U.S. patent application number 17/208286 was filed with the patent office on 2022-01-13 for dna polymerase mutants having enhanced template discrimination activity.
The applicant listed for this patent is Integrated DNA Technologies, Inc.. Invention is credited to Mark Aaron Behlke, Joseph R. Dobosy, Richard Owczarzy, Scott D. Rose, Susan M. Rupp, Joseph A. Walder.
Application Number | 20220010346 17/208286 |
Document ID | / |
Family ID | |
Filed Date | 2022-01-13 |
United States Patent
Application |
20220010346 |
Kind Code |
A1 |
Behlke; Mark Aaron ; et
al. |
January 13, 2022 |
DNA POLYMERASE MUTANTS HAVING ENHANCED TEMPLATE DISCRIMINATION
ACTIVITY
Abstract
This invention relates to mutant Taq DNA polymerase having an
enhanced template discrimination activity compared with an
unmodified Taq DNA polymerase of SEQ ID NO.:1, wherein the amino
acid sequence of the mutant Taq DNA polymerase consists of
substitutions at residue positions 783, 784, or a combination of
783 and 784 of the unmodified Taq DNA polymerase of SEQ ID
NO.:1.
Inventors: |
Behlke; Mark Aaron;
(Coralville, IA) ; Walder; Joseph A.; (Chicago,
IL) ; Owczarzy; Richard; (Coralville, IA) ;
Rose; Scott D.; (Coralville, IA) ; Dobosy; Joseph
R.; (Coralville, IA) ; Rupp; Susan M.;
(Marion, IA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Integrated DNA Technologies, Inc. |
Coralville |
IA |
US |
|
|
Appl. No.: |
17/208286 |
Filed: |
March 22, 2021 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15386631 |
Dec 21, 2016 |
10982247 |
|
|
17208286 |
|
|
|
|
14542539 |
Nov 14, 2014 |
|
|
|
15386631 |
|
|
|
|
61904335 |
Nov 14, 2013 |
|
|
|
International
Class: |
C12P 19/34 20060101
C12P019/34; C12N 9/12 20060101 C12N009/12 |
Claims
1. A mutant Taq DNA polymerase having an enhanced template
discrimination activity compared with an unmodified Taq DNA
polymerase of SEQ ID NO.:1, wherein the amino acid sequence of the
mutant Taq DNA polymerase consists of substitutions at residue
positions 783, 784, or a combination of 783 and 784 of the
unmodified Taq DNA polymerase of SEQ ID NO.:1.
2. The mutant Taq DNA polymerase of claim 1, wherein the enhanced
template discrimination activity comprises at least one property
selected from the group consisting of enhanced 3'-mismatch
discrimination and enhanced 3'-nucleotide discrimination.
3. The mutant Taq DNA polymerase of claim 1, further comprising
polymerase activity at least comparable to about 0.01-fold the
polymerase activity of unmodified Taq DNA polymerase.
4. The mutant Taq DNA polymerase of claim 1, wherein the enhanced
template discrimination activity comprises enhanced 3'-mismatch
discrimination, wherein an average .DELTA..DELTA.Cq is at least
about 1.0 when the mutant Taq DNA polymerase is evaluated for
enhanced 3'-mismatch discrimination by allele-specific PCR
assay.
5. The mutant Taq DNA polymerase of claim 1, wherein the enhanced
template discrimination activity comprises enhanced 3'-nucleotide
discrimination, wherein an average .DELTA..DELTA.Cq is at least
about 1.0 when the mutant Taq DNA polymerase is evaluated for
enhanced 3'-nucleotide discrimination by quantitative PCR.
6. The mutant Taq DNA polymerase of claim 1, wherein the enhanced
template discrimination activity comprises enhanced 3'-mismatch
discrimination by rhPCR, wherein an average .DELTA..DELTA.Cq is at
least about 1.0 when the mutant Taq DNA polymerase is evaluated for
enhanced 3'-mismatch discrimination by rhPCR with an RDDDDx
blocked-cleavable rhPCR primer.
7. The mutant Taq DNA polymerase of claim 1, wherein the enhanced
template discrimination activity comprises enhanced 3'-mismatch
discrimination by rhPCR, wherein an average .DELTA..DELTA.Cq is at
least about 0.50 when the mutant Taq DNA polymerase is evaluated
for enhanced 3'-mismatch discrimination by rhPCR with an RDxxD
blocked-cleavable rhPCR primer.
8. The mutant Taq DNA polymerase of claim 1, wherein the enhanced
template discrimination activity comprises enhanced 3'-mismatch
discrimination by rhPCR SNP discrimination assay, wherein an
average .DELTA..DELTA.Cq is at least about 1.0 when the mutant Taq
DNA polymerase is evaluated for enhanced 3'-mismatch discrimination
by rhPCR SNP discrimination assay of the SMAD7 gene NM_005904, C/T
SNP, rs4939827) with RDDDDx blocked-cleavable rhPCR primers
consisting of SEQ ID NOs:76 and 77.
9. The mutant Taq DNA polymerase of claim 1, wherein the enhanced
template discrimination activity comprises enhanced 3'-mismatch
discrimination by rhPCR SNP discrimination assay, wherein an
average .DELTA..DELTA.Cq is at least about 1.0 when the mutant Taq
DNA polymerase is evaluated for enhanced 3'-mismatch discrimination
by rhPCR SNP discrimination assay of the SMAD7 gene NM_005904, C/T
SNP, rs4939827) with RDxxD blocked-cleavable rhPCR primers
consisting of SEQ ID NOs:78 and 79.
10. The