal activity. The term
"increased activity" refers to activity higher than normal
activity.
[0083] The terms "composition" and "formulation" are used
interchangeably.
[0084] A "subject" to which administration is contemplated refers
to a human (i.e., male or female of any age group, e.g., pediatric
subject (e.g., infant, child, or adolescent) or adult subject
(e.g., young adult, middle-aged adult, or senior adult)) or
non-human animal. In certain embodiments, the non-human animal is a
mammal (e.g., primate (e.g., cynomolgus monkey or rhesus monkey),
commercially relevant mammal (e.g., cattle, pig, horse, sheep,
goat, cat, or dog), or bird (e.g., commercially relevant bird, such
as chicken, duck, goose, or turkey)). In certain embodiments, the
non-human animal is a fish, reptile, or amphibian. The non-human
animal may be a male or female at any stage of development. The
non-human animal may be a transgenic animal or genetically
engineered animal. A "patient" refers to a human subject in need of
treatment of a disease. The subject may also be a plant. In certain
embodiments, the plant is a land plant. In certain embodiments, the
plant is a non-vascular land plant. In certain embodiments, the
plant is a vascular land plant. In certain embodiments, the plant
is a seed plant. In certain embodiments, the plant is a cultivated
plant. In certain embodiments, the plant is a dicot. In certain
embodiments, the plant is a monocot. In certain embodiments, the
plant is a flowering plant. In some embodiments, the plant is a
cereal plant, e.g., maize, corn, wheat, rice, oat, barley, rye, or
millet. In some embodiments, the plant is a legume, e.g., a bean
plant, e.g., soybean plant. In some embodiments, the plant is a
tree or shrub.
[0085] The term "biological sample" refers to any sample including
tissue samples (such as tissue sections and needle biopsies of a
tissue); cell samples (e.g., cytological smears (such as Pap or
blood smears) or samples of cells obtained by microdissection);
samples of whole organisms (such as samples of yeasts or bacteria);
or cell fractions, fragments or organelles (such as obtained by
lysing cells and separating the components thereof by
centrifugation or otherwise). Other examples of biological samples
include blood, serum, urine, semen, fecal matter, cerebrospinal
fluid, interstitial fluid, mucous, tears, sweat, pus, biopsied
tissue (e.g., obtained by a surgical biopsy or needle biopsy),
nipple aspirates, milk, vaginal fluid, saliva, swabs (such as
buccal swabs), or any material containing biomolecules that is
derived from another biological sample.
[0086] The terms "administer," "administering," or "administration"
refers to implanting, absorbing, ingesting, injecting, inhaling, or
otherwise introducing a compound described herein, or a composition
thereof, into, in, or on a subject.
[0087] The terms "treatment," "treat," and "treating" refer to
reversing, alleviating, delaying the onset of, or inhibiting the
progress of a disease described herein. In some embodiments,
treatment may be administered after one or more signs or symptoms
of the disease have developed or have been observed. In other
embodiments, treatment may be administered in the absence of signs
or symptoms of the disease. For example, treatment may be
administered to a susceptible subject prior to the onset of
symptoms (e.g., in light of a history of symptoms and/or in light
of exposure to a pathogen). Treatment may also be continued after
symptoms have resolved, for example, to delay or prevent
recurrence.
[0088] The terms "condition," "disease," and "disorder" are used
interchangeably.
[0089] An "effective amount" of a compound described herein refers
to an amount sufficient to elicit the desired biological response,
i.e., treating the condition. As will be appreciated by those of
ordinary skill in this art, the effective amount of a compound
described herein may vary depending on such factors as the desired
biological endpoint, the pharmacokinetics of the compound, the
condition being treated, the mode of administration, and the age
and health of the subject. In certain embodiments, an effective
amount is a therapeutically effective amount. In certain
embodiments, an effective amount is a prophylactic treatment. In
certain embodiments, an effective amount is the amount of a
compound described herein in a single dose. In certain embodiments,
an effective amount is the combined amounts of a compound described
herein in multiple doses.
[0090] A "therapeutically effective amount" of a compound described
herein is an amount sufficient to provide a therapeutic benefit in
the treatment of a condition or to delay or minimize one or more
symptoms associated with the condition. A therapeutically effective
amount of a compound means an amount of therapeutic agent, alone or
in combination with other therapies, which provides a therapeutic
benefit in the treatment of the condition. The term
"therapeutically effective amount" can encompass an amount that
improves overall therapy, reduces or avoids symptoms, signs, or
causes of the condition, and/or enhances the therapeutic efficacy
of another therapeutic agent.
[0091] A "prophylactically effective amount" of a compound
described herein is an amount sufficient to prevent a condition, or
one or more symptoms associated with the condition or prevent its
recurrence. A prophylactically effective amount of a compound means
an amount of a therapeutic agent, alone or in combination with
other agents, which provides a prophylactic benefit in the
prevention of the condition. The term "prophylactically effective
amount" can encompass an amount that improves overall prophylaxis
or enhances the prophylactic efficacy of another prophylactic
agent.
[0092] A "proliferative disease" refers to a disease that occurs
due to abnormal growth or extension by the multiplication of cells
(Walker, Cambridge Dictionary of Biology; Cambridge University
Press: Cambridge, UK, 1990). A proliferative disease may be
associated with: 1) the pathological proliferation of normally
quiescent cells; 2) the pathological migration of cells from their
normal location (e.g., metastasis of neoplastic cells); 3) the
pathological expression of proteolytic enzymes such as the matrix
metalloproteinases (e.g., collagenases, gelatinases, and
elastases); or 4) the pathological angiogenesis as in proliferative
retinopathy and tumor metastasis. Exemplary proliferative diseases
include cancers (i.e., "malignant neoplasms"), benign neoplasms,
diseases associated with angiogenesis, inflammatory diseases, and
autoimmune diseases.
[0093] The term "angiogenesis" refers to the physiological process
through which new blood vessels form from pre-existing vessels.
Angiogenesis is distinct from vasculogenesis, which is the de novo
formation of endothelial cells from mesoderm cell precursors. The
first vessels in a developing embryo form through vasculogenesis,
after which angiogenesis is responsible for most blood vessel
growth during normal or abnormal development. Angiogenesis is a
vital process in growth and development, as well as in wound
healing and in the formation of granulation tissue. However,
angiogenesis is also a fundamental step in the transition of tumors
from a benign state to a malignant one, leading to the use of
angiogenesis inhibitors in the treatment of cancer. Angiogenesis
may be chemically stimulated by angiogenic proteins, such as growth
factors (e.g., VEGF). "Pathological angiogenesis" refers to
abnormal (e.g., excessive or insufficient) angiogenesis that
amounts to and/or is associated with a disease.
[0094] The terms "neoplasm" and "tumor" are used herein
interchangeably and refer to an abnormal mass of tissue wherein the
growth of the mass surpasses and is not coordinated as in the
growth of normal tissue. A neoplasm or tumor may be "benign" or
"malignant," depending on the following characteristics: degree of
cellular differentiation (including morphology and functionality),
rate of growth, local invasion, and metastasis. A "benign neoplasm"
is generally well differentiated, has characteristically slower
growth than a malignant neoplasm, and remains localized to the site
of origin. In addition, a benign neoplasm does not have the
capacity to infiltrate, invade, or metastasize to distant sites.
Exemplary benign neoplasms include, but are not limited to, lipoma,
chondroma, adenomas, acrochordon, senile angiomas, seborrheic
keratoses, lentigos, and sebaceous hyperplasias. In some cases,
certain "benign" tumors may later give rise to malignant neoplasms,
which may result from additional genetic changes in a subpopulation
of the tumor's neoplastic cells, and these tumors are referred to
as "pre-malignant neoplasms." An exemplary pre-malignant neoplasm
is a teratoma. In contrast, a "malignant neoplasm" is generally
poorly differentiated (anaplasia) and has characteristically rapid
growth accompanied by progressive infiltration, invasion, and
destruction of the surrounding tissue. Furthermore, a malignant
neoplasm generally has the capacity to metastasize to distant
sites. The term "metastasis," "metastatic," or "metastasize" refers
to the spread or migration of cancerous cells from a primary or
original tumor to another organ or tissue and is typically
identifiable by the presence of a "secondary tumor" or "secondary
cell mass" of the tissue type of the primary or original tumor and
not of that of the organ or tissue in which the secondary
(metastatic) tumor is located. For example, a prostate cancer that
has migrated to bone is said to be metastasized prostate cancer and
includes cancerous prostate cancer cells growing in bone
tissue.
[0095] The term "cancer" refers to a class of diseases
characterized by the development of abnormal cells that proliferate
uncontrollably and have the ability to infiltrate and destroy
normal body tissues. See, e.g., Stedman's Medical Dictionary, 25th
ed.; Hensyl ed.; Williams & Wilkins: Philadelphia, 1990.
Exemplary cancers include, but are not limited to, hematological
malignancies. Additional exemplary cancers include, but are not
limited to, acoustic neuroma; adenocarcinoma; adrenal gland cancer;
anal cancer; angiosarcoma (e.g., lymphangiosarcoma,
lymphangioendotheliosarcoma, hemangiosarcoma); appendix cancer;
benign monoclonal gammopathy; biliary cancer (e.g.,
cholangiocarcinoma); bladder cancer; breast cancer (e.g.,
adenocarcinoma of the breast, papillary carcinoma of the breast,
mammary cancer, medullary carcinoma of the breast, triple negative
breast cancer (TNBC)); brain cancer (e.g., meningioma,
glioblastomas, glioma (e.g., astrocytoma, oligodendroglioma),
medulloblastoma); bronchus cancer; carcinoid tumor; cervical cancer
(e.g., cervical adenocarcinoma); choriocarcinoma; chordoma;
craniopharyngioma; colorectal cancer (e.g., colon cancer, rectal
cancer, colorectal adenocarcinoma); connective tissue cancer;
epithelial carcinoma; ependymoma; endotheliosarcoma (e.g., Kaposi's
sarcoma, multiple idiopathic hemorrhagic sarcoma); endometrial
cancer (e.g., uterine cancer, uterine sarcoma); esophageal cancer
(e.g., adenocarcinoma of the esophagus, Barrett's adenocarcinoma);
Ewing's sarcoma; ocular cancer (e.g., intraocular melanoma,
retinoblastoma); familiar hypereosinophilia; gall bladder cancer;
gastric cancer (e.g., stomach adenocarcinoma); gastrointestinal
stromal tumor (GIST); germ cell cancer; head and neck cancer (e.g.,
head and neck squamous cell carcinoma, oral cancer (e.g., oral
squamous cell carcinoma), throat cancer (e.g., laryngeal cancer,
pharyngeal cancer, nasopharyngeal cancer, oropharyngeal cancer));
heavy chain disease (e.g., alpha chain disease, gamma chain
disease, mu chain disease; hemangioblastoma; hypopharynx cancer;
inflammatory myofibroblastic tumors; immunocytic amyloidosis;
kidney cancer (e.g., nephroblastoma a.k.a. Wilms' tumor, renal cell
carcinoma); liver cancer (e.g., hepatocellular cancer (HCC),
malignant hepatoma); lung cancer (e.g., bronchogenic carcinoma,
small cell lung cancer (SCLC), non-small cell lung cancer (NSCLC),
adenocarcinoma of the lung); leiomyosarcoma (LMS); mastocytosis
(e.g., systemic mastocytosis); muscle cancer; myelodysplastic
syndrome (MDS); mesothelioma; myeloproliferative disorder (MPD)
(e.g., polycythemia vera (PV), essential thrombocytosis (ET),
agnogenic myeloid metaplasia (AMM) a.k.a. myelofibrosis (MF),
chronic idiopathic myelofibrosis, chronic myelocytic leukemia
(CML), chronic neutrophilic leukemia (CNL), hypereosinophilic
syndrome (HES)); neuroblastoma; neurofibroma (e.g.,
neurofibromatosis (NF) type 1 or type 2, schwannomatosis);
neuroendocrine cancer (e.g., gastroenteropancreatic neuroendocrine
tumor (GEP-NET), carcinoid tumor); osteosarcoma (e.g., bone
cancer); ovarian cancer (e.g., cystadenocarcinoma, ovarian
embryonal carcinoma, ovarian adenocarcinoma); papillary
adenocarcinoma; pancreatic cancer (e.g., pancreatic
andenocarcinoma, intraductal papillary mucinous neoplasm (IPMN),
Islet cell tumors); penile cancer (e.g., Paget's disease of the
penis and scrotum); pinealoma; primitive neuroectodermal tumor
(PNT); plasma cell neoplasia; paraneoplastic syndromes;
intraepithelial neoplasms; prostate cancer (e.g., prostate
adenocarcinoma); rectal cancer; rhabdomyosarcoma; salivary gland
cancer; skin cancer (e.g., squamous cell carcinoma (SCC),
keratoacanthoma (KA), melanoma, basal cell carcinoma (BCC)); small
bowel cancer (e.g., appendix cancer); soft tissue sarcoma (e.g.,
malignant fibrous histiocytoma (MFH), liposarcoma, malignant
peripheral nerve sheath tumor (MPNST), chondrosarcoma,
fibrosarcoma, myxosarcoma); sebaceous gland carcinoma; small
intestine cancer; sweat gland carcinoma; synovioma; testicular
cancer (e.g., seminoma, testicular embryonal carcinoma); thyroid
cancer (e.g., papillary carcinoma of the thyroid, papillary thyroid
carcinoma (PTC), medullary thyroid cancer); urethral cancer;
vaginal cancer; and vulvar cancer (e.g., Paget's disease of the
vulva).
[0096] The term "hematological malignancy" refers to tumors that
affect blood, bone marrow, and/or lymph nodes. Exemplary
hematological malignancies include, but are not limited to,
leukemia, such as acute lymphoblastic leukemia (ALL) (e.g., B-cell
ALL, T-cell ALL), acute myelocytic leukemia (AML) (e.g., B-cell
AML, T-cell AML), chronic myelocytic leukemia (CML) (e.g., B-cell
CML, T-cell CML), and chronic lymphocytic leukemia (CLL) (e.g.,
B-cell CLL, T-cell CLL)); lymphoma, such as Hodgkin lymphoma (HL)
(e.g., B-cell HL, T-cell HL) and non-Hodgkin lymphoma (NHL) (e.g.,
B-cell NHL, such as diffuse large cell lymphoma (DLCL) (e.g.,
diffuse large B-cell lymphoma (DLBCL, e.g., activated B-cell (ABC)
DLBCL (ABC-DLBCL))), follicular lymphoma, chronic lymphocytic
leukemia/small lymphocytic lymphoma (CLL/SLL), mantle cell lymphoma
(MCL), marginal zone B-cell lymphoma (e.g., mucosa-associated
lymphoid tissue (MALT) lymphoma, nodal marginal zone B-cell
lymphoma, splenic marginal zone B-cell lymphoma), primary
mediastinal B-cell lymphoma, Burkitt's lymphoma, Waldenstrom's
macroglobulinemia (WM, lymphoplasmacytic lymphoma), hairy cell
leukemia (HCL), immunoblastic large cell lymphoma, precursor
B-lymphoblastic lymphoma, central nervous system (CNS) lymphoma
(e.g., primary CNS lymphoma and secondary CNS lymphoma); and T-cell
NHL, such as precursor T-lymphoblastic lymphoma/leukemia,
peripheral T-cell lymphoma (PTCL) (e.g., cutaneous T-cell lymphoma
(CTCL) (e.g., mycosis fungoides, Sezary syndrome),
angioimmunoblastic T-cell lymphoma, extranodal natural killer
T-cell lymphoma, enteropathy type T-cell lymphoma, subcutaneous
panniculitis-like T-cell lymphoma, and anaplastic large cell
lymphoma); lymphoma of an immune privileged site (e.g., cerebral
lymphoma, ocular lymphoma, lymphoma of the placenta, lymphoma of
the fetus, testicular lymphoma); a mixture of one or more
leukemia/lymphoma as described above; myelodysplasia; and multiple
myeloma (MM).
[0097] The term "inflammatory disease" refers to a disease caused
by, resulting from, or resulting in inflammation. The term
"inflammatory disease" may also refer to a dysregulated
inflammatory reaction that causes an exaggerated response by
macrophages, granulocytes, and/or T-lymphocytes leading to abnormal
tissue damage and/or cell death. An inflammatory disease can be
either an acute or chronic inflammatory condition and can result
from infections or non-infectious causes. Inflammatory diseases
include, without limitation, atherosclerosis, arteriosclerosis,
autoimmune disorders, multiple sclerosis, systemic lupus
erythematosus, polymyalgia rheumatica (PMR), gouty arthritis,
degenerative arthritis, tendonitis, bursitis, psoriasis, cystic
fibrosis, arthrosteitis, rheumatoid arthritis, inflammatory
arthritis, Sjogren's syndrome, giant cell arteritis, progressive
systemic sclerosis (scleroderma), ankylosing spondylitis,
polymyositis, dermatomyositis, pemphigus, pemphigoid, diabetes
(e.g., Type I), myasthenia gravis, Hashimoto's thyroiditis, Graves'
disease, Goodpasture's disease, mixed connective tissue disease,
sclerosing cholangitis, inflammatory bowel disease, Crohn's
disease, ulcerative colitis, pernicious anemia, inflammatory
dermatoses, usual interstitial pneumonitis (UIP), asbestosis,
silicosis, bronchiectasis, berylliosis, talcosis, pneumoconiosis,
sarcoidosis, desquamative interstitial pneumonia, lymphoid
interstitial pneumonia, giant cell interstitial pneumonia, cellular
interstitial pneumonia, extrinsic allergic alveolitis, Wegener's
granulomatosis and related forms of angiitis (temporal arteritis
and polyarteritis nodosa), inflammatory dermatoses, hepatitis,
delayed-type hypersensitivity reactions (e.g., poison ivy
dermatitis), pneumonia, respiratory tract inflammation, Adult
Respiratory Distress Syndrome (ARDS), encephalitis, immediate
hypersensitivity reactions, asthma, hay fever, allergies, acute
anaphylaxis, rheumatic fever, glomerulonephritis, pyelonephritis,
cellulitis, cystitis, chronic cholecystitis, ischemia (ischemic
injury), reperfusion injury, allograft rejection, host-versus-graft
rejection, appendicitis, arteritis, blepharitis, bronchiolitis,
bronchitis, cervicitis, cholangitis, chorioamnionitis,
conjunctivitis, dacryoadenitis, dermatomyositis, endocarditis,
endometritis, enteritis, enterocolitis, epicondylitis,
epididymitis, fasciitis, fibrositis, gastritis, gastroenteritis,
gingivitis, ileitis, iritis, laryngitis, myelitis, myocarditis,
nephritis, omphalitis, oophoritis, orchitis, osteitis, otitis,
pancreatitis, parotitis, pericarditis, pharyngitis, pleuritis,
phlebitis, pneumonitis, proctitis, prostatitis, rhinitis,
salpingitis, sinusitis, stomatitis, synovitis, testitis,
tonsillitis, urethritis, urocystitis, uveitis, vaginitis,
vasculitis, vulvitis, vulvovaginitis, angitis, chronic bronchitis,
osteomyelitis, optic neuritis, temporal arteritis, transverse
myelitis, necrotizing fasciitis, and necrotizing enterocolitis.
[0098] An "autoimmune disease" refers to a disease arising from an
inappropriate immune response of the body of a subject against
substances and tissues normally present in the body. In other
words, the immune system mistakes some part of the body as a
pathogen and attacks its own cells. This may be restricted to
certain organs (e.g., in autoimmune thyroiditis) or involve a
particular tissue in different places (e.g., Goodpasture's disease
which may affect the basement membrane in both the lung and
kidney). The treatment of autoimmune diseases is typically with
immunosuppression, e.g., medications which decrease the immune
response. Exemplary autoimmune diseases include, but are not
limited to, glomerulonephritis, Goodpasture's syndrome, necrotizing
vasculitis, lymphadenitis, peri-arteritis nodosa, systemic lupus
erythematosis, rheumatoid arthritis, psoriatic arthritis, systemic
lupus erythematosis, psoriasis, ulcerative colitis, systemic
sclerosis, dermatomyositis/polymyositis, anti-phospholipid antibody
syndrome, scleroderma, pemphigus vulgaris, ANCA-associated
vasculitis (e.g., Wegener's granulomatosis, microscopic
polyangiitis), uveitis, Sjogren's syndrome, Crohn's disease,
Reiter's syndrome, ankylosing spondylitis, Lyme disease,
Guillain-Barre syndrome, Hashimoto's thyroiditis, and
cardiomyopathy.
[0099] The term "kinase" is a type of enzyme that transfers
phosphate groups from high energy donor molecules, such as ATP, to
specific substrates, referred to as phosphorylation. Kinases are
part of the larger family of phosphotransferases. One of the
largest groups of kinases are protein kinases, which act on and
modify the activity of specific proteins. Kinases are used
extensively to transmit signals and control complex processes in
cells. Various other kinases act on small molecules such as lipids,
carbohydrates, amino acids, and nucleotides, either for signaling
or to prime them for metabolic pathways. Kinases are often named
after their substrates. More than 500 different protein kinases
have been identified in humans. Exemplary human protein kinases
include, but are not limited to, AAK1, ABL, ACK, ACTR2, ACTR2B,
AKT1, AKT2, AKT3, ALK, ALK1, ALK2, ALK4, ALK7, AMPKa1, AMPKa2,
ANKRD3, ANPa, ANPb, ARAF, ARAFps, ARG, AurA, AurAps1, AurAps2,
AurB, AurBpsl, AurC, AXL, BARK1, BARK2, BIKE, BLK, BMPR1A,
BMPR1Aps1, BMPR1Aps2, BMPR1B, BMPR2, BMX, BRAF, BRAFps, BRK, BRSK1,
BRSK2, BTK, BUB1, BUBR1, CaMKla, CaMK1b, CaMK1d, CaMK1g, CaMK2a,
CaMK2b, CaMK2d, CaMK2g, CaMK4, CaMKK1, CaMKK2, caMLCK, CASK, CCK4,
CCRK, CDCl.sub.2, CDCl.sub.7, CDK10, CDK11, CDK2, CDK3, CDK4,
CDK4ps, CDK5, CDK5ps, CDK6, CDK7, CDK7ps, CDK8, CDK8ps, CDK9,
CDKL1, CDKL2, CDKL3, CDKL4, CDKL5, CGDps, CHED, CHK1, CHK2,
CHK2ps1, CHK2ps2, CKla, CKla2, CKlaps1, CKlaps2, CKlaps3, CKld,
CKle, CKlg1, CK1g2, CKlg2ps, CK1g3, CK2a1, CK2a1-rs, CK2a2, CLIK1,
CLIKIL, CLK1, CLK2, CLK2ps, CLK3, CLK3ps, CLK4, COT, CRIK, CRK7,
CSK, CTK, CYGD, CYGF, DAPK1, DAPK2, DAPK3, DCAMKL1, DCAMKL2,
DCAMKL3, DDR1, DDR2, DLK, DMPK1, DMPK2, DRAK1, DRAK2, DYRKIA,
DYRKIB, DYRK2, DYRK3, DYRK4, EGFR, EphA1, EphA10, EphA2, EphA3,
EphA4, EphA5, EphA6, EphA7, EphA8, EphB1, EphB2, EphB3, EphB4,
EphB6, Erk1, Erk2, Erk3, Erk3ps1, Erk3ps2, Erk3ps3, Erk3ps4, Erk4,
Erk5, Erk7, FAK, FER, FERps, FES, FGFR1, FGFR2, FGFR3, FGFR4, FGR,
FLT1, FLT1ps, FLT3, FLT4, FMS, FRK, Fused, FYN, GAK, GCK, GCN2,
GCN22, GPRK4, GPRK5, GPRK6, GPRK6ps, GPRK7, GSK3A, GSK3B, Haspin,
HCK, HER2/ErbB2, HER3/ErbB3, HER4/ErbB4, HH498, HIPK1, HIPK2,
HIPK3, HIPK4, HPK1, HRI, HRIps, HSER, HUNK, ICK, IGF1R, IKKa, IKKb,
IKKe, ILK, INSR, IRAK1, IRAK2, IRAK3, IRAK4, IRE1, IRE2, IRR, ITK,
JAK1, JAK2, JAK3, JNK1, JNK2, JNK3, KDR, KHS1, KHS2, KIS, KIT,
KSGCps, KSR1, KSR2, LATS1, LATS2, LCK, LIMK1, LIMK2, LIMK2ps, LKB1,
LMR1, LMR2, LMR3, LOK, LRRK1, LRRK2, LTK, LYN, LZK, MAK, MAP2K1,
MAP2K1ps, MAP2K2, MAP2K2ps, MAP2K3, MAP2K4, MAP2K5, MAP2K6, MAP2K7,
MAP3K1, MAP3K2, MAP3K3, MAP3K4, MAP3K5, MAP3K6, MAP3K7, MAP3K8,
MAPKAPK2, MAPKAPK3, MAPKAPK5, MAPKAPKps1, MARK1, MARK2, MARK3,
MARK4, MARKps01, MARKps02, MARKps03, MARKps04, MARKps05, MARKps07,
MARKps08, MARKps09, MARKps10, MARKps11, MARKps12, MARKps13,
MARKps15, MARKps16, MARKps17, MARKps18, MARKps19, MARKps20,
MARKps21, MARKps22, MARKps23, MARKps24, MARKps25, MARKps26,
MARKps27, MARKps28, MARKps29, MARKps30, MAST1, MAST2, MAST3, MAST4,
MASTL, MELK, MER, MET, MISR2, MLK1, MLK2, MLK3, MLK4, MLKL, MNK1,
MNK1ps, MNK2, MOK, MOS, MPSK1, MPSK1ps, MRCKa, MRCKb, MRCKps, MSK1,
MSK12, MSK2, MSK22, MSSK1, MST1, MST2, MST3, MST3ps, MST4, MUSK,
MYO3A, MYO3B, MYT1, NDR1, NDR2, NEK1, NEK10, NEK11, NEK2, NEK2ps1,
NEK2ps2, NEK2ps3, NEK3, NEK4, NEK4ps, NEK5, NEK6, NEK7, NEK8, NEK9,
NIK, NIM1, NLK, NRBP1, NRBP2, NuaK1, NuaK2, Obsen, Obscn2, OSR1,
p38a, p38b, p38d, p38g, p70S6K, p70S6Kb, p70S6Kps1, p70S6Kps2,
PAK1, PAK2, PAK2ps, PAK3, PAK4, PAK5, PAK6, PASK, PBK, PCTAIRE1,
PCTAIRE2, PCTAIRE3, PDGFRa, PDGFRb, PDK1, PEK, PFTAIRE1, PFTAIRE2,
PHKg1, PHKglps1, PHKglps2, PHKglps3, PHKg2, PIK3R4, PIM1, PIM2,
PIM3, PINK1, PITSLRE, PKACa, PKACb, PKACg, PKCa, PKCb, PKCd, PKCe,
PKCg, PKCh, PKCi, PKCips, PKCt, PKCz, PKD1, PKD2, PKD3, PKG1, PKG2,
PKN1, PKN2, PKN3, PKR, PLK1, PLK1ps1, PLK1ps2, PLK2, PLK3, PLK4,
PRKX, PRKXps, PRKY, PRP4, PRP4ps, PRPK, PSKH1, PSKHlps, PSKH2,
PYK2, QIK, QSK, RAF1, RAF1ps, RET, RHOK, RIPK1, RIPK2, RIPK3,
RNAseL, ROCK1, ROCK2, RON, ROR1, ROR2, ROS, RSK1, RSK12, RSK2,
RSK22, RSK3, RSK32, RSK4, RSK42, RSKL1, RSKL2, RYK, RYKps, SAKps,
SBK, SCYL1, SCYL2, SCYL2ps, SCYL3, SGK, SgK050ps, SgK069, SgK071,
SgK085, SgK110, SgK196, SGK2, SgK223, SgK269, SgK288, SGK3, SgK307,
SgK384ps, SgK396, SgK424, SgK493, SgK494, SgK495, SgK496, SIK(e.g.,
SIK1, SIK2), skMLCK, SLK, Slob, smMLCK, SNRK, SPEG, SPEG2, SRC,
SRM, SRPK1, SRPK2, SRPK2ps, SSTK, STK33, STK33ps, STLK3, STLK5,
STLK6, STLK6ps1, STLK6-rs, SuRTK106, SYK, TAK1, TAO1, TAO2, TAO3,
TBCK, TBK1, TEC, TESK1, TESK2, TGFbR1, TGFbR2, TIE1, TIE2, TLK1,
TLK1ps, TLK2, TLK2ps1, TLK2ps2, TNK1, Trad, Trb1, Trb2, Trb3, Trio,
TRKA, TRKB, TRKC, TSSK1, TSSK2, TSSK3, TSSK4, TSSKps1, TSSKps2,
TTBK1, TTBK2, TTK, TTN, TXK, TYK2, TYK22, TYRO3, TYRO3ps, ULK1,
ULK2, ULK3, ULK4, VACAMKL, VRK1, VRK2, VRK3, VRK3ps, Weel, WeelB,
WeelBps, Weelps1, Weelps2, Wnk1, Wnk2, Wnk3, Wnk4, YANK1, YANK2,
YANK3, YES, YESps, YSK1, ZAK, ZAP70, ZC1/HGK, ZC2/TNIK, ZC3/MINK,
and ZC4/NRK.
[0100] The term "SRC family kinase" refers to a family of
non-receptor tyrosine protein kinases that includes nine members:
SRCA subfamily that includes c-SRC (proto-oncogene tyrosine-protein
kinase SRC), YES (proto-oncogene tyrosine-protein kinase Yes), FYN
(proto-oncogene tyrosine-protein kinase FYN), and FGR
(Gardner-Rasheed feline sarcoma viral (v-FGR) oncogene homolog);
SRCB subfamily that includes LCK (lymphocyte-specific protein
tyrosine kinase), HCK (tyrosine-protein kinase HCK, hemopoietic
cell kinase), BLK (tyrosine-protein kinase BLK), and LYN
(tyrosine-protein kinase LYN); and FRK (Fyn-related kinase).
[0101] The term "CDK" refers to a cyclin-dependent kinase. A CDK
binds a cyclin (e.g., Cyclin H), which is a regulatory protein.
CDKs phosphorylate their substrates at serines and threonines. The
consensus sequence for the phosphorylation site in the amino acid
sequence of a CDK substrate is [S/T*]PX[K/R], where S/T* is the
phosphorylated serine or threonine, P is proline, X is any amino
acid, K is lysine, and R is arginine. CDKs include CDK1, CDK2,
CDK3, CDK4, CDK5, CDK6, CDK7, CDK8, CDK9, CDK10, CDK11, CDK12,
CDK13, CDK14, CDK15, CDK16, CDK17, CDK18, CDK19 and CDK20.
[0102] CDK7, cyclin-dependent kinase 7, is a CDK, wherein the
substrate is Cyclin H, MAT1 (e.g., MNAT1), or Cyclin H and MAT1.
CDK7 is alternatively referred to as CAK1, HCAK, MO15, STK1, CDKN7,
and p39MO15. Non-limiting examples of the nucleotide and protein
sequences for human CDK7 are described in GenBank Accession Number
NP_001790, incorporated herein by reference. The amino acid
sequence of this CDK7 is as follows:
TABLE-US-00001 MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRS
EAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDL
EVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDE
NGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDM
WAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPD
YVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKY
FSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKK LIF
DETAILED DESCRIPTION OF CERTAIN EMBODIMENTS OF THE INVENTION
[0103] Cyclin dependent kinases (CDKs) are key regulators of the
cell cycle. Their successive activation and inactivation drives the
cycle forward. The activity of CDKs is regulated by multiple
mechanisms such as positive and negative phosphorylation, binding
of regulatory proteins like cyclins, and CDK inhibitors.
Cyclin-dependent kinase 7 (CDK7) plays a critical role in the
regulation of RNA polymerase II-mediated transcription of
protein-encoding genes. Disruption of CDK7 signaling causes defects
in transcription; however, a complete understanding of how CDK7
disruption affects global transcription is lacking. Furthermore,
the absence of selective inhibitors of CDK7 has hindered
investigation of the transcriptional and functional consequences of
acute and long-term inhibition of CDK7 under normal and
pathological conditions. The present invention describes a cellular
screen and conventional proteomics target discovery approach that
resulted in the identification of highly selective CDK7 inhibitors
and analogs, which have the ability to covalently modify a cysteine
residue located outside of the canonical kinase domain (i.e.,
Cys312 of CDK7). This cysteine is exclusively found in CDK7 and
provides an unanticipated means of overcoming the daunting
challenge of achieving selectivity amongst the 19 CDKs reported to
date. Irreversible inhibition of CDK7 using an inhibitor of the
present invention results in the prolonged disruption of
transcription and the induction of apoptosis of a diverse subset of
cancer cell lines. Genome-wide transcript analysis following
inhibitor treatment delineates CDK7-responsive genes as important
in the maintenance of the cancer cell state, in particular MYC and
MCL-1 genes. Selective covalent inhibition of CDK7 may be a viable
cancer therapeutic strategy.
[0104] The present invention provides compounds, which inhibit the
activity of a kinase, for the prevention and/or treatment of a
subject with a proliferative disease. In certain embodiments, the
inventive compounds inhibit the activity of cyclin-dependent kinase
(CDK). In certain embodiments, the inventive compounds inhibit the
activity of a cyclin-dependent kinase 7 (CDK7). The present
invention also provides methods of using the compounds described
herein, e.g., as biological probes to study the inhibition of the
activity of a kinase (e.g., CDK (e.g., CDK7)), and as therapeutics,
e.g., in the prevention and/or treatment of diseases associated
with the overexpression and/or aberrant activity of a kinase (e.g.,
CDK (e.g., CDK7)). In certain embodiments, the diseases are
proliferative diseases. The proliferative diseases that may be
treated and/or prevented include, but are not limited to, cancers
(e.g., leukemia, melanoma, multiple myeloma), benign neoplasms,
diseases associated with angiogenesis, inflammatory diseases,
autoinflammatory diseases, and autoimmune diseases. Also provided
by the present disclosure are pharmaceutical compositions, kits,
methods, and uses including a compound of Formula (I) as described
herein.
[0105] In addition to inhibiting the activity of CDK7, compounds of
the present invention are selective for CDK7 relative to other
CDKs. The present invention addresses potential deficiencies of
some previous CDK7 inhibitors which also have the ability to
inhibit CDK12 or CDK13 (Kwiatowski et al., "Targeting transcription
regulation in cancer with a covalent CDK7 inhibitor." Nature 511,
616-620 (2014)). This affords the opportunity to more clearly
differentiate pharmacological effects that are derived from CDK7
inhibition relative to CDK12 and/or CDK13 inhibition and provides
new compounds, and compositions thereof, for drug development and
therapeutic use.
Compounds
[0106] Aspects of the present disclosure relate to the compounds
described herein. The compounds described herein are
pyrrolo-pyrazole containing compounds that may be useful in
treating and/or preventing proliferative diseases in a subject,
inhibiting the activity of a protein kinase (e.g., CDK) in a
subject or biological sample, and inducing apoptosis of a cell. In
certain embodiments, a compound described herein is a compound of
Formula (I), or a pharmaceutically acceptable salt, solvate,
hydrate, polymorph, co-crystal, tautomer, stereoisomer,
isotopically labeled derivative, or prodrug thereof. In certain
embodiments, a compound described herein is a compound of Formula
(I), or a pharmaceutically acceptable salt thereof.
[0107] Provided herein are compounds of Formula (I):
##STR00012##
and pharmaceutically acceptable salts, solvates, hydrates,
polymorphs, co-crystals, tautomers, stereoisomers, isotopically
labeled derivatives, and prodrugs thereof, wherein: [0108] R.sup.1
is --NR.sup.aR.sup.b, --CHR.sup.aR.sup.b or --OR.sup.a, wherein
each of Ra and R.sup.b is independently hydrogen, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, a nitrogen protecting group when attached
to a nitrogen atom, or an oxygen protecting group when attached to
an oxygen atom, or R.sup.a and R.sup.b are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring; [0109] each of R.sup.3 and R.sup.4 is
independently hydrogen, halogen, optionally substituted
C.sub.1-C.sub.6 alkyl, or optionally substituted aryl, or R.sup.3
and R.sup.4 are joined to form an optionally substituted
C.sub.3-C.sub.6 carbocyclyl ring; [0110] R.sup.5 is independently
hydrogen, optionally substituted C.sub.1-C.sub.6 alkyl, or a
nitrogen protecting group; [0111] L.sup.1 is --NR.sup.L1--,
--NR.sup.L1C(.dbd.O)--, --C(.dbd.O)NR.sup.L1--, --O--, or --S--,
wherein R.sup.L1 is hydrogen, optionally substituted
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group; [0112] Ring
A is optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, or optionally
substituted heteroaryl; [0113] L.sup.2 is a bond, --C(.dbd.O)--,
--NR.sup.L2--, --C(.dbd.O)NR.sup.L2--, --NR.sup.L2C(.dbd.O)--,
--O--, or --S--, wherein R.sup.L2 is hydrogen, optionally
substituted C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group;
[0114] Ring B is absent, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
or optionally substituted heteroaryl; and [0115] R.sup.2 is any of
Formulae (i-1)-(i-42) as defined herein:
[0115] ##STR00013## ##STR00014## ##STR00015## ##STR00016## [0116]
wherein: [0117] L.sup.3 is a bond or an optionally substituted
C.sub.1-4 hydrocarbon chain, optionally wherein one or more carbon
units of the hydrocarbon chain are independently replaced with
--C(.dbd.O)--, --O--, --S--, --NR.sup.L3a--,
--NR.sup.L3aC(.dbd.O)--, --C(.dbd.O)NR.sup.L3a--, --SC(.dbd.O)--,
--C(.dbd.O)S--, --OC(.dbd.O)--, --C(.dbd.O)O--,
--NR.sup.L3aC(.dbd.S)--, --C(.dbd.S)NR.sup.L3a--,
trans-CR.sup.L3b.dbd.CR.sup.L3b--, cis-CR.sup.L3b.dbd.CR.sup.L3b,
--C.ident.C--, --S(.dbd.O)--, --S(.dbd.O)O--, --OS(.dbd.O)--,
--S(.dbd.O)NR.sup.L3a--, --NR.sup.L3aS(.dbd.O)--,
--S(.dbd.O).sub.2--, --S(.dbd.O).sub.2O--, --OS(.dbd.O).sub.2--,
--S(.dbd.O).sub.2NR.sup.L3a, or --NR.sup.L3aS(.dbd.O).sub.2--,
wherein R.sup.L3a is hydrogen, substituted or unsubstituted
C.sub.1-6 alkyl, or a nitrogen protecting group, and wherein each
occurrence of R.sup.L3b is independently hydrogen, halogen,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
or optionally substituted heteroaryl, or two R.sup.L3b groups are
joined to form an optionally substituted carbocyclic or optionally
substituted heterocyclic ring; [0118] L.sup.4 is a bond or an
optionally substituted, branched or unbranched C.sub.1-6
hydrocarbon chain; each of R.sup.E1, R.sup.E2, and R.sup.E3 is
independently hydrogen, halogen, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, optionally substituted
heteroaryl, --CN, --CH.sub.2OR.sup.EE, --CH.sub.2N(R.sup.EE).sub.2,
--CH.sub.2SR.sup.EE, --OR.sup.EE, --N(R.sup.EE).sub.2,
--Si(R.sup.EE).sub.3, and --SR.sup.EE, wherein each occurrence of
R.sup.EE is independently hydrogen, optionally substituted alkyl,
optionally substituted alkoxy, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
or optionally substituted heteroaryl, or two R.sup.EE groups are
joined to form an optionally substituted heterocyclic ring; or
R.sup.E1 and R.sup.E3, or R.sup.E2 and R.sup.E3, or R.sup.E1 and
R.sup.E2 are joined to form an optionally substituted carbocyclic
or optionally substituted heterocyclic ring; [0119] R.sup.E4 is a
leaving group; [0120] R.sup.E5 is halogen; [0121] R.sup.E6 is
hydrogen, substituted or unsubstituted C.sub.1-6 alkyl, or a
nitrogen protecting group; each instance of Y is independently O,
S, or NR.sup.E7, wherein R.sup.E7 is hydrogen, substituted or
unsubstituted C.sub.1-6 alkyl, or a nitrogen protecting group;
[0122] a is 1 or 2; and [0123] each instance of z is independently
0, 1, 2, 3, 4, 5, or 6, as valency permits.
[0124] In certain embodiments, a compound described herein is of
Formula (I):
##STR00017##
and pharmaceutically acceptable salts, solvates, hydrates,
polymorphs, co-crystals, tautomers, stereoisomers, isotopically
labeled derivatives, and prodrugs thereof, wherein: [0125] R.sup.1
is --NR.sup.aR.sup.b, --CHR.sup.aR.sup.b or --OR.sup.a, wherein
each of R.sup.a and R.sup.b is independently hydrogen, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, a nitrogen protecting group when attached
to a nitrogen atom, or an oxygen protecting group when attached to
an oxygen atom, or R.sup.a and R.sup.b are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring; [0126] each of R.sup.3 and R.sup.4 is
independently hydrogen, halogen, or optionally substituted
C.sub.1-C.sub.6 alkyl, or R.sup.3 and R.sup.4 are joined to form an
optionally substituted C.sub.3-C.sub.6 carbocyclyl ring; [0127]
R.sup.5 is hydrogen, optionally substituted C.sub.1-C.sub.6 alkyl,
or a nitrogen protecting group; [0128] L.sup.1 is --NR.sup.L1--,
--NR.sup.L1C(.dbd.O)--, --C(.dbd.O)NR.sup.L1--, --O--, or --S--,
wherein R is hydrogen, optionally substituted C.sub.1-C.sub.6
alkyl, or a nitrogen protecting group; [0129] Ring A is optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, or optionally substituted heteroaryl;
[0130] L.sup.2 is a bond, --C(.dbd.O)--, --NR.sup.L2--,
--C(.dbd.O)NR.sup.L2--, --NR.sup.L2C(.dbd.O)--, --O--, or --S--,
wherein R.sup.L2 is hydrogen, optionally substituted
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group; [0131] Ring
B is absent, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, or
optionally substituted heteroaryl; and [0132] R.sup.2 is any of
Formulae (i-1)-(i-41) as defined herein:
[0132] ##STR00018## ##STR00019## ##STR00020## ##STR00021## [0133]
wherein: [0134] L.sup.3 is a bond or an optionally substituted
C.sub.1-4 hydrocarbon chain, optionally wherein one or more carbon
units of the hydrocarbon chain are independently replaced with
--C(.dbd.O)--, --O--, --S--, --NR.sup.L3a--,
--NR.sup.L3aC(.dbd.O)--, --C(.dbd.O)NR.sup.L3a--, --SC(.dbd.O)--,
--C(.dbd.O)S--, --OC(.dbd.O)--, --C(.dbd.O)O--,
--NR.sup.L3aC(.dbd.S)--, --C(.dbd.S)NR.sup.L3a--,
trans-CR.sup.L3b.dbd.CR.sup.L3b--, cis-CR.sup.L3b.dbd.CR.sup.L3b,
--C.ident.C--, --S(.dbd.O)--, --S(.dbd.O)O--, --OS(.dbd.O)--,
--S(.dbd.O)NR.sup.L3a--, NR.sup.L3aS(.dbd.O).sub.2--,
--S(.dbd.O).sub.2--, --S(.dbd.O).sub.2O--, --OS(.dbd.O).sub.2--,
--S(.dbd.O).sub.2NR.sup.L3a, or --NR.sup.L3aS(.dbd.O).sub.2--,
wherein R.sup.L3a is hydrogen, substituted or unsubstituted
C.sub.1-6 alkyl, or a nitrogen protecting group, and wherein each
occurrence of R.sup.L3b is independently hydrogen, halogen,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
or optionally substituted heteroaryl, or two R.sup.L3b groups are
joined to form an optionally substituted carbocyclic or optionally
substituted heterocyclic ring; [0135] L.sup.4 is a bond or an
optionally substituted, branched or unbranched C.sub.1-6
hydrocarbon chain; [0136] each of R.sup.E1, R.sup.E2, and R.sup.E3
is independently hydrogen, halogen, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, optionally substituted
heteroaryl, --CN, --CH.sub.2OR.sup.EE, --CH.sub.2N(R.sup.EE).sub.2,
--CH.sub.2SR.sup.EE, --OR.sup.EE, --N(R.sup.EE).sub.2,
--Si(R.sup.EE).sub.3, and --SR.sup.EE, wherein each occurrence of
R.sup.EE is independently hydrogen, optionally substituted alkyl,
optionally substituted alkoxy, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
or optionally substituted heteroaryl, or two R.sup.EE groups are
joined to form an optionally substituted heterocyclic ring; or
R.sup.E1 and R.sup.E3, or R.sup.E2 and R.sup.E3, or R.sup.E1 and
R.sup.E2 are joined to form an optionally substituted carbocyclic
or optionally substituted heterocyclic ring; [0137] R.sup.E4 is a
leaving group; [0138] R.sup.E5 is halogen; [0139] R.sup.E6 is
hydrogen, substituted or unsubstituted C.sub.1-6 alkyl, or a
nitrogen protecting group; each instance of Y is independently O,
S, or NR.sup.E7, wherein R.sup.E7 is hydrogen, substituted or
unsubstituted C.sub.1-6 alkyl, or a nitrogen protecting group;
[0140] a is 1 or 2; and [0141] each instance of z is independently
0, 1, 2, 3, 4, 5, or 6, as valency permits.
[0142] Compounds of Formula (I) include R.sup.1 attached to the
carbonyl substituent of the pyrrolopyrazole bicyclic ring. R.sup.1
may be --NR.sup.aR.sup.b, --CHR.sup.aR.sup.b or --OR.sup.a, wherein
each of R.sup.a and R.sup.b is independently hydrogen, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, a nitrogen protecting group when attached
to a nitrogen atom, or an oxygen protecting group when attached to
an oxygen atom, or R.sup.a and R.sup.b are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring. In certain embodiments, R.sup.1 is
--NR.sup.aR.sup.b. In certain embodiments, R.sup.1 is
--CHR.sup.aR.sup.b. In certain embodiments, R.sup.1 is
--OR.sup.a.
[0143] In certain embodiments, R.sup.1 is
##STR00022##
wherein R.sup.2' is hydrogen, optionally substituted
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group, and each
ring atom is optionally substituted. In certain embodiments,
R.sup.1 is
##STR00023##
[0144] In certain embodiments, R.sup.1 is of Formula (ii-1):
##STR00024##
wherein: [0145] R.sup.b is hydrogen, optionally substituted
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group; [0146]
R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl; and [0147] R.sup.2a is hydrogen, --OR.sup.1N, or
--NR.sup.1NR.sup.2N, wherein each of R.sup.1N and R.sup.2N is
independently hydrogen, C.sub.1-C.sub.6 alkyl, a nitrogen
protecting group when attached to a nitrogen atom, or an oxygen
protecting group when attached to an oxygen atom.
[0148] In certain embodiments, R.sup.1 is of Formula (ii-2):
##STR00025##
wherein: [0149] R.sup.b is hydrogen, optionally substituted
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group; [0150]
R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl; and [0151] R.sup.2a is hydrogen, --OR.sup.1N, or
--NR.sup.1NR.sup.2N, wherein each of R.sup.1N and R.sup.2N is
independently hydrogen, C.sub.1-C.sub.6 alkyl, a nitrogen
protecting group when attached to a nitrogen atom, or an oxygen
protecting group when attached to an oxygen atom.
[0152] In certain embodiments, R.sup.b is hydrogen. In certain
embodiments, R.sup.b is optionally substituted C.sub.1-C.sub.6
alkyl. In certain embodiments, R.sup.b is unsubstituted
C.sub.1-C.sub.6 alkyl. In certain embodiments, R.sup.b is a
nitrogen protecting group. In certain embodiments, R.sup.b is Bn,
BOC, Cbz, Fmoc, trifluoroacetyl, triphenylmethyl, acetyl, or
Ts.
[0153] In certain embodiments, R.sup.1a is hydrogen. In certain
embodiments, R.sup.1a is methyl. In certain embodiments, R.sup.1a
is ethyl. In certain embodiments, R.sup.1a is propyl. In certain
embodiments, R.sup.1a is optionally substituted phenyl. In certain
embodiments, R.sup.1a is phenyl.
[0154] In certain embodiments, R.sup.2a is hydrogen. In certain
embodiments, R.sup.2a is --OR.sup.1N, wherein R.sup.1N is hydrogen,
C.sub.1-C.sub.6 alkyl, or an oxygen protecting group. In certain
embodiments, R.sup.2a is --OH. In certain embodiments, R.sup.2a is
--NR.sup.1NR.sup.2N, wherein each of R.sup.1N and R.sup.2N is
independently hydrogen, C.sub.1-C.sub.6 alkyl, or a nitrogen
protecting group. In certain embodiments, R.sup.1N and R.sup.2N are
the same. In certain embodiments, R.sup.1N and R.sup.2N are
distinct. In certain embodiments, R.sup.1N and R.sup.2N are both
methyl. In certain embodiments, R.sup.1N and R.sup.2N are both
ethyl. In certain embodiments, R.sup.1N and R.sup.2N are both
propyl. In certain embodiments, R.sup.1N and R.sup.2N are both
hydrogen. In certain embodiments, R.sup.1N and R.sup.2N are both
nitrogen protecting groups. In certain embodiments, at least one of
R.sup.1N and R.sup.2N is methyl. In certain embodiments, at least
one of R.sup.1N and R.sup.2N is ethyl. In certain embodiments, at
least one of R.sup.1N and R.sup.2N is propyl. In certain
embodiments, at least one of R.sup.1N and R.sup.2N is hydrogen. In
certain embodiments, at least one of R.sup.1N and R.sup.2N is a
nitrogen protecting group. In certain embodiments, R.sup.1N is
methyl, and R.sup.2N is hydrogen. In certain embodiments, R.sup.1N
is ethyl, and R.sup.2N is hydrogen. In certain embodiments,
R.sup.1N is propyl, and R.sup.2N is hydrogen. In certain
embodiments, R.sup.1N is a nitrogen protecting group, and R.sup.2N
is hydrogen. In certain embodiments, R.sup.1N is methyl, and
R.sup.2N is a nitrogen protecting group. In certain embodiments,
R.sup.1 is ethyl, and R.sup.2N is a nitrogen protecting group. In
certain embodiments, R.sup.1N is propyl, and R.sup.2N is a nitrogen
protecting group.
[0155] In certain embodiments, R.sup.1 is of Formula (ii-1a):
##STR00026##
wherein: [0156] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or
optionally substituted aryl; and [0157] each of R.sup.1N and
R.sup.2N is independently hydrogen, C.sub.1-C.sub.6 alkyl, or a
nitrogen protecting group.
[0158] In certain embodiments, R.sup.1 is of Formula (ii-2a):
##STR00027##
wherein: [0159] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or
optionally substituted aryl; and [0160] each of R.sup.1N and
R.sup.2N is independently hydrogen, C.sub.1-C.sub.6 alkyl, or a
nitrogen protecting group.
[0161] In certain embodiments, R.sup.1a is hydrogen. In certain
embodiments, R.sup.1a is methyl. In certain embodiments, R.sup.1a
is ethyl. In certain embodiments, R.sup.1a is propyl. In certain
embodiments, R.sup.1a is optionally substituted phenyl. In certain
embodiments, R.sup.1a is phenyl. In certain embodiments, R.sup.1N
and R.sup.2N are the same.
[0162] In certain embodiments, R.sup.1N and R.sup.2N are distinct.
In certain embodiments, R.sup.1N and R.sup.2N are both methyl. In
certain embodiments, R.sup.1N and R.sup.2N are both ethyl. In
certain embodiments, R.sup.1N and R.sup.2N are both propyl. In
certain embodiments, RN and R.sup.2N are both hydrogen. In certain
embodiments, R.sup.1N and R.sup.2N are both nitrogen protecting
groups. In certain embodiments, at least one of RN and R.sup.2N is
methyl. In certain embodiments, at least one of R.sup.1N and
R.sup.2N is ethyl. In certain embodiments, at least one of RN and
R.sup.2N is propyl. In certain embodiments, at least one of RN and
R.sup.2N is hydrogen. In certain embodiments, at least one of RN
and R.sup.2N is a nitrogen protecting group. In certain
embodiments, RN is methyl, and R.sup.2N is hydrogen. In certain
embodiments, R.sup.1N is ethyl, and R.sup.2N is hydrogen. In
certain embodiments, R.sup.1N is propyl, and R.sup.2N is hydrogen.
In certain embodiments, R.sup.1N is a nitrogen protecting group,
and R.sup.2N is hydrogen. In certain embodiments, R.sup.1N is
methyl, and R.sup.2N is a nitrogen protecting group. In certain
embodiments, R.sup.1N is ethyl, and R.sup.2N is a nitrogen
protecting group. In certain embodiments, R.sup.1N is propyl, and
R.sup.2N is a nitrogen protecting group.
[0163] In certain embodiments, R.sup.1 is of Formula (ii-1b):
##STR00028##
wherein R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl.
[0164] In certain embodiments, R.sup.1 is of Formula (ii-2b):
##STR00029##
wherein R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl.
[0165] In certain embodiments, R.sup.1a is hydrogen. In certain
embodiments, R.sup.1a is methyl. In certain embodiments, R.sup.1a
is ethyl. In certain embodiments, R.sup.1a is propyl. In certain
embodiments, R.sup.1a is optionally substituted phenyl. In certain
embodiments, R.sup.1a is phenyl.
[0166] In certain embodiments, R.sup.1 is:
##STR00030##
[0167] In certain embodiments, R.sup.1 is:
##STR00031##
[0168] In certain embodiments, R.sup.1 is:
##STR00032##
[0169] In certain embodiments, R.sup.1 is:
##STR00033##
[0170] In certain embodiments, R.sup.1 is of Formula (ii-1c):
##STR00034##
wherein: [0171] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or
optionally substituted aryl; and [0172] each of R.sup.1N and
R.sup.2N is independently hydrogen, C.sub.1-C.sub.6 alkyl, or an
oxygen protecting group.
[0173] In certain embodiments, R.sup.1 is of Formula (ii-2c):
##STR00035##
wherein: [0174] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or
optionally substituted aryl; and [0175] each of R.sup.1N and
R.sup.2N is independently hydrogen, C.sub.1-C.sub.6 alkyl, or an
oxygen protecting group.
[0176] In certain embodiments, R.sup.1a is hydrogen. In certain
embodiments, R.sup.1a is methyl. In certain embodiments, R.sup.1a
is ethyl. In certain embodiments, R.sup.1a is propyl. In certain
embodiments, R.sup.1a is optionally substituted phenyl. In certain
embodiments, R.sup.1a is phenyl. In certain embodiments, R.sup.1N
is hydrogen. In certain embodiments, R.sup.1N is methyl. In certain
embodiments, R.sup.1N is ethyl. In certain embodiments, R.sup.1N is
propyl. In certain embodiments, R.sup.1N is an oxygen protecting
group.
[0177] In certain embodiments, R.sup.1 is of Formula (ii-1d):
##STR00036##
wherein R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl.
[0178] In certain embodiments, R.sup.1 is of Formula (ii-2d):
##STR00037##
wherein R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl.
[0179] In certain embodiments, R.sup.1a is hydrogen. In certain
embodiments, R.sup.1a is methyl. In certain embodiments, R.sup.1a
is ethyl. In certain embodiments, R.sup.1a is propyl. In certain
embodiments, R.sup.1a is optionally substituted phenyl. In certain
embodiments, R.sup.1a is phenyl.
[0180] In certain embodiments, R.sup.1 is
##STR00038##
[0181] In certain embodiments, R.sup.1 is --NR.sup.aR.sup.b,
wherein R.sup.a is optionally substituted aryl, and R.sup.b is
hydrogen, optionally substituted alkyl, optionally substituted
alkenyl, optionally substituted alkynyl, optionally substituted
carbocyclyl, optionally substituted heterocyclyl, optionally
substituted aryl, optionally substituted heteroaryl, or a nitrogen
protecting group. In certain embodiments, R.sup.1 is
--NR.sup.aR.sup.b, wherein R.sup.a is optionally substituted
heteroaryl, and R.sup.b is hydrogen, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, optionally substituted
heteroaryl, or a nitrogen protecting group. In certain embodiments,
R.sup.1 is --NR.sup.aR.sup.b, wherein R.sup.a is optionally
substituted heterocyclyl, and R.sup.b is hydrogen, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, or a nitrogen protecting group. In certain
embodiments, R.sup.1 is --NR.sup.aR.sup.b, wherein R.sup.a is
optionally substituted carbocyclyl, and R.sup.b is selected from
hydrogen, optionally substituted alkyl, optionally substituted
alkenyl, optionally substituted alkynyl, optionally substituted
carbocyclyl, optionally substituted heterocyclyl, optionally
substituted aryl, optionally substituted heteroaryl, or a nitrogen
protecting group. In certain embodiments, R.sup.1 is
--NR.sup.aR.sup.b, wherein R.sup.a is optionally substituted aryl,
and R.sup.b is hydrogen. In certain embodiments, R.sup.1 is
--NR.sup.aR.sup.b, wherein R.sup.a is optionally substituted
heteroaryl, and R.sup.b is hydrogen. In certain embodiments,
R.sup.1 is --NR.sup.aR.sup.b, wherein R.sup.a is optionally
substituted heterocyclyl, and R.sup.b is hydrogen. In certain
embodiments, R.sup.1 is --NR.sup.aR.sup.b, wherein R.sup.a is
optionally substituted carbocyclyl, and R.sup.b is hydrogen. In
certain embodiments, R.sup.1 is --NR.sup.aR.sup.b, wherein R.sup.a
is optionally substituted pyrazolyl, and R.sup.b is hydrogen. In
certain embodiments, R.sup.1 is --NR.sup.aR.sup.b, wherein R.sup.a
is 1-methyl-1H-pyrazol-4-yl, and R.sup.b is hydrogen. In certain
embodiments, R.sup.1 is
##STR00039##
[0182] Compounds of Formula (I) include linker L.sup.1 joining the
pyrrolopyrazole bicyclic ring and Ring A. Linker L.sup.1 may be
--NR.sup.L--, --NR.sup.LC(.dbd.O)--, --C(.dbd.O)NR.sup.L--, --O--,
or --S--, wherein R.sup.L1 is hydrogen, optionally substituted
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group. In certain
embodiments, L.sup.1 is --NR.sup.L1--, wherein R.sup.L1 is
hydrogen, optionally substituted C.sub.1-C.sub.6 alkyl, or a
nitrogen protecting group. In certain embodiments, L.sup.1 is
--NR.sup.LC(.dbd.O)--, wherein R.sup.L1 is hydrogen, optionally
substituted C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group.
In certain embodiments, L.sup.1 is --C(.dbd.O)NR.sup.L--, wherein
R.sup.L1 is hydrogen, optionally substituted C.sub.1-C.sub.6 alkyl,
or a nitrogen protecting group. In certain embodiments, R.sup.L1 is
hydrogen. In certain embodiments, L.sup.1 is --NH--. In certain
embodiments, L.sup.1 is --NH(C.dbd.O)--. In certain embodiments,
L.sup.1 is --(C.dbd.O)NH--. In certain embodiments, L.sup.1 is
--O--. In certain embodiments, L.sup.1 is --S--.
[0183] Compounds of Formula (I) include R.sup.3 and R.sup.4
attached to the pyrrolopyrazole bicyclic ring. Each of R.sup.3 and
R.sup.4 is independently hydrogen, halogen, optionally substituted
aryl, or optionally substituted C.sub.1-C.sub.6 alkyl, or R.sup.3
and R.sup.4 are joined to form an optionally substituted
C.sub.3-C.sub.6 carbocyclyl ring. In certain embodiments, R.sup.3
is a substituted or unsubstituted aryl (e.g., substituted or
unsubstituted phenyl). In certain embodiments, R.sup.4 is a
substituted or unsubstituted aryl (e.g., substituted or
unsubstituted phenyl). In certain embodiments, R.sup.3 and R.sup.4
are joined to form an optionally substituted C.sub.3-C.sub.6
carbocyclyl. In certain embodiments, R.sup.3 and R.sup.4 are joined
to form an optionally substituted cyclopropane. In certain
embodiments, R.sup.3 and R.sup.4 are joined to form an
unsubstituted cyclopropane. In certain embodiments, R.sup.3 and
R.sup.4 are joined to form an optionally substituted cyclohexane.
In certain embodiments, R.sup.3 and R.sup.4 are joined to form an
unsubstituted cyclohexane. In certain embodiments, R.sup.3 and
R.sup.4 are the same. In certain embodiments, R.sup.3 and R.sup.4
are distinct. In certain embodiments, R.sup.3 and R.sup.4 are
optionally substituted C.sub.1-C.sub.6 alkyl. In certain
embodiments, R.sup.3 and R.sup.4 are unsubstituted C.sub.1-C.sub.6
alkyl. In certain embodiments, R.sup.3 and R.sup.4 are both methyl.
In certain embodiments, R.sup.3 and R.sup.4 are both ethyl. In
certain embodiments, R.sup.3 and R.sup.4 are both propyl. In
certain embodiments, R.sup.3 and R.sup.4 are both hydrogen. In
certain embodiments, R.sup.3 and R.sup.4 are both halogen. In
certain embodiments, each of R.sup.3 and R.sup.4 is independently
--Cl, --Br, or --I. In certain embodiments, R.sup.3 and R.sup.4 are
both --F. In certain embodiments, R.sup.3 and R.sup.4 are joined as
--CH.sub.2CH.sub.2--.
[0184] In certain embodiments, R.sup.3 is optionally substituted
C.sub.1-C.sub.6 alkyl (e.g., isopropyl). In certain embodiments,
R.sup.3 is unsubstituted C.sub.1-C.sub.6 alkyl. In certain
embodiments, R.sup.3 is methyl. In certain embodiments, R.sup.3 is
ethyl. In certain embodiments, R.sup.3 is propyl. In certain
embodiments, R.sup.3 is hydrogen. In certain embodiments, R.sup.3
is halogen. In certain embodiment, R.sup.3 is --Cl, --Br, or --I.
In certain embodiment, R.sup.3 is --F. In certain embodiments,
R.sup.4 is optionally substituted C.sub.1-C.sub.6 alkyl (e.g.,
isopropyl). In certain embodiments, R.sup.4 is unsubstituted
C.sub.1-C.sub.6 alkyl. In certain embodiments, R.sup.4 is methyl.
In certain embodiments, R.sup.4 is ethyl. In certain embodiments,
R.sup.4 is propyl. In certain embodiments, R.sup.4 is hydrogen. In
certain embodiments, R.sup.4 is halogen. In certain embodiment,
R.sup.4 is --Cl, --Br, or --I. In certain embodiment, R.sup.4 is
--F.
[0185] In certain embodiments, R.sup.3 is hydrogen, and R.sup.4 is
methyl. In certain embodiments, R.sup.3 is methyl, and R.sup.4 is
hydrogen. In certain embodiments, R.sup.3 is hydrogen, and R.sup.4
is ethyl. In certain embodiments, R.sup.3 is ethyl, and R.sup.4 is
hydrogen. In certain embodiments, R.sup.3 is hydrogen, and R.sup.4
is propyl. In certain embodiments, R.sup.3 is propyl, and R.sup.4
is hydrogen. In certain embodiments, R.sup.3 is hydrogen, and
R.sup.4 is --Cl, --Br, or --I. In certain embodiments, R.sup.3 is
--Cl, Br, or --I, and R.sup.4 is hydrogen. In certain embodiments,
R.sup.3 is hydrogen, and R.sup.4 is --F. In certain embodiments,
R.sup.3 is --F, and R.sup.4 is hydrogen. In certain embodiments,
R.sup.3 is methyl, and R.sup.4 is --F. In certain embodiments,
R.sup.3 is --F, and R.sup.4 is methyl. In certain embodiments,
R.sup.3 is ethyl, and R.sup.4 is --F. In certain embodiments,
R.sup.3 is --F, and R.sup.4 is ethyl. In certain embodiments,
R.sup.3 is propyl, and R.sup.4 is --F. In certain embodiments,
R.sup.3 is --F, and R.sup.4 is propyl. In certain embodiments,
R.sup.3 is methyl, and R.sup.4 is --Cl, --Br, or --I. In certain
embodiments, R.sup.3 is --Cl, --Br, or --I, and R.sup.4 is methyl.
In certain embodiments, R.sup.3 is ethyl, and R.sup.4 is --Cl,
--Br, or --I. In certain embodiments, R.sup.3 is --Cl, --Br, or
--I, and R.sup.4 is ethyl. In certain embodiments, R.sup.3 is
propyl, and R.sup.4 is --Cl, --Br, or --I. In certain embodiments,
R.sup.3 is --Cl, --Br, or --I, and R.sup.4 is propyl.
[0186] Compounds of Formula (I) include R.sup.5 attached to a
pyrazole nitrogen. R.sup.5 may be hydrogen, optionally substituted
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group. In certain
embodiments, R.sup.5 is optionally substituted C.sub.1-C.sub.6
alkyl. In certain embodiments, R.sup.5 is unsubstituted
C.sub.1-C.sub.6 alkyl. In certain embodiments, R.sup.5 is
substituted methyl. In certain embodiments, R.sup.5 is
unsubstituted methyl. In certain embodiments, R.sup.5 is hydrogen.
In certain embodiments, R.sup.5 is a nitrogen protecting group. In
certain embodiments, R.sup.5 is Bn, BOC, Cbz, Fmoc,
trifluoroacetyl, triphenylmethyl, acetyl, or Ts.
[0187] Compounds of Formula (I) may exist as tautomers or mixtures
thereof of Formulae (I-a) and (I-b):
##STR00040##
In each tautomer, R.sup.5 is attached to different pyrazole
nitrogens in compounds of each formula. In certain embodiments,
R.sup.5 is attached to the nitrogen at the position labeled 1, as
in Formula (I-a). In certain embodiments, R.sup.5 is attached to
the nitrogen at the position labeled 2, as in Formula (I-b). In
certain embodiments, compounds of Formula (I) may exist as a
mixture of compounds of Formulae (I-a) and (I-b), in which case
R.sup.5 is attached to the nitrogen at the position labeled 1 for
components of the mixture corresponding to Formula (I-a), and
R.sup.5 is the nitrogen at the position labeled 2 for components of
the mixture corresponding to Formula (I-b).
[0188] Compounds of Formula (I) include Ring A between linker
L.sup.1 and linker L.sup.2. Ring A may be optionally substituted
carbocyclyl, optionally substituted heterocyclyl, optionally
substituted aryl, or optionally substituted heteroaryl. In certain
embodiments, Ring A is optionally substituted carbocyclyl. In
certain embodiments, Ring A is optionally substituted heterocyclyl.
In certain embodiments, Ring A is optionally substituted aryl. In
certain embodiments, Ring A is optionally substituted heteroaryl.
In certain embodiments, Ring A is optionally substituted phenyl. In
certain embodiments, Ring A is phenyl substituted with only L.sup.1
and L.sup.2. In certain embodiments, Ring A is optionally
substituted cyclohexyl. In certain embodiments, Ring A is
optionally substituted piperidinyl. In certain embodiments, Ring A
is optionally substituted piperizinyl. In certain embodiments, Ring
A is optionally substituted pyridinyl. In certain embodiments, Ring
A is optionally substituted pyrimidinyl.
[0189] In certain embodiments, linkers L.sup.1 and L.sup.2 are
attached "ortho" or 1,2 to Ring A. In certain embodiments, linkers
L.sup.1 and L.sup.2 are attached "meta" or 1,3 to Ring A. In
certain embodiments, linkers L.sup.1 and L.sup.2 are attached
"para" or 1,4 to ring A.
[0190] In certain embodiments, Ring A is
##STR00041##
wherein each ring atom is optionally substituted. In certain
embodiments, Ring A is
##STR00042##
wherein each ring atom is optionally substituted. In certain
embodiments, Ring A is
##STR00043##
wherein each ring atom is optionally substituted. In certain
embodiments, Ring A is
##STR00044##
wherein each ring atom is optionally substituted, and L.sup.1 and
L.sup.2 may attach to ring A at either indicated position. In
certain embodiments, Ring A is
##STR00045##
wherein each ring atom is optionally substituted, and L.sup.1 and
L.sup.2 may attach to ring A at either indicated position. In
certain embodiments, Ring A is
##STR00046##
wherein each ring atom is optionally substituted, and L.sup.1 and
L.sup.2 may attach to ring A at either indicated position. In
certain embodiments, Ring A is
##STR00047##
wherein each ring atom is optionally substituted, and L.sup.1 and
L.sup.2 may attach to ring A at either indicated position.
[0191] In certain embodiments, Ring A is
##STR00048##
In certain embodiments, Ring A is
##STR00049##
In certain embodiments, Ring A is
##STR00050##
In certain embodiments, Ring A is
##STR00051##
L.sup.1 and L.sup.2 may attach to ring A at either indicated
position. In certain embodiments, Ring A is
##STR00052##
wherein L.sup.1 and L.sup.2 may attach to ring A at either
indicated position. In certain embodiments, Ring A is
##STR00053##
wherein L.sup.1 and L.sup.2 may attach to ring A at either
indicated position. In certain embodiments, Ring A is
##STR00054##
wherein L.sup.1 and L.sup.2 may attach to ring A at either
indicated position.
[0192] Compounds of Formula (I) include linker L.sup.2 joining Ring
A to Ring B. Linker L.sup.2 may be a bond, --C(.dbd.O)--,
--NR.sup.L2--, --C(.dbd.O)NR.sup.L2--, --NR.sup.L2C(.dbd.O)--,
--O--, or --S-- wherein R.sup.L2 is hydrogen, optionally
substituted C.sub.1-C.sub.6 alkyl, or a nitrogen protection group.
In certain embodiments, L.sup.2 is a bond, such that Ring B or
R.sup.2 is directly attached to Ring A. In certain embodiments,
L.sup.2 is --NR.sup.L2--, wherein R.sup.L2 is hydrogen, optionally
substituted C.sub.1-C.sub.6 alkyl, or a nitrogen protection group.
In certain embodiments, L.sup.2 is --C(.dbd.O)NR.sup.L2--, wherein
R.sup.L2 is hydrogen, optionally substituted C.sub.1-C.sub.6 alkyl,
or a nitrogen protection group. In certain embodiments, L.sup.2 is
--NR.sup.L2C(.dbd.O)--, wherein R.sup.L2 is hydrogen, optionally
substituted C.sub.1-C.sub.6 alkyl, or a nitrogen protection group.
In certain embodiments, L.sup.2 is --O--. In certain embodiments,
L.sup.2 is --S--. In certain embodiments, R.sup.L2 is hydrogen. In
certain embodiments, L.sup.2 is --C(.dbd.O)--. In certain
embodiments, L.sup.2 is --NH--. In certain embodiments, L.sup.2 is
--NHC(.dbd.O)--. In certain embodiments, L.sup.2 is
--C(.dbd.O)NH--. In certain embodiments, L.sup.2 is --O--. In
certain embodiments, L.sup.2 is --S--.
[0193] Compounds of Formula (I) include Ring B between linker
L.sup.2 and group R.sup.2. In certain embodiments, linker L.sup.2
is a bond, such that Ring B is directly attached to Ring A. Ring B
may absent, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, or
optionally substituted heteroaryl. In certain embodiments, Ring B
is absent, such that L.sup.2 is directly attached to R.sup.2. In
certain embodiments, Ring B is absent and linker L.sup.2 is a bond,
such that Ring A is directly attached to R.sup.2. In certain
embodiments, Ring B is optionally substituted carbocyclyl. In
certain embodiments, Ring B is optionally substituted heterocyclyl.
In certain embodiments, Ring B is optionally substituted aryl. In
certain embodiments, Ring B is optionally substituted heteroaryl.
In certain embodiments, Ring B is optionally substituted phenyl. In
certain embodiments, Ring B is optionally substituted cyclohexyl.
In certain embodiments, Ring B is optionally substituted
piperidinyl. In certain embodiments, Ring B is optionally
substituted piperizinyl. In certain embodiments, Ring B is
optionally substituted pyridinyl. In certain embodiments, Ring B is
optionally substituted pyrimidinyl.
[0194] In certain embodiments, linker L.sup.2 and group R.sup.2 are
attached "ortho" or 1,2 to each other on Ring B. In certain
embodiments, linkers L.sup.2 and group R.sup.2 are attached "meta"
or 1,2 to each other on Ring B. In certain embodiments, linkers
L.sup.2 and R.sup.2 are attached "para" or 1,4 to each other on
Ring B.
[0195] In certain embodiments, Ring B is
##STR00055##
wherein each ring atom is optionally substituted. In certain
embodiments, Ring B is
##STR00056##
wherein each ring atom is optionally substituted. In certain
embodiments, Ring B is
##STR00057##
wherein each ring atom is optionally substituted. In certain
embodiments, Ring B is
##STR00058##
wherein each ring atom is optionally substituted, and L.sup.2 and
R.sup.2 may attach to Ring B at either indicated position. In
certain embodiments, Ring B is
##STR00059##
wherein each ring atom is optionally substituted, and L.sup.2 and
R.sup.2 may attach to Ring B at either indicated position. In
certain embodiments, Ring B is
##STR00060##
wherein each ring atom is optionally substituted, and L.sup.2 and
R.sup.2 may attach to Ring B at either indicated position. In
certain embodiments, Ring B is
##STR00061##
wherein each ring atom is optionally substituted, and L.sup.2 and
R.sup.2 may attach to Ring B at either indicated position.
[0196] In certain embodiments, Ring B is
##STR00062##
In certain embodiments, Ring B is
##STR00063##
In certain embodiments, Ring B is
##STR00064##
In certain embodiments, Ring B is
##STR00065##
L.sup.1 and L.sup.2 may attach to Ring B at either indicated
position. In certain embodiments, Ring B is
##STR00066##
wherein L.sup.2 and R.sup.2 may attach to Ring B at either
indicated position. In certain embodiments, Ring B is
##STR00067##
wherein L.sup.2 and R.sup.2 may attach to Ring B at either
indicated position. In certain embodiments, Ring B is
##STR00068##
wherein L.sup.2 and R.sup.2 may attach to Ring B at either
indicated position.
[0197] Compounds of Formula (I) include R.sup.2 attached to Ring B.
In certain embodiments, Ring B is absent, such that R.sup.2 is
directly attached to linker L.sup.2. In certain embodiments, Ring B
is absent and L.sup.2 is a bond, such that R.sup.2 is directly
attached to Ring A. In certain embodiments, R.sup.2 comprises an
electrophilic moiety. In certain embodiments, R.sup.2 comprises a
Michael acceptor moiety. The electrophilic moiety (e.g., Michael
acceptor moiety) may react with a cysteine residue of a kinase
(e.g., CDK (e.g., CDK7)) to allow for covalent attachment of the
compound to the kinase. In certain embodiments, the electrophilic
moiety (e.g., Michael acceptor moiety) may react with a cysteine
residue of a kinase (e.g., CDK (e.g., CDK7)). In certain
embodiments, the electrophilic moiety (e.g., Michael acceptor
moiety) may react with the Cys312 residue of CDK7. In certain
embodiments, the covalent attachment is irreversible. In certain
embodiments, the covalent attachment is reversible.
[0198] R.sup.2 may be any one of Formulae (i-1)-(i-42). In certain
embodiments, R.sup.2 is of Formula (i-1):
##STR00069##
In certain embodiments, R.sup.2 is of Formula (i-2):
##STR00070##
In certain embodiments, R.sup.2 is of Formula (i-3):
##STR00071##
In certain embodiments, R.sup.2 is of Formula (i-4):
##STR00072##
In certain embodiments, R.sup.2 is of Formula (i-5):
##STR00073##
In certain embodiments, R.sup.2 is of Formula (i-6)
##STR00074##
In certain embodiments, R.sup.2 is of Formula (i-7):
##STR00075##
In certain embodiments, R.sup.2 is of Formula (i-8):
##STR00076##
In certain embodiments, R.sup.2 is of Formula (i-9):
##STR00077##
In certain embodiments, R.sup.2 is of Formula (i-10):
##STR00078##
In certain embodiments, R.sup.2 is of Formula (i-11):
##STR00079##
In certain embodiments, R.sup.2 is of Formula (i-12):
##STR00080##
In certain embodiments, R.sup.2 is of Formula (i-13):
##STR00081##
In certain embodiments, R.sup.2 is of Formula (i-14):
##STR00082##
In certain embodiments, R.sup.2 is of Formula (i-15):
##STR00083##
In certain embodiments, R.sup.2 is of Formula (i-16):
##STR00084##
In certain embodiments, R.sup.2 is of Formula (i-17):
##STR00085##
In certain embodiments, R.sup.2 is of Formula (i-18):
##STR00086##
In certain embodiments, R.sup.2 is of Formula (i-19):
##STR00087##
In certain embodiments, R.sup.2 is of Formula (i-20):
##STR00088##
In certain embodiments, R.sup.2 is of Formula (i-21):
##STR00089##
In certain embodiments, R.sup.2 is of Formula (i-22):
##STR00090##
In certain embodiments, R.sup.2 is of Formula (i-23):
##STR00091##
In certain embodiments, R.sup.2 is of Formula (i-24):
##STR00092##
In certain embodiments, R.sup.2 is of Formula (i-25):
##STR00093##
In certain embodiments, R.sup.2 is of Formula (i-26):
##STR00094##
In certain embodiments, R.sup.2 is of Formula (i-27):
##STR00095##
In certain embodiments, R.sup.2 is of Formula (i-28):
##STR00096##
In certain embodiments, R.sup.2 is of Formula (i-29):
##STR00097##
In certain embodiments, R.sup.2 is of Formula (i-30):
##STR00098##
In certain embodiments, R.sup.2 is of Formula (i-31):
##STR00099##
In certain embodiments, R.sup.2 is of Formula (i-32):
##STR00100##
In certain embodiments, R.sup.2 is of Formula (i-33):
##STR00101##
In certain embodiments, R.sup.2 is of Formula (i-34):
##STR00102##
In certain embodiments, R.sup.2 is of Formula (i-35):
##STR00103##
In certain embodiments, R.sup.2 is of Formula (i-36):
##STR00104##
In certain embodiments, R.sup.2 is of Formula (i-37):
##STR00105##
In certain embodiments, R.sup.2 is of Formula (i-38):
##STR00106##
In certain embodiments, R.sup.2 is of Formula (i-39):
##STR00107##
In certain embodiments, R.sup.2 is of Formula (i-40):
##STR00108##
In certain embodiments, R.sup.2 is of Formula (i-41):
##STR00109##
In certain embodiments, R.sup.2 is of Formula (i-42):
##STR00110##
[0199] In certain embodiments, R.sup.2 is of Formula (i-1a):
##STR00111##
In certain embodiments, R.sup.2 is of Formula (i-1b):
##STR00112##
In certain embodiments, R.sup.2 is of Formula (i-1c):
##STR00113##
In certain embodiments, R.sup.2 is of Formula (i-1d):
##STR00114##
In certain embodiments, R.sup.2 is of Formula (i-1e):
##STR00115##
In certain embodiments, R.sup.2 is of Formula (i-1f):
##STR00116##
In certain embodiments, R.sup.2 is of Formula (i-1g):
##STR00117##
In certain embodiments, R.sup.2 is of Formula (i-1g):
##STR00118##
In certain embodiments, R.sup.2 is
##STR00119##
In certain embodiments, R.sup.2 is
##STR00120##
In certain embodiments, R.sup.2 is
##STR00121##
In certain embodiments, R.sup.2 is
##STR00122##
[0200] In certain embodiments, R.sup.2 is of Formula (i-1a):
##STR00123##
In certain embodiments, R.sup.2 is of Formula (i-1b):
##STR00124##
In certain embodiments, R.sup.2 is of Formula (i-1c):
##STR00125##
In certain embodiments, R.sup.2 is
[0201] In certain embodiments, R.sup.2 is of Formula (i-18a):
##STR00126##
In certain embodiments, R.sup.2 is of Formula (i-18b):
##STR00127##
In certain embodiments, R.sup.2 is of Formula (i-18c):
##STR00128##
[0202] In certain embodiments, R.sup.2 is of Formula (i-15a):
##STR00129##
In certain embodiments, R.sup.2 is of Formula (i-15b):
##STR00130##
In certain embodiments, R.sup.2 is of Formula (i-15c):
##STR00131##
[0203] R.sup.2 may contain linker L.sup.3 or L.sup.4. In certain
embodiments, L.sup.3 is a bond. L.sup.3 is an optionally
substituted C.sub.1-4 hydrocarbon chain. In certain embodiments,
L.sup.3 is optionally substituted ethyl. In certain embodiments,
L.sup.3 is optionally substituted alkenyl. In certain embodiments,
L.sup.3 is an optionally substituted C.sub.1-4 hydrocarbon chain,
wherein one or more carbon units of the hydrocarbon chain are
independently replaced with --C(.dbd.O)--, --O--, --S--,
--NR.sup.L3a--, --NR.sup.L3aC(.dbd.O)--, --C(.dbd.O)NR.sup.L3a--,
--SC(.dbd.O)--, --C(.dbd.O)S--, --OC(.dbd.O)--, --C(.dbd.O)O--,
--NR.sup.L3aC(.dbd.S)--, --C(.dbd.S)NR.sup.L3a,
trans-CR.sup.L3b.dbd.CR.sup.L3b--, cis-CR.sup.L3b.dbd.CR.sup.L3b--,
--C.ident.C--, --S(.dbd.O)--, --S(.dbd.O)O--, --OS(.dbd.O)--,
--S(.dbd.O)NR.sup.L3a--, --NR.sup.L3aS(.dbd.O)--,
--S(.dbd.O).sub.2--, --S(.dbd.O).sub.2O--, --OS(.dbd.O).sub.2--,
--S(.dbd.O).sub.2NR.sup.L3a--, or --NR.sup.L3aS(.dbd.O).sub.2--. In
certain embodiments, L.sup.3 is an optionally substituted C.sub.1-4
hydrocarbon chain, wherein one carbon unit of the hydrocarbon chain
is replaced with --NR.sup.L3a-- (e.g., --NH--). In certain
embodiments, L.sup.3 is of the formula:
--(CH.sub.2).sub.1-4--NR.sup.L3a-- (e.g.,
--(CH.sub.2).sub.1-4--NH--) or --NR.sup.L3a--CH.sub.2).sub.1-4--
(e.g., --NH--CH.sub.2).sub.1-4--). In certain embodiments, L.sup.3
is --NR.sup.L3a--. In certain embodiments, L.sup.3 is
--NR.sup.L3a(C.dbd.O)--. In certain embodiments, L.sup.3 is
--(C.dbd.O)NR.sup.L3a--. In certain embodiments, L.sup.3 is --NH--.
In certain embodiments, L.sup.3 is --(C.dbd.O)--. In certain
embodiments, L.sup.3 is --NH(C.dbd.O)--. In certain embodiments,
L.sup.3 is --(C.dbd.O)NH--. In certain embodiments, L.sup.3 is
--O--. In certain embodiments, L.sup.3 is --S--. In certain
embodiments, L.sup.4 is a bond. In certain embodiments, L.sup.4 is
an optionally substituted C.sub.1-4 hydrocarbon chain.
[0204] Linker L.sup.3 may contain groups R.sup.L3a or R.sup.L3b. In
certain embodiments, R.sup.L3a is hydrogen. In certain embodiments,
at least one instance of R.sup.L3b is hydrogen. In certain
embodiments, each instance of R.sup.L3b is hydrogen. In certain
embodiments, at least one instance of R.sup.L3b is --Cl, --Br, or
--I. In certain embodiments, each instance of R.sup.L3b is --Cl,
--Br, or --I. In certain embodiments, at least one instance of
R.sup.L3b is --F. In certain embodiments, each instance of
R.sup.L3b is --F. In certain embodiments, at least one instance of
R.sup.L3b is optionally substituted alkyl, optionally substituted
alkenyl, optionally substituted alkynyl, optionally substituted
carbocyclyl, optionally substituted heterocyclyl, optionally
substituted aryl, or optionally substituted heteroaryl. In certain
embodiments, two R.sup.L3b groups are joined to form an optionally
substituted carbocyclic or optionally substituted heterocyclic
ring.
[0205] R.sup.2 may contain groups R.sup.E1, R.sup.E2, and/or
R.sup.E3. In certain embodiments, R.sup.E1 is hydrogen. In certain
embodiments, R.sup.E2 is hydrogen. In certain embodiments, R.sup.E3
is hydrogen. In certain embodiments, R.sup.E is --Cl, --Br, or --I.
In certain embodiments, R.sup.E2 is --Cl, --Br, or --I. In certain
embodiments, R.sup.E3 is --Cl, --Br, or --I. In certain
embodiments, R.sup.E1 is --F. In certain embodiments, R.sup.E2 is
--F. In certain embodiments, R.sup.E3 is --F. In certain
embodiments, R.sup.E1 is optionally substituted alkyl (e.g.,
substituted or unsubstituted C.sub.1-6 alkyl). In certain
embodiments, R.sup.E2 is optionally substituted alkyl (e.g.,
substituted or unsubstituted C.sub.1-6 alkyl). In certain
embodiments, R.sup.E3 is optionally substituted alkyl (e.g.,
substituted or unsubstituted C.sub.1-6 alkyl). In certain
embodiments, R.sup.E1 is optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, --CN, --CH.sub.2OR.sup.EE,
--CH.sub.2N(R.sup.EE).sub.2, --CH.sub.2SR.sup.EE, --OR.sup.EE,
--N(R.sup.EE).sub.2, --Si(R.sup.EE).sub.3, or --SR.sup.EE. In
certain embodiments, R.sup.E2 is optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
optionally substituted heteroaryl, --CN, --CH.sub.2OR.sup.EE,
--CH.sub.2N(R.sup.EE).sub.2, --CH.sub.2SR.sup.EE, --OR.sup.EE,
--N(R.sup.EE).sub.2, --Si(R.sup.EE).sub.3, or --SR.sup.EEIn certain
embodiments, R.sup.E3 is optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, --CN, --CH.sub.2OR.sup.EE,
--CH.sub.2N(R.sup.EE).sub.2, --CH.sub.2SR.sup.EE, --OR.sup.EE,
--N(R.sup.EE).sub.2, --Si(R.sup.EE).sub.3, or --SR.sup.EE. In
certain embodiments, R.sup.E1 is --N(R.sup.EE).sub.2. In certain
embodiments, R.sup.E2 is --N(R.sup.EE).sub.2. In certain
embodiments, R.sup.E3 is --N(R.sup.EE).sub.2. In certain
embodiments, R.sup.E1 is --N(CH.sub.3).sub.2. In certain
embodiments, R.sup.E2 is --N(CH.sub.3).sub.2. In certain
embodiments, R.sup.E3 is --N(CH.sub.3).sub.2. In certain
embodiments, R.sup.E1 is --CH.sub.2N(R.sup.EE).sub.2. In certain
embodiments, R.sup.E2 is --CH.sub.2N(R.sup.EE).sub.2. In certain
embodiments, R.sup.E3 is --CH.sub.2N(R.sup.EE).sub.2. In certain
embodiments, R.sup.E1 is --CH.sub.2N(CH.sub.3).sub.2. In certain
embodiments, R.sup.E2 is --CH.sub.2N(CH.sub.3).sub.2. In certain
embodiments, R.sup.E3 is --CH.sub.2N(CH.sub.3).sub.2. In certain
embodiments, R.sup.E1 is --CN. In certain embodiments, R.sup.E2 is
--CN. In certain embodiments, R.sup.E3 is --CN.
[0206] In certain embodiments, R.sup.E1 and R.sup.E3 are joined to
form an optionally substituted carbocyclic ring. In certain
embodiments, R.sup.E1 and R.sup.E3 are joined to form an optionally
substituted heterocyclic ring. In certain embodiments, R.sup.E2 and
R.sup.E3 are joined to form an optionally substituted carbocyclic
ring. In certain embodiments, R.sup.E2 and R.sup.E3 are joined to
form an optionally substituted heterocyclic ring. In certain
embodiments, R.sup.E1 and R.sup.E2 are joined to form an optionally
substituted carbocyclic ring. In certain embodiments, R.sup.E1 and
R.sup.E2 are joined to form an optionally substituted heterocyclic
ring.
[0207] R.sup.2 may contain group RE, where R.sup.E4 is a leaving
group. In certain embodiments, R.sup.E4 is --Cl, --Br, or --I. In
certain embodiments, R.sup.E4 is --F. In certain embodiments,
R.sup.E4 is --OS(.dbd.O)R.sup.E4a or --OS(.dbd.O).sub.2R.sup.E4a,
wherein R.sup.E4a is substituted or unsubstituted alkyl,
substituted or unsubstituted alkenyl, substituted or unsubstituted
alkynyl, substituted or unsubstituted carbocyclyl, substituted or
unsubstituted heterocyclyl, substituted or unsubstituted aryl, or
substituted or unsubstituted heteroaryl. In certain embodiments,
R.sup.E4 is --OR.sup.E4a. In certain embodiments, R.sup.E4 is
--OMs, --OTf, --OTs, --OBs, or 2-nitrobenzenesulfonyloxy. In
certain embodiments, R.sup.E4 is --OR.sup.E4a. In certain
embodiments, R.sup.E4 is --OMe, --OCF.sub.3, or --OPh. In certain
embodiments, R.sup.E4 is --OC(.dbd.O)R.sup.E4a. In certain
embodiments, R.sup.E4 is --OC(.dbd.O)Me, --OC(.dbd.O)CF.sub.3,
--OC(.dbd.O)Ph, or --OC(.dbd.O)Cl. In certain embodiments, R.sup.E4
is --OC(.dbd.O)OR.sup.E4a. In certain embodiments, R.sup.E4 is
--OC(.dbd.O)OMe or --OC(.dbd.O)O(t-Bu).
[0208] R.sup.2 may contain group R.sup.E5, where R.sup.E5 is a
halogen. In certain embodiments, R.sup.E5 is --Cl, --Br, or --I. In
certain embodiments, R.sup.E5 is --F.
[0209] R.sup.2 may contain group R.sup.E6. In certain embodiments,
R.sup.E6 is hydrogen. In certain embodiments, R.sup.E6 is
substituted or unsubstituted C.sub.1-C.sub.6 alkyl. In certain
embodiments, R.sup.E6 is a nitrogen protecting group.
[0210] In certain embodiments, a is 1. In certain embodiments, a is
2.
[0211] In certain embodiments, z is 0. In certain embodiments, z is
1. In certain embodiments, z is 2. In certain embodiments, z is 3,
4, 5, or 6.
[0212] R.sup.2 may contain group Y. In certain embodiments, Y is O.
In certain embodiments, Y is S. In certain embodiments, Y is
NR.sup.E7. In certain embodiments, Y is NH.
[0213] In certain embodiments, a compound described herein is of
Formula (II):
##STR00132##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein R.sup.1, R.sup.2, linker
L.sup.2, Ring A, and Ring B are as defined for Formula (I).
[0214] In certain embodiments, a compound of Formula (I) is of
Formula (III):
##STR00133##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein R.sup.1, R.sup.2, linker
L.sup.2, Ring A, and Ring B are as defined for Formula (I).
[0215] In certain embodiments, a compound of Formula (I) is of
Formula (IV-a):
##STR00134##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein R.sup.1, R.sup.2, linker
L.sup.1, linker L.sup.2, and Ring B are as defined for Formula
(I).
[0216] In certain embodiments, a compound of Formula (I) is of
Formula (IV-b):
##STR00135##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein R.sup.1, R.sup.2, linker
L.sup.1, linker L.sup.2, and Ring B are as defined for Formula
(I).
[0217] In certain embodiments, a compound Formula (I) is of Formula
(IV-c):
##STR00136##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein R.sup.1, R.sup.2, linker
L.sup.1, linker L.sup.2, and Ring B are as defined for Formula
(I).
[0218] In certain embodiments, a compound Formula (I) is of Formula
(IV-d):
##STR00137##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein R.sup.1, R.sup.2, linker
L.sup.1, linker L.sup.2, and Ring B are as defined for Formula
(I).
[0219] In certain embodiments, a compound Formula (I) is of Formula
(IV-e):
##STR00138##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein R.sup.1, R.sup.2, linker
L.sup.1, linker L.sup.2, and Ring B are as defined for Formula
(I).
[0220] In certain embodiments, a compound Formula (I) is of Formula
(IV-f):
##STR00139##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein R.sup.1, R.sup.2, linker
Lt, linker L.sup.2, and Ring B are as defined for Formula (I).
[0221] In certain embodiments, a compound Formula (I) is of Formula
(V-a):
##STR00140##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0222] R.sup.2, linker
L.sup.2, Ring A, and Ring B are as defined for Formula (I); [0223]
R.sup.a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl; and [0224] each of R.sup.1N and R.sup.2N is
independently hydrogen, C.sub.1-C.sub.6 alkyl, or a nitrogen
protecting group, or R.sup.1N and R.sup.2N are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring.
[0225] In certain embodiments, a compound Formula (I) is of Formula
(V-b):
##STR00141##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0226] R.sup.2, linker
L.sup.2, Ring A, and Ring B are as defined for Formula (I); [0227]
R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl; and [0228] each of R.sup.1N and R.sup.2N is
independently hydrogen, C.sub.1-C.sub.6 alkyl, or a nitrogen
protecting group, or R.sup.1N and R.sup.2N are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring.
[0229] In certain embodiments, a compound Formula (I) is of Formula
(V-c):
##STR00142##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0230] R.sup.2, linker
L.sup.2, Ring A, and Ring B are as defined for Formula (I); [0231]
R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl; and [0232] each of R.sup.1N and R.sup.2N is
independently hydrogen, C.sub.1-C.sub.6 alkyl, or a nitrogen
protecting group, or R.sup.1N and R.sup.2N are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring.
[0233] In certain embodiments, a compound Formula (I) is of Formula
(V-d):
##STR00143##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0234] R.sup.2, linker
L.sup.2, Ring A, and Ring B are as defined for Formula (I); [0235]
R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl; and [0236] each of R.sup.1N and R.sup.2N is
independently hydrogen, C.sub.1-C.sub.6 alkyl, or a nitrogen
protecting group, or R.sup.1N and R.sup.2N are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring.
[0237] In certain embodiments, a compound Formula (I) is of Formula
(VI-a):
##STR00144##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0238] R.sup.2, linker L,
linker L.sup.2, and Ring B are as defined for Formula (I); [0239]
R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl; and [0240] each of R.sup.1N and R.sup.2N is
independently hydrogen, C.sub.1-C.sub.6 alkyl, or a nitrogen
protecting group, or R.sup.1N and R.sup.2N are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring.
[0241] In certain embodiments, a compound Formula (I) is of Formula
(VI-b):
##STR00145##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0242] R.sup.2, linker Lt,
linker L.sup.2, and Ring B are as defined for Formula (I); [0243]
R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl; and [0244] each of R.sup.1N and R.sup.2N is
independently hydrogen, C.sub.1-C.sub.6 alkyl, or a nitrogen
protecting group, or R.sup.1N and R.sup.2N are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring.
[0245] In certain embodiments, a compound Formula (I) is of Formula
(VI-c):
##STR00146##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0246] R.sup.2, linker Lt,
linker L.sup.2, and Ring B are as defined for Formula (I); [0247]
R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl; and [0248] each of R.sup.1N and R.sup.2N is
independently hydrogen, C.sub.1-C.sub.6 alkyl, or a nitrogen
protecting group, or R.sup.1N and R.sup.2N are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring.
[0249] In certain embodiments, a compound Formula (I) is of Formula
(VI-d):
##STR00147##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0250] R.sup.2, linker
L.sup.1, linker L.sup.2, and Ring B are as defined for Formula (I);
[0251] R.sup.a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl; and [0252] each of R.sup.1N and R.sup.2N is
independently hydrogen, C.sub.1-C.sub.6 alkyl, or a nitrogen
protecting group, or R.sup.1N and R.sup.2N are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring.
[0253] In certain embodiments, a compound Formula (I) is of Formula
(VI-e):
##STR00148##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0254] R.sup.2, linker
L.sup.1, linker L.sup.2, and Ring B are as defined for Formula (I);
[0255] R.sup.a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl; and [0256] each of R.sup.1N and R.sup.2N is
independently hydrogen, C.sub.1-C.sub.6 alkyl, or a nitrogen
protecting group, or R.sup.1N and R.sup.2N are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring.
[0257] In certain embodiments, a compound Formula (I) is of Formula
(VI-f):
##STR00149##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0258] R.sup.2, linker L,
linker L.sup.2, and Ring B are as defined for Formula (I); [0259]
R.sup.a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl; and [0260] each of R.sup.1N and R.sup.2N is
independently hydrogen, C.sub.1-C.sub.6 alkyl, or a nitrogen
protecting group, or R.sup.1N and R.sup.2N are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring.
[0261] In certain embodiments, a compound Formula (I) is of Formula
(VI-g):
##STR00150##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0262] R.sup.2, linker
L.sup.1, linker L.sup.2, and Ring B are as defined for Formula (I);
[0263] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl; and [0264] each of R.sup.1N and R.sup.2N is
independently hydrogen, C.sub.1-C.sub.6 alkyl, or a nitrogen
protecting group, or R.sup.1N and R.sup.2N are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring.
[0265] In certain embodiments, a compound Formula (I) is of Formula
(VI-h):
##STR00151##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0266] R.sup.2, linker L,
linker L.sup.2, and Ring B are as defined for Formula (I); [0267]
R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl; and [0268] each of R.sup.1N and R.sup.2N is
independently hydrogen, C.sub.1-C.sub.6 alkyl, or a nitrogen
protecting group, or R.sup.1N and R.sup.2N are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring.
[0269] In certain embodiments, a compound Formula (I) is of Formula
(VI-i):
##STR00152##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0270] R.sup.2, linker L,
linker L.sup.2, and Ring B are as defined for Formula (I); [0271]
R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl; and [0272] each of R.sup.1N and R.sup.2N is
independently hydrogen, C.sub.1-C.sub.6 alkyl, or a nitrogen
protecting group, or R.sup.1N and R.sup.2N are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring.
[0273] In certain embodiments, a compound Formula (I) is of Formula
(VI-j):
##STR00153##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0274] R.sup.2, linker L,
linker L.sup.2, and Ring B are as defined for Formula (I); [0275]
R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl; and [0276] each of R.sup.1N and R.sup.2N is
independently hydrogen, C.sub.1-C.sub.6 alkyl, or a nitrogen
protecting group, or R.sup.1N and R.sup.2N are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring.
[0277] In certain embodiments, a compound Formula (I) is of Formula
(VI-k):
##STR00154##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0278] R.sup.2, linker L,
linker L.sup.2, and Ring B are as defined for Formula (I); [0279]
R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl; and [0280] each of R.sup.1N and R.sup.2N is
independently hydrogen, C.sub.1-C.sub.6 alkyl, or a nitrogen
protecting group, or R.sup.1N and R.sup.2N are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring.
[0281] In certain embodiments, a compound Formula (I) is of Formula
(VI-1):
##STR00155##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0282] R.sup.2, linker L,
linker L.sup.2, and Ring B are as defined for Formula (I); [0283]
R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl; and [0284] each of R.sup.1N and R.sup.2N is
independently hydrogen, C.sub.1-C.sub.6 alkyl, or a nitrogen
protecting group, or R.sup.1N and R.sup.2N are joined to form an
optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring.
[0285] In certain embodiments, a compound Formula (I) is of Formula
(VII-a):
##STR00156##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0286] R.sup.2, linker
L.sup.2, Ring A, and Ring B are as defined for Formula (I); and
[0287] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl.
[0288] In certain embodiments, a compound Formula (I) is of Formula
(VII-b):
##STR00157##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0289] R.sup.2, linker
L.sup.2, Ring A, and Ring B are as defined for Formula (I); and
[0290] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl.
[0291] In certain embodiments, a compound Formula (I) is of Formula
(VII-c):
##STR00158##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0292] R.sup.2, linker
L.sup.2, Ring A, and Ring B are as defined for Formula (I); and
[0293] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl.
[0294] In certain embodiments, a compound Formula (I) is of Formula
(VII-d):
##STR00159##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0295] R.sup.2, linker
L.sup.2, Ring A, and Ring B are as defined for Formula (I); and
[0296] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl.
[0297] In certain embodiments, a compound Formula (I) is of Formula
(VIII-a):
##STR00160##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: R.sup.2, linker L, linker
L.sup.2, and Ring B are as defined for Formula (I); and R.sup.1a is
hydrogen, C.sub.1-C.sub.6 alkyl, or optionally substituted
aryl.
[0298] In certain embodiments, a compound Formula (I) is of Formula
(VIII-b):
##STR00161##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0299] R.sup.2, linker L,
linker L.sup.2, and Ring B are as defined for Formula (I); and
[0300] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl.
[0301] In certain embodiments, a compound Formula (I) is of Formula
(VIII-c):
##STR00162##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0302] R.sup.2, linker L,
linker L.sup.2, and Ring B are as defined for Formula (I); and
[0303] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl.
[0304] In certain embodiments, a compound Formula (I) is of Formula
(VIII-d):
##STR00163##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0305] R.sup.2, linker L,
linker L.sup.2, and Ring B are as defined for Formula (I); and
[0306] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl.
[0307] In certain embodiments, a compound Formula (I) is of Formula
(VIII-e):
##STR00164##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof wherein: [0308] R.sup.2, linker L,
linker L.sup.2, and Ring B are as defined for Formula (I); and
[0309] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl.
[0310] In certain embodiments, a compound Formula (I) is of Formula
(VIII-f):
##STR00165##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof wherein: [0311] R.sup.2, linker L,
linker L.sup.2, and Ring B are as defined for Formula (I); and
[0312] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl.
[0313] In certain embodiments, a compound Formula (I) is of Formula
(VIII-g):
##STR00166##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof wherein: [0314] R.sup.2, linker L,
linker L.sup.2, and Ring B are as defined for Formula (I); and
[0315] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl.
[0316] In certain embodiments, a compound Formula (I) is of Formula
(VIII-h):
##STR00167##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof wherein: [0317] R.sup.2, linker L,
linker L.sup.2, and Ring B are as defined for Formula (I); and
[0318] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl.
[0319] In certain embodiments, a compound Formula (I) is of Formula
(VIII-i):
##STR00168##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof wherein: [0320] R.sup.2, linker L,
linker L.sup.2, and Ring B are as defined for Formula (I); and
[0321] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl.
[0322] In certain embodiments, a compound Formula (I) is of Formula
(VIII-j):
##STR00169##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof wherein: [0323] R.sup.2, linker L,
linker L.sup.2, and Ring B are as defined for Formula (I); and
[0324] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl.
[0325] In certain embodiments, a compound Formula (I) is of Formula
(VIII-k):
##STR00170##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof wherein: [0326] R.sup.2, linker L,
linker L.sup.2, and Ring B are as defined for Formula (I); and
[0327] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl.
[0328] In certain embodiments, a compound Formula (I) is of Formula
(VIII-1):
##STR00171##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof wherein: [0329] R.sup.2, linker L,
linker L.sup.2, and Ring B are as defined for Formula (I); and
[0330] R.sup.1a is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally
substituted aryl.
[0331] In certain embodiments, a compound Formula (I) is of Formula
(IX-a):
##STR00172##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein R.sup.1, linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I).
[0332] In certain embodiments, a compound Formula (I) is of Formula
(IX-b):
##STR00173##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein R.sup.1, linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I).
[0333] In certain embodiments, a compound Formula (I) is of Formula
(IX-c):
##STR00174##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein R.sup.1, linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I).
[0334] In certain embodiments, a compound Formula (I) is of Formula
(IX-d):
##STR00175##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein R.sup.1, linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I).
[0335] In certain embodiments, a compound Formula (I) is of Formula
(X-a):
##STR00176##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0336] linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I); [0337] R.sup.1a
is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally substituted aryl;
and [0338] each of R.sup.1N and R.sup.2N is independently hydrogen,
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group, or R.sup.1N
and R.sup.2N are joined to form an optionally substituted
carbocyclic, optionally substituted heterocyclic, optionally
substituted aryl, or optionally substituted heteroaryl ring.
[0339] In certain embodiments, a compound Formula (I) is of Formula
(X-b):
##STR00177##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0340] linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I); [0341] R.sup.1a
is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally substituted aryl;
and [0342] each of R.sup.1N and R.sup.2N is independently hydrogen,
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group, or R.sup.1N
and R.sup.2N are joined to form an optionally substituted
carbocyclic, optionally substituted heterocyclic, optionally
substituted aryl, or optionally substituted heteroaryl ring.
[0343] In certain embodiments, a compound Formula (I) is of Formula
(X-c):
##STR00178##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0344] linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I); [0345] R.sup.1a
is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally substituted aryl;
and [0346] each of R.sup.1N and R.sup.2N is independently hydrogen,
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group, or R.sup.1N
and R.sup.2N are joined to form an optionally substituted
carbocyclic, optionally substituted heterocyclic, optionally
substituted aryl, or optionally substituted heteroaryl ring.
[0347] In certain embodiments, a compound Formula (I) is of Formula
(X-d):
##STR00179##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0348] linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I); [0349] R.sup.1a
is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally substituted aryl;
and [0350] each of R.sup.1N and R.sup.2N is independently hydrogen,
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group, or R.sup.1N
and R.sup.2N are joined to form an optionally substituted
carbocyclic, optionally substituted heterocyclic, optionally
substituted aryl, or optionally substituted heteroaryl ring.
[0351] In certain embodiments, a compound Formula (I) is of Formula
(XI-a):
##STR00180##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0352] linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I); [0353] R.sup.1a
is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally substituted aryl;
and [0354] each of R.sup.1N and R.sup.2N is independently hydrogen,
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group, or R.sup.1N
and R.sup.2N are joined to form an optionally substituted
carbocyclic, optionally substituted heterocyclic, optionally
substituted aryl, or optionally substituted heteroaryl ring.
[0355] In certain embodiments, a compound Formula (I) is of Formula
(XI-b):
##STR00181##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0356] linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I); [0357] R.sup.a
is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally substituted aryl;
and [0358] each of R.sup.1N and R.sup.2N is independently hydrogen,
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group, or R.sup.1N
and R.sup.2N are joined to form an optionally substituted
carbocyclic, optionally substituted heterocyclic, optionally
substituted aryl, or optionally substituted heteroaryl ring.
[0359] In certain embodiments, a compound Formula (I) is of Formula
(XI-c):
##STR00182##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0360] linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I); [0361] R.sup.a
is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally substituted aryl;
and [0362] each of R.sup.1N and R.sup.2N is independently hydrogen,
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group, or R.sup.1N
and R.sup.2N are joined to form an optionally substituted
carbocyclic, optionally substituted heterocyclic, optionally
substituted aryl, or optionally substituted heteroaryl ring.
[0363] In certain embodiments, a compound Formula (I) is of Formula
(XI-d):
##STR00183##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0364] linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I); [0365] R.sup.a
is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally substituted aryl;
and [0366] each of R.sup.1N and R.sup.2N is independently hydrogen,
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group, or R.sup.1N
and R.sup.2N are joined to form an optionally substituted
carbocyclic, optionally substituted heterocyclic, optionally
substituted aryl, or optionally substituted heteroaryl ring.
[0367] In certain embodiments, a compound Formula (I) is of Formula
(XII-a):
##STR00184##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0368] linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I); [0369] R.sup.1a
is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally substituted aryl;
and [0370] each of R.sup.1N and R.sup.2N is independently hydrogen,
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group, or R.sup.1N
and R.sup.2N are joined to form an optionally substituted
carbocyclic, optionally substituted heterocyclic, optionally
substituted aryl, or optionally substituted heteroaryl ring.
[0371] In certain embodiments, a compound Formula (I) is of Formula
(XII-b):
##STR00185##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0372] linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I); [0373] R.sup.1a
is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally substituted aryl;
and [0374] each of R.sup.1N and R.sup.2N is independently hydrogen,
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group, or R.sup.1N
and R.sup.2N are joined to form an optionally substituted
carbocyclic, optionally substituted heterocyclic, optionally
substituted aryl, or optionally substituted heteroaryl ring.
[0375] In certain embodiments, a compound Formula (I) is of Formula
(XII-c):
##STR00186##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0376] linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I); [0377] R.sup.1a
is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally substituted aryl;
and [0378] each of R.sup.1N and R.sup.2N is independently hydrogen,
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group, or R.sup.1N
and R.sup.2N are joined to form an optionally substituted
carbocyclic, optionally substituted heterocyclic, optionally
substituted aryl, or optionally substituted heteroaryl ring.
[0379] In certain embodiments, a compound Formula (I) is of Formula
(XII-d):
##STR00187##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0380] linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I); [0381] R.sup.1a
is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally substituted aryl;
and [0382] each of R.sup.1N and R.sup.2N is independently hydrogen,
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group, or R.sup.1N
and R.sup.2N are joined to form an optionally substituted
carbocyclic, optionally substituted heterocyclic, optionally
substituted aryl, or optionally substituted heteroaryl ring.
[0383] In certain embodiments, a compound Formula (I) is of Formula
(XIII-a):
##STR00188##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0384] linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I); [0385] R.sup.1a
is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally substituted aryl;
and [0386] each of R.sup.1N and R.sup.2N is independently hydrogen,
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group, or R.sup.1N
and R.sup.2N are joined to form an optionally substituted
carbocyclic, optionally substituted heterocyclic, optionally
substituted aryl, or optionally substituted heteroaryl ring.
[0387] In certain embodiments, a compound Formula (I) is of Formula
(XIII-b):
##STR00189##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0388] linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I); [0389] R.sup.1a
is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally substituted aryl;
and [0390] each of R.sup.1N and R.sup.2N is independently hydrogen,
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group, or R.sup.1N
and R.sup.2N are joined to form an optionally substituted
carbocyclic, optionally substituted heterocyclic, optionally
substituted aryl, or optionally substituted heteroaryl ring.
[0391] In certain embodiments, a compound Formula (I) is of Formula
(XIII-c):
##STR00190##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0392] linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I); [0393] R.sup.1a
is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally substituted aryl;
and [0394] each of R.sup.1N and R.sup.2N is independently hydrogen,
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group, or R.sup.1N
and R.sup.2N are joined to form an optionally substituted
carbocyclic, optionally substituted heterocyclic, optionally
substituted aryl, or optionally substituted heteroaryl ring.
[0395] In certain embodiments, a compound Formula (I) is of Formula
(XIII-d):
##STR00191##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein: [0396] linker L.sup.2,
Ring A, and Ring B are as defined for Formula (I); [0397] R.sup.1a
is hydrogen, C.sub.1-C.sub.6 alkyl, or optionally substituted aryl;
and [0398] each of R.sup.1N and R.sup.2N is independently hydrogen,
C.sub.1-C.sub.6 alkyl, or a nitrogen protecting group, or R.sup.1N
and R.sup.2N are joined to form an optionally substituted
carbocyclic, optionally substituted heterocyclic, optionally
substituted aryl, or optionally substituted heteroaryl ring.
[0399] In certain embodiments, the compound according to Formula
(I) is a compound listed in Table 1.
TABLE-US-00002 TABLE 1 Exemplary Compounds of Formula (I) Name
Structure Characterization Data Compound 101 (S)-3-((3-(4-
acrylamidobenzamido) phenyl)amino)-N-(2- (dimethylamino)-1-
phenylethyl)-6,6- dimethy1-4,6- dihydropyrrolo[3,4-
c]pyrazole-5(1H)- carboxamide ##STR00192## .sup.1H NMR: 600 MHz
(DMSO-d.sub.6) .delta. 10.44 (d, J = 4.2 Hz, 1H), 10.04 (s, 1H),
8.33 (s, 1H), 7.96-7.93 (m, 2H), 7.82-7.80 (m, 2H), 7.34-7.32 (m,
2H), 7.26-7.23 (m, 2H), 7.20-7.10 (m, 3H), 6.52-6.46 (m, 1H),
6.35-6.30 (m, 1H), 6.09 (s, 1H), 5.84-5.81 (m, 1H), 4.89- 4.83 (m,
1H), 4.35 (d, J = 19.8 Hz, 2H), 2.64-2.57 (m, 1H), 2.45-2.38 (m,
1H), 2.18 (s, 6H), 1.65 (d, J = 4.2 Hz, 3H), 1.58 (d, J = 4.8 Hz,
3H); MS m/z: 607.4 [M + 1]. Compound 102 (S)-3-((4-(4-
acrylamidobenzamido) phenyl)amino)-N-(2- (dimethylamino)-1-
phenylethyl)-6,6- dimethyl-4,6- dihydropyrrolo[3,4-
c]pyrazole-5(1H)- carboxamide ##STR00193## .sup.1H NMR (TFA salt):
400 MHz (DMSO-d.sub.6) .delta. 10.46 (s, 1H), 10.01 (s, 1H),
8.98-8.89 (br, 1H), 8.25 (s, 1H), 7.99 (d, J = 8.8 Hz, 2H), 7.85
(d, J = 8.8 Hz, 2H), 7.64 (d, J = 8.8 Hz, 2H), 7.48-7.42 (m, 4H),
7.38-7.34 (m, 1H), 7.00-6.91 (m, 2H), 6.69 (d, J = 8.8 Hz, 1H),
6.53 (dd, J = 17.2, 10.0 Hz, 1H), 6.36 (dd, J = 17.2, 2.0 Hz, 1H),
5.87 (dd, J = 10.0, 2.0 Hz, 1H), 5.40- 5.35 (m, 1H), 4.48 (d, J =
10.8 Hz, 1H), 4.33 (d, J = 10.8 Hz, 1H), 3.10- 2.95 (m, 2H), 2.93
(d, J = 4.8 Hz, 3H), 2.87 (d, J = 4.8 Hz, 3H), 1.74 (s, 3H), 1.65
(s, 3H); MS m/z: 607.4 [M + 1]. Compound 103 (S)-3-((4-(3-
acrylamidobenzamido) phenyl)amino)-N-(2- (dimethylamino)-1-
phenylethyl)-6,6- dimethyl-4,6- dihydropyrrolo [3,4-c]pyrazole-
5(1H)-carboxamide ##STR00194## .sup.1H NMR (TFA salt): 400 MHz
(DMSO-d.sub.6) .delta. 11.90-11.70 (br, 1H), 10.26 (s, 1H), 9.98
(s, 1H), 8.22-8.10 (br, 1H), 8.07 (m, 1H), 7.83 (dd, J = 8.0, 1.2
Hz, 1H), 7.57 (d, J = 8.0 Hz, 1H), 7.51 (d, J = 8.8 Hz, 2H), 7.39
(t, J = 8.0 Hz, 1H), 7.27 (d, J = 7.2 Hz, 2H), 7.22 (t, J = 7.2 Hz,
2H), 7.12 (t, J = 7.2 Hz, 1H), 6.39 (dd, J = 17.2, 10.0 Hz, 1H),
6.22 (dd, J = 17.2, 2.0 Hz, 1H), 6.03-5.92 (m, 1H), 5.72 (dd, J =
10.0, 2.0 Hz, 1H), 4.60-4.51 (m, 1H), 4.25-4.14 (m, 2H), 2.52 (dd,
J = 12.0, 8.8 Hz, 1H), 2.32-2.27 (m, 1H), 2.10 (s, 6H), 1.57 (s,
3H), 1.50 (s, 3H); MS m/z: 607.4 [M + 1]. Compound 104 (S)-N-(2-
(dimethylamino)-1- phenylethyl)-6,6- dimethyl-3-((3-(4-
propionamidobenzamido) phenyl)amino)-4,6- dihydropyrrolo[3,4-c]
pyrazole-5(1H)- carboxamide ##STR00195## .sup.1H NMR (TFA salt):
400 MHz (DMSO-d.sup.6) .delta. 12.20-11.80 (br, 1H), 10.09 (s, 1H),
9.93 (s, 1H), 8.23 (s, 1H), 7.83 (d, J = 8.0 Hz, 2H), 7.65 (d, J =
8.8 Hz, 2H), 7.50-7.30 (m, 1H), 7.27 (d, J = 6.8 Hz, 2H), 7.18 (t,
J = 7.2 Hz, 2H), 7.13-7.09 (m, 3H), 6.59- 6.51 (m, 1H), 6.12 (s,
1H), 4.92-4.80 (m, 1H), 4.29 (s, 2H), 2.30 (q, J = 7.6 Hz, 2H),
2.22 (m, 6H), 1.57 (s, 3H), 1.51 (s, 3H), 1.03 (t, J = 7.6 Hz, 3H);
MS m/z: 609.4 [M + 1]. Compound 105 (S)-3-((3-(3-
acrylamidobenzamido) phenyl)amino)-N-(2- (dimethylamino)-1-
phenylethyl)-6,6- dimethyl-4,6- dihydropyrrolo [3,4-c]pyrazole-
5(1H)-carboxamide ##STR00196## .sup.1H NMR (TFA salt): 400 MHz
(DMSO-d.sub.6) 12.10-11.82 (br, 1H), 10.26 (s, 1H), 10.08 (s, 1H),
8.25 (s, 1H), 8.06 (s, 1H), 7.85 (dd, J = 8.4, 1.2 Hz, 1H), 7.55
(d, J = 7.6 Hz, 1H), 7.39 (t, J = 8.0 Hz, 1H), 7.24 (d, J = 7.2 Hz,
2H), 7.15 (t, J = 7.2 Hz, 2H), 7.08 (d, J = 6.4 Hz, 1H), 6.39 (dd,
J = 17.2, 10.0 Hz, 1H), 6.22 (dd, J = 17.2, 2.0 Hz, 1H), 5.97 (s,
1H), 5.72 (dd, J = 10.0, 2.0 Hz, 1H), 4.76-4.70 (m, 1H), 4.30-4.19
(m, 2H), 2.50-2.44 (m, 1H), 2.29-2.22 (m, 1H), 2.05 (s, 6H), 1.57
(s, 3H), 1.50 (s, 3H); MS m/z: 607.4 [M + 1]. Compound 106
3-((3-(4- acrylamidobenzamido) phenyl)amino)-N-(2-
(dimethylamino)ethyl)- 6,6-dimethyl-4,6- dihydropyrrolo[3,4-c]
pyrazole-5(1H)- carboxamide ##STR00197## .sup.1H NMR (TFA salt):
400 MHz (DMSO-d.sub.6) .delta. 10.49 (s, 1H), 10.07 (s, 1H), 9.41
(s, 1H), 8.37 (s, 1H), 7.99 (d, J = 8.8 Hz, 2H), 7.86 (d, J = 8.8
Hz, 2H), 7.49 (s, 1H), 7.21 (m, 2H), 6.74 (m, 1H), 6.53 (dd, J =
17.2, 10.0 Hz, 1H), 6.38 (m, 1H), 6.36 (dd, J = 17.2, 2.0 Hz, 1H),
5.87 (dd, J = 10.0, 2.0 Hz, 1H), 4.27 (s, 2H), 3.41 (q, J = 5.6 Hz,
2H), 3.18 (q, J = 5.6 Hz, 2H), 2.86 (s, 3H), 2.85 (s, 3H), 1.71 (s,
6H); MS m/z: 531.4 [M + 1]. Compound 107 4-acrylamido-N-(3-
((6,6-dimethyl-5- (4-methylpiperazine- 1-carbonyl)-1,4,5,6-
tetrahydropyrrolo[3, 4-c]pyrazol-3-yl) amino)phenyl) benzamide
##STR00198## .sup.1H NMR (TFA salt): 400 MHz (DMSO-d.sub.6) .delta.
10.49 (s, 1H), 10.08 (s, 1H), 9.68 (s, 1H), 8.44 (s, 1H), 7.99 (d,
J = 8.8 Hz, 2H), 7.86 (d, J = 8.4 Hz, 2H), 7.62 (s, 1H), 7.23-7.13
(m, 2H), 6.84 (d, J = 7.2 Hz, 1H), 6.53 (dd, J = 17.2, 10.0 Hz,
1H), 6.36 (dd, J = 17.2, 2.0 Hz, 1H), 5.87 (dd, J = 10.0, 2.0 Hz,
1H), 4.43 (s, 2H), 3.40- 3.33 (m, 4H), 3.15-2.97 (m, 4H), 2.82 (s,
3H), 1.70 (s, 6H); MS m/z: 543.4 [M + 1]. Compound 108 3-((3-(4-
acrylamidobenzamido) phenyl)amino)-N-(1- (dimethylamino)
propan-2-yl)-6,6- dimethyl-4,6- dihydropyrrolo [3,4-c]pyrazole-
5(1H)-carboxamide ##STR00199## .sup.1H NMR (TFA salt): 400 MHz
(DMSO-d.sub.6) .delta. 10.35 (s, 1H), 9.95 (s, 1H), 8.91 (s, 1H),
8.23 (s, 1H), 7.85 (d, J = 8.4 Hz, 2H), 7.72 (d, J = 8.4 Hz, 2H),
7.32 (s, 1H), 7.11-7.05 (m, 2H), 6.57 (m, 1H), 6.40 (dd, J = 16.8,
10.0 Hz, 1H), 6.23 (dd, J = 16.8, 2.0 Hz, 1H), 5.91 (d, J = 8.4 Hz,
1H), 5.74 (dd, J = 10.0, 2.0 Hz, 1H), 4.1 (s, 2H), 4.14-4.07 (m,
1H), 3.05-2.94 (m, 2H), 2.71 (d, J = 4.8 Hz, 3H), 2.69 (d, J = 4.8
Hz, 3H), 1.59 (s, 6H), 1.01 (d, J = 6.4 Hz, 3H), 0.85-0.76 (m, 1H);
MS m/z: 545.3 [M + 1]. Compound 109 (S,E)-3-((3-(4-(4-
(dimethylamino)but-2- enamido)benzamido) phenyl)amino)-N-(2-
hydroxy-1- phenylethyl)-6,6- dimethyl-4,6- dihydropyrrolo[3,4-c]
pyrazole-5(1H)- carboxamide ##STR00200## .sup.1H NMR (TFA salt):
400 MHz (DMSO-d.sub.6) .delta. 10.68 (s, 1H), 10.13 (s, 1H), 10.01
(s, 1H), 8.43 (s, 1H), 8.03 (d, J = 8.8 Hz, 2H), 7.88 (d, J = 8.8
Hz, 2H), 7.54 (s, 1H), 7.41-7.39 (m, 2H), 7.34-7.30 (m, 2H),
7.27-7.22 (m, 3H), 6.92-6.82 (m, 2H), 6.58 (d, J = 15.6 Hz, 1H),
6.13 (d, J = 8.0 Hz, 1H), 4.85 (q, J = 6.8 Hz, 1H), 4.48 (q, J =
11.2 Hz, 2H), 4.06 (d, J = 7.2 Hz, 2H), 3.63 (d, J = 6.4 Hz, 2H),
2.91 (s, 6H), 2.64 (t, J = 5.6 Hz, 1H), 1.73 (s, 3H), 1.67 (s, 3H);
MS m/z: 637.3 [M + 1]. Compound 110 (S)-3-((3- acrylamidophenyl)
amino)-N-(2- (dimethylamino)- 1-phenylethyl)- 6,6-dimethyl-4,6-
dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide ##STR00201##
.sup.1H NMR (TFA salt): 400 MHz (DMSO-d.sub.6) .delta. 9.94 (s,
1H), 8.90 (s, 1H), 8.24 (s, 1H), 7.35-7.27 (m, 4H), 7.24-7.22 (m,
2H), 7.08-7.02 (m, 2H), 6.56-6.52 (m, 2H), 6.38 (dd, J = 16.8, 10.0
Hz, 1H), 6.16 (dd, J = 16.8, 2.0 H, 1H), 5.29-5.22 (m, 1H), 4.31
(q, J = 11.2 Hz, 2H), 3.39-3.34 (m, 1H), 3.28-3.22 (m, 1H), 2.80
(d, J = 4.8 Hz, 1H), 2.73 (d, J = 4.8 Hz, 1H), 1.59 (s, 3H), 1.53
(s, 3H); MS m/z: 488.3 [M + 1]. Compound 111 (S)-3-((4-
acrylamidophenyl) amino)-N-(2- (dimethylamino)- 1-phenylethyl)-
6,6-dimethyl-4,6- dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide
##STR00202## .sup.1H NMR (TFA salt): 400 MHz (DMSO-d.sub.6) .delta.
9.86 (s, 1H), 8.91 (s, 1H), 8.13 (s, 1H), 7.49-7.43 (m, 2H),
7.40-7.27 (m, 5H), 7.22 (m, 1H), 6.82 (d, J = 9.2 Hz, 1H), 6.55 (d,
J = 9.2 Hz, 1H), 6.34 (dd, J = 16.8, 10.0 Hz, 1H), 6.13 (dd, J =
16.8, 2.0 Hz, 1H), 5.62 (dd, J = 10.0, 2.0 Hz, 1H), 5.29- 5.22 (m,
1H), 4.33 (d, J = 11.2 Hz, 1H), 4.19 (d, J = 11.2 Hz, 1H), 3.42-
3.36 (m, 1H), 3.29-3.23 (m, 1H), 2.81 (d, J = 4.8 Hz, 1H), 2.74 (d,
J = 4.8 Hz, 1H), 1.60 (s, 3H), 1.51 (s, 3H); MS m/z: 488.3 [M + 1].
Compound 112 (S)-3-(3-(4- acrylamidobenzamido) benzamido)-N-(2-
(dimethylamino)-1- phenylethyl)-6,6- dimethyl-4,6- dihydropyrrolo
[3,4-c]pyrazole- 5(1H)-carboxamide ##STR00203## .sup.1H NMR (TFA
salt): 400 MHz (DMSO-d.sub.6) .delta. 10.97 (s, 1H), 10.53 (s, 1H),
10.40 (s, 1H), 9.04 (s, 1H), 8.62 (m, 1H), 8.04 (d, J = 9.2 Hz,
2H), 7.89 (d, J = 9.2 Hz, 2H), 7.83 (d, J = 7.6 Hz, 1H), 7.57-7.44
(m, 4H), 7.36 (t, J = 7.2 Hz, 1H), 6.83 (d, J = 9.2 Hz, 1H), 6.54
(dd, J = 17.2, 10.0 Hz, 1H), 6.37 (dd, J = 17.2, 2.0 Hz, 1H), 5.88
(dd, J = 10.0, 2.0 Hz, 1H), 5.43- 5.37 (m, 1H), 4.86 (d, J = 12.4
Hz, 1H), 4.64 (d, J = 11.6 Hz, 1H), 2.95 (d, J = 8.4 Hz, 3H), 2.90
(d, J = 8.4 Hz, 3H), 1.74 (s, 3H), 1.66 (s, 3H); MS m/z: 635.3 [M +
1]. Compound 113 3-((R)-1- acryloylpiperidine- 3-carboxamido)-N-
((S)-2-(dimethylamino)- 1-phenylethyl)- 6,6-dimethyl-4,6-
dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide ##STR00204##
.sup.1H NMR (TFA salt): 600 MHz (DMSO-d.sub.6) .delta. 10.56 (d, J
= 19.8 Hz, 1H), 8.95 (s, 1H), 7.41-7.36 (m, 3H), 7.31-7.27 (m, 1H),
6.87-6.79 (m, 1H), 6.72 (d, J = 9.0 Hz, 1H), 6.08 (d, J = 16.2 Hz,
1H),5.66 (d, J = 10.2 Hz, 1H), 5.32 (m, 1H), 4.69 (m, 1H), 4.47 (m,
2H), 4.03 (m, 2H), 3.53 (t, J = 12.0 Hz, 2H), 3.35-3.30 (m, 1H),
3.18-3.12 (m, 1H), 2.99 (t, J = 13.2 Hz, 1H), 2.85 (d, J = 5.4 Hz,
3H), 2.82 (d, J = 4.8 Hz, 3H), 2.70 (t, J = 12.0 Hz, 1H), 1.95 (m,
1H), 1.73 (m, 1H), 1.62 (s, 3H), 1.53 (s, 3H), 1.33 (m, 1H); MS
m/z: 508.3 [M + 1]. Compound 114 3-((S)-1- acryloylpiperidine-
3-carboxamido)- N-((S)-2- (dimethylamino)- 1-phenylethyl)-
6,6-dimethyl-4,6- dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide
##STR00205## .sup.1H NMR (TFA salt): 400 MHz (DMSO-d.sub.6) .delta.
10.50 (d, J = 15.6 Hz, 1H), 8.90 (s, 1H), 7.37-7.31 (m, 4H),
7.25-7.21 (m, 1H), 6.82-6.72 (m, 1H), 6.66 (d, J = 8.8 Hz, 1H),
6.03 (d, J = 16.4 Hz, 1H), 5.61 (d, J = 10.8 Hz, 1H), 5.27 (m, 1H),
4.62 (m, 1H), 4.43 (m, 2H), 4.07-3.96 (m, 2H), 3.13-3.05 (m, 2H),
2.94 (t, J = 12.0 Hz, 1H), 2.81 (d, J = 5.2 Hz, 3H), 2.77 (d, J =
5.2 Hz, 3H), 2.69-2.57 (m, 1H), 1.89 (m, 1H), 1.67 (m, 1H), 1.57
(s, 3H), 1.49 (s, 3H), 1.29 (m, 1H); MS m/z: 508.3 [M + 1].
Compound 115 3-((1-(4- acrylamidobenzoyl) piperidin-3-yl)
amino)-N-((S)-2- (dimethylamino)- 1-phenylethyl)- 6,6-dimethyl-4,6-
dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide ##STR00206##
.sup.1H NMR (TFA salt): 600 MHz (DMSO-d.sub.6) .delta. 10.29 (s,
1H), 9.10 (s, 1H), 7.72-7.55 (m, 1H), 7.49-7.26 (m, 7H), 6.73-6.61
(m, 1H), 6.49-6.40 (m, 1H), 6.27-6.24 (m, 1H), 5.77-5.75 (m, 1H),
5.36-5.26 (m, 1H), 4.55-4.50 (m, 1H), 4.30-4.24 (m, 2H), 3.55-3.45
(m, 3H), 3.38-3.32 (m, 2H), 3.28-3.07 (m, 2H), 2.88 (m, 3H), 2.85
(m, 1H), 2.82 (m, 3H), 2.00-1.90 (m, 1H), 1.85-1.70 (m, 1H),
1.65-1.50 (m, 6H), 1.09-1.03 (m, 1H); MS m/z: 599.4 [M + 1].
Compound 116 (S)-3-((1-(4- acrylamidobenzoyl) piperidin-4-yl)
amino)-N-(2- (dimethylamino)- 1-phenylethyl)- 6,6-dimethyl-4,6-
dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide ##STR00207##
.sup.1H NMR: 600 MHz (DMSO-d.sub.6) .delta. 11.30 (br, 1H), 10.30
(s, 1H), 7.71 (d, J = 9.0 Hz, 2H), 7.36-7.33 (m, 4H), 7.28 (t, J =
7.8 Hz, 2H), 7.18 (t, J = 7.8 Hz, 1H), 6.43 (dd, J = 16.8, 10.2 Hz,
1H), 6.27 (dd, J = 16.8, 2.2 Hz, 1H), 5.95 (d, J = 6.0 Hz, 1H),
5.77 (dd, J = 10.2, 2.2 Hz, 1H), 5.33-5.20 (m, 1H), 4.82 (q, J =
7.2 Hz, 1H), 4.26 (q, J = 12.0 Hz, 2H), 3.72-3.58 (m, 1H),
3.16-3.03 (m, 2H), 2.60 (m, 1H), 2.42 (m, 1H), 2.19 (s, 6H), 1.89
(m, 2H), 1.54 (s, 3H), 1.48 (s, 3H), 1.36 (m, 2H); MS m/z: 599.4 [M
+ 1]. Compound 117 3-(((1R,3S)-3-(4- acrylamidobenzamido)
cyclohexyl)amino)- N-((S)-2- (dimethylamino)- 1-phenylethyl)-
6,6-dimethy1-4,6- dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide
##STR00208## .sup.1H NMR (TFA salt): 600 MHz (DMSO-d.sub.6) .delta.
10.35 (d, J = 3.0 Hz, 1H), 9.11 (s, 1H), 8.09 (d, J = 7.8 Hz, 1H),
7.80 (dd, J = 9.0, 2.0 Hz, 2H), 7.71 (dd, J = 9.0, 1.8 Hz, 2H),
7.46- 7.42 (m, 2H), 7.39-7.35 (m, 2H), 7.30-7.28 (m, 1H), 6.68 (t,
J = 7.8 Hz, 1H), 6.44 (dd, J = 16.8, 10.2 Hz, 1H), 6.27 (dd, J =
16.8, 2.2 Hz, 1H), 5.78 (dd, J = 10.2, 2.2 Hz, 1H), 5.34- 5.30 (m,
1H), 4.52 (t, J = 12.0 Hz, 1H), 4.38 (dd, J = 13.2, 12.0 Hz, 2H),
4.17-4.10 (m, 1H), 3.67 (m, 2H), 3.48 (t, J = 12.0 Hz, 2H),
3.37-3.33 (m, 2H), 2.88 (m, 3H), 2.82 (m, 3H), 1.89-1.80 (m, 2H),
1.71-1.60 (m, 3H), 1.62 (s, 3H), 1.55 (s, 3H), 1.36 (m, 2H); MS
m/z: 613.4 [M + 1]. Compound 118 3-(((lR,3R)-3-(4-
acrylamidobenzamido) cyclohexyl)amino)- N-((S)-2- (dimethylamino)-
1-phenylethyl)-6,6- dimethyl-4,6- dihydropyrrolo [3,4-c]pyrazole-
5(1H)-carboxamide ##STR00209## 1.sup.1H NMR: 600 MHz (DMSO-d.sub.6)
.delta. 11.22 (br, 1H), 10.32 (s, 1H), 8.19 (dd, J = 7.8, 3.0 Hz,
1H), 7.81 (dd, J = 8.4, 3.0 Hz, 2H), 7.70 (dd, J = 8.4, 5.4 Hz,
2H), 7.35 (d, J = 7.8 Hz, 2H), 7.30-7.26 (m, 2H), 7.20- 7.16 (m,
1H), 6.43 (dd, J = 16.8, 10.2 Hz, 1H), 6.27 (dd, J = 16.8, 2.2 Hz,
1H), 6.01 (m, 1H), 5.77 (dd, J = 10.2, 2.2 Hz, 1H), 5.25-5.17 (m,
1H), 4.89-4.82 (m, 1H), 4.36-4.27 (m, 2H), 3.90-3.83 (m, 1H),
3.08-3.01 (m, 1H), 2.68- 2.60 (m, 1H), (s, 3H), 2.13-2.08 (m, 1H),
1.92-1.86 (m, 1H), 1.85- 1.79 (m, 1H), 1.78-1.73 (m, 1H), 1.54 (s,
3H), 1.48 (d, J = 5.4 Hz, 3H), 1.42-1.35 (m, 1H), 1.28- 1.19 (m,
2H), 1.11-1.03 (m, 1H); MS m/z: 613.4 [M + 1]. Compound 119
(S)-3-((4-(4- acrylamidobenzamido) cyclohexyl)amino)-N-
(2-(dimethylamino)-1- phenylethyl)-6,6- dimethyl-4,6-
dihydropyrrolo [3,4-c]pyrazole- 5(1H)-carboxamide ##STR00210##
.sup.1H NMR: 600 MHz (DMSO-d.sub.6) .delta. 11.30 (br, 1H), 10.32
(s, 1H), 8.11 (d, J = 7.8 Hz, 1H), 7.80 (d, J = 8.4 Hz, 2H), 7.71
(d, J = 8.4 Hz, 2H), 7.37 (m, 2H), 7.32 (m, 2H), 7.22 (m, 1H), 6.43
(dd, J = 16.8, 10.2 Hz, 1H), 6.27 (d, J = 16.8 Hz, 1H), 6.13 (m,
1H), 5.78 (d, J = 10.2, Hz, 1H), 5.13-4.94 (m, 2H), 4.35-4.26 (m,
2H), 3.75-3.49 (m, 1H), 3.47 (t, J = 5.4 Hz, 1H), 3.40 (t, J = 5.4
Hz, 1H), 3.07-2.97 (m, 2H), 2.50-2.32 (m, 4H), 1.98 (d, J = 10.8
Hz, 3H), 1.87 (d, J = 10.2 Hz, 3H), 1.77-1.70 (m, 1H), 1.67-1.60
(m, 1H), 1.56 (s, 3H), 1.49 (s, 3H), 1.47- 1.38 (m, 2H), 1.37-1.33
(m, 1H), 1.29-1.17 (m, 4H), 1.15 (t, J = 7.2 Hz, 1H), 0.85-0.76 (m,
1H); MS m/z: 613.4 [M + 1]. Compound 120 ##STR00211## Compound 121
##STR00212## Compound 122 ##STR00213## Compound 123 ##STR00214##
Compound 124 ##STR00215## Compound 125 ##STR00216## Compound 126
##STR00217## Compound 127 ##STR00218##
Pharmaceutical Compositions and Administration
[0400] The pharmaceutical compositions described herein may be
useful in treating and/or preventing proliferative diseases (e.g.,
cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma,
Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer,
Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung
cancer, colorectal cancer), benign neoplasms, diseases associated
with angiogenesis, inflammatory diseases, autoinflammatory
diseases, and autoimmune diseases) in a subject. The compositions
described herein may also be useful for inhibiting the activity of
a protein kinase (e.g., CDK (e.g., CDK7)) in a subject, biological
sample, tissue, or cell. The compositions described herein may also
be useful for inducing apoptosis in a cell.
[0401] The present disclosure provides pharmaceutical compositions
comprising a compound described herein (e.g., a compound of Formula
(I)), or a pharmaceutically acceptable salt, solvate, hydrate,
polymorph, co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, and optionally a pharmaceutically
acceptable excipient. In certain embodiments, the pharmaceutical
composition of the invention comprises a compound described herein,
or a pharmaceutically acceptable salt thereof, and optionally a
pharmaceutically acceptable excipient. In certain embodiments, a
pharmaceutical composition described herein comprises a compound
described herein, or a pharmaceutically acceptable salt thereof,
and a pharmaceutically acceptable excipient. In certain
embodiments, the compound described herein, or a pharmaceutically
acceptable salt, solvate, hydrate, polymorph, co-crystal, tautomer,
stereoisomer, isotopically labeled derivative, or prodrug thereof,
is provided in an effective amount in the pharmaceutical
composition.
[0402] In certain embodiments, the effective amount is a
therapeutically effective amount (e.g., amount effective for
treating a proliferative disease in a subject in need thereof). In
certain embodiments, the effective amount is an amount effective
for inhibiting the activity of a protein kinase (e.g., CDK (e.g.,
CDK7)) in a subject in need thereof. In certain embodiments, the
effective amount is an amount effective for inhibiting the activity
of a protein kinase (e.g., CDK (e.g., CDK7)) in a cell. In certain
embodiments, the effective amount is an amount effective for
inducing apoptosis in a cell. In certain embodiments, the effective
amount is a prophylactically effective amount (e.g., amount
effective for preventing a proliferative disease in a subject in
need thereof and/or for keeping a subject in need thereof in
remission of a proliferative disease).
[0403] In certain embodiments, a protein kinase described herein is
a CDK. In certain embodiments, a protein kinase described herein is
CDK1, CDK2, CDK3, CDK4, CDK5, CDK6, CDK7, CDK8, CDK9, CDK10, CDK11,
CDK12, CDK13, CDK14, CDK15, CDK16, CDK17, CDK18, CDK19, or CDK20.
In certain embodiments, a protein kinase described herein is CDK7.
In certain embodiments, a protein kinase described herein is CDK12.
In certain embodiments, a protein kinase described herein is CDK13.
In certain embodiments, a protein kinase described herein is a Src
family kinase. In certain embodiments, a protein kinase described
herein is SRC. In certain embodiments, a protein kinase described
herein is FGR. In certain embodiments, a protein kinase described
herein is BUB1B. In certain embodiments, a protein kinase described
herein is CHEK2. In certain embodiments, a protein kinase described
herein is HIPK4. In certain embodiments, a protein kinase described
herein is PRKCQ. In certain embodiments, a protein kinase described
herein is RET. In certain embodiments, a protein kinase described
herein is MELK. In certain embodiments, a protein kinase described
herein is IRAK1, IRAK4, BMX, or PI3K. In certain embodiments, a
protein kinase described herein is ABL, ARG, BLK, CSK, EphB1,
EphB2, FGR, FRK, FYN, SRC, YES, LCK, LYN, MAP2K5, NLK, p38a, SNRK,
or TEC. In certain embodiments, a protein kinase described herein
is ABL1(H396P)-phosphorylated, ABL1-phosphorylated, BLK, EPHA4,
EPHB2, EPHB3, EPHB4, FGR, JAK3(JH1domain-catalytic), KIT,
KIT(L576P), KIT(V559D), PDGFRB, SRC, YES,
ABL1(H396P)-nonphosphorylated, ABL1(Y253F)-phosphorylated,
ABL1-nonphosphorylated, FRK, LYN, ABL1(Q252H)-nonphosphorylated,
DDR1, EPHB1, ERBB4, p38-alpha, ABL2, ABL1(Q252H)-phosphorylated,
SIK, EPHA8, MEK5, ABL1(E255K)-phosphorylated,
ABL1(F317L)-nonphosphorylated, FYN, LCK, EPHA2,
ABL1(M351T)-phosphorylated, TXK, EGFR(L858R), EGFR(L861Q), ERBB2,
ERBB3, EPHA5, ABL1(F317I)-nonphosphorylated, EGFR(L747-E749del,
A750P), CSK, EPHA1, ABL1(F317L)-phosphorylated, BRAF(V600E), EGFR,
KIT-autoinhibited, or EGFR(E746-A750del). In certain embodiments, a
protein kinase described herein is ABL1(F317L)-nonphosphorylated,
ABL1(H396P)-nonphosphorylated, ABL1(H396P)-phosphorylated,
ABL1-phosphorylated, BLK, EPHA4, EPHB2, EPHB3, EPHB4,
JAK3(JH1domain-catalytic), KIT, KIT(L576P), KIT(V559D), LYN,
PDGFRB, SRC, YES, ABL1-nonphosphorylated,
ABL1(Y253F)-phosphorylated, ERBB3, FGR, FRK, p38-alpha,
ABL1(F317I)-nonphosphorylated, DDR1, EPHA2,
ABL1(Q252H)-phosphorylated, MEK5, ABL1(Q252H)-nonphosphorylated,
ABL2, FYN, EPHB1, ABL1(E255K)-phosphorylated,
ABL1(F317L)-phosphorylated, EPHA1, ABL1(M351T)-phosphorylated,
ERBB4, TXK, LCK, EPHA8, SIK, EPHA5, EGFR(L861Q),
CSF1R-autoinhibited, BRAF(V600E), BRK, CSK, KIT(D816V),
KIT-autoinhibited, EGFR(L747-T751del,Sins), EGFR(L858R),
EGFR(L747-E749del, A750P), or CSF1R.
[0404] In certain embodiments, the effective amount is an amount
effective for inhibiting the activity of a protein kinase (e.g.,
CDK (e.g., CDK7)) by at least about 10%, at least about 20%, at
least about 30%, at least about 40%, at least about 50%, at least
about 60%, at least about 70%, at least about 80%, at least about
90%, at least about 95%, or at least about 98%. In certain
embodiments, the effective amount is an amount effective for
inhibiting the activity of a protein kinase (e.g., CDK (e.g.,
CDK7)) by not more than 10%, not more than 20%, not more than 30%,
not more than 40%, not more than 50%, not more than 60%, not more
than 70%, not more than 80%, not more than 90%, not more than 95%,
or not more than 98%. In certain embodiments, the effective amount
is an amount effective for inhibiting the activity of a protein
kinase (e.g., CDK (e.g., CDK7)) by a range between a percentage
described in this paragraph and another percentage described in
this paragraph, inclusive.
[0405] Pharmaceutical compositions described herein can be prepared
by any method known in the art of pharmacology. In general, such
preparatory methods include bringing the compound described herein
(i.e., the "active ingredient") into association with a carrier or
excipient, and/or one or more other accessory ingredients, and
then, if necessary and/or desirable, shaping, and/or packaging the
product into a desired single- or multi-dose unit.
[0406] Pharmaceutical compositions can be prepared, packaged,
and/or sold in bulk, as a single unit dose, and/or as a plurality
of single unit doses. A "unit dose" is a discrete amount of the
pharmaceutical composition comprising a predetermined amount of the
active ingredient. The amount of the active ingredient is generally
equal to the dosage of the active ingredient which would be
administered to a subject and/or a convenient fraction of such a
dosage, such as one-half or one-third of such a dosage.
[0407] Relative amounts of the active ingredient, the
pharmaceutically acceptable excipient, and/or any additional
ingredients in a pharmaceutical composition described herein will
vary, depending upon the identity, size, and/or condition of the
subject treated and further depending upon the route by which the
composition is to be administered. The composition may comprise
between 0.1% and 100% (w/w) active ingredient.
[0408] Pharmaceutically acceptable excipients used in the
manufacture of provided pharmaceutical compositions include inert
diluents, dispersing and/or granulating agents, surface active
agents and/or emulsifiers, disintegrating agents, binding agents,
preservatives, buffering agents, lubricating agents, and/or oils.
Excipients such as cocoa butter and suppository waxes, coloring
agents, coating agents, sweetening, flavoring, and perfuming agents
may also be present in the composition.
[0409] Exemplary diluents include calcium carbonate, sodium
carbonate, calcium phosphate, dicalcium phosphate, calcium sulfate,
calcium hydrogen phosphate, sodium phosphate lactose, sucrose,
cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol,
inositol, sodium chloride, dry starch, cornstarch, powdered sugar,
and mixtures thereof.
[0410] Exemplary granulating and/or dispersing agents include
potato starch, corn starch, tapioca starch, sodium starch
glycolate, clays, alginic acid, guar gum, citrus pulp, agar,
bentonite, cellulose, and wood products, natural sponge,
cation-exchange resins, calcium carbonate, silicates, sodium
carbonate, cross-linked poly(vinyl-pyrrolidone) (crospovidone),
sodium carboxymethyl starch (sodium starch glycolate),
carboxymethyl cellulose, cross-linked sodium carboxymethyl
cellulose (croscarmellose), methylcellulose, pregelatinized starch
(starch 1500), microcrystalline starch, water insoluble starch,
calcium carboxymethyl cellulose, magnesium aluminum silicate
(Veegum), sodium lauryl sulfate, quaternary ammonium compounds, and
mixtures thereof.
[0411] Exemplary surface active agents and/or emulsifiers include
natural emulsifiers (e.g., acacia, agar, alginic acid, sodium
alginate, tragacanth, chondrux, cholesterol, xanthan, pectin,
gelatin, egg yolk, casein, wool fat, cholesterol, wax, and
lecithin), colloidal clays (e.g., bentonite (aluminum silicate) and
Veegum (magnesium aluminum silicate)), long chain amino acid
derivatives, high molecular weight alcohols (e.g., stearyl alcohol,
cetyl alcohol, oleyl alcohol, triacetin monostearate, ethylene
glycol distearate, glyceryl monostearate, and propylene glycol
monostearate, polyvinyl alcohol), carbomers (e.g., carboxy
polymethylene, polyacrylic acid, acrylic acid polymer, and
carboxyvinyl polymer), carrageenan, cellulosic derivatives (e.g.,
carboxymethylcellulose sodium, powdered cellulose, hydroxymethyl
cellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose,
methylcellulose), sorbitan fatty acid esters (e.g., polyoxyethylene
sorbitan monolaurate (Tween.RTM. 20), polyoxyethylene sorbitan
(Tween.RTM. 60), polyoxyethylene sorbitan monooleate (Tween.RTM.
80), sorbitan monopalmitate (Span.RTM. 40), sorbitan monostearate
(Span.RTM. 60), sorbitan tristearate (Span.RTM. 65), glyceryl
monooleate, sorbitan monooleate (Span.RTM. 80), polyoxyethylene
esters (e.g., polyoxyethylene monostearate (Myrj.COPYRGT. 45),
polyoxyethylene hydrogenated castor oil, polyethoxylated castor
oil, polyoxymethylene stearate, and Solutol*), sucrose fatty acid
esters, polyethylene glycol fatty acid esters (e.g.,
Cremophor.RTM.), polyoxyethylene ethers, (e.g., polyoxyethylene
lauryl ether (Brij.COPYRGT. 30)), poly(vinyl-pyrrolidone),
diethylene glycol monolaurate, triethanolamine oleate, sodium
oleate, potassium oleate, ethyl oleate, oleic acid, ethyl laurate,
sodium lauryl sulfate, Pluronic.RTM. F-68, poloxamer P-188,
cetrimonium bromide, cetylpyridinium chloride, benzalkonium
chloride, docusate sodium, and/or mixtures thereof.
[0412] Exemplary binding agents include starch (e.g., cornstarch
and starch paste), gelatin, sugars (e.g., sucrose, glucose,
dextrose, dextrin, molasses, lactose, lactitol, mannitol, etc.),
natural and synthetic gums (e.g., acacia, sodium alginate, extract
of Irish moss, panwar gum, ghatti gum, mucilage of isapol husks,
carboxymethylcellulose, methylcellulose, ethylcellulose,
hydroxyethylcellulose, hydroxypropyl cellulose, hydroxypropyl
methylcellulose, microcrystalline cellulose, cellulose acetate,
poly(vinyl-pyrrolidone), magnesium aluminum silicate
(Veegum.COPYRGT.), and larch arabogalactan), alginates,
polyethylene oxide, polyethylene glycol, inorganic calcium salts,
silicic acid, polymethacrylates, waxes, water, alcohol, and/or
mixtures thereof.
[0413] Exemplary preservatives include antioxidants, chelating
agents, antimicrobial preservatives, antifungal preservatives,
antiprotozoan preservatives, alcohol preservatives, acidic
preservatives, and other preservatives. In certain embodiments, the
preservative is an antioxidant. In other embodiments, the
preservative is a chelating agent.
[0414] Exemplary antioxidants include alpha tocopherol, ascorbic
acid, ascorbyl palmitate, butylated hydroxyanisole, butylated
hydroxytoluene, monothioglycerol, potassium metabisulfite,
propionic acid, propyl gallate, sodium ascorbate, sodium bisulfite,
sodium metabisulfite, and sodium sulfite.
[0415] Exemplary chelating agents include
ethylenediaminetetraacetic acid (EDTA) and salts and hydrates
thereof (e.g., sodium edetate, disodium edetate, trisodium edetate,
calcium disodium edetate, dipotassium edetate, and the like),
citric acid and salts and hydrates thereof (e.g., citric acid
monohydrate), fumaric acid and salts and hydrates thereof, malic
acid and salts and hydrates thereof, phosphoric acid and salts and
hydrates thereof, and tartaric acid and salts and hydrates thereof.
Exemplary antimicrobial preservatives include benzalkonium
chloride, benzethonium chloride, benzyl alcohol, bronopol,
cetrimide, cetylpyridinium chloride, chlorhexidine, chlorobutanol,
chlorocresol, chloroxylenol, cresol, ethyl alcohol, glycerin,
hexetidine, imidurea, phenol, phenoxyethanol, phenylethyl alcohol,
phenylmercuric nitrate, propylene glycol, and thimerosal.
[0416] Exemplary antifungal preservatives include butyl paraben,
methyl paraben, ethyl paraben, propyl paraben, benzoic acid,
hydroxybenzoic acid, potassium benzoate, potassium sorbate, sodium
benzoate, sodium propionate, and sorbic acid.
[0417] Exemplary alcohol preservatives include ethanol,
polyethylene glycol, phenol, phenolic compounds, bisphenol,
chlorobutanol, hydroxybenzoate, and phenylethyl alcohol.
[0418] Exemplary acidic preservatives include vitamin A, vitamin C,
vitamin E, beta-carotene, citric acid, acetic acid, dehydroacetic
acid, ascorbic acid, sorbic acid, and phytic acid.
[0419] Other preservatives include tocopherol, tocopherol acetate,
deteroxime mesylate, cetrimide, butylated hydroxyanisol (BHA),
butylated hydroxytoluened (BHT), ethylenediamine, sodium lauryl
sulfate (SLS), sodium lauryl ether sulfate (SLES), sodium
bisulfite, sodium metabisulfite, potassium sulfite, potassium
metabisulfite, Glydant.RTM. Plus, Phenonip.COPYRGT., methylparaben,
Germall.RTM. 115, Germaben.RTM. II, Neolone.RTM., Kathon.RTM., and
Euxyl.RTM..
[0420] Exemplary buffering agents include citrate buffer solutions,
acetate buffer solutions, phosphate buffer solutions, ammonium
chloride, calcium carbonate, calcium chloride, calcium citrate,
calcium glubionate, calcium gluceptate, calcium gluconate,
D-gluconic acid, calcium glycerophosphate, calcium lactate,
propanoic acid, calcium levulinate, pentanoic acid, dibasic calcium
phosphate, phosphoric acid, tribasic calcium phosphate, calcium
hydroxide phosphate, potassium acetate, potassium chloride,
potassium gluconate, potassium mixtures, dibasic potassium
phosphate, monobasic potassium phosphate, potassium phosphate
mixtures, sodium acetate, sodium bicarbonate, sodium chloride,
sodium citrate, sodium lactate, dibasic sodium phosphate, monobasic
sodium phosphate, sodium phosphate mixtures, tromethamine,
magnesium hydroxide, aluminum hydroxide, alginic acid, pyrogen-free
water, isotonic saline, Ringer's solution, ethyl alcohol, and
mixtures thereof.
[0421] Exemplary lubricating agents include magnesium stearate,
calcium stearate, stearic acid, silica, talc, malt, glyceryl
behanate, hydrogenated vegetable oils, polyethylene glycol, sodium
benzoate, sodium acetate, sodium chloride, leucine, magnesium
lauryl sulfate, sodium lauryl sulfate, and mixtures thereof.
[0422] Exemplary natural oils include almond, apricot kernel,
avocado, babassu, bergamot, black current seed, borage, cade,
camomile, canola, caraway, carnauba, castor, cinnamon, cocoa
butter, coconut, cod liver, coffee, corn, cotton seed, emu,
eucalyptus, evening primrose, fish, flaxseed, geraniol, gourd,
grape seed, hazel nut, hyssop, isopropyl myristate, jojoba, kukui
nut, lavandin, lavender, lemon, litsea cubeba, macademia nut,
mallow, mango seed, meadowfoam seed, mink, nutmeg, olive, orange,
orange roughy, palm, palm kernel, peach kernel, peanut, poppy seed,
pumpkin seed, rapeseed, rice bran, rosemary, safflower, sandalwood,
sasquana, savoury, sea buckthorn, sesame, shea butter, silicone,
soybean, sunflower, tea tree, thistle, tsubaki, vetiver, walnut,
and wheat germ oils. Exemplary synthetic oils include, but are not
limited to, butyl stearate, caprylic triglyceride, capric
triglyceride, cyclomethicone, diethyl sebacate, dimethicone 360,
isopropyl myristate, mineral oil, octyldodecanol, oleyl alcohol,
silicone oil, and mixtures thereof.
[0423] Liquid dosage forms for oral and parenteral administration
include pharmaceutically acceptable emulsions, microemulsions,
solutions, suspensions, syrups and elixirs. In addition to the
active ingredients, the liquid dosage forms may comprise inert
diluents commonly used in the art such as, for example, water or
other solvents, solubilizing agents and emulsifiers such as ethyl
alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl
alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol,
dimethylformamide, oils (e.g., cottonseed, groundnut, corn, germ,
olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl
alcohol, polyethylene glycols and fatty acid esters of sorbitan,
and mixtures thereof. Besides inert diluents, the oral compositions
can include adjuvants such as wetting agents, emulsifying and
suspending agents, sweetening, flavoring, and perfuming agents. In
certain embodiments for parenteral administration, the conjugates
described herein are mixed with solubilizing agents such as
Cremophor.RTM., alcohols, oils, modified oils, glycols,
polysorbates, cyclodextrins, polymers, and mixtures thereof.
[0424] Injectable preparations, for example, sterile injectable
aqueous or oleaginous suspensions can be formulated according to
the known art using suitable dispersing or wetting agents and
suspending agents. The sterile injectable preparation can be a
sterile injectable solution, suspension, or emulsion in a nontoxic
parenterally acceptable diluent or solvent, for example, as a
solution in 1,3-butanediol. Among the acceptable vehicles and
solvents that can be employed are water, Ringer's solution, U.S.P.,
and isotonic sodium chloride solution. In addition, sterile, fixed
oils are conventionally employed as a solvent or suspending medium.
For this purpose any bland fixed oil can be employed including
synthetic mono- or di-glycerides. In addition, fatty acids such as
oleic acid are used in the preparation of injectables.
[0425] The injectable formulations can be sterilized, for example,
by filtration through a bacterial-retaining filter, or by
incorporating sterilizing agents in the form of sterile solid
compositions which can be dissolved or dispersed in sterile water
or other sterile injectable medium prior to use.
[0426] In order to prolong the effect of a drug, it is often
desirable to slow the absorption of the drug from subcutaneous or
intramuscular injection. This can be accomplished by the use of a
liquid suspension of crystalline or amorphous material with poor
water solubility. The rate of absorption of the drug then depends
upon its rate of dissolution, which, in turn, may depend upon
crystal size and crystalline form. Alternatively, delayed
absorption of a parenterally administered drug form may be
accomplished by dissolving or suspending the drug in an oil
vehicle.
[0427] Compositions for rectal or vaginal administration are
typically suppositories which can be prepared by mixing the
conjugates described herein with suitable non-irritating excipients
or carriers such as cocoa butter, polyethylene glycol, or a
suppository wax which are solid at ambient temperature but liquid
at body temperature and therefore melt in the rectum or vaginal
cavity and release the active ingredient.
[0428] Solid dosage forms for oral administration include capsules,
tablets, pills, powders, and granules. In such solid dosage forms,
the active ingredient is mixed with at least one inert,
pharmaceutically acceptable excipient or carrier such as sodium
citrate or dicalcium phosphate and/or (a) fillers or extenders such
as starches, lactose, sucrose, glucose, mannitol, and silicic acid,
(b) binders such as, for example, carboxymethylcellulose,
alginates, gelatin, polyvinylpyrrolidinone, sucrose, and acacia,
(c) humectants such as glycerol, (d) disintegrating agents such as
agar, calcium carbonate, potato or tapioca starch, alginic acid,
certain silicates, and sodium carbonate, (e) solution retarding
agents such as paraffin, (f) absorption accelerators such as
quaternary ammonium compounds, (g) wetting agents such as, for
example, cetyl alcohol and glycerol monostearate, (h) absorbents
such as kaolin and bentonite clay, and (i) lubricants such as talc,
calcium stearate, magnesium stearate, solid polyethylene glycols,
sodium lauryl sulfate, and mixtures thereof. In the case of
capsules, tablets, and pills, the dosage form may include a
buffering agent.
[0429] Solid compositions of a similar type can be employed as
fillers in soft and hard-filled gelatin capsules using such
excipients as lactose or milk sugar as well as high molecular
weight polyethylene glycols and the like. The solid dosage forms of
tablets, dragees, capsules, pills, and granules can be prepared
with coatings and shells such as enteric coatings and other
coatings well known in the art of pharmacology. They may optionally
comprise opacifying agents and can be of a composition that they
release the active ingredient(s) only, or preferentially, in a
certain part of the intestinal tract, optionally, in a delayed
manner. Examples of encapsulating compositions which can be used
include polymeric substances and waxes. Solid compositions of a
similar type can be employed as fillers in soft and hard-filled
gelatin capsules using such excipients as lactose or milk sugar as
well as high molecular weight polyethylene glycols and the
like.
[0430] The active ingredient can be in a micro-encapsulated form
with one or more excipients as noted above. The solid dosage forms
of tablets, dragees, capsules, pills, and granules can be prepared
with coatings and shells such as enteric coatings, release
controlling coatings, and other coatings well known in the
pharmaceutical formulating art. In such solid dosage forms the
active ingredient can be admixed with at least one inert diluent
such as sucrose, lactose, or starch. Such dosage forms may
comprise, as is normal practice, additional substances other than
inert diluents, e.g., tableting lubricants and other tableting aids
such a magnesium stearate and microcrystalline cellulose. In the
case of capsules, tablets and pills, the dosage forms may comprise
buffering agents. They may optionally comprise opacifying agents
and can be of a composition that they release the active
ingredient(s) only, or preferentially, in a certain part of the
intestinal tract, optionally, in a delayed manner. Examples of
encapsulating agents which can be used include polymeric substances
and waxes.
[0431] Dosage forms for topical and/or transdermal administration
of a compound described herein may include ointments, pastes,
creams, lotions, gels, powders, solutions, sprays, inhalants,
and/or patches. Generally, the active ingredient is admixed under
sterile conditions with a pharmaceutically acceptable carrier or
excipient and/or any needed preservatives and/or buffers as can be
required. Additionally, the present disclosure contemplates the use
of transdermal patches, which often have the added advantage of
providing controlled delivery of an active ingredient to the body.
Such dosage forms can be prepared, for example, by dissolving
and/or dispensing the active ingredient in the proper medium.
Alternatively or additionally, the rate can be controlled by either
providing a rate controlling membrane and/or by dispersing the
active ingredient in a polymer matrix and/or gel.
[0432] Suitable devices for use in delivering intradermal
pharmaceutical compositions described herein include short needle
devices. Intradermal compositions can be administered by devices
which limit the effective penetration length of a needle into the
skin. Alternatively or additionally, conventional syringes can be
used in the classical mantoux method of intradermal administration.
Jet injection devices which deliver liquid formulations to the
dermis via a liquid jet injector and/or via a needle which pierces
the stratum corneum and produces a jet which reaches the dermis are
suitable. Ballistic powder/particle delivery devices which use
compressed gas to accelerate the compound in powder form through
the outer layers of the skin to the dermis are suitable.
[0433] Formulations suitable for topical administration include,
but are not limited to, liquid and/or semi-liquid preparations such
as liniments, lotions, oil-in-water and/or water-in-oil emulsions
such as creams, ointments, and/or pastes, and/or solutions and/or
suspensions. Topically administrable formulations may, for example,
comprise from about 1% to about 10% (w/w) active ingredient,
although the concentration of the active ingredient can be as high
as the solubility limit of the active ingredient in the solvent.
Formulations for topical administration may further comprise one or
more of the additional ingredients described herein.
[0434] A pharmaceutical composition described herein can be
prepared, packaged, and/or sold in a formulation suitable for
pulmonary administration via the buccal cavity. Such a formulation
may comprise dry particles which comprise the active ingredient and
which have a diameter in the range from about 0.5 to about 7
nanometers, or from about 1 to about 6 nanometers. Such
compositions are conveniently in the form of dry powders for
administration using a device comprising a dry powder reservoir to
which a stream of propellant can be directed to disperse the powder
and/or using a self-propelling solvent/powder dispensing container
such as a device comprising the active ingredient dissolved and/or
suspended in a low-boiling propellant in a sealed container. Such
powders comprise particles wherein at least 98% of the particles by
weight have a diameter greater than 0.5 nanometers and at least 95%
of the particles by number have a diameter less than 7 nanometers.
Alternatively, at least 95% of the particles by weight have a
diameter greater than 1 nanometer and at least 90% of the particles
by number have a diameter less than 6 nanometers. Dry powder
compositions may include a solid fine powder diluent such as sugar
and are conveniently provided in a unit dose form.
[0435] Low boiling propellants generally include liquid propellants
having a boiling point of below 65.degree. F. at atmospheric
pressure. Generally the propellant may constitute 50 to 99.9% (w/w)
of the composition, and the active ingredient may constitute 0.1 to
20% (w/w) of the composition. The propellant may further comprise
additional ingredients such as a liquid non-ionic and/or solid
anionic surfactant and/or a solid diluent (which may have a
particle size of the same order as particles comprising the active
ingredient).
[0436] Pharmaceutical compositions described herein formulated for
pulmonary delivery may provide the active ingredient in the form of
droplets of a solution and/or suspension. Such formulations can be
prepared, packaged, and/or sold as aqueous and/or dilute alcoholic
solutions and/or suspensions, optionally sterile, comprising the
active ingredient, and may conveniently be administered using any
nebulization and/or atomization device. Such formulations may
further comprise one or more additional ingredients including, but
not limited to, a flavoring agent such as saccharin sodium, a
volatile oil, a buffering agent, a surface active agent, and/or a
preservative such as methylhydroxybenzoate. The droplets provided
by this route of administration may have an average diameter in the
range from about 0.1 to about 200 nanometers.
[0437] Formulations described herein as being useful for pulmonary
delivery are useful for intranasal delivery of a pharmaceutical
composition described herein. Another formulation suitable for
intranasal administration is a coarse powder comprising the active
ingredient and having an average particle from about 0.2 to 500
micrometers. Such a formulation is administered by rapid inhalation
through the nasal passage from a container of the powder held close
to the nares.
[0438] Formulations for nasal administration may, for example,
comprise from about as little as 0.1% (w/w) to as much as 100%
(w/w) of the active ingredient, and may comprise one or more of the
additional ingredients described herein. A pharmaceutical
composition described herein can be prepared, packaged, and/or sold
in a formulation for buccal administration. Such formulations may,
for example, be in the form of tablets and/or lozenges made using
conventional methods, and may contain, for example, 0.1 to 20%
(w/w) active ingredient, the balance comprising an orally
dissolvable and/or degradable composition and, optionally, one or
more of the additional ingredients described herein. Alternately,
formulations for buccal administration may comprise a powder and/or
an aerosolized and/or atomized solution and/or suspension
comprising the active ingredient. Such powdered, aerosolized,
and/or aerosolized formulations, when dispersed, may have an
average particle and/or droplet size in the range from about 0.1 to
about 200 nanometers, and may further comprise one or more of the
additional ingredients described herein.
[0439] A pharmaceutical composition described herein can be
prepared, packaged, and/or sold in a formulation for ophthalmic
administration. Such formulations may, for example, be in the form
of eye drops including, for example, a 0.1-1.0% (w/w) solution
and/or suspension of the active ingredient in an aqueous or oily
liquid carrier or excipient. Such drops may further comprise
buffering agents, salts, and/or one or more other of the additional
ingredients described herein. Other opthalmically-administrable
formulations which are useful include those which comprise the
active ingredient in microcrystalline form and/or in a liposomal
preparation. Ear drops and/or eye drops are also contemplated as
being within the scope of this disclosure.
[0440] Although the descriptions of pharmaceutical compositions
provided herein are principally directed to pharmaceutical
compositions which are suitable for administration to humans, such
compositions are generally suitable for administration to animals
of all sorts. Modification of pharmaceutical compositions suitable
for administration to humans in order to render the compositions
suitable for administration to various animals is well understood,
and the ordinarily skilled veterinary pharmacologist can design
and/or perform such modification with ordinary experimentation.
[0441] The compounds provided herein are typically formulated in
dosage unit form for ease of administration and uniformity of
dosage. It will be understood, however, that the total daily usage
of the compositions described herein will be decided by a physician
within the scope of sound medical judgment. The specific
therapeutically effective dose level for any particular subject or
organism will depend upon a variety of factors including the
disease being treated and the severity of the disorder; the
activity of the specific active ingredient employed; the specific
composition employed; the age, body weight, general health, sex,
and diet of the subject; the time of administration, route of
administration, and rate of excretion of the specific active
ingredient employed; the duration of the treatment; drugs used in
combination or coincidental with the specific active ingredient
employed; and like factors well known in the medical arts.
[0442] The compounds and compositions provided herein can be
administered by any route, including enteral (e.g., oral),
parenteral, intravenous, intramuscular, intra-arterial,
intramedullary, intrathecal, subcutaneous, intraventricular,
transdermal, interdermal, rectal, intravaginal, intraperitoneal,
topical (as by powders, ointments, creams, and/or drops), mucosal,
nasal, bucal, sublingual; by intratracheal instillation, bronchial
instillation, and/or inhalation; and/or as an oral spray, nasal
spray, and/or aerosol. Specifically contemplated routes are oral
administration, intravenous administration (e.g., systemic
intravenous injection), regional administration via blood and/or
lymph supply, and/or direct administration to an affected site. In
general, the most appropriate route of administration will depend
upon a variety of factors including the nature of the agent (e.g.,
its stability in the environment of the gastrointestinal tract),
and/or the condition of the subject (e.g., whether the subject is
able to tolerate oral administration). In certain embodiments, the
compound or pharmaceutical composition described herein is suitable
for topical administration to the eye of a subject.
[0443] The exact amount of a compound required to achieve an
effective amount will vary from subject to subject, depending, for
example, on species, age, and general condition of a subject,
severity of the side effects or disorder, identity of the
particular compound, mode of administration, and the like. An
effective amount may be included in a single dose (e.g., single
oral dose) or multiple doses (e.g., multiple oral doses). In
certain embodiments, when multiple doses are administered to a
subject or applied to a biological sample, tissue, or cell, any two
doses of the multiple doses include different or substantially the
same amounts of a compound described herein. In certain
embodiments, when multiple doses are administered to a subject or
applied to a biological sample, tissue, or cell, the frequency of
administering the multiple doses to the subject or applying the
multiple doses to the tissue or cell is three doses a day, two
doses a day, one dose a day, one dose every other day, one dose
every third day, one dose every week, one dose every two weeks, one
dose every three weeks, or one dose every four weeks. In certain
embodiments, the frequency of administering the multiple doses to
the subject or applying the multiple doses to the tissue or cell is
one dose per day. In certain embodiments, the frequency of
administering the multiple doses to the subject or applying the
multiple doses to the tissue or cell is two doses per day. In
certain embodiments, the frequency of administering the multiple
doses to the subject or applying the multiple doses to the tissue
or cell is three doses per day. In certain embodiments, when
multiple doses are administered to a subject or applied to a
biological sample, tissue, or cell, the duration between the first
dose and last dose of the multiple doses is one day, two days, four
days, one week, two weeks, three weeks, one month, two months,
three months, four months, six months, nine months, one year, two
years, three years, four years, five years, seven years, ten years,
fifteen years, twenty years, or the lifetime of the subject,
biological sample, tissue, or cell. In certain embodiments, the
duration between the first dose and last dose of the multiple doses
is three months, six months, or one year. In certain embodiments,
the duration between the first dose and last dose of the multiple
doses is the lifetime of the subject, biological sample, tissue, or
cell. In certain embodiments, a dose (e.g., a single dose, or any
dose of multiple doses) described herein includes independently
between 0.1 .mu.g and 1 .mu.g, between 0.001 mg and 0.01 mg,
between 0.01 mg and 0.1 mg, between 0.1 mg and 1 mg, between 1 mg
and 3 mg, between 3 mg and 10 mg, between 10 mg and 30 mg, between
30 mg and 100 mg, between 100 mg and 300 mg, between 300 mg and
1,000 mg, or between 1 g and 10 g, inclusive, of a compound
described herein. In certain embodiments, a dose described herein
includes independently between 1 mg and 3 mg, inclusive, of a
compound described herein. In certain embodiments, a dose described
herein includes independently between 3 mg and 10 mg, inclusive, of
a compound described herein. In certain embodiments, a dose
described herein includes independently between 10 mg and 30 mg,
inclusive, of a compound described herein. In certain embodiments,
a dose described herein includes independently between 30 mg and
100 mg, inclusive, of a compound described herein.
[0444] Dose ranges as described herein provide guidance for the
administration of provided pharmaceutical compositions to an adult.
The amount to be administered to, for example, a child or an
adolescent can be determined by a medical practitioner or person
skilled in the art and can be lower or the same as that
administered to an adult.
[0445] A compound or composition, as described herein, can be
administered in combination with one or more additional
pharmaceutical agents (e.g., therapeutically and/or
prophylactically active agents) useful in treating and/or
preventing a proliferative disease. The compounds or compositions
can be administered in combination with additional pharmaceutical
agents that improve their activity (e.g., activity (e.g., potency
and/or efficacy) in treating a proliferative disease in a subject
in need thereof, in preventing a proliferative disease in a subject
in need thereof, and/or in inhibiting the activity of a protein
kinase (e.g., CDK (e.g., CDK7) in a subject, biological sample,
tissue, or cell), improve bioavailability, improve safety, reduce
drug resistance, reduce and/or modify metabolism, inhibit
excretion, and/or modify distribution in a subject, biological
sample, tissue, or cell. It will also be appreciated that the
therapy employed may achieve a desired effect for the same
disorder, and/or it may achieve different effects. In certain
embodiments, a pharmaceutical composition described herein
including a compound described herein and an additional
pharmaceutical agent shows a synergistic effect that is absent in a
pharmaceutical composition including one of the compound and the
additional pharmaceutical agent, but not both.
[0446] The compound or composition can be administered concurrently
with, prior to, or subsequent to one or more additional
pharmaceutical agents, which may be useful as, e.g., combination
therapies in treating and/or preventing a proliferative disease.
Pharmaceutical agents include therapeutically active agents.
Pharmaceutical agents also include prophylactically active agents.
Pharmaceutical agents include small organic molecules such as drug
compounds (e.g., compounds approved for human or veterinary use by
the U.S. Food and Drug Administration as provided in the Code of
Federal Regulations (CFR)), peptides, proteins, carbohydrates,
monosaccharides, oligosaccharides, polysaccharides, nucleoproteins,
mucoproteins, lipoproteins, synthetic polypeptides or proteins,
small molecules linked to proteins, glycoproteins, steroids,
nucleic acids, DNAs, RNAs, nucleotides, nucleosides,
oligonucleotides, antisense oligonucleotides, lipids, hormones,
vitamins, and cells. In certain embodiments, the additional
pharmaceutical agent is a pharmaceutical agent useful in treating a
proliferative disease. In certain embodiments, the additional
pharmaceutical agent is a pharmaceutical agent useful in preventing
a proliferative disease. In certain embodiments, the additional
pharmaceutical agent is a pharmaceutical agent useful in inhibiting
the activity of a protein kinase (e.g., CDK (e.g., CDK7)) in a
subject, biological sample, tissue, or cell. In certain
embodiments, the additional pharmaceutical agent is a
pharmaceutical agent useful in inducing apoptosis in a cell. In
certain embodiments, the additional pharmaceutical agent is a
pharmaceutical agent approved by a regulatory agency (e.g., the US
FDA) for treating and/or preventing a proliferative disease. Each
additional pharmaceutical agent may be administered at a dose
and/or on a time schedule determined for that pharmaceutical agent.
The additional pharmaceutical agent(s) may also be administered
together with each other and/or with the compound or composition
described herein in a single dose or administered separately in
different doses. The particular combination to employ in a regimen
will take into account compatibility of the compound described
herein with the additional pharmaceutical agent(s) and/or the
desired therapeutic and/or prophylactic effect to be achieved. In
general, it is expected that the additional pharmaceutical agent(s)
in combination be utilized at levels that do not exceed the levels
at which they are utilized individually. In some embodiments, the
levels utilized in combination will be lower than those utilized
individually.
[0447] In certain embodiments, the additional pharmaceutical agent
is an anti-proliferative agent (e.g., anti-cancer agent). In
certain embodiments, the additional pharmaceutical agent is an
anti-leukemia agent. In certain embodiments, the additional
pharmaceutical agent is ABITREXATE (methotrexate), ADE, Adriamycin
RDF (doxorubicin hydrochloride), Ambochlorin (chlorambucil),
ARRANON (nelarabine), ARZERRA (ofatumumab), BOSULIF (bosutinib),
BUSULFEX (busulfan), CAMPATH (alemtuzumab), CERUBIDINE
(daunorubicin hydrochloride), CLAFEN (cyclophosphamide), CLOFAREX
(clofarabine), CLOLAR (clofarabine), CVP, CYTOSAR-U (cytarabine),
CYTOXAN (cyclophosphamide), ERWINAZE (Asparaginase Erwinia
Chrysanthemi), FLUDARA (fludarabine phosphate), FOLEX
(methotrexate), FOLEX PFS (methotrexate), GAZYVA (obinutuzumab),
GLEEVEC (imatinib mesylate), Hyper-CVAD, ICLUSIG (ponatinib
hydrochloride), IMBRUVICA (ibrutinib), LEUKERAN (chlorambucil),
LINFOLIZIN (chlorambucil), MARQIBO (vincristine sulfate liposome),
METHOTREXATE LPF (methorexate), MEXATE (methotrexate), MEXATE-AQ
(methotrexate), mitoxantrone hydrochloride, MUSTARGEN
(mechlorethamine hydrochloride), MYLERAN (busulfan), NEOSAR
(cyclophosphamide), ONCASPAR (Pegaspargase), PURINETHOL
(mercaptopurine), PURIXAN (mercaptopurine), Rubidomycin
(daunorubicin hydrochloride), SPRYCEL (dasatinib), SYNRIBO
(omacetaxine mepesuccinate), TARABINE PFS (cytarabine), TASIGNA
(nilotinib), TREANDA (bendamustine hydrochloride), TRISENOX
(arsenic trioxide), VINCASAR PFS (vincristine sulfate), ZYDELIG
(idelalisib), or a combination thereof. In certain embodiments, the
additional pharmaceutical agent is an anti-lymphoma agent. In
certain embodiments, the additional pharmaceutical agent is
ABITREXATE (methotrexate), ABVD, ABVE, ABVE-PC, ADCETRIS
(brentuximab vedotin), ADRIAMYCIN PFS (doxorubicin hydrochloride),
ADRIAMYCIN RDF (doxorubicin hydrochloride), AMBOCHLORIN
(chlorambucil), AMBOCLORIN (chlorambucil), ARRANON (nelarabine),
BEACOPP, BECENUM (carmustine), BELEODAQ (belinostat), BEXXAR
(tositumomab and iodine 1131 tositumomab), BICNU (carmustine),
BLENOXANE (bleomycin), CARMUBRIS (carmustine), CHOP, CLAFEN
(cyclophosphamide), COPP, COPP-ABV, CVP, CYTOXAN
(cyclophosphamide), DEPOCYT (liposomal cytarabine), DTIC-DOME
(dacarbazine), EPOCH, FOLEX (methotrexate), FOLEX PFS
(methotrexate), FOLOTYN (pralatrexate), HYPER-CVAD, ICE, IMBRUVICA
(ibrutinib), INTRON A (recombinant interferon alfa-2b), ISTODAX
(romidepsin), LEUKERAN (chlorambucil), LINFOLIZIN (chlorambucil),
Lomustine, MATULANE (procarbazine hydrochloride), METHOTREXATE LPF
(methotrexate), MEXATE (methotrexate), MEXATE-AQ (methotrexate),
MOPP, MOZOBIL (plerixafor), MUSTARGEN (mechlorethamine
hydrochloride), NEOSAR (cyclophosphamide), OEPA, ONTAK (denileukin
diftitox), OPPA, R-CHOP, REVLIMID (lenalidomide), RITUXAN
(rituximab), STANFORD V, TREANDA (bendamustine hydrochloride),
VAMP, VELBAN (vinblastine sulfate), VELCADE (bortezomib), VELSAR
(vinblastine sulfate), VINCASAR PFS (vincristine sulfate), ZEVALIN
(ibritumomab tiuxetan), ZOLINZA (vorinostat), ZYDELIG (idelalisib),
or a combination thereof. In certain embodiments, the additional
pharmaceutical agent is an anti-myelodysplasia agent. In certain
embodiments, the additional pharmaceutical agent is REVLIMID
(lenalidomide), DACOGEN (decitabine), VIDAZA (azacitidine),
CYTOSAR-U (cytarabine), IDAMYCIN (idarubicin), CERUBIDINE
(daunorubicin), or a combination thereof.
[0448] In certain embodiments, the additional pharmaceutical agent
is an anti-macroglobulinemia agent.
[0449] In certain embodiments, the additional pharmaceutical agent
is LEUKERAN (chlorambucil), NEOSAR (cyclophosphamide), FLUDARA
(fludarabine), LEUSTATIN (cladribine), or a combination thereof. In
certain embodiments, the additional pharmaceutical agent is
ABITREXATE (methotrexate), ABRAXANE (paclitaxel albumin-stabilized
nanoparticle formulation), AC, AC-T, ADE, ADRIAMYCIN PFS
(doxorubicin hydrochloride), ADRUCIL (fluorouracil), AFINITOR
(everolimus), AFINITOR DISPERZ (everolimus), ALDARA (imiquimod),
ALIMTA (pemetrexed disodium), AREDIA (pamidronate disodium),
ARIMIDEX (anastrozole), AROMASIN (exemestane), AVASTIN
(bevacizumab), BECENUM (carmustine), BEP, BICNU (carmustine),
BLENOXANE (bleomycin), CAF, CAMPTOSAR (irinotecan hydrochloride),
CAPOX, CAPRELSA (vandetanib), CARBOPLATIN-TAXOL, CARMUBRIS
(carmustine), CASODEX (bicalutamide), CEENU (lomustine), CERUBIDINE
(daunorubicin hydrochloride), CERVARIX (recombinant HPV bivalent
vaccine), CLAFEN (cyclophosphamide), CMF, COMETRIQ
(cabozantinib-s-malate), COSMEGEN (dactinomycin), CYFOS
(ifosfamide), CYRAMZA (ramucirumab), CYTOSAR-U (cytarabine),
CYTOXAN (cyclophosphamide), DACOGEN (decitabine), DEGARELIX, DOXIL
(doxorubicin hydrochloride liposome), DOXORUBICIN HYDROCHLORIDE,
DOX-SL (doxorubicin hydrochloride liposome), DTIC-DOME
(dacarbazine), EFUDEX (fluorouracil), ELLENCE (epirubicin
hydrochloride), ELOXATIN (oxaliplatin), ERBITUX (cetuximab),
ERIVEDGE (vismodegib), ETOPOPHOS (etoposide phosphate), EVACET
(doxorubicin hydrochloride liposome), FARESTON (toremifene),
FASLODEX (fulvestrant), FEC, FEMARA (letrozole), FLUOROPLEX
(fluorouracil), FOLEX (methotrexate), FOLEX PFS (methotrexate),
FOLFIRI, FOLFIRI-BEVACIZUMAB, FOLFIRI-CETUXIMAB, FOLFIRINOX,
FOLFOX, FU-LV, GARDASIL (recombinant human papillomavirus (HPV)
quadrivalent vaccine), GEMCITABINE-CISPLATIN,
GEMCITABINE-OXALIPLATIN, GEMZAR (gemcitabine hydrochloride),
GILOTRIF (afatinib dimaleate), GLEEVEC (imatinib mesylate), GLIADEL
(carmustine implant), GLIADEL WAFER (carmustine implant), HERCEPTIN
(trastuzumab), HYCAMTIN (topotecan hydrochloride), IFEX
(ifosfamide), IFOSFAMIDUM (ifosfamide), INLYTA (axitinib), INTRON A
(recombinant interferon alfa-2b), IRESSA (gefitinib), IXEMPRA
(ixabepilone), JAKAFI (ruxolitinib phosphate), JEVTANA
(cabazitaxel), KADCYLA (ado-trastuzumab emtansine), KEYTRUDA
(pembrolizumab), KYPROLIS (carfilzomib), LIPODOX (doxorubicin
hydrochloride liposome), LUPRON (leuprolide acetate), LUPRON DEPOT
(leuprolide acetate), LUPRON DEPOT-3 MONTH (leuprolide acetate),
LUPRON DEPOT-4 MONTH (leuprolide acetate), LUPRON DEPOT-PED
(leuprolide acetate), MEGACE (megestrol acetate), MEKINIST
(trametinib), METHAZOLASTONE (temozolomide), METHOTREXATE LPF
(methotrexate), MEXATE (methotrexate), MEXATE-AQ (methotrexate),
MITOXANTRONE HYDROCHLORIDE, MITOZYTREX (mitomycin c), MOZOBIL
(plerixafor), MUSTARGEN (mechlorethamine hydrochloride), MUTAMYCIN
(mitomycin c), MYLOSAR (azacitidine), NAVELBINE (vinorelbine
tartrate), NEOSAR (cyclophosphamide), NEXAVAR (sorafenib tosylate),
NOLVADEX (tamoxifen citrate), NOVALDEX (tamoxifen citrate), OFF,
PAD, PARAPLAT (carboplatin), PARAPLATIN (carboplatin), PEG-INTRON
(peginterferon alfa-2b), PEMETREXED DISODIUM, PERJETA (pertuzumab),
PLATINOL (cisplatin), PLATINOL-AQ (cisplatin), POMALYST
(pomalidomide), prednisone, PROLEUKIN (aldesleukin), PROLIA
(denosumab), PROVENGE (sipuleucel-t), REVLIMID (lenalidomide),
RUBIDOMYCIN (daunorubicin hydrochloride), SPRYCEL (dasatinib),
STIVARGA (regorafenib), SUTENT (sunitinib malate), SYLATRON
(peginterferon alfa-2b), SYLVANT (siltuximab), SYNOVIR
(thalidomide), TAC, TAFINLAR (dabrafenib), TARABINE PFS
(cytarabine), TARCEVA (erlotinib hydrochloride), TASIGNA
(nilotinib), TAXOL (paclitaxel), TAXOTERE (docetaxel), TEMODAR
(temozolomide), THALOMID (thalidomide), TOPOSAR (etoposide),
TORISEL (temsirolimus), TPF, TRISENOX (arsenic trioxide), TYKERB
(lapatinib ditosylate), VECTIBIX (panitumumab), VEIP, VELBAN
(vinblastine sulfate), VELCADE (bortezomib), VELSAR (vinblastine
sulfate), VEPESID (etoposide), VIADUR (leuprolide acetate), VIDAZA
(azacitidine), VINCASAR PFS (vincristine sulfate), VOTRIENT
(pazopanib hydrochloride), WELLCOVORIN (leucovorin calcium),
XALKORI (crizotinib), XELODA (capecitabine), XELOX, XGEVA
(denosumab), XOFIGO (radium 223 dichloride), XTANDI (enzalutamide),
YERVOY (ipilimumab), ZALTRAP (ziv-aflibercept), ZELBORAF
(vemurafenib), ZOLADEX (goserelin acetate), ZOMETA (zoledronic
acid), ZYKADIA (ceritinib), ZYTIGA (abiraterone acetate), or a
combination thereof. In certain embodiments, the additional
pharmaceutical agent is a protein kinase inhibitor (e.g., tyrosine
protein kinase inhibitor). In certain embodiments, the additional
pharmaceutical agent is an inhibitor of a Src family kinase. In
certain embodiments, the additional pharmaceutical agent is a CDK
inhibitor. In certain embodiments, the additional pharmaceutical
agent is a CDK7 inhibitor. In certain embodiments, the additional
pharmaceutical agent is an inhibitor of one or more protein kinases
selected from the group consisting of IRAK1, IRAK4, BMX, and PI3K.
In certain embodiments, the additional pharmaceutical agent is an
inhibitor of one or more protein kinases selected from the group
consisting of BUB1B, CDK2, CDK9, CHEK2, FGR, HIPK4, PRKCQ, RET,
SRC, or MELK. In certain embodiments, the additional pharmaceutical
agent is an inhibitor of one or more protein kinases selected from
the group consisting of ABL, ARG, BLK, CSK, EphB1, EphB2, FGR, FRK,
FYN, SRC, YES, LCK, LYN, MAP2K5, NLK, p38a, SNRK, and TEC. In
certain embodiments, the additional pharmaceutical agent is an
inhibitor of one or more protein kinases selected from the group
consisting of ABL1(H396P)-phosphorylated, ABL1-phosphorylated, BLK,
EPHA4, EPHB2, EPHB3, EPHB4, FGR, JAK3(JH1domain-catalytic), KIT,
KIT(L576P), KIT(V559D), PDGFRB, SRC, YES,
ABL1(H396P)-nonphosphorylated, ABL1(Y253F)-phosphorylated,
ABL1-nonphosphorylated, FRK, LYN, ABL1(Q252H)-nonphosphorylated,
DDR1, EPHB1, ERBB4, p38-alpha, ABL2, ABL1(Q252H)-phosphorylated,
SIK, EPHA8, MEK5, ABL1(E255K)-phosphorylated,
ABL1(F317L)-nonphosphorylated, FYN, LCK, EPHA2,
ABL1(M351T)-phosphorylated, TXK, EGFR(L858R), EGFR(L861Q), ERBB2,
ERBB3, EPHA5, ABL1(F317I)-nonphosphorylated, EGFR(L747-E749del,
A750P), CSK, EPHA1, ABL1(F317L)-phosphorylated, BRAF(V600E), EGFR,
KIT-autoinhibited, and EGFR(E746-A750del). In certain embodiments,
the additional pharmaceutical agent is an inhibitor of one or more
protein kinases selected from the group consisting of
ABL1(F317L)-nonphosphorylated, ABL1(H396P)-nonphosphorylated,
ABL1(H396P)-phosphorylated, ABL1-phosphorylated, BLK, EPHA4, EPHB2,
EPHB3, EPHB4, JAK3(JH1domain-catalytic), KIT, KIT(L576P),
KIT(V559D), LYN, PDGFRB, SRC, YES, ABL1-nonphosphorylated,
ABL1(Y253F)-phosphorylated, ERBB3, FGR, FRK, p38-alpha,
ABL1(F317I)-nonphosphorylated, DDR1, EPHA2,
ABL1(Q252H)-phosphorylated, MEK5, ABL1(Q252H)-nonphosphorylated,
ABL2, FYN, EPHB1, ABL1(E255K)-phosphorylated,
ABL1(F317L)-phosphorylated, EPHA1, ABL1(M351T)-phosphorylated,
ERBB4, TXK, LCK, EPHA8, SIK, EPHA5, EGFR(L861Q),
CSF1R-autoinhibited, BRAF(V600E), BRK, CSK, KIT(D816V),
KIT-autoinhibited, EGFR(L747-T751del,Sins), EGFR(L858R),
EGFR(L747-E749del, A750P), and CSF1R. In certain embodiments, the
additional pharmaceutical agent is an anti-angiogenesis agent,
anti-inflammatory agent, immunosuppressant, anti-bacterial agent,
anti-viral agent, cardiovascular agent, cholesterol-lowering agent,
anti-diabetic agent, anti-allergic agent, pain-relieving agent, or
a combination thereof. In certain embodiments, the compounds
described herein or pharmaceutical compositions can be administered
in combination with an anti-cancer therapy including, but not
limited to, transplantation (e.g., bone marrow transplantation,
stem cell transplantation), surgery, radiation therapy,
immunotherapy, and chemotherapy.
[0450] Also encompassed by the disclosure are kits (e.g.,
pharmaceutical packs). The kits provided may comprise a
pharmaceutical composition or compound described herein and a
container (e.g., a vial, ampule, bottle, syringe, and/or dispenser
package, or other suitable container). In some embodiments,
provided kits may optionally further include a second container
comprising a pharmaceutical excipient for dilution or suspension of
a pharmaceutical composition or compound described herein. In some
embodiments, the pharmaceutical composition or compound described
herein provided in the first container and the second container are
combined to form one unit dosage form.
Methods of Treatment and Uses
[0451] The present invention also provides methods for the
treatment or prevention of a proliferative disease (e.g., cancers
(e.g., leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's
lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's
sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer,
colorectal cancer), benign neoplasms, diseases associated with
angiogenesis, inflammatory diseases, autoinflammatory diseases, and
autoimmune diseases).
[0452] The compounds described herein may: [0453] exhibit kinase
inhibitory activity, [0454] exhibit the ability to inhibit
cyclin-dependent kinase (CDK), [0455] exhibit the ability to
inhibit cyclin-dependent kinase 7 (CDK7), [0456] exhibit the
ability to inhibit cyclin-dependent kinase 7 (CDK7), without
inhibiting another cyclin-dependent kinase (CDK), [0457] exhibit a
therapeutic effect and/or preventative effect in the treatment of
cancers, [0458] exhibit a therapeutic effect and/or preventative
effect in the treatment of Myc-dependent cancers, and/or [0459]
exhibit a therapeutic profile (e.g., optimum safety and curative
effect) that is superior to existing chemotherapeutic agents.
[0460] Without wishing to be bound by any particular theory, the
compounds described herein may be able to bind (e.g., covalently
modify) a protein kinase described herein. In certain embodiments,
the R.sup.2 group of a compound described herein may be able to
bind (e.g., covalently modify) to the protein kinase. In certain
embodiments, the R.sup.2 group of a compound described herein may
be able to covalently bind a cysteine residue of the protein
kinase. In certain embodiments, the R.sup.2 group of a compound
described herein may be able to covalently bind Cys312 residue of
CDK7.
[0461] In another aspect, the present disclosure provides methods
of inhibiting the activity of a protein kinase in a subject, the
methods comprising administering to the subject an effective amount
(e.g., therapeutically effective amount) of a compound, or
pharmaceutical composition thereof, as described herein.
[0462] In another aspect, the present disclosure provides methods
of inhibiting the activity of a protein kinase in a biological
sample, the methods comprising contacting the biological sample
with an effective amount of a compound, or pharmaceutical
composition thereof, as described herein.
[0463] In another aspect, the present disclosure provides methods
of inhibiting the activity of a protein kinase in a tissue, the
methods comprising contacting the tissue with an effective amount
of a compound, or pharmaceutical composition thereof, as described
herein.
[0464] In another aspect, the present disclosure provides methods
of inhibiting the activity of a protein kinase in a cell, the
methods comprising contacting the cell with an effective amount of
a compound, or pharmaceutical composition thereof, as described
herein.
[0465] In certain embodiments, the subject being treated is a
mammal. In certain embodiments, the subject is a human. In certain
embodiments, the subject is a domesticated animal, such as a dog,
cat, cow, pig, horse, sheep, or goat. In certain embodiments, the
subject is a companion animal such as a dog or cat. In certain
embodiments, the subject is a livestock animal such as a cow, pig,
horse, sheep, or goat. In certain embodiments, the subject is a zoo
animal. In another embodiment, the subject is a research animal
such as a rodent, dog, or non-human primate. In certain
embodiments, the subject is a non-human transgenic animal such as a
transgenic mouse or transgenic pig.
[0466] In certain embodiments, a biological sample described herein
is bone marrow, lymph node, spleen, or blood.
[0467] In certain embodiments, a cell described herein is in vitro.
In certain embodiments, a cell described herein is ex vivo. In
certain embodiments, a cell described herein is in vivo. In certain
embodiments, a cell described herein is a malignant cell (e.g.,
malignant blood cell). In certain embodiments, a cell described
herein is a malignant hematopoietic stem cell (e.g., malignant
myeloid cell or malignant lymphoid cell). In certain embodiments, a
cell described herein is a malignant lymphocyte (e.g., malignant
T-cell or malignant B-cell). In certain embodiments, a cell
described herein is a malignant red blood cell, malignant white
blood cell, or malignant platelet. In certain embodiments, a cell
described herein is a malignant neutrophil, malignant macrophage,
or malignant plasma cell.
[0468] The proliferative disease to be treated or prevented using
the compounds described herein may be associated with
overexpression of a kinase, such as cyclin-dependent kinase (CDK).
The process of eukaryotic cell division may be broadly divided into
a series of sequential phases termed G1, S, G2, and M. Correct
progression through the various phases of the cell cycle has been
shown to be critically dependent upon the spatial and temporal
regulation of a family of proteins known as cyclin dependent
kinases (CDKs) and a diverse set of their cognate protein partners
termed cyclins. CDKs are CDCl.sub.2 (also known as CDK1) homologous
serine-threonine kinase proteins that are able to utilize ATP as a
substrate in the phosphorylation of diverse polypeptides in a
sequence-dependent context. Cyclins are a family of proteins
characterized by a homology region, containing approximately 100
amino acids, termed the "cyclin box" which is used in binding to,
and defining selectivity for, specific CDK partner proteins.
[0469] Modulation of the expression levels, degradation rates,
protein levels, and activity levels of various CDKs and cyclins
throughout the cell cycle leads to the cyclical formation of a
series of CDK/cyclin complexes, in which the CDKs are enzymatically
active. The formation of these complexes controls passage through
discrete cell cycle checkpoints and thereby enables the process of
cell division to continue. Failure to satisfy the prerequisite
biochemical criteria at a given cell cycle checkpoint, i.e.,
failure to form a required CDK/cyclin complex, can lead to cell
cycle arrest and/or cellular apoptosis. Aberrant cellular
proliferation can often be attributed to loss of correct cell cycle
control. Inhibition of CDK enzymatic activity therefore provides a
means by which abnormally dividing cells can have their division
arrested and/or be killed. The diversity of CDKs, and CDK
complexes, and their critical roles in mediating the cell cycle,
provides a broad spectrum of potential therapeutic targets selected
on the basis of a defined biochemical rationale.
[0470] CDK7, a member of the CDK family, was originally isolated as
the catalytic subunit of the trimeric CDK-activating kinase (CAK)
complex. This complex, consisting of CDK7, cyclin H, and MAT1, is
responsible for activation of the mitotic promoting factor in
vitro. The discovery that CDK7 was also a component of the basal
transcription repair factor IIH (TFIIH) implicated a dual role for
CDK7 in transcription as part of TFIIH and in the control of the
cell cycle as the trimeric CAK complex. TFIIH is a multi-subunit
protein complex identified as a factor required for RNA polymerase
II (RNAP II)-catalyzed transcription, and subsequently this complex
was found to play a key role in nucleotide excision repair. CDK7 is
a component of at least three complexes, i.e., the trimeric CAK
complex, the quaternary complex with the XPD (or ERCC2, a protein
involved in transcription-coupled nucleotide excision repair), and
the nine-subunit TFIIH complex. The two functions of CDK7 in CAK
and CTD phosphorylation support critical facets of cellular
proliferation, cell cycling, and transcription. Overexpression of
CDK7 may inhibit apoptosis, promote transcription and cell
proliferation, and/or disrupt DNA repair, and therefore, cause
proliferative diseases. In certain embodiments, the proliferative
disease to be treated or prevented using the compounds described
herein may be associated with overexpression of a CDK (e.g.,
CDK7).
[0471] A proliferative disease may be associated with aberrant
activity of a CDK (e.g., CDK7). Aberrant activity of a CDK (e.g.,
CDK7) may be an elevated and/or an inappropriate activity of the
CDK. Deregulation of cell cycle progression is a characteristic of
a proliferative disease, and a majority of proliferative diseases
have abnormalities in some component of CDK (e.g., CDK7) activity,
frequently through elevated and/or inappropriate CDK activation.
Inhibition of the catalytic activity of CDK7 would be expected to
inhibit cell cycle progression by blocking the phosphorylation of
cell cycle CDKs, and would additionally inhibit transcription of
effectors of cell division. In certain embodiments, CDK7 is not
overexpressed, and the activity of CDK7 is elevated and/or
inappropriate. In certain other embodiments, CDK7 is overexpressed,
and the activity of CDK7 is elevated and/or inappropriate. The
compounds described herein, and pharmaceutically acceptable salts,
solvates, hydrates, polymorphs, co-crystals, tautomers,
stereoisomers, isotopically labeled derivatives, prodrugs, and
compositions thereof, may inhibit the activity of CDK7 and be
useful in treating and/or preventing proliferative diseases.
[0472] A proliferative disease may also be associated with
inhibition of apoptosis of a cell in a biological sample or
subject. All types of biological samples described herein or known
in the art are contemplated as being within the scope of the
invention. Apoptosis is the process of programmed cell death.
Inhibition of apoptosis may result in uncontrolled cell
proliferation and, therefore, may cause proliferative diseases. The
cell cycle CDKs (CDK1, 2, 4, and 6) are activated by
phosphorylation by CDK7/cyclin H (also called CAK). Inhibition of
CDK7 would therefore result in cell-cycle arrest at multiple points
in the cell cycle due to failure to activate the cell cycle CDKs.
CDK 7 activates transcription by phosphorylating the CTD of RNAP
II. Inhibition of CTD phosphorylation has been shown to inhibit
transcription and reduce expression of short lived proteins,
including those involved in apoptosis regulation. It is appreciated
in the art that stalling of RNA polymerase may activate p53 (also
known as protein 53 or tumor protein 53, a tumor suppressor protein
that is encoded in humans by the TP53 gene), leading to apoptosis.
Thus, inhibition of the activity of CDK7 are expected to cause
cytotoxicity by inducing apoptosis. The compounds described herein,
and pharmaceutically acceptable salts, solvates, hydrates,
polymorphs, co-crystals, tautomers, stereoisomers, isotopically
labeled derivatives, prodrugs, and compositions thereof, may induce
apoptosis, and therefore, be useful in treating and/or preventing
proliferative diseases.
[0473] In certain embodiments, the proliferative disease to be
treated or prevented using the compounds described herein is
cancer. All types of cancers disclosed herein or known in the art
are contemplated as being within the scope of the invention. In
certain embodiments, the proliferative disease is a cancer
associated with dependence on BCL-2 anti-apoptotic proteins (e.g.,
MCL-1 and/or XIAP). In certain embodiments, the proliferative
disease is a cancer associated with overexpression of MYC (a gene
that codes for a transcription factor). In certain embodiments, the
cancer is a MYC-dependent cancer. In certain embodiments, the
proliferative disease is a hematological malignancy. In certain
embodiments, the proliferative disease is a blood cancer. In
certain embodiments, the proliferative disease is a hematological
malignancy. In certain embodiments, the proliferative disease is
leukemia. In certain embodiments, the proliferative disease is
chronic lymphocytic leukemia (CLL). In certain embodiments, the
proliferative disease is acute lymphoblastic leukemia (ALL). In
certain embodiments, the proliferative disease is T-cell acute
lymphoblastic leukemia (T-ALL). In certain embodiments, the
proliferative disease is chronic myelogenous leukemia (CML). In
certain embodiments, the proliferative disease is acute myelogenous
leukemia (AML). In certain embodiments, the proliferative disease
is acute monocytic leukemia (AMoL). In certain embodiments, the
proliferative disease is lymphoma. In some embodiments, the
proliferative disease is Burkitt's lymphoma. In certain
embodiments, the proliferative disease is a Hodgkin's lymphoma. In
certain embodiments, the proliferative disease is a non-Hodgkin's
lymphoma. In certain embodiments, the proliferative disease is
multiple myeloma. In certain embodiments, the proliferative disease
is melanoma. In certain embodiments, the proliferative disease is
colorectal cancer. In certain embodiments, the proliferative
disease is breast cancer. In certain embodiments, the proliferative
disease is triple-negative breast cancer (TNBC). In certain
embodiments, the proliferative disease is a bone cancer. In certain
embodiments, the proliferative disease is osteosarcoma. In certain
embodiments, the proliferative disease is Ewing's sarcoma. In some
embodiments, the proliferative disease is a brain cancer. In some
embodiments, the proliferative disease is neuroblastoma. In some
embodiments, the proliferative disease is a lung cancer. In some
embodiments, the proliferative disease is small cell lung cancer
(SCLC). In some embodiments, the proliferative disease is non-small
cell lung cancer. In some embodiments, the proliferative disease is
a benign neoplasm. All types of benign neoplasms disclosed herein
or known in the art are contemplated as being within the scope of
the invention. In some embodiments, the proliferative disease is
associated with angiogenesis. All types of angiogenesis disclosed
herein or known in the art are contemplated as being within the
scope of the invention. In certain embodiments, the proliferative
disease is an inflammatory disease. All types of inflammatory
diseases disclosed herein or known in the art are contemplated as
being within the scope of the invention. In certain embodiments,
the inflammatory disease is rheumatoid arthritis. In some
embodiments, the proliferative disease is an autoinflammatory
disease. All types of autoinflammatory diseases disclosed herein or
known in the art are contemplated as being within the scope of the
invention. In some embodiments, the proliferative disease is an
autoimmune disease. All types of autoimmune diseases disclosed
herein or known in the art are contemplated as being within the
scope of the invention.
[0474] Another aspect of the invention relates to methods of
inhibiting the activity of a kinase in a biological sample or
subject. In certain embodiments, the kinase is CDK. In certain
embodiments, the kinase is CDK7. In certain embodiments, the
activity of the kinase is aberrant activity of the kinase. In
certain embodiments, the inhibition of the activity of the kinase
is irreversible. In other embodiments, the inhibition of the
activity of the kinase is reversible. In certain embodiments, the
methods of inhibiting the activity of the kinase include attaching
a compound described herein to the kinase.
[0475] Also provided in the present invention are methods of
inhibiting transcription of genes in a biological sample or
subject. Genes which may have their transcription inhibited by the
compounds herein include MYC, KLF2, E2F2, CDK6, CCND3, E2F3,
HNRPDL, TET1, and IL7R.
[0476] The present invention also provides methods of inhibiting
cell growth in a biological sample or subject.
[0477] In still another aspect, the present invention provides
methods of inducing apoptosis of a cell in a biological sample or a
subject.
[0478] In certain embodiments, the methods described herein include
administering to a subject or contacting a biological sample with
an effective amount of a compound described herein, or a
pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, or a pharmaceutical composition
thereof. In certain embodiments, the methods described herein
include administering to a subject or contacting a biological
sample with an effective amount of a compound described herein, or
a pharmaceutically acceptable salt thereof, or a pharmaceutical
composition thereof. In certain embodiments, the compound is
contacted with a biological sample. In certain embodiments, the
compound is administered to a subject. In certain embodiments, the
compound is administered in combination with one or more additional
pharmaceutical agents described herein. The additional
pharmaceutical agent may be an anti-proliferative agent. In certain
embodiments, the additional pharmaceutical agent is an anti-cancer
agent. The additional pharmaceutical agent may also be a kinase
inhibitor. In certain embodiments, the additional pharmaceutical
agent is an inhibitor of a CDK. In certain embodiments, the
additional pharmaceutical agent is an inhibitor of CDK7. In certain
embodiments, the additional pharmaceutical agent is a selective
inhibitor of CDK7. In certain embodiments, the additional
pharmaceutical agent is a nonselective inhibitor of CDK7. In
certain embodiments, the additional pharmaceutical agent is an
inhibitor of another CDK. In certain embodiments, the additional
pharmaceutical agent is a selective inhibitor of another CDK. In
certain embodiments, the additional pharmaceutical agent is a
nonselective inhibitor of another CDK. In certain embodiments, the
additional pharmaceutical agent is flavopiridol, triptolide,
SNS-032 (BMS-387032), PHA-767491, PHA-793887, BS-181, (S)--CR8,
(R)--CR8, or NU6140. In certain embodiments, the additional
pharmaceutical agent is an inhibitor of a mitogen-activated protein
kinase (MAPK). In certain embodiments, the additional
pharmaceutical agent is an inhibitor of a glycogen synthase kinase
3 (GSK3). In certain embodiments, the additional pharmaceutical
agent is an inhibitor of an AGC kinase. In certain embodiments, the
additional pharmaceutical agent is an inhibitor of a
calmodulin-dependent kinase (CaM Kinase). In certain embodiments,
the additional pharmaceutical agent is an inhibitor of a casein
kinase 1. In certain embodiments, the additional pharmaceutical
agent is an inhibitor of a STE kinase. In certain embodiments, the
additional pharmaceutical agent is an inhibitor of a tyrosine
kinase.
[0479] In some embodiments, the additional pharmaceutical agent is
a topoisomerase inhibitor, a MCL1 inhibitor, a BCL-2 inhibitor, a
BCL-xL inhibitor, a BRD4 inhibitor, a CDK9 inhibitor, a Jumonji
histone demethylase inhibitor, or a DNA damage inducer. In some
embodiments, the additional pharmaceutical agent is etoposide,
obatoclax, navitoclax, JQ1,
4-(((5'-chloro-2'-(((1R,4R)-4-(((R)-1-methoxypropan-2-yl)amino)cyclohexyl-
)amino)-[2,4'-bipyridin]-6-yl)amino)methyl)tetrahydro-2H-pyran-4-carbonitr-
ile, JIB04, or cisplatin. In some embodiments, the additional
pharmaceutical agent is etoposide, obatoclax, or navitoclax, and
the disease to be treated is breast cancer, e.g., triple-negative
breast cancer, HER2 positive breast cancer, ER-positive breast
cancer, or ER/PR-positive breast cancer. In some embodiments, the
additional pharmaceutical agent is etoposide, JIB04, or cisplatin,
and the disease to be treated is Ewing's sarcoma. In some
embodiments, the additional pharmaceutical agent is JQ1 or NVP2,
and the disease to be treated is leukemia, e.g., acute myelogenous
leukemia, myeloblastic leukemia, promyelocytic leukemia,
myelomonocytic leukemia, monocytic leukemia, monoblastic leukemia,
or megakaryoblastic leukemia. In certain embodiments, a
pharmaceutical composition described herein further comprises a
combination of the additional pharmaceutical agents described
herein.
[0480] The inventive compounds or compositions may synergistically
augment inhibition of CDK7 induced by the additional pharmaceutical
agent(s) in the biological sample or subject. Thus, the combination
of the inventive compounds or compositions and the additional
pharmaceutical agent(s) may be useful in treating proliferative
diseases resistant to a treatment using the additional
pharmaceutical agent(s) without the inventive compounds or
compositions.
[0481] In some embodiments, the activity of a protein kinase is
non-selectively inhibited by the compounds or pharmaceutical
compositions described herein. In some embodiments, the activity of
a protein kinase described herein is selectively inhibited by the
compounds or pharmaceutical compositions described herein, compared
to the activity of a different protein (e.g., a different protein
kinase). In certain embodiments, the activity of CDK (e.g., CDK7)
is selectively inhibited by a compound or pharmaceutical
composition described herein, compared to the activity of a
different protein. In certain embodiments, the activity of CDK7 is
selectively inhibited by a compound or pharmaceutical composition
described herein, compared to the activity of a different CDK
protein. In certain embodiments, the activity of CDK7 is
selectively inhibited by a compound or pharmaceutical composition
described herein, compared to the activity of CDK12. In certain
embodiments, the activity of CDK7 is selectively inhibited by a
compound or pharmaceutical composition described herein, compared
to the activity of CDK13. In certain embodiments, the activity of
CDK7 is selectively inhibited by a compound or pharmaceutical
composition described herein, compared to the activity of CDK12 and
the activity of CDK13.
[0482] The selectivity of a compound or pharmaceutical composition
described herein in inhibiting the activity of a protein kinase
over a different protein (e.g., a different protein kinase) may be
measured by the quotient of the IC.sub.50 value of the compound or
pharmaceutical composition in inhibiting the activity of the
different protein over the IC.sub.50 value of the compound or
pharmaceutical composition in inhibiting the activity of the
protein kinase. The selectivity of a compound or pharmaceutical
composition described herein for a protein kinase over a different
protein may also be measured by the quotient of the K.sub.d value
of an adduct of the compound or pharmaceutical composition and the
different protein over the K.sub.d value of an adduct of the
compound or pharmaceutical composition and the protein kinase. In
certain embodiments, the selectivity is at least 2-fold, at least
3-fold, at least 5-fold, at least 10-fold, at least 30-fold, at
least 100-fold, at least 300-fold, at least 1,000-fold, at least
3,000-fold, at least 10,000-fold, at least 30,000-fold, or at least
100,000-fold. In certain embodiments, the selectivity is not more
than 100,000-fold, not more than 10,000-fold, not more than
1,000-fold, not more than 100-fold, not more than 10-fold, or not
more than 2-fold. Combinations of the above-referenced ranges
(e.g., at least 2-fold and not more than 10,000-fold) are also
within the scope of the disclosure.
[0483] In certain embodiments, a kit described herein includes a
first container comprising a compound or pharmaceutical composition
described herein. In certain embodiments, a kit described herein is
useful in treating a proliferative disease (e.g., cancers (e.g.,
leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's
lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's
sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer,
colorectal cancer), benign neoplasms, diseases associated with
angiogenesis, inflammatory diseases, autoinflammatory diseases, and
autoimmune diseases) in a subject in need thereof, preventing a
proliferative disease in a subject in need thereof, inhibiting the
activity of a protein kinase (e.g., CDK (e.g., CDK7)) in a subject,
biological sample, tissue, or cell, and/or inducing apoptosis in a
cell.
[0484] In certain embodiments, a kit described herein further
includes instructions for using the compound or pharmaceutical
composition included in the kit. A kit described herein may also
include information as required by a regulatory agency such as the
U.S. Food and Drug Administration (FDA). In certain embodiments,
the information included in the kits is prescribing information. In
certain embodiments, the kits and instructions provide for treating
a proliferative disease in a subject in need thereof, preventing a
proliferative disease in a subject in need thereof, inhibiting the
activity of a protein kinase (e.g., CDK (e.g., CDK7)) in a subject,
biological sample, tissue, or cell, and/or inducing apoptosis in a
cell. A kit described herein may include one or more additional
pharmaceutical agents described herein as a separate
composition.
EXAMPLES
[0485] In order that the invention described herein may be more
fully understood, the following examples are set forth. The
synthetic and biological examples described in this application are
offered to illustrate the compounds, pharmaceutical compositions,
and methods provided herein and are not to be construed in any way
as limiting their scope.
Synthesis of the Compounds
[0486] The compounds provided herein can be prepared from readily
available starting materials using the following general methods
and procedures. Reactions were monitored by thin layer
chromatography (TLC) with 0.25 mm E. Merck pre-coated silica gel
plates (60 F.sub.254) and Waters LCMS system (Waters 2489
UV/Visible Detector, Waters 3100 Mass, Waters 515 HPLC pump, Waters
2545 Binary Gradient Module, Waters Reagent Manager, Waters 2767
Sample Manager) using SunFire.TM. C18 column (4.6.times.50 mm, 5 m
particle size): solvent gradient=95% A at 0 min, 0% A at 5 min;
solvent A=0.5% TFA in Water; solvent B=Methanol; flow rate: 1.5
mL/min. Purification of reaction products was carried out by flash
chromatography using CombiFlash.RTM. Rf with Teledyne Isco
RediSep.RTM. Rf High Performance Gold or Silicycle SiliaSep.TM.
High Performance columns (4 g, 12 g, 24 g, 40 g, 80 g or 120 g) or
by Waters preparative HPLC system with a C18 column: solvent
gradient=100% A at 0 min, 0% A at 15 min; solvent A=0.5% TFA in
Water; solvent B=Methanol; flow rate: 20 mL/min. The purity of all
compounds was over 95% and was analyzed with Waters LCMS system.
.sup.1H NMR and .sup.13C NMR spectra were obtained using a Varian
Inova-600 or 400 MHz spectrometer. Chemical shifts are reported
relative to chloroform (6=7.24) for .sup.1H NMR or dimethyl
sulfoxide (6=2.50) for .sup.1H NMR and dimethyl sulfoxide
(.delta.=39.51) for .sup.13C NMR. Data are reported as (br=broad,
s=singlet, d=doublet, t=triplet, q=quartet, m=multiplet).
Example 1.
(S)-3-((3-(4-acrylamidobenzamido)phenyl)amino)-N-(2-(dimethylam-
ino)-1-phenylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-c-
arboxamide (Compound 101)
[0487] The synthesis of Compound 101 follows Synthetic Scheme 1.
The syntheses of Compounds 102 to 111 (presented in Table 2) follow
a corresponding method.
##STR00219## ##STR00220##
5-(tert-Butyl) ethyl
3-amino-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate
##STR00221##
[0489] To a solution of tert-butyl
3-amino-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxylate
(1.0 g, 3.95 mmol) and TEA (0.6 g, 0.82 mL, 5.93 mmol) in THF (10
mL) was added ethyl chloroformate (0.43 g, 0.38 mL, 3.95 mmol)
dropwise at 0.degree. C. The mixture was stirred at 0.degree. C.
for 1 h. The solvent was evaporated and the residue was partitioned
with EtOAc and sat. NaHCO.sub.3. The organic layer was washed with
water and brine, dried (Na.sub.2SO.sub.4). This was concentrated to
give 5-(tert-butyl) ethyl
3-amino-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate
as an off white solid (1.28 g, 100%). LC/MS (ESI) m/z=325.3
(M+H).sup.+.
5-(tert-Butyl) ethyl
6,6-dimethyl-3-((3-nitrophenyl)amino)-4,6-dihydropyrrolo[3,4-c]pyrazole-1-
,5-dicarboxylate
##STR00222##
[0491] To a suspension of 5-(tert-butyl) ethyl
3-amino-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate
(500 mg, 1.54 mmol), (3-nitrophenyl)boronic acid (514 mg, 3.08
mmol), and Cu(OAc).sub.2 (420 mg, 2.31 mmol) in DCM (10 mL) was
added TEA (311 mg, 0.43 mL, 3.08 mmol). The mixture was stirred at
room temperature overnight. Solvent was evaporated and the crude
was purified by flash column chromatography on silica gel
(EtOAc/hexane, 0-70%) to give 5-(tert-butyl) ethyl
6,6-dimethyl-3-((3-nitrophenyl)amino)-4,6-dihydropyrrolo[3,4-c]pyrazole-1-
,5-dicarboxylate as a yellow solid (240 mg, 35%). LC/MS (ESI)
m/z=446.4 (M+H).sup.+.
5-(tert-Butyl) ethyl
3-((3-aminophenyl)amino)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-1-
,5-dicarboxylate
##STR00223##
[0493] To a solution of 5-(tert-butyl) ethyl
6,6-dimethyl-3-((3-nitrophenyl)amino)-4,6-dihydropyrrolo[3,4-c]pyrazole-1-
,5-dicarboxylate (120 mg, 0.27 mmol) in EtOAc (2 mL) and pyridine
(0.2 mL) was added SnCl.sub.2.2H.sub.2O (305 mg, 1.35 mmol). The
mixture was stirred at 70.degree. C. overnight. The mixture was
diluted with CHC.sub.3/i-PrOH (v/v 4:1) and washed with sat.
NaHCO.sub.3 and brine, dried (Na.sub.2SO.sub.4), and concentrated.
The crude was purified by flash column chromatography on silica gel
(MeOH/DCM, 0-10%) to give 5-(tert-butyl) ethyl
3-((3-aminophenyl)amino)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-1-
,5-dicarboxylate as a yellow solid (99 mg, 88%). LC/MS (ESI)
m/z=416.4 (M+H).sup.+.
5-(tert-Butyl) ethyl
6,6-dimethyl-3-((3-(4-nitrobenzamido)phenyl)amino)-4,6-dihydropyrrolo[3,4-
-c]pyrazole-1,5-dicarboxylate
##STR00224##
[0495] To a solution of 5-(tert-butyl) ethyl
3-((3-aminophenyl)amino)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-1-
,5-dicarboxylate (99 mg, 0.24 mmol) and DIEA (62 mg, 84 .mu.L, 0.48
mmol) in DCM (2 mL) was added 4-nitrobenzoyl chloride (53 mg, 0.29
mmol) at 0.degree. C. The reaction was stirred at room temperature
for 2 h and concentrated. The crude was purified by flash column
chromatography on silica gel (MeOH/DCM, 0-5%) to give
5-(tert-butyl) ethyl
6,6-dimethyl-3-((3-(4-nitrobenzamido)phenyl)amino)-4,6-dihydropyrrolo[3,4-
-c]pyrazole-1,5-dicarboxylate as a yellow solid (129 mg, 95%).
LC/MS (ESI) m/z=565.4 (M+H).sup.+.
Ethyl
6,6-dimethyl-3-((3-(4-nitrobenzamido)phenyl)amino)-5,6-dihydropyrrol-
o[3,4-c]pyrazole-1(4H)-carboxylate
##STR00225##
[0497] To a solution of 5-(tert-butyl) 1- or 2-ethyl
6,6-dimethyl-3-((3-(4-nitrobenzamido)phenyl)amino)-4,6-dihydropyrrolo[3,4-
-c]pyrazole-1,5-dicarboxylate (129 mg, 0.23 mmol) in DCM (1 mL) was
added TFA (1 mL). The reaction was stirred at room temperature for
1 h and concentrated to give ethyl
6,6-dimethyl-3-((3-(4-nitrobenzamido)phenyl)amino)-5,6-dihydropyrrolo[3,4-
-c]pyrazole-1(4H)-carboxylate as a TFA salt, which was used
directly without further purification. LC/MS (ESI) m/z=464.4
(M+H).sup.+.
Ethyl
(S)-5-((2-(dimethylamino)-1-phenylethyl)carbamoyl)-6,6-dimethyl-3-((-
3-(4-nitrobenzamido)phenyl)amino)-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)--
carboxylate
##STR00226##
[0499] To a mixture of ethyl
6,6-dimethyl-3-((3-(4-nitrobenzamido)phenyl)amino)-5,6-dihydropyrrolo[3,4-
-c]pyrazole-1(4H)-carboxylate (TFA salt, 0.23 mmol) in DCM (2 mL)
was added DIEA (148 mg, 0.2 mL, 1.15 mmol) at 0.degree. C.,
followed by (S)-2-isocyanato-N,N-dimethyl-2-phenylethan-1-amine HCl
salt (62 mg, 0.27 mmol). The solution was stirred at 0.degree. C.
for 1 h and diluted with CHC.sub.3/i-PrOH (v/v 4:1) and washed with
sat. NaHCO.sub.3 and brine, dried (Na.sub.2SO.sub.4), and
concentrated. The crude was purified by flash column chromatography
on silica gel (1.75 M NH.sub.3 in MeOH/DCM, 0-10%) to give ethyl
(S)-5-((2-(dimethylamino)-1-phenylethyl)carbamoyl)-6,6-dimethyl-3-((3-(4--
nitrobenzamido)phenyl)amino)-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-carbo-
xylate as a yellow solid (134 mg, 89% over 2 steps). LC/MS (ESI)
m/z=655.4 (M+H).sup.+.
Ethyl
(S)-3-((3-(4-aminobenzamido)phenyl)amino)-5-((2-(dimethylamino)-1-ph-
enylethyl)carbamoyl)-6,6-dimethyl-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)--
carboxylate
##STR00227##
[0501] To a solution of ethyl
(S)-5-((2-(dimethylamino)-1-phenylethyl)carbamoyl)-6,6-dimethyl-3-((3-(4--
nitrobenzamido)phenyl)amino)-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-carbo-
xylate (134 mg, 0.20 mmol) in EtOAc (2 mL) was added
SnCl.sub.2.2H.sub.2O (226 mg, 1.0 mmol). The mixture was stirred at
70.degree. C. for 2 h and diluted with CHC.sub.3/i-PrOH (v/v 4:1)
and washed with sat. NaHCO.sub.3 and brine, dried
(Na.sub.2SO.sub.4), and concentrated. The crude was purified by
flash column chromatography on silica gel (1.75 M NH.sub.3 in
MeOH/DCM, 0-10%) to give ethyl
(S)-3-((3-(4-aminobenzamido)phenyl)amino)-5-((2-(dimethylamino)-1-phenyle-
thyl)carbamoyl)-6,6-dimethyl-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-carbo-
xylate as a yellow solid (112 mg, 90%). LC/MS (ESI) m/z=625.4
(M+H).sup.+.
Compound 101.
(S)-3-((3-(4-acrylamidobenzamido)phenyl)amino)-N-(2-(dimethylamino)-1-phe-
nylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamide
##STR00228##
[0503] To a mixture of ethyl
(S)-3-((3-(4-aminobenzamido)phenyl)amino)-5-((2-(dimethylamino)-1-phenyle-
thyl)carbamoyl)-6,6-dimethyl-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-carbo-
xylate (20 mg, 0.032 mmol) in THF (1 mL) and sat. NaHCO.sub.3(1 mL)
was added acryloyl chloride (5.8 mg, 0.064 mmol) dropwise at
0.degree. C. The mixture was stirred at 0.degree. C. for 10 min and
diluted with CHCl.sub.3/i-PrOH (v/v 4:1) and washed with sat.
NaHCO.sub.3 and brine, dried (Na.sub.2SO.sub.4), and concentrated.
The crude ethyl
(S)-3-((3-(4-acrylamidobenzamido)phenyl)amino)-5-((2-(dimethylamino)-1-ph-
enylethyl)carbamoyl)-6,6-dimethyl-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)--
carboxylate was dissolved in i-PrOH (1 mL) and LiOH (1 M, 1 mL) was
added. After stirred at room temperature for 10 min, the mixture
was diluted with CHCl.sub.3/i-PrOH (v/v 4:1) and washed with sat.
NaHCO.sub.3 and brine, dried (Na.sub.2SO.sub.4), and concentrated.
The crude was purified by reverse phase preparative HPLC
(MeOH/H.sub.2O, 0-100%) to give
(S)-3-((3-(4-acrylamidobenzamido)phenyl)amino)-N-(2-(dimethylamino)-1-phe-
nylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamide
as a white solid (10.5 mg, 54%). .sup.1H NMR: 600 MHz
(DMSO-d.sub.6) .delta. 10.44 (d, J=4.2 Hz, 1H), 10.04 (s, 1H), 8.33
(s, 1H), 7.96-7.93 (m, 2H), 7.82-7.80 (m, 2H), 7.34-7.32 (m, 2H),
7.26-7.23 (m, 2H), 7.20-7.10 (m, 3H), 6.52-6.46 (m, 1H), 6.35-6.30
(m, 1H), 6.09 (s, 1H), 5.84-5.81 (m, 1H), 4.89-4.83 (m, 1H), 4.35
(d, J=19.8 Hz, 2H), 2.64-2.57 (m, 1H), 2.45-2.38 (m, 1H), 2.18 (s,
6H), 1.65 (d, J=4.2 Hz, 3H), 1.58 (d, J=4.8 Hz, 3H); MS m/z: 607.4
[M+1].
TABLE-US-00003 TABLE 2 The following compounds were produced by
using the corresponding starting compounds according to a method
similar to that described in Example 1: Name Structure
Characterization Data Compound 102 (S)-3-((4-(4-
acrylamidobenzamido) phenyl)amino)-N-(2- (dimethylamino)-1-
phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4-
c]pyrazole-5(1H)- carboxamide ##STR00229## .sup.1H NMR (TFA salt):
400 MHz (DMSO-d.sub.6) .delta. 10.46 (s, 1H), 10.01 (s, 1H),
8.98-8.89 (br, 1H), 8.25 (s, 1H), 7.99 (d, J = 8.8 Hz, 2H), 7.85
(d, J = 8.8 Hz, 2H), 7.64 (d, J = 8.8 Hz, 2H), 7.48-7.42 (m, 4H),
7.38- 7.34 (m, 1H), 7.00-6.91 (m, 2H), 6.69 (d, J = 8.8 Hz, 1H),
6.53 (dd, J = 17.2, 10.0 Hz, 1H), 6.36 (dd, J = 17.2, 2.0 Hz, 1H),
5.87 (dd, J = 10.0, 2.0 Hz, 1H), 5.40-5.35 (m, 1H), 4.48 (d, J =
10.8 Hz, 1H), 4.33 (d, J = 10.8 Hz, 1H), 3.10-2.95 (m, 2H), 2.93
(d, J = 4.8 Hz, 3H), 2.87 (d, J = 4.8 Hz, 3H), 1.74 (s, 3H), 1.65
(s, 3H); MS m/z: 607.4 [M + 1]. Compound 103 (S)-3-((4-(3-
acrylamidobenzamido) phenyl)amino)-N-(2- (dimethylamino)-1-
phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4-
c]pyrazole-5(1H)- carboxamide ##STR00230## .sup.1H NMR (TFA salt):
400 MHz (DMSO-d.sub.6) .delta. 11.90-11.70 (br, 1H), 10.26 (s, 1H),
9.98 (s, 1H), 8.22-8.10 (br, 1H), 8.07 (m, 1H), 7.83 (dd, J = 8.0,
1.2 Hz, 1H), 7.57 (d, J = 8.0 Hz, 1H), 7.51 (d, J = 8.8 Hz, 2H),
7.39 (t, J = 8.0 Hz, 1H), 7.27 (d, J = 7.2 Hz, 2H), 7.22 (t, J =
7.2 Hz, 2H), 7.12 (t, J = 7.2 Hz, 1H), 6.39 (dd, J = 17.2, 10.0 Hz,
1H), 6.22 (dd, J = 17.2, 2.0 Hz, 1H), 6.03-5.92 (m, 1H), 5.72 (dd,
J = 10.0, 2.0 Hz, 1H), 4.60-4.51 (m, 1H), 4.25-4.14 (m, 2H), 2.52
(dd, J = 12.0, 8.8 Hz, 1H), 2.32-2.27 (m, 1H), 2.10 (s, 6H), 1.57
(s, 3H), 1.50 (s, 3H); MS m/z: 607.4 [M + 1]. Compound 104
(S)-N-(2-(dimethylamino)-1- phenylethyl)-6,6-dimethyl-3- ((3-(4-
propionamidobenzamido) phenyl)amino)-4,6- dihydropyrrolo[3,4-
c]pyrazole-5(1H)- carboxamide ##STR00231## .sup.1H NMR (TFA salt):
400 MHz (DMSO-d.sub.6) .delta. 12.20-11.80 (br, 1H), 10.09 (s, 1H),
9.93 (s, 1H), 8.23 (s, 1H), 7.83 (d, J = 8.0 Hz, 2H), 7.65 (d, J =
8.8 Hz, 2H), 7.50-7.30 (m, 1H), 7.27 (d, J = 6.8 Hz, 2H), 7.18 (t,
J = 7.2 Hz, 2H), 7.13-7.09 (m, 3H), 6.59-6.51 (m, 1H), 6.12 (s,
1H), 4.92-4.80 (m, 1H), 4.29 (s, 2H), 2.30 (q, J = 7.6 Hz, 2H),
2.22 (m, 6H), 1.57 (s, 3H), 1.51 (s, 3H), 1.03 (t, J = 7.6 Hz, 3H);
MS m/z: 609.4 [M + 1]. Compound 105 (S)-3-((3-(3-
acrylamidobenzamido) phenyl)amino)-N-(2- (dimethylamino)-1-
phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]prazole-5(1H)-
carboxamide ##STR00232## .sup.1H NMR (TFA salt): 400 MHz
(DMSO-d.sub.6) .delta. 12.10-11.82 (br, 1H), 10.26 (s, 1H), 10.08
(s, 1H), 8.25 (s, 1H), 8.06 (s, 1H), 7.85 (dd, J = 8.4, 1.2 Hz,
1H), 7.55 (d, J = 7.6 Hz, 1H), 7.39 (t, J = 8.0 Hz, 1H), 7.24 (d, J
= 7.2 Hz, 2H), 7.15 (t, J = 7.2 Hz, 2H), 7.08 (d, J = 6.4 Hz, 1H),
6.39 (dd, J = 17.2, 10.0 Hz, 1H), 6.22 (dd, J = 17.2, 2.0 Hz, 1H),
5.97 (s, 1H), 5.72 (dd, J = 10.0, 2.0 Hz, 1H), 4.76- 4.70 (m, 1H),
4.30-4.19 (m, 2H), 2.50-2.44 (m, 1H), 2.29- 2.22 (m, 1H), 2.05 (s,
6H), 1.57 (s, 3H), 1.50 (s, 3H); MS m/z: 607.4 [M + 1]. Compound
106 3-((3-(4- acrylamidobenzamido) phenyl)amino)-N-(2-
(dimethylamino)ethyl)-6,6- dimethyl-4,6- dihydropyrrolo[3,4-
c]prazole-5(1H)- carboxamide ##STR00233## .sup.1H NMR (TFA salt):
400 MHz (DMSO-d.sub.6) .delta. 10.49 (s, 1H), 10.07 (s, 1H), 9.41
(s, 1H), 8.37 (s, 1H), 7.99 (d, J = 8.8 Hz, 2H), 7.86 (d, J = 8.8
Hz, 2H), 7.49 (s, 1H), 7.21 (m, 2H), 6.74 (m, 1H), 6.53 (dd, J =
17.2, 10.0 Hz, 1H), 6.38 (m, 1H), 6.36 (dd, J = 17.2, 2.0 Hz, 1H),
5.87 (dd, J = 10.0, 2.0 Hz, 1H), 4.27 (s, 2H), 3.41 (q, J = 5.6 Hz,
2H), 3.18 (q, J = 5.6 Hz, 2H), 2.86 (s, 3H), 2.85 (s, 3H), 1.71 (s,
6H); MS m/z: 531.4 [M + 1]. Compound 107 4-acrylamido-N-(3-((6,6-
dimethyl-5-(4- methylpiperazine-1- carbonyl)-1,4,5,6-
tetrahydropyrrolo[3,4- c]pyrazol-3- yl)amino)phenyl)benzamide
##STR00234## .sup.1H NMR (TFA salt): 400 MHz (DMSO-d.sub.6) .delta.
10.49 (s, 1H), 10.08 (s, 1H), 9.68 (s, 1H), 8.44 (s, 1H), 7.99 (s,
J = 8.8 Hz, 2H), 7.86 (d, J = 8.4 Hz, 2H), 7.62 (s, 1H), 7.23-7.13
(m, 2H), 6.84 (d, J = 7.2 Hz, 1H), 6.53 (dd, J = 17.2, 10.0 Hz,
1H), 6.36 (dd, J = 17.2, 2.0 Hz, 1H), 5.87 (dd, J = 10.0, 2.0 Hz,
1H), 4.43 (s, 2H), 3.40- 3.33 (m, 4H), 3.15-2.97 (m, 4H), 2.82 (s,
3H), 1.70 (s, 6H); MS m/z: 543.4 [M + 1]. Compound 108 3-((3-(4-
acrylamidobenzamido) phenyl)amino)-N-(1- (dimethylamino)propan-2-
yl)-6,6-dimethyl-4,6- dihydropyrrolo[3,4- c]prazole-5(1H)-
carboxamide ##STR00235## .sup.1H NMR (TFA salt): 400 MHz
(DMSO-d.sub.6) .delta. 10.35 (s, 1H), 9.95 (s, 1H), 8.91 (s, 1H),
8.23 (s, 1H), 7.85 (d, J = 8.4 Hz, 2H), 7.72 (d, J = 8.4 Hz, 2H),
7.32 (s, 1H), 7.11-7.05 (m, 2H), 6.57 (m, 1H), 6.40 (dd, J = 16.8,
10.0 Hz, 1H), 6.23 (dd, J = 16.8, 2.0 Hz, 1H), 5.91 (d, J = 8.4 Hz,
1H), 5.74 (dd, J = 10.0, 2.0 Hz, 1H), 4.18 (s, 2H), 4.14-4.07 (m,
1H), 3.05-2.94 (m, 2H), 2.71 (d, J = 4.8 Hz, 3H), 2.69 (d, J = 4.8
Hz, 3H), 1.59 (s, 6H), 1.01 (d, J = 6.4 Hz, 3H), 0.85-0.76 (m, 1H);
MS m/z: 545.3 [M + 1]. Compound 109 (S,E)-3-((3-(4-(4-
(dimethylamino)but-2- enamido)benzamido)phenyl)
amino)-N-(2-hydroxy-1- phenylethyl)-6,6-dimethyl-
4,6-dihydropyrrolo[3,4- c]prazole-5(1H)- carboxamide ##STR00236##
.sup.1H NMR (TFA salt): 400 MHz (DMSO-d.sub.6) .delta. 10.68 (s,
1H), 10.13 (s, 1H), 10.01 (s, 1H), 8.43 (s, 1H), 8.03 (d, J = 8.8
Hz, 2H), 7.88 (d, J = 8.8 Hz, 2H), 7.54 (s, 1H), 7.41-7.39 (m, 2H),
7.34-7.30 (m, 2H), 7.27-7.22 (m, 3H), 6.92-6.82 (m, 2H), 6.58 (d, J
= 15.6 Hz, 1H), 6.13 (d, J = 8.0 Hz, 1H), 4.85 (q, J = 6.8 Hz, 1H),
4.48 (q, J = 11.2 Hz, 2H), 4.06 (d, J = 7.2 Hz, 2H), 3.63 (d, J =
6.4 Hz, 2H), 2.91 (s, 6H), 2.64 (t, J = 5.6 Hz, 1H), 1.73 (s, 3H),
1.67 (s, 3H); MS m/z: 637.3 [M + 1]. Compound 110 (S)-3-((3-
acrylamidophenyl)amino)- N-(2-(dimethylamino)-1-
phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]prazole-5(1H)-
carboxamide ##STR00237## .sup.1H NMR (TFA salt): 400 MHz
(DMSO-d.sub.6) .delta. 9.94 (s, 1H), 8.90 (s, 1H), 8.24 (s, 1H),
7.35-7.27 (m, 4H), 7.24-7.22 (m, 2H), 7.08-7.02 (m, 2H), 6.56-6.52
(m, 2H), 6.38 (dd, J = 16.8, 10.0 Hz, 1H), 6.16 (dd, J = 16.8, 2.0
Hz, 1H), 5.67 (dd, J = 10.0, 2.0 Hz, 1H), 5.29-5.22 (m, 1H), 4.31
(q, J = 11.2 Hz, 2H), 3.39-3.34 (m, 1H), 3.28- 3.22 (m, 1H), 2.80
(d, J = 4.8 Hz, 1H), 2.73 (d, J = 4.8 Hz, 1H), 1.59 (s, 3H), 1.53
(s, 3H); MS m/z: 488.3 [M + 1]. Compound 111 (S)-3-((4-
acrylamidophenyl)amino)- N-(2-(dimethylamino)-1-
phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4- c]prazole-5(1H)-
carboxamide ##STR00238## .sup.1H NMR (TFA salt): 400 MHz
(DMSO-d.sub.6) .delta. 9.86 (s, 1H), 8.91 (s, 1H), 8.13 (s, 1H),
7.49-7.43 (m, 2H), 7.40-7.27 (m, 5H), 7.22 (m, 1H), 6.82 (d, J =
9.2 Hz, 1H), 6.55 (d, J = 9.2 Hz, 1H), 6.34 (dd, J = 16.8, 10.0 Hz,
1H), 6.13 (dd, J = 16.8, 2.0 Hz, 1H), 5.62 (dd, J = 10.0, 2.0 Hz,
1H), 5.29-5.22 (m, 1H), 4.33 (d, J = 11.2 Hz, 1H), 4.19 (d, J =
11.2 Hz, 1H), 3.42-3.36 (m, 1H), 3.29-3.23 (m, 1H), 2.81 (d, J =
4.8 Hz, 1H), 2.74 (d, J = 4.8 Hz, 1H), 1.60 (s, 3H), 1.51 (s, 3H);
MS m/z: 488.3 [M + 1].
Example 2.
(S)-3-(3-(4-acrylamidobenzamido)benzamido)-N-(2-(dimethylamino)-
-1-phenylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carbo-
xamide (Compound 112)
[0504] The synthesis of Compound 112 follows Synthetic Scheme 2.
The syntheses of Compounds 120, and 214 to 217 (presented in Table
3) follow a corresponding method.
##STR00239## ##STR00240##
5-(tert-Butyl) ethyl
6,6-dimethyl-3-(3-nitrobenzamido)-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-d-
icarboxylate
##STR00241##
[0506] To a solution of 5-(tert-butyl) ethyl
3-amino-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate
(100 mg, 0.31 mmol) and DIEA (79 mg, 0.11 mL, 0.62 mmol) in DCM (2
mL) was added 3-nitrobenzoyl chloride (87 mg, 0.47 mmol). The
reaction was stirred at room temperature for 2 h and concentrated.
The crude was purified by flash column chromatography on silica gel
(EtOAc/hexanes, 0-70%) to give 5-(tert-Butyl) ethyl
6,6-dimethyl-3-(3-nitrobenzamido)-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-d-
icarboxylate as a yellow solid (110 mg, 75%). LC/MS (ESI) m/z=474.4
(M+H).sup.+.
Compound 112.
(S)-3-(3-(4-acrylamidobenzamido)benzamido)-N-(2-(dimethylamino)-1-phenyle-
thyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamide
##STR00242##
[0508] Following the previously described synthetic procedure of
Compound 101 from 5-(tert-butyl) ethyl
6,6-dimethyl-3-(3-nitrobenzamido)-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-d-
icarboxylate,
(S)-3-(3-(4-acrylamidobenzamido)benzamido)-N-(2-(dimethylamino)-1-phenyle-
thyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamide
was obtained as a white solid. .sup.1H NMR (TFA salt): 400 MHz
(DMSO-d.sub.6) .delta. 10.97 (s, 1H), 10.53 (s, 1H), 10.40 (s, 1H),
9.04 (s, 1H), 8.62 (m, 1H), 8.04 (d, J=9.2 Hz, 2H), 7.89 (d, J=9.2
Hz, 2H), 7.83 (d, J=7.6 Hz, 1H), 7.57-7.44 (m, 4H), 7.36 (t, J=7.2
Hz, 1H), 6.83 (d, J=9.2 Hz, 1H), 6.54 (dd, J=17.2, 10.0 Hz, 1H),
6.37 (dd, J=17.2, 2.0 Hz, 1H), 5.88 (dd, J=10.0, 2.0 Hz, 1H),
5.43-5.37 (m, 1H), 4.86 (d, J=12.4 Hz, 1H), 4.64 (d, J=11.6 Hz,
1H), 2.95 (d, J=8.4 Hz, 3H), 2.90 (d, J=8.4 Hz, 3H), 1.74 (s, 3H),
1.66 (s, 3H); MS m/z: 635.3 [M+1].
TABLE-US-00004 TABLE 3 The following compounds were produced using
the corresponding starting compounds according to a method similar
to that described for the synthesis of Compound 112: Name Structure
Characterization Data Compound 120. (S)-3-(3-
acrylamidobenzamido)-N- (2-(dimethylamino)-1-
phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4-
c]pyrazole-5(1H)- carboxamide ##STR00243## .sup.1H NMR (TFA salt):
600 MHz (DMSO-d.sub.6) .delta. 10.77 (s, 1H), 10.19 (s, 1H), 8.86
(s, 1H), 8.32 (s, 1H), 7.60 (m, 1H), 7.54 (m, 1H), 7.28 (m, 4H),
7.15 (m, 1H), 6.62 (m, 1H), 6.31 (m, 1H), 6.14 (m, 1H), 5.64 (m,
1H), 5.19 (m, 1H), 4.64 (m, 1H), 4.42 (m, 1H), 3.41 (m, 1H), 3.19
(m, 1H), 2.73 (m, 3H), 2.69 (m, 3H), 1.53 (s, 3H), 1.44 (s, 3H); MS
m/z: 516.3 [M + 1]. Compound 214. (S)-3-(4- acrylamidobenzamido)-N-
(2-(dimethylamino)-1- phenylethyl)-6,6-dimethyl-
4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide ##STR00244##
.sup.1H NMR: 600 MHz (DMSO- d.sub.6) .delta. 10.80 (s, 1H), 10.43
(s, 1H), 8.98 (s, 1H), 7.99 (d, J = 8.8 Hz, 2H), 7.78 (d, J = 8.8
Hz, 2H), 7.71 (d, J = 7.6 Hz, 2H), 7.38 (t, J = 7.0 Hz, 2H), 7.28
(t, J = 7.0 Hz, 1H), 6.75 (d, J = 9.4 Hz, 1H), 6.45 (dd, J = 17.0,
10.0 Hz, 1H), 6.29 (dd, J = 16.4, 2.4 Hz, 1H), 5.80 (dd, J = 10.0,
1.8 Hz, 1H), 5.33 (m, 1H), 4.75 (d, J = 11.7 Hz, 1H), 4.53 (d, J =
11.7 Hz, 1H), 3.53 (m, 1H), 3.33 (m, 1H), 2.86 (d, J = 4.7 Hz, 3H),
2.82 (d, J = 5.3 Hz, 3H), 1.65 (d, 3H), 1.57 (s, 3H); MS m/z: 516.3
[M + 1]. Compound 215. (S)-N-(2-(dimethylamino)-1-
phenylethyl)-6,6-dimethyl-3- (4- propionamidobenzamido)-
4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide ##STR00245##
.sup.1H NMR: 600 MHz (DMSO- d.sub.6) .delta. 12.38 (s, 1H), 10.71
(s, 1H), 10.12 (s, 1H), 7.95 (m, 2H), 7.69 (m, 2H), 7.35 (d, J =
7.0 Hz, 2H), 7.28 (t, J = 7.6 Hz, 2H), 7.18 (d, J = 7.6 Hz, 1H),
6.25 (m, 1H), 4.87 (m, 1H), 4.52 (m, 2H), 2.68 (m, 1H), 2.41 (m,
1H), 2.34 (q, J = 7.6 Hz, 2H), 2.20 (m, 6H), 1.62 (m, 3H), 1.55 (s,
3H), 1.08 (t, J = 7.6 Hz, 1H); MS m/z: 518.3 [M + 1]. Compound 216.
(S)-3-(4-acrylamido-2- methoxybenzamido)-N-(2- (dimethylamino)-1-
phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4-
c]pyrazole-5(1H)- carboxamide ##STR00246## .sup.1H NMR (a mixture
of rotamers): 600 MHz (DMSO- d.sub.6) .delta. 12.41, 12.32 (s, 1H),
10.49, 10.45 (s, 1H), 10.29, 10.09 (s, 1H), 8.97 (br, 1H), 7.86 (m,
1H), 7.63 (m, 1H), 7.38 (m, 2H), 7.32 (m, 2H), 7.22 (m, 1H), 6.44
(dd, J = 17.0, 10.0 Hz, 1H), 6.30 (dd, J = 17.0, 1.2 Hz, 1H), 5.81
(d, J = 11.7 Hz, 1H), 5.05 (br, 1H), 4.63 (m, 1H), 4.57 (m, 1H),
3.95 (m, 3H), 2.70-2.20 (m, 6H), 1.64, 1.60 (s, 3H), 1.56, 1.52 (s,
3H); MS m/z: 546.3 [M + 1]. Compound 217. (S)-3-(4-acrylamido-3-
methoxybenzamido)-N-(2- (dimethylamino)-1-
phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4-
c]pyrazole-5(1H)- carboxamide ##STR00247## .sup.1H NMR: 600 MHz
(DMSO- d.sub.6) .delta. 12.44 (s, 1H), 10.87 (s, 1H), 9.55 (s, 1H),
8.26 (m, 1H), 7.72 (s, 1H), 7.65 (m, 1H), 7.38 (m, 2H), 7.32 (m,
2H), 7.23 (m, 1H), 6.76 (dd, J = 17.0, 10.0 Hz, 1H), 6.46 (br, 1H),
6.25 (dd, J = 17.0, 1.8 Hz, 1H), 5.75 (d, J = 10.0 Hz, 1H), 5.07
(br, 1H), 4.63 (m, 1H), 4.56 (m, 1H), 3.94 (s, 3H), 2.79-2.06 (m,
6H), 1.64 (s, 3H), 1.57 (s, 3H); MS m/z: 546.3 [M + 1].
Example 3.
3-(1-acryloylpiperidine-3-carboxamido)-N--((S)-2-(dimethylamino-
)-1-phenylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carb-
oxamide (Compounds 113 & 114)
[0509] The synthesis of Compounds 113 follows Synthetic Scheme 3.
The synthesis of Compounds 114, 123, 221, and 222 (presented in
Table 4) follows a corresponding method.
##STR00248##
5-(tert-Butyl) ethyl
(R)-3-(1-((benzyloxy)carbonyl)piperidine-3-carboxamido)-6,6-dimethyl-4,6--
dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate
##STR00249##
[0511] To a solution of 5-(tert-butyl) ethyl
3-amino-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate
(100 mg, 0.31 mmol),
(R)-1-((benzyloxy)carbonyl)piperidine-3-carboxylic acid (122 mg,
0.47 mmol), and DIEA (120 mg, 0.16 mL, 0.93 mmol) in DMF (2 mL) was
HATU (236 mg, 0.62 mmol). The mixture was stirred at room
temperature overnight and diluted with ethyl acetate and sat.
NaHCO.sub.3. The organic layer was washed with water and brine,
dried (Na.sub.2SO.sub.4), and concentrated. The crude was purified
by flash column chromatography on silica gel (EtOAc/hexanes, 0-70%)
to give 5-(tert-butyl) ethyl
(R)-3-(1-((benzyloxy)carbonyl)piperidine-3-carboxamido)-6,6-dimethyl-4,6--
dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate as a yellow solid
(65 mg, 37%). LC/MS (ESI) m/z=570.4 (M+H).sup.+.
Ethyl
3-((R)-1-((benzyloxy)carbonyl)piperidine-3-carboxamido)-5-(((S)-2-(d-
imethylamino)-1-phenylethyl)carbamoyl)-6,6-dimethyl-5,6-dihydropyrrolo[3,4-
-c]pyrazole-1(4H)-carboxylate
##STR00250##
[0513] To a solution of 5-(tert-butyl) ethyl
(R)-3-(1-((benzyloxy)carbonyl)piperidine-3-carboxamido)-6,6-dimethyl-4,6--
dihydropyrrolo[3,4-c]pyrazole-1,5-dicarboxylate (65 mg, 0.115 mmol)
in DCM (1 mL) was added TFA (1 mL). The reaction was stirred at
room temperature for 1 h and concentrated to give ethyl
(R)-3-(1-((benzyloxy)carbonyl)piperidine-3-carboxamido)-6,6-dimethyl-5,6--
dihydropyrrolo[3,4-c]pyrazole-1(4H)-carboxylate as a TFA salt,
which was used directly without further purification. LC/MS (ESI)
m/z=470.4 (M+H).sup.+.
[0514] To a mixture of
(R)-3-(1-((benzyloxy)carbonyl)piperidine-3-carboxamido)-6,6-dimethyl-5,6--
dihydropyrrolo[3,4-c]pyrazole-1(4H)-carboxylate (TFA salt, 0.115
mmol) in DCM (1 mL) was added DIEA (74 mg, 0.1 mL, 0.57 mmol) at
0.degree. C., followed by
(S)-2-isocyanato-N,N-dimethyl-2-phenylethan-1-amine HCl salt (31
mg, 0.14 mmol). The solution was stirred at 0.degree. C. for 1 h
and diluted with CHC.sub.3/i-PrOH (v/v 4:1) and washed with sat.
NaHCO.sub.3 and brine, dried (Na.sub.2SO.sub.4), and concentrated.
The crude was purified by flash column chromatography on silica gel
(1.75 M NH.sub.3 in MeOH/DCM, 0-10%) to give ethyl
3-((R)-1-((benzyloxy)carbonyl)piperidine-3-carboxamido)-5-(((S)-2-(dimeth-
ylamino)-1-phenylethyl)carbamoyl)-6,6-dimethyl-5,6-dihydropyrrolo[3,4-c]py-
razole-1(4H)-carboxylate as a yellow solid (53 mg, 70% over 2
steps). LC/MS (ESI) m/z=660.4 (M+H).sup.+.
N--((S)-2-(dimethylamino)-1-phenylethyl)-6,6-dimethyl-3-((R)-piperidine-3--
carboxamido)-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamide
##STR00251##
[0516] A mixture of ethyl
3-((R)-1-((benzyloxy)carbonyl)piperidine-3-carboxamido)-5-(((S)-2-(dimeth-
ylamino)-1-phenylethyl)carbamoyl)-6,6-dimethyl-5,6-dihydropyrrolo[3,4-c]py-
razole-1(4H)-carboxylate (53 mg, 0.081 mmol) and 10% Pd/C (10 mg)
in MeOH (5 mL) was degassed. The mixture was stirred under H.sub.2
(1 atm) at room temperature overnight. The reaction was filtered
through Celite.RTM. and concentrated to give
N--((S)-2-(dimethylamino)-1-phenylethyl)-6,6-dimethyl-3-((R)-piperidine-3-
-carboxamido)-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamide
as a clear wax (28 mg, 78%). LC/MS (ESI) m/z: 454.4
(M+H).sup.+.
Compound 113:
3-((R)-1-acryloylpiperidine-3-carboxamido)-N--((S)-2-(dimethylamino)-1-ph-
enylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamid-
e
##STR00252##
[0518] To a mixture of
N--((S)-2-(dimethylamino)-1-phenylethyl)-6,6-dimethyl-3-((R)-piperidine-3-
-carboxamido)-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamide
(20 mg, 0.044 mmol) in THF (1 mL) and sat. NaHCO.sub.3(1 mL) was
added acryloyl chloride (12 mg, 0.13 mmol) dropwise at 0.degree. C.
The mixture was stirred at 0.degree. C. for 10 min and diluted with
CHCl.sub.3/i-PrOH (v/v 4:1) and washed with sat. NaHCO.sub.3 and
brine, dried (Na.sub.2SO.sub.4), and concentrated. The crude was
dissolved in i-PrOH (1 mL) and LiOH (1 M, 1 mL) was added. After
stirred at room temperature for 10 min, the mixture was diluted
with CHC.sub.3/i-PrOH (v/v 4:1) and washed with sat. NaHCO.sub.3
and brine, dried (Na.sub.2SO.sub.4), and concentrated. The crude
was purified by reverse phase preparative HPLC (MeOH/H.sub.2O,
0-100%) to give
3-((R)-1-acryloylpiperidine-3-carboxamido)-N--((S)-2-(dimethylamino)-1-ph-
enylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamid-
e TFA salt as a white solid (11 mg, 42%). .sup.1H NMR (TFA salt):
600 MHz (DMSO-d.sub.6) .delta. 10.56 (d, J=19.8 Hz, 1H), 8.95 (s,
1H), 7.41-7.36 (m, 3H), 7.31-7.27 (m, 1H), 6.87-6.79 (m, 1H), 6.72
(d, J=9.0 Hz, 1H), 6.08 (d, J=16.2 Hz, 1H), 5.66 (d, J=10.2 Hz,
1H), 5.32 (m, 1H), 4.69 (m, 1H), 4.47 (m, 2H), 4.03 (m, 2H), 3.53
(t, J=12.0 Hz, 2H), 3.35-3.30 (m, 1H), 3.18-3.12 (m, 1H), 2.99 (t,
J=13.2 Hz, 1H), 2.85 (d, J=5.4 Hz, 3H), 2.82 (d, J=4.8 Hz, 3H),
2.70 (t, J=12.0 Hz, 1H), 1.95 (m, 1H), 1.73 (m, 1H), 1.62 (s, 3H),
1.53 (s, 3H), 1.33 (m, 1H); MS m/z: 508.3 [M+1].
Compound 114.
3-((S)-1-acryloylpiperidine-3-carboxamido)-N--((S)-2-(dimethylamino)-1-ph-
enylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamid-
e
##STR00253##
[0520]
3-((S)-1-Acryloylpiperidine-3-carboxamido)-N--((S)-2-(dimethylamino-
)-1-phenylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carb-
oxamide was prepared by using the corresponding starting compounds
according to a method similar to that described for Compound 113.
.sup.1H NMR (TFA salt): 400 MHz (DMSO-d.sub.6) .delta. 10.50 (d,
J=15.6 Hz, 1H), 8.90 (s, 1H), 7.37-7.31 (m, 4H), 7.25-7.21 (m, 1H),
6.82-6.72 (m, 1H), 6.66 (d, J=8.8 Hz, 1H), 6.03 (d, J=16.4 Hz, 1H),
5.61 (d, J=10.8 Hz, 1H), 5.27 (m, 1H), 4.62 (m, 1H), 4.43 (m, 2H),
4.07-3.96 (m, 2H), 3.13-3.05 (m, 2H), 2.94 (t, J=12.0 Hz, 1H), 2.81
(d, J=5.2 Hz, 3H), 2.77 (d, J=5.2 Hz, 3H), 2.69-2.57 (m, 1H), 1.89
(m, 1H), 1.67 (m, 1H), 1.57 (s, 3H), 1.49 (s, 3H), 1.29 (m, 1H); MS
m/z: 508.3 [M+1].
TABLE-US-00005 TABLE 4 The following compounds were produced using
the corresponding starting compounds according to a method similar
to that described for the synthesis of Compound 113: Name Structure
Characterization Data Compound 123. (S)-3-(1-acryloylpiperidine-
4-carboxamido)-N-(2- (dimethylamino)-1- phenylethyl)-6,6-dimethyl-
4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide ##STR00254##
.sup.1H NMR (TFA salt): 600 MHz (DMSO-d.sub.6) .delta. 10.45 (s,
1H), 8.93 (s, 1H), 7.35 (m, 3H), 7.25 (t, J = 7.0 Hz, 1H), 6.76
(dd, J = 16.4, 10.6 Hz, 1H), 6.67 (d, J = 9.4 Hz, 1H), 6.04 (dd, J
= 16.4, 2.4 Hz, 1H), 5.62 (dd, J = 10.6, 2.4 Hz, 1H), 5.28 (td, J =
12.3, 3.5 Hz, 1H), 4.64 (d, J = 11.7 Hz, 1H), 4.43 (d, J = 12.3 Hz,
1H), 4.39 (d, J = 12.3 Hz, 1H), 4.05 (d, J = 14.1 Hz, 1H), 3.49 (t,
J = 12.3 Hz, 1H), 3.29 (m, 1H), 3.04 (t, J = 12.9 Hz, 1H), 2.81 (d,
J = 4.7 Hz, 3H), 2.79 (d, J = 4.7 Hz, 3H), 2.82 (m, 2H), 1.77 (m,
2H), 1.58 (s, 3H), 1.50 (s, 3H), 1.42 (m, 2H); MS m/z: 508.3 [M +
1]. Compound 221. 3-((1s,4R)-4- acrylamidocyclohexane-1-
carboxamido)-N-((S)-2- (dimethylamino)-1-
phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4-
c]pyrazole-5(1H)- carboxamide ##STR00255## .sup.1H NMR: 600 MHz
(DMSO- d.sub.6) .delta. 12.26 (s, 1H), 10.27 (s, 1H), 7.92 (s, 1H),
7.37 (m, 2H), 7.32 (m, 2H), 7.23 (m, 1H), 6.32 (dd, J = 17.0, 10.6
Hz, 1H), 6.06 (dd, J = 17.0, 2.4 Hz, 1H), 5.54 (dd, J = 10.0, 2.4
Hz, 1H), 4.56 (m, 1H), 4.48 (m, 1H), 3.86 (m, 1H), 2.43 (m, 2H),
1.76 (m, 4H), 1.60 (s, 3H), 1.57 (m, 2H), 1.53 (s, 3H); MS m/z:
522.3 [M + 1]. Compound 222. 3-((1r,4S)-4- acrylamidocyclohexane-1-
carboxamido)-N-((S)-2- (dimethylamino)-1-
phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4-
c]pyrazole-5(1H)- carboxamide ##STR00256## .sup.1H NMR: 600 MHz
(DMSO- d.sub.6) .delta. 12.24 (s, 1H), 10.31 (s, 1H), 7.97 (d, J =
7.6 Hz, 1H), 7.36 (d, J = 7.0 Hz, 2H), 7.29 (t, J = 7.6 Hz, 2H),
7.20 (t, J = 7.6 Hz, 1H), 6.34 (m, 1H), 6.16 (dd, J = 17.2, 10.0
Hz, 1H), 6.05 (dd, J = 17.0, 2.4 Hz, 1H), 5.55 (dd, J = 10.0, 2.4
Hz, 1H), 4.94 (m, 1H), 4.48 (m, 2H), 3.55 (m, 1H), 2.32 (m, 6H),
1.84 (m, 4H), 1.59 (s, 3H), 1.51 (s, 3H), 1.48 (m, 2H), 1.21 (m,
2H); MS m/z: 522.3 [M + 1].
Example 4.
3-((1-(4-acrylamidobenzoyl)piperidin-3-yl)amino)-N--((S)-2-(dim-
ethylamino)-1-phenylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole--
5(1H)-carboxamide (Compound 115)
[0521] The synthesis of Compounds 115 follows Synthetic Scheme 4.
The syntheses of Compounds 116 to 119, and Compounds 228 to 232
(presented in Table 5) follow a corresponding method.
##STR00257##
tert-Butyl
6,6-dimethyl-3-((1-(4-nitrobenzoyl)piperidin-3-yl)amino)-4,6-dihydropyrro-
lo[3,4-c]pyrazole-5(1H)-carboxylate
##STR00258##
[0523] To a solution of tert-butyl
3-amino-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxylate
(50 mg, 0.20 mmol) in THF (1 mL) was added
1-(4-nitrobenzoyl)piperidin-3-one (49 mg, 0.20 mmol), followed by
AcOH (5 drops) and Na(OAc).sub.3BH (127 mg, 0.60 mmol). The mixture
was stirred at room temperature O/N and diluted with EtOAc and sat.
NaHCO.sub.3. The organic layer was washed with water and brine,
dried (Na.sub.2SO.sub.4), and concentrated. The crude was purified
by reverse phase preparative HPLC (MeOH/H.sub.2O, 0-100%) to give
tert-butyl
6,6-dimethyl-3-((1-(4-nitrobenzoyl)piperidin-3-yl)amino)-4,6-dihydropyrro-
lo[3,4-c]pyrazole-5(1H)-carboxylate as a TFA salt (48 mg, 40%).
LC/MS (ESI) m/z: 485.4 (M+H).sup.+.
1-Benzyl 5-(tert-butyl)
6,6-dimethyl-3-((1-(4-nitrobenzoyl)piperidin-3-yl)amino)-4,6-dihydropyrro-
lo[3,4-c]pyrazole-1,5-dicarboxylate
##STR00259##
[0525] To a solution of tert-butyl
6,6-dimethyl-3-((1-(4-nitrobenzoyl)piperidin-3-yl)amino)-4,6-dihydropyrro-
lo[3,4-c]pyrazole-5(1H)-carboxylate TFA salt (48 mg, 0.08 mmol) in
THF (2 mL) was added DIEA (31 mg, 42 .mu.L, 0.24 mmol) at 0.degree.
C. Benzyl chloroformate (14 mg, 0.08 mmol) was added dropwise and
stirred at 0.degree. C. for 1 h. The reaction was diluted with
EtOAc and sat. NaHCO.sub.3. The organic layer was washed with water
and brine, dried (Na.sub.2SO.sub.4), and concentrated. The crude
was purified by flash column chromatography on silica gel
(EtOAc/hexanes, 0-70%) to give 1-benzyl 5-(tert-butyl)
6,6-dimethyl-3-((1-(4-nitrobenzoyl)piperidin-3-yl)amino)-4,6-dihydropyrro-
lo[3,4-c]pyrazole-1,5-dicarboxylate as a yellow solid (28 mg, 56%).
LC/MS (ESI) m/z: 619.4 (M+H).sup.+.
Benzyl
5-(((S)-2-(dimethylamino)-1-phenylethyl)carbamoyl)-6,6-dimethyl-3-(-
(1-(4-nitrobenzoyl)piperidin-3-yl)amino)-5,6-dihydropyrrolo[3,4-c]pyrazole-
-1(4H)-carboxylate
##STR00260##
[0527] To a solution of 1-benzyl 5-(tert-butyl)
6,6-dimethyl-3-((1-(4-nitrobenzoyl)piperidin-3-yl)amino)-4,6-dihydropyrro-
lo[3,4-c]pyrazole-1,5-dicarboxylate (28 mg, 0.045 mmol) in DCM (1
mL) was added TFA (1 mL). The reaction was stirred at room
temperature for 1 h and concentrated to give benzyl
6,6-dimethyl-3-((1-(4-nitrobenzoyl)piperidin-3-yl)amino)-5,6-dihydropyrro-
lo[3,4-c]pyrazole-1(4H)-carboxylate as a TFA salt, which was used
directly without further purification. LC/MS (ESI) m/z=519.4
(M+H).sup.+.
[0528] To a mixture of benzyl
6,6-dimethyl-3-((1-(4-nitrobenzoyl)piperidin-3-yl)amino)-5,6-dihydropyrro-
lo[3,4-c]pyrazole-1(4H)-carboxylate (TFA salt, 0.045 mmol) in DCM
(1 mL) was added DIEA (29 mg, 39 .mu.L, 0.22 mmol) at 0.degree. C.,
followed by (S)-2-isocyanato-N,N-dimethyl-2-phenylethan-1-amine HCl
salt (12 mg, 0.054 mmol). The solution was stirred at 0.degree. C.
for 1 h and diluted with CHC.sub.3/i-PrOH (v/v 4:1) and washed with
sat. NaHCO.sub.3 and brine, dried (Na.sub.2SO.sub.4), and
concentrated. The crude was purified by flash column chromatography
on silica gel (1.75 M NH.sub.3 in MeOH/DCM, 0-10%) to give benzyl
5-(((S)-2-(dimethylamino)-1-phenylethyl)carbamoyl)-6,6-dimethyl-3-((1-(4--
nitrobenzoyl)piperidin-3-yl)amino)-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-
-carboxylate (24 mg, 77% over 2 steps). LC/MS (ESI) m/z=709.4
(M+H).sup.+.
3-((1-(4-Aminobenzoyl)piperidin-3-yl)amino)-N--((S)-2-(dimethylamino)-1-ph-
enylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamid-
e
##STR00261##
[0530] A mixture of benzyl
5-(((S)-2-(dimethylamino)-1-phenylethyl)carbamoyl)-6,6-dimethyl-3-((1-(4--
nitrobenzoyl)piperidin-3-yl)amino)-5,6-dihydropyrrolo[3,4-c]pyrazole-1(4H)-
-carboxylate (24 mg, 0.034 mmol) and 10% Pd/C (5 mg) in MeOH (5 mL)
was degassed. The mixture was stirred under H.sub.2 (1 atm) at room
temperature for 6 h. The reaction was filtered through Celite.RTM.
and concentrated to give
3-((1-(4-aminobenzoyl)piperidin-3-yl)amino)-N--((S)-2-(dimethylamino)-1-p-
henylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxami-
de as a clear wax (18 mg, 70%). LC/MS (ESI) m/z: 545.4
(M+H).sup.+.
Compound 115.
3-((1-(4-acrylamidobenzoyl)piperidin-3-yl)amino)-N--((S)-2-(dimethylamino-
)-1-phenylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carb-
oxamide
##STR00262##
[0532] To a mixture of
3-((1-(4-aminobenzoyl)piperidin-3-yl)amino)-N--((S)-2-(dimethylamino)-1-p-
henylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxami-
de (18 mg, 0.033 mmol) in THF (1 mL) and sat. NaHCO.sub.3(1 mL) was
added acryloyl chloride (9.0 mg, 0.099 mmol) dropwise at 0.degree.
C. The mixture was stirred at 0.degree. C. for 10 min and diluted
with CHCl.sub.3/i-PrOH (v/v 4:1) and washed with sat. NaHCO.sub.3
and brine, dried (Na.sub.2SO.sub.4), and concentrated. The crude
was dissolved in i-PrOH (1 mL) and LiGH (1 M, 1 mL) was added.
After stirred at room temperature for 10 min, the mixture was
diluted with CHCl.sub.3/i-PrOH (v/v 4:1) and washed with sat.
NaHCO.sub.3 and brine, dried (Na.sub.2SO.sub.4), and concentrated.
The crude was purified by reverse phase preparative HPLC
(MeOH/H.sub.2O, 0-100%) to give
3-((1-(4-acrylamidobenzoyl)piperidin-3-yl)amino)-N--((S)-2-(dimethylamino-
)-1-phenylethyl)-6,6-dimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carb-
oxamide TFA salt as a white solid (10.5 mg, 45%). .sup.1H NMR (TFA
salt): 600 MHz (DMSO-d.sub.6) .delta. 10.29 (s, 1H), 9.10 (s, 1H),
7.72-7.55 (m, 1H), 7.49-7.26 (m, 7H), 6.73-6.61 (m, 1H), 6.49-6.40
(m, 1H), 6.27-6.24 (m, 1H), 5.77-5.75 (m, 1H), 5.36-5.26 (m, 1H),
4.55-4.50 (m, 1H), 4.30-4.24 (m, 2H), 3.55-3.45 (m, 3H), 3.38-3.32
(m, 2H), 3.28-3.07 (m, 2H), 2.88 (m, 3H), 2.85 (m, 1H), 2.82 (m,
3H), 2.00-1.90 (m, 1H), 1.85-1.70 (m, 1H), 1.65-1.50 (m, 6H),
1.09-1.03 (m, 1H); MS m/z: 599.4 [M+1].
TABLE-US-00006 TABLE 5 The following compounds were produced using
the corresponding starting compounds according to a method similar
to that described for the synthesis of Compound 115: Name Structure
Characterization Data Compound 116 (S)-3-((1-(4- acrylamidobenzoyl)
piperidin-4-yl)amino)- N-(2-(dimethylamino)-1-
phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4-
c]pyrazole-5(1H)- carboxamide ##STR00263## .sup.1H NMR: 600 MHz
(DMSO- d.sub.6) .delta. 11.30 (br, 1H), 10.30 (s, 1H), 7.71 (d, J =
9.0 Hz, 2H), 7.36-7.33 (m, 4H), 7.28 (t, J = 7.8 Hz, 2H), 7.18 (t,
J = 7.8 Hz, 1H), 6.43 (dd, J = 16.8, 10.2 Hz, 1H), 6.27 (dd, J =
16.8, 2.2 Hz, 1H), 5.95 (d, J = 6.0 Hz, 1H), 5.77 (dd, J = 10.2,
2.2 Hz, 1H), 5.33-5.20 (m, 1H), 4.82 (q, J = 7.2 Hz, 1H), 4.26 (q,
J = 12.0 Hz, 2H), 3.72-3.58 (m, 1H), 3.16-3.03 (m, 2H), 2.60 (m,
1H), 2.42 (m, 1H), 2.19 (s, 6H), 1.89 (m, 2H), 1.54 (s, 3H), 1.48
(s, 3H), 1.36 (m, 2H); MS m/z: 599.4 [M + 1]. Compound 117
3-(((1R,3S)-3-(4- acrylamidobenzamido) cyclohexyl)amino)-N-((S)-
2-(dimethylamino)-1- phenylethyl)-6,6-dimethyl-
4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide ##STR00264##
.sup.1H NMR (TFA salt): 600 MHz (DMSO-d.sub.6) .delta. 10.35 (d, J
= 3.0 Hz, 1H), 9.11 (s, 1H), 8.09 (d, J = 7.8 Hz, 1H), 7.80 (dd, J
= 9.0, 2.0 Hz, 2H), 7.71 (dd, J = 9.0, 1.8 Hz, 2H), 7.46-7.42 (m,
2H), 7.39-7.35 (m, 2H), 7.30- 7.28 (m, 1H), 6.68 (t, J = 7.8 Hz,
1H), 6.44 (dd, J = 16.8, 10.2 Hz, 1H), 6.27 (dd, J = 16.8, 2.2 Hz,
1H), 5.78 (dd, J = 10.2, 2.2 Hz, 1H), 5.34-5.30 (m, 1H), 4.52 (t, J
= 12.0 Hz, 1H), 4.38 (dd, J = 13.2, 12.0 Hz, 2H), 4.17-4.10 (m,
1H), 3.67 (m, 2H), 3.48 (t, J = 12.0 Hz, 2H), 3.37-3.33 (m, 2H),
2.88 (m, 3H), 2.82 (m, 3H), 1.89-1.80 (m, 2H), 1.71-1.60 (m, 3H),
1.62 (s, 3H), 1.55 (s, 3H), 1.36 (m, 2H); MS m/z: 613.4 [M + 1].
Compound 118 3-(((1R,3R)-3-(4- acrylamidobenzamido)
cyclohexyl)amino)-N-((S)- 2-(dimethylamino)-1-
phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4-
c]pyrazole-5(1H)- carboxamide ##STR00265## .sup.1H NMR: 600 MHz
(DMSO- d.sub.6) .delta. 11.22 (br, 1H), 10.32 (s, 1H), 8.19 (dd, J
= 7.8, 3.0 Hz, 1H), 7.81 (dd, J = 8.4, 3.0 Hz, 2H), 7.70 (dd, J =
8.4, 5.4 Hz, 2H), 7.35 (d, J = 7.8 Hz, 2H), 7.30-7.26 (m, 2H),
7.20-7.16 (m, 1H), 6.43 (dd, J = 16.8, 10.2 Hz, 1H), 6.27 (dd, J =
16.8, 2.2 Hz, 1H), 6.01 (m, 1H), 5.77 (dd, J = 10.2, 2.2 Hz, 1H),
5.25-5.17 (m, 1H), 4.89- 4.82 (m, 1H), 4.36-4.27 (m, 2H), 3.90-3.83
(m, 1H), 3.08- 3.01 (m, 1H), 2.68-2.60 (m, 1H), 2.50-2.42 (m, 1H),
2.21 (s, 3H), 2.19 (s, 3H), 2.13-2.08 (m, 1H), 1.92-1.86 (m, 1H),
1.85-1.79 (m, 1H), 1.78-1.73 (m, 1H), 1.54 (s, 3H), 1.48 (d, J =
5.4 Hz, 3H), 1.42-1.35 (m, 1H), 1.28-1.19 (m, 2H), 1.11- 1.03 (m,
1H); MS m/z: 613.4 [M + 1]. Compound 119 (S)-3-((4-(4-
acrylamidobenzamido) cyclohexyl)amino)-N-2- (dimethylamino)-1-
phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4-
c]pyrazole-5(1H)- carboxamide ##STR00266## .sup.1H NMR: 600 MHz
(DMSO- d.sub.6) .delta. 11.30 (br, 1H), 10.32 (s, 1H), 8.11 (d, J =
7.8 Hz, 1H), 7.80 (d, J = 8.4 Hz, 2H), 7.71 (d, J = 8.4 Hz, 2H),
7.37 (m, 2H), 7.32 (m, 2H), 7.22 (m, 1H), 6.43 (dd, J = 16.8, 10.2
Hz, 1H), 6.27 (d, J = 16.8 Hz, 1H), 6.13 (m, 1H), 5.78 (d, J =
10.2, Hz, 1H), 5.13-4.94 (m, 2H), 4.35-4.26 (m, 2H), 3.75- 3.49 (m,
1H), 3.47 (t, J = 5.4 Hz, 1H), 3.40 (t, J = 5.4 Hz, 1H), 3.07-2.97
(m, 2H), 2.50- 2.32 (m, 4H), 1.98 (d, J = 10.8 Hz, 3H), 1.87 (d, J
= 10.2 Hz, 3H), 1.77-1.70 (m, 1H), 1.67- 1.60 (m, 1H), 1.56 (s,
3H), 1.49 (s, 3H), 1.47-1.38 (m, 2H), 1.37-1.33 (m, 1H), 1.29-1.17
(m, 4H), 1.15 (t, J = 7.2 Hz, 1H), 0.85-0.76 (m, 1H); MS m/z: 613.4
[M + 1]. Compound 228. 3-(((1R,3S)-3- acrylamidocyclohexyl)
amino)-N-((S)- 2-(dimethylamino)-1- phenylethyl)-6,6-dimethyl-
4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide ##STR00267##
.sup.1H NMR: 600 MHz (DMSO- d.sub.6) .delta. 11.24 (br, 1H), 9.01
(br, 1H), 8.07 (m, 1H), 7.40 (m, 2H), 7.35 (m, 2H), 7.26 (m, 1H),
6.52 (br, 1H), 6.17 (ddd, J = 17.0, 10.0, 1.2 Hz, 1H), 6.05 (ddd, J
= 17.0, 7.0, 1.8 Hz, 1H), 5.55 (ddd, J = 10.0, 7.6, 2.4 Hz, 1H),
5.20 (m, 1H), 4.42 (m, 1H), 4.31 (m, 1H), 3.69 (m, 1H), 2.98 (m,
1H), 2.76 (m, 6H), 2.03 (m, 1H), 1.87 (m, 1H), 1.76 (m, 2H), 1.56
(s, 3H), 1.48 (s, 3H), 1.32 (m, 1H), 1.08 (m, 2H); MS m/z: 494.4 [M
+ 1]. Compound 229. 3-(((1R,3R)-3- acrylamidocyclohexyl)
amino)-N-((S)- 2-(dimethylamino)-1- phenylethyl)-6,6-dimethyl-
4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide ##STR00268##
.sup.1H NMR: 600 MHz (DMSO- d.sub.6) .delta. 11.13 (br, 1H), 9.00
(br, 1H), 7.96 (m, 1H), 7.40 (t, J = 7.6 Hz, 2H), 7.36 (t, J = 7.0
Hz, 2H), 7.27 (t, J = 7.0 Hz, 1H), 6.52 (br, 1H), 6.25 (ddd, J =
17.0, 10.6, 7.0 Hz, 1H), 6.04 (ddd, J = 17.0, 3.5, 2.4 Hz, 1H),
5.53 (ddd, J = 10.0, 10.0, 2.4 Hz, 1H), 5.27 (m, 1H), 4.43 (m, 1H),
4.30 (t, J = 11.2 Hz, 1H), 4.01 (m, 1H), 3.50 (m, 1H), 2.78 (m,
6H), 1.74 (m, 2H), 1.61 (m, 1H), 1.57 (s, 3H), 1.52 (m, 3H), 1.48
(s, 3H), 1.22 (m, 2H); MS m/z: 494.4 [M + 1]. Compound 230.
(S)-3-((4- acrylamidocyclohexyl) amino)-N-(2- (dimethylamino)-1-
phenylethyl)-6,6-dimethyl- 4,6-dihydropyrrolo[3,4-
c]pyrazole-5(1H)- carboxamide ##STR00269## .sup.1H NMR (mixture of
diastereomers): 600 MHz (DMSO-d.sub.6) .delta. 11.28 (br, 1H), 9.04
(s, 1H), 7.94 (dd, J = 18.8, 7.6 Hz, 1H), 7.41 (d, J = 7.6 Hz, 2H),
7.36 (t, J = 7.0 Hz, 2H), 7.27 (t, J = 7.6 Hz, 1H), 6.58 (br, 1H),
6.28 (dd, J = 17.0, 10.6 Hz, 1H for one isomer), 6.20 (dd, J =
17.0, 10.0 Hz, 1H for another isomer), 6.05 (ddd, J = 17.0 4.7, 2.4
Hz, 1H), 5.54 (dd, J = 10.0, 2.4 Hz, 1H), 5.29 (br, 1H), 4.42 (dd,
J = 23.5, 10.0 Hz, 1H), 4.29 (dd, J = 27.0, 11.2 Hz, 1H), 3.72 (m,
1H), 3.55 (m, 1H), 3.20 (m, 1H), 2.97 (m, 1H), 2.81 (m, 6H), 1.94
(m, 1H), 1.83 (m, 1H), 1.61 (m, 2H), 1.57 (s, 3H), 1.49 (s, 3H for
one isomer), 1.48 (s, 3H for another isomer), 1.23 (m, 2H); MS m/z:
494.4 [M + 1]. Compound 231. (S)-3-((1- acryloylpiperidin-
4-yl)amino)-N-(2- (dimethylamino)-1- phenylethyl)-6,6-dimethyl-
4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide ##STR00270##
.sup.1H NMR: 600 MHz (DMSO- d.sub.6) .delta. 11.30 (br, 1H), 7.34
(d, J = 7.6 Hz, 2H), 7.29 (t, J = 7.0 Hz, 2H), 7.19 (t, J = 7.0 Hz,
1H), 6.81 (dd, J = 17.0, 10.6 Hz, 1H), 6.08 (dd, J = 17.0, 2.9 Hz,
1H), 5.98 (br, 1H), 5.65 (dd, J = 10.0, 2.4 Hz, 1H), 4.86 (m, 1H),
4.27 (m, 2H), 4.20 (d, J = 13.0 Hz, 1H), 3.95 (d, J = 13.5 Hz, 1H),
3.19 (t, J = 12.3 Hz, 1H), 2.91 (t, J = 11.2 Hz, 1H), 2.22 (m, 6H),
1.88 (m, 2H), 1.55 (s, 3H), 1.48 (s, 3H), 1.28 (m, 2H); MS m/z:
480.3 [M + 1]. Compound 232. 3-((1- acryloylpiperidin-
3-yl)amino)-N-((S)-2- (dimethylamino)-1- phenylethyl)-6,6-dimethyl-
4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)- carboxamide ##STR00271##
.sup.1H NMR: 600 MHz (DMSO- d.sub.6) .delta. 11.29 (br, 1H), 7.33
(m, 2H), 7.28 (m, 2H), 7.19 (m, 1H), 6.81 (m, 1H), 6.63 (dd, J =
16.4, 10.6 Hz, 1H), 6.10 (dd, J = 15.9, 5.9 Hz, 1H), 6.02 (d, J =
17.0 Hz, 1H), 5.96 (m, 1H), 5.66 (d, J = 9.4 Hz, 1H), 5.56 (dd, J =
18.8, 12.3 Hz, 1H), 5.31 (m, 1H), 4.84 (m, 1H), 4.36 (m, 1H), 4.25
(m, 2H), 4.01 (m, 1H), 3.86 (m, 2H), 3.19 (m, 1H), 3.06 (m, 1H),
2.64 (m, 2H), 2.20 (m, 6H), 1.95 (m, 1H), 1.73 (m, 1H), 1.55 (s,
3H), 1.48 (d, J = 5.9 Hz, 3H), 1.43 (m, 2H); MS m/z: 480.3 [M +
1].
Example 5.
(S)-3'-(4-acrylamidobenzamido)-N-(2-(dimethylamino)-1-phenyleth-
yl)-1',4'-dihydro-5'
H-spiro[cyclopropane-1,6'-pyrrolo[3,4-c]pyrazole]-5'-carboxamide
(Compound 233)
[0533] The synthesis of Compound 233 follows Synthetic Scheme 5.
The syntheses of Compounds 234-240 (presented in Table 6) follow a
corresponding method.
##STR00272##
TABLE-US-00007 TABLE 6 The following compounds were produced using
the corresponding starting compounds according to a method similar
to that described for the synthesis of Compound 233: Name Structure
Characterization Data Compound 233. (S)-3'-(4-
acrylamidobenzamido)-N- (2-(dimethylamino)-1-
phenylethyl)-1',4'-dihydro- 5'H-spiro[cyclopropane-
1,6'-pyrrolo[3,4-c]pyrazole]- 5'-carboxamide ##STR00273## .sup.1H
NMR: 600 MHz (DMSO- d.sub.6) .delta. 12.16 (br, 1H), 10.79 (s, 1H),
10.44 (s, 1H), 8.00 (m, 2H), 7.79 (m, 2H), 7.36 (m, 2H), 7.30 (m,
2H), 7.21 (m, 1H), 6.46 (dd, J = 17.0, 10.0 Hz, 1H), 6.29 (dd, J =
17.0, 1.8 Hz, 1H), 5.80 (dd, J = 10.0, 1.8 Hz, 1H), 4.89 (m, 1H),
4.70 (m, 2H), 2.27 (m, 6H), 2.05 (m, 1H), 1.99 (m, 1H), 0.82 (m,
4H); MS m/z: 514.3 [M + 1]. Compound 234. (R)-3-(4-
acrylamidobenzamido)-N- ((S)-2-(dimethylamino)-1-
phenylethyl)-6-isopropyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)-
carboxamide ##STR00274## .sup.1H NMR: 600 MHz (DMSO- d.sub.6)
.delta. 12.42 (br, 1H), 10.77 (s, 1H), 10.45 (s, 1H), 8.00 (d, J =
8.2 Hz, 2H), 7.79 (d, J = 8.2 Hz, 2H), 7.38 (m, 2H), 7.32 (m, 2H),
7.22 (m, 1H), 6.60 (br, 1H), 6.47 (dd, J = 17.0, 10.0 Hz, 1H), 6.29
(dd, J = 17.0, 2.4 Hz, 1H), 5.79 (dd, J = 10.6, 1.8 Hz, 1H), 4.83
(m, 1H), 4.54 (m, 2H), 2.33 (m, 6H), 0.98 (d, J = 5.3 Hz, 3H), 0.84
(m, 1H), 0.49 (d, J = 6.5 Hz, 3H); MS m/z: 530.3 [M + 1]. Compound
235. (S)-3-(4- acrylamidobenzamido)-N- ((S)-2-(dimethylamino)-1-
phenylethyl)-6-isopropyl- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)-
carboxamide ##STR00275## .sup.1H NMR: 600 MHz (DMSO- d.sub.6)
.delta. 12.40 (br, 1H), 10.76 (s, 1H), 10.44 (s, 1H), 8.00 (d, J =
7.6 Hz, 2H), 7.78 (d, J = 7.6 Hz, 2H), 7.35 (m, 2H), 7.30 (m, 2H),
7.20 (m, 1H), 6.56 (br, 1H), 6.47 (dd. J = 17.0, 10.0 Hz, 1H), 6.29
(dd, J = 17.0, 1.8 Hz, 1H), 5.80 (dd, J = 10.0, 1.8 Hz, 1H), 4.97
(m, 1H), 4.79 (m, 1H), 4.53 (m, 2H), 2.37 (m, 6H), 1.00 (m, 3H),
0.84 (m, 1H), 0.55 (d, J = 7.0 Hz, 3H); MS m/z: 530.3 [M + 1].
Compound 236. (S)-3'-(4- acrylamidobenzamido)-N-
(2-(dimethylamino)-1- phenylethyl)-1',4'-dihydro-5'H-
spiro[cyclohexane-1,6'- pyrrolo[3,4-c]pyrazole]-5'- carboxamide
##STR00276## .sup.1H NMR: 500 MHz (DMSO-d.sub.6) .delta. 12.40 (br,
1H), 10.83 (s, 1H), 10.48 (s, 1H), 8.06 (d, J = 8.5 Hz, 2H), 7.86
(d, J = 8.5 Hz, 2H), 7.42 (d, J = 7.3 Hz, 2H), 7.35 (t, J = 7.3 Hz,
2H), 7.25 (t, J = 7.3 Hz, 1H), 6.53 (dd, J = 17.0, 10.0 Hz, 1H),
6.37 (dd, J = 17.0, 1.8 Hz, 1H), 6.27 (m, 1H), 5.88 (dd, J = 10.0,
1.8 Hz, 1H), 4.92 (m, 1H), 4.59 (m, 2H), 2.87 (m, 1H), 2.74 (m,
2H), 2.46 (m, 1H), 2.25 (s, 6H), 1.69 (m, 4H), 1.53 (m, 2H), 1.42
(m, 2H), 1.29 (s, 6H), 1.21 (m, 2H), 0.91 (m, 2H); MS m/z: 556.3 [M
+ 1]. Compound 237. (R)-3-(4- acrylamidobenzamido)-N-
((S)-2-(dimethylamino)-1- phenylethyl)-6-phenyl-4,6-
dihydropyrrolo[3,4-c]pyrazole- 5(1H)-carboxamide ##STR00277##
.sup.1H NMR (a mixture of two rotamers): 500 MHz (DMSO-d.sub.6)
.delta. 12.33, 12.14 (s, 1H), 10.84, 10.73 (s, 1H), 10.35 (s, 1H),
7.95 (m, 2H), 7.73 (m, 2H), 7.23 (m, 9H), 7.10 (t, J = 7.3 Hz, 1H),
6.40 (dd, J = 17.1, 10.1 Hz, 1H), 6.24 (dd, J = 16.8, 1.8 Hz, 1H),
5.93 (m, 1H), 5.74 (dd, J = 10.1, 1.8 Hz, 1H), 4.73 (m, 1H), 4.61
(m, 2H), 2.21 (m, 1H), 1.99 (m, 6H); MS m/z: 564.3 [M + 1].
Compound 238. (R)-3-(4- acrylamidobenzamido)-N-
((S)-2-(dimethylamino)-1- phenylethyl)-6-phenyl-4,6-
dihydropyrrolo[3,4-c]pyrazole- 5(1H)-carboxamide ##STR00278##
.sup.1H NMR: 500 MHz (DMSO-d.sub.6) .delta. 12.33 (s, 1H), 10.75
(s, 1H), 10.35 (s, 1H), 7.95 (m, 2H), 7.73 (m, 2H), 7.21 (m, 10H),
6.40 (dd, J = 17.1, 10.0 Hz, 1H), 6.24 (dd, J = 17.1, 1.8 Hz, 1H),
5.87 (m, 1H), 5.75 (dd, J = 10.1, 1.8 Hz, 1H), 4.72 (m, 2H), 4.61
(m, 1H), 2.57 (m, 1H), 2.31 (m, 1H), 2.11 (s, 6H); MS m/z: 564.3 [M
+ 1]. Compound 239. (S)-3-(4- acrylamidobenzamido)-N-
((S)-2-(dimethylamino)-1- phenylethyl)-6-phenyl-4,6-
dihydropyrrolo[3,4-c]pyrazole- 5(1H)-carboxamide ##STR00279##
.sup.1H NMR (a mixture of two rotamers): 500 MHz (DMSO-d.sub.6)
.delta. 12.34, 12.10 (s, 1H), 10.74 (s, 1H), 10.35 (s, 1H), 7.95
(m, 2H), 7.73 (m, 2H), 7.20 (m, 10H), 6.40 (dd, J = 17.1, 10.1 Hz,
1H), 6.24 (dd, J = 17.1, 1.8 Hz, 1H), 5.93 (m, 1H), 5.74 (dd, J =
10.1, 1.8 Hz, 1H), 4.73 (m, 1H), 4.61 (m, 2H), 2.23 (m, 1H), 2.00
(m, 6H); MS m/z: 564.3 [M + 1]. Compound 240. (S)-3-(4-
acrylamidobenzamido)-N- ((S)-2-(dimethylamino)-1-
phenylethyl)-6-phenyl-4,6- dihydropyrrolo[3,4-c]pyrazole-
5(1H)-carboxamide ##STR00280## .sup.1H NMR: 500 MHz (DMSO-d.sub.6)
.delta. 12.37 (s, 1H), 10.77 (s, 1H), 10.42 (s, 1H), 7.96 (m, 2H),
7.75 (m, 2H), 7.20 (m, 10H), 6.43 (dd, J = 17.1, 10.1 Hz, 1H), 6.24
(dd, J = 17.1, 1.8 Hz, 1H), 5.90 (m, 1H), 5.75 (dd, J = 10.1, 1.8
Hz, 1H), 4.42 (m, 6H), 1.19 (m, 1H); MS m/z: 564.3 [M + 1].
[0534] The synthesis of Compound 241 follows Synthetic Scheme 6.
The syntheses of Compounds 242-247 (presented in Table 7) follow a
corresponding method.
##STR00281##
t-Butyl
6,6-dimethyl-3-(3-nitrobenzamido)-4,6-dihydropyrrolo[3,4-c]pyrazo-
le-5(1H)-carboxylate
##STR00282##
[0536] To a solution of 5-(tert-butyl) ethyl
6,6-dimethyl-3-((3-nitrophenyl)amino)-4,6-dihydropyrrolo[3,4-c]pyrazole-1-
,5-dicarboxylate (500 mg, 1.05 mmol) in i-PrOH (5 mL) was added 1 M
NaOH aqueous solution (5 mL). The mixture was stirred at rt for 30
min and extracted with CHCl.sub.3/i-PrOH (v:v 4:1). The crude was
purified by flash column chromatography on silica gel (1.75 M
NH.sub.3 in MeOH/DCM, 0-15%) to give t-butyl
6,6-dimethyl-3-(3-nitrobenzamido)-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-
-carboxylate as a yellow solid (394 mg, 93%). LC/MS (ESI) m/z:
402.4 (M+H).sup.+.
t-Butyl
1,6,6-trimethyl-3-(3-nitrobenzamido)-4,6-dihydropyrrolo[3,4-c]pyra-
zole-5(1H)-carboxylate
##STR00283##
[0538] A solution of t-butyl
6,6-dimethyl-3-(3-nitrobenzamido)-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-
-carboxylate (394 mg, 0.98 mmol) and methyl iodide (697 mg, 0.31
mL, 4.91 mmol) in THF (5 mL) was stirred at 80.degree. C.
overnight. The mixture was cooled and extracted with EtOAc and
washed with sat. NaHCO.sub.3 and brine. The crude was purified by
reverse phase preparative HPLC (MeOH/H.sub.2O, 0-100%) to give
t-butyl
1,6,6-trimethyl-3-(3-nitrobenzamido)-4,6-dihydropyrrolo[3,4-c]pyrazole-5(-
1H)-carboxylate (123 mg, 30%) and t-butyl
2,6,6-trimethyl-3-(3-nitrobenzamido)-2,6-dihydropyrrolo[3,4-c]pyrazole-5(-
4H)-carboxylate (108 mg, 26%) as white solids. LC/MS (ESI) m/z:
416.4 (M+H).sup.+.
Example 41.
(S)-3-(3-acrylamidobenzamido)-N-(2-(dimethylamino)-1-phenylethyl)-1,6,6-t-
rimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamide
##STR00284##
[0540] Following the previous described procedure starting with
t-butyl
1,6,6-trimethyl-3-(3-nitrobenzamido)-4,6-dihydropyrrolo[3,4-c]pyrazole-5(-
1H)-carboxylate,
(S)-3-(3-acrylamidobenzamido)-N-(2-(dimethylamino)-1-phenylethyl)-1,6,6-t-
rimethyl-4,6-dihydropyrrolo[3,4-c]pyrazole-5(1H)-carboxamide was
obtained as a white solid. .sup.1H NMR: 500 MHz (DMSO-d.sub.6)
.delta. 10.70 (s, 1H), 10.34 (s, 1H), 7.94 (d, J=8.9 Hz, 2H), 7.71
(d, J=8.9 Hz, 2H), 7.31 (d, J=7.3 Hz, 2H), 7.23 (t, J=7.6 Hz, 2H),
7.13 (t, J=7.3 Hz, 1H), 6.40 (dd, J=17.1, 10.1 Hz, 1H), 6.24 (dd,
J=17.1, 1.8 Hz, 1H), 6.21 (m, 1H), 5.74 (dd, J=10.1, 1.8 Hz, 1H),
4.81 (q, J=7.3 Hz, 1H), 4.45 (dd, J=15.9, 11.9 Hz, 1H), 3.65 (s,
3H), 2.60 (m, 1H), 2.33 (m, 1H), 2.13 (s, 6H), 1.64 (s, 3H), 1.56
(s, 3H); MS m/z: 530.3 [M+1].
TABLE-US-00008 TABLE 7 The following compounds were produced using
the corresponding starting compounds according to a method similar
to that described for the synthesis of Compound 241: Name Structure
Characterization Data Compound 242. (S)-3-(4-
acrylamidobenzamido)-N- (2-(dimethylamino)-1- phenylethyl)-2,6,6-
trimethyl-2,6- dihydropyrrolo[3,4- c]pyrazole-5(4H)- carboxamide
##STR00285## .sup.1H NMR: 500 MHz (DMSO- d.sub.6) .delta. 10.40 (s,
1H), 10.22 (s, 1H), 7.93 (d, J = 8.9 Hz, 2H), 7.77 (d, J = 8.9 Hz,
2H), 7.28 (d, J = 7.3 Hz, 2H), 7.22 (t, J = 7.6 Hz, 2H), 7.12 (t, J
= 7.3 Hz, 1H), 6.41 (dd, J = 17.1, 10.1 Hz, 1H), 6.24 (dd, J =
17.1, 1.8 Hz, 1H), 6.14 (d, J = 7.3 Hz, 1H), 5.75 (dd, J = 10.1,
1.8 Hz, 1H), 4.81 (q, J = 7.9 Hz, 1H), 4.34 (dd, J = 15.3, 12.5 Hz,
1H), 3.67 (s, 3H), 2.57 (m, 1H), 2.30 (m, 1H), 2.12 (s, 6H), 1.53
(s, 3H), 1.46 (s, 3H); MS m/z: 530.3 [M + 1]. Compound 243.
(S)-3-(4-acrylamido-2- methoxybenzamido)-N- (2-(dimethylamino)-1-
phenylethyl)-1,6,6- trimethyl-4,6- dihydropyrrolo[3,4-
c]pyrazole-5(1H)- carboxamide ##STR00286## .sup.1H NMR: 500 MHz
(DMSO- d.sub.6) .delta. 10.40 (s, 1H), 10.01 (s, 1H), 7.79 (d, J =
8.5 Hz, 1H), 7.58 (dd, J = 1.5 Hz, 1H), 7.32 (m, 2H), 7.25 (t, J =
7.3 Hz, 2H), 7.16 (t, J = 7.3 Hz, 1H), 6.40 (dd, J = 17.1, 10.1 Hz,
1H), 6.37 (br, 1H), 6.25 (dd, J = 16.8, 1.8 Hz, 1H), 5.76 (dd, J =
10.1, 1.8 Hz, 1H), 4.92 (m, 1H), 4.49 (m, 2H), 3.89 (s, 3H), 3.64
(s, 3H), 2.30 (m, 6H), 1.64 (s, 3H), 1.57 (s, 3H); MS m/z: 560.3 [M
+ 1]. Compound 244. (S)-3-(4-acrylamido-2- methoxybenzamido)-N-
(2-(dimethylamino)-1- phenylethyl)-2,6,6- trimethyl-2,6-
dihydropyrrolo[3,4- c]pyrazole-5(4H)- carboxamide ##STR00287##
.sup.1H NMR: 500 MHz (DMSO- d.sub.6) .delta. 10.52 (s, 1H), 10.01
(s, 1H), 7.79 (d, J = 8.5 Hz, 1H), 7.65 (dd, J = 1.8 Hz, 1H), 7.31
(d, J = 8.5 Hz, 2H), 7.24 (t, J = 7.6 Hz, 2H), 7.14 (t, J = 7.3 Hz,
1H), 6.43 (dd, J = 16.8, 10.1 Hz, 1H), 6.25 (br, 1H), 6.25 (dd, J =
16.8, 1.8 Hz, 1H), 5.76 (dd, J = 10.1, 1.8 Hz, 1H), 4.89 (m, 1H),
4.41 (m, 2H), 3.90 (d, 3H), 3.67 (s, 3H), 2.23 (m, 6H), 1.54 (s,
3H), 1.46 (s, 3H); MS m/z: 560.3 [M + 1]. Compound 245. 3-(4-
acrylamidobenzamido)- N-(1- (dimethylamino)propan-2-
yl)-1,6,6-trimethyl-4,6- dihydropyrrolo[3,4- c]pyrazole-5(1H)-
carboxamide ##STR00288## .sup.1H NMR: 500 MHz (DMSO- d.sub.6)
.delta. 10.68 (s, 1H), 10.33 (s, 1H), 7.93 (d, J = 8.9 Hz, 2H),
7.71 (d, J = 8.9 Hz, 2H), 6.39 (dd, J = 17.1, 10.1 Hz, 1H), 6.23
(dd, J = 17.1, 10.1 Hz, 1H), 5.74 (dd, J = 10.1, 1.8 Hz, 1H), 5.64
(d, J = 7.9 Hz, 1H), 4.33 (dd, J = 21.7, 11.9 Hz, 2H), 3.74 (m,
1H), 3.66 (s, 3H), 2.20 (dd, J = 11.9, 7.0 Hz, 1H), 2.10 (m, 1H),
2.08 (s, 6H), 1.64 (s, 6H), 1.00 (d, J = 6.4 Hz, 3H); MS m/z: 530.3
[M + 1]. Compound 246. (S)-2-(dimethylamino)-1- phenylethyl 3-(4-
acrylamidobenzamido)- 1,6,6-trimethyl-4,6- dihydropyrrolo[3,4-
c]pyrazole-5(1H)- carboxylate ##STR00289## .sup.1H NMR (a mixture
of two rotamers): 500 MHz (DMSO- d.sub.6) .delta. 10.74, 10.70 (s,
1H), 10.33, 10.32 (s, 1H), 7.93 (m, 2H), 7.69 (m, 2H), 7.32 (m,
4H), 7.23 (m, 1H), 6.39 (m, 1H), 6.23 (m, 1H), 5.75 (m, 1H), 4.56
(dd, J = 15.3, 13.4 Hz, 2H), 4.40, 4.31 (d, J = 13.4 Hz, 1H), 3.68,
3.67 (s, 3H), 2.73 (m, 1H), 2.45 (m, 1H), 2.17, 2.15 (s, 6H), 1.73,
1.55 (s, 3H), 1.64 (s, 3H); MS m/z: 531.3 [M + 1]. Compound 247.
(S)-N-(2-(dimethylamino)- 1-phenylethyl)-1,6,6- trimethyl-3-(4-
propionamidobenzamido)- 4,6-dihydropyrrolo[3,4- c]pyrazole-5(1H)-
carboxamide ##STR00290## .sup.1H NMR: 500 MHz (DMSO- d.sub.6)
.delta. 10.79 (s, 1H), 10.18 (s, 1H), 8.03 (d, J = 8.9 Hz, 2H),
7.76 (d, J = 8.9 Hz, 2H), 7.43 (d, J = 7.3 Hz, 2H), 7.35 (t, J =
7.3 Hz, 2H), 7.25 (t, J = 7.3 Hz, 1H), 6.34 (d, J = 7.3 Hz, 1H),
4.93 (q, J = 7.9 Hz, 1H), 4.56 (dd, J = 16.5, 11.9 Hz, 2H), 3.78
(s, 3H), 2.72 (m, 1H), 2.45 (m, 1H), 2.42 (q, J = 7.6 Hz, 2H), 2.25
(s, 6H), 1.77 (s, 3H), 1.69 (s, 3H), 1.16 (t, J = 7.3 Hz, 3H); MS
m/z: 532.4 [M + 1].
Biological Assays of the Compounds
Example 5. Inhibition of Kinase Activity
[0541] Compounds of the invention were assayed for activity against
a variety of different kinases. Exemplary results are presented as
calculated IC.sub.50 values (Table A1 & A2). In Table A1 and A2
"A" represents a calculated IC.sub.50 value of less than 100 nM;
"B" represents a calculated IC.sub.50 value of greater than or
equal to 100 nM and less than 1 .mu.M; and "C" represents a
calculated IC.sub.50 value of 1 .mu.M or greater. The co-factors
used for each kinase in the assays were as follows: CDK7: cyclin H
and MNAT1; CDK2: cyclin A; CDK9: cyclin K.
TABLE-US-00009 TABLE A1 Calculated IC.sub.50 values of exemplary
compounds of the invention against CDK7. Compound No. CDK7
IC.sub.50 101 A 102 A 103 A 104 A 105 A 106 B 107 A 108 A 109 A 110
A 111 B 112 A 113 A 114 A 115 A 116 A 117 A 118 A 119 A 120 A 123 A
214 A 215 A 216 A 217 A 222 A 231 A 232 A 233 A 234 A 235 C 236 B
237 C 238 C 239 C 240 C 241 A 242 C 243 C 244 C 245 C 246 B
TABLE-US-00010 TABLE A2 Calculated IC.sub.50 values of exemplary
compounds of the invention against various kinases. Compound No.
Kinase 101 106 CDK2 C CDK9 C CHEK2 A FGR A HIPK4 B PRKCQ A RET A
SRC A MELK B B
Example 6. Inhibition of Cell Proliferation
[0542] Exemplary compounds of the invention were tested at
different concentrations. Cells were plated in 96-well plates at
the following seeding densities: Jurkat T-cell acute lymphoblastic
leukemia 25,000 cells/well; HCT116 colorectal carcinoma 8,000
cells/well; Kelly neuroblastoma 4,000 cells/well. The cells were
treated with various concentration of compounds (ranging from 1 nM
to 10 .mu.M). DMSO solvent with no compound served as a control.
Following incubation for 72 hours, cell survival following
treatment with exemplary compounds described herein was assessed by
CellTiter-Glo.RTM. Luminescent cell viability assay (Promega).
IC.sub.50 values were determined using GRAPHPAD PRISM 6 software.
Exemplary results are shown in Table A3, wherein "A" represents a
calculated IC.sub.50 value of less than 500 nM; "B" represents a
calculated IC.sub.50 value of greater than or equal to 500 nM and
less than 5000 .mu.M; and "C" represents a calculated IC.sub.50
value of 5000 .mu.M or greater
TABLE-US-00011 TABLE A3 Calculated IC.sub.50 values of exemplary
compounds of the invention against cancer cells. Jurkat T-cell
acute Compound lymphoblastic HCT116 colorectal Kelly No. leukemia
carcinoma neuroblastoma 101 A A B 102 C 104 B B 106 C 107 B 112
B
Example 7. Labeling of CDK7 with an Inhibitor
[0543] CAK complex (Millipore cat #14-476) in 40 mM Hepes pH 7.4,
150 mM NaCl, 5% glycerol and 1 mM DTT with protease and phosphatase
inhibitors was incubated with a 10-fold molar excess of Compound
101 for 6 hrs at 37.degree. C. Proteins were resolved by SDS-PAGE,
bands corresponding to CDK7 were digested in-gel with trypsin, and
peptides analyzed by nano LC-MS using an Orbitrap XL mass
spectrometer (ThermoFisher Scientific, San Jose, Calif.).
Efficiency of labeling was estimated from the reduction in signal
of the Cys312 containing peptide YFSNRPGPTPGCQLPRPNCPVETLK compared
to DMSO control. Signals from CDK7 peptides VPFLPGDSDLDQLTR and
LDFLGEGQFATVYK were used for normalization. See FIG. 1 for the
total ion chromatograms (TIC) and extracted ion chromatograms (EIC)
of the CDK7 peptides treated with DMSO (A-D) or Compound 101 (E-H).
The labeled peptide was detected by mass spectrometry, as shown in
the spectrum of FIG. 2. The signal at m/z 687.7498 corresponds to
YFSNRPGPTPGCQLPRPNCPVETLK, labeled with Compound 101 at Cys312.
EQUIVALENTS AND SCOPE
[0544] In the claims articles such as "a," "an," and "the" may mean
one or more than one unless indicated to the contrary or otherwise
evident from the context. Claims or descriptions that include "or"
between one or more members of a group are considered satisfied if
one, more than one, or all of the group members are present in,
employed in, or otherwise relevant to a given product or process
unless indicated to the contrary or otherwise evident from the
context. The invention includes embodiments in which exactly one
member of the group is present in, employed in, or otherwise
relevant to a given product or process. The invention includes
embodiments in which more than one, or all of the group members are
present in, employed in, or otherwise relevant to a given product
or process.
[0545] Furthermore, the invention encompasses all variations,
combinations, and permutations in which one or more limitations,
elements, clauses, and descriptive terms from one or more of the
listed claims is introduced into another claim. For example, any
claim that is dependent on another claim can be modified to include
one or more limitations found in any other claim that is dependent
on the same base claim. Where elements are presented as lists,
e.g., in Markush group format, each subgroup of the elements is
also disclosed, and any element(s) can be removed from the group.
It should it be understood that, in general, where the invention,
or aspects of the invention, is/are referred to as comprising
particular elements and/or features, certain embodiments of the
invention or aspects of the invention consist, or consist
essentially of, such elements and/or features. For purposes of
simplicity, those embodiments have not been specifically set forth
in haec verba herein. It is also noted that the terms "comprising"
and "containing" are intended to be open and permits the inclusion
of additional elements or steps. Where ranges are given, endpoints
are included. Furthermore, unless otherwise indicated or otherwise
evident from the context and understanding of one of ordinary skill
in the art, values that are expressed as ranges can assume any
specific value or sub-range within the stated ranges in different
embodiments of the invention, to the tenth of the unit of the lower
limit of the range, unless the context clearly dictates
otherwise.
[0546] This application refers to various issued patents, published
patent applications, journal articles, and other publications, all
of which are incorporated herein by reference. If there is a
conflict between any of the incorporated references and the instant
specification, the specification shall control. In addition, any
particular embodiment of the present invention that falls within
the prior art may be explicitly excluded from any one or more of
the claims. Because such embodiments are deemed to be known to one
of ordinary skill in the art, they may be excluded even if the
exclusion is not set forth explicitly herein. Any particular
embodiment of the invention can be excluded from any claim, for any
reason, whether or not related to the existence of prior art.
[0547] Those skilled in the art will recognize or be able to
ascertain using no more than routine experimentation many
equivalents to the specific embodiments described herein. The scope
of the present embodiments described herein is not intended to be
limited to the above Description, but rather is as set forth in the
appended claims. Those of ordinary skill in the art will appreciate
that various changes and modifications to this description may be
made without departing from the spirit or scope of the present
invention, as defined in the following claims.
Sequence CWU 1
1
4115PRTArtificial SequenceSynthetic 1Val Pro Phe Leu Pro Gly Asp
Ser Asp Leu Asp Gln Leu Thr Arg1 5 10 15214PRTArtificial
SequenceSynthetic 2Leu Asp Phe Leu Gly Glu Gly Gln Phe Ala Thr Val
Tyr Lys1 5 10325PRTArtificial SequenceSynthetic 3Tyr Phe Ser Asn
Arg Pro Gly Pro Thr Pro Gly Cys Gln Leu Pro Arg1 5 10 15Pro Asn Cys
Pro Val Glu Thr Leu Lys 20 254346PRTHomo sapiens 4Met Ala Leu Asp
Val Lys Ser Arg Ala Lys Arg Tyr Glu Lys Leu Asp1 5 10 15Phe Leu Gly
Glu Gly Gln Phe Ala Thr Val Tyr Lys Ala Arg Asp Lys 20 25 30Asn Thr
Asn Gln Ile Val Ala Ile Lys Lys Ile Lys Leu Gly His Arg 35 40 45Ser
Glu Ala Lys Asp Gly Ile Asn Arg Thr Ala Leu Arg Glu Ile Lys 50 55
60Leu Leu Gln Glu Leu Ser His Pro Asn Ile Ile Gly Leu Leu Asp Ala65
70 75 80Phe Gly His Lys Ser Asn Ile Ser Leu Val Phe Asp Phe Met Glu
Thr 85 90 95Asp Leu Glu Val Ile Ile Lys Asp Asn Ser Leu Val Leu Thr
Pro Ser 100 105 110His Ile Lys Ala Tyr Met Leu Met Thr Leu Gln Gly
Leu Glu Tyr Leu 115 120 125His Gln His Trp Ile Leu His Arg Asp Leu
Lys Pro Asn Asn Leu Leu 130 135 140Leu Asp Glu Asn Gly Val Leu Lys
Leu Ala Asp Phe Gly Leu Ala Lys145 150 155 160Ser Phe Gly Ser Pro
Asn Arg Ala Tyr Thr His Gln Val Val Thr Arg 165 170 175Trp Tyr Arg
Ala Pro Glu Leu Leu Phe Gly Ala Arg Met Tyr Gly Val 180 185 190Gly
Val Asp Met Trp Ala Val Gly Cys Ile Leu Ala Glu Leu Leu Leu 195 200
205Arg Val Pro Phe Leu Pro Gly Asp Ser Asp Leu Asp Gln Leu Thr Arg
210 215 220Ile Phe Glu Thr Leu Gly Thr Pro Thr Glu Glu Gln Trp Pro
Asp Met225 230 235 240Cys Ser Leu Pro Asp Tyr Val Thr Phe Lys Ser
Phe Pro Gly Ile Pro 245 250 255Leu His His Ile Phe Ser Ala Ala Gly
Asp Asp Leu Leu Asp Leu Ile 260 265 270Gln Gly Leu Phe Leu Phe Asn
Pro Cys Ala Arg Ile Thr Ala Thr Gln 275 280 285Ala Leu Lys Met Lys
Tyr Phe Ser Asn Arg Pro Gly Pro Thr Pro Gly 290 295 300Cys Gln Leu
Pro Arg Pro Asn Cys Pro Val Glu Thr Leu Lys Glu Gln305 310 315
320Ser Asn Pro Ala Leu Ala Ile Lys Arg Lys Arg Thr Glu Ala Leu Glu
325 330 335Gln Gly Gly Leu Pro Lys Lys Leu Ile Phe 340 345
* * * * *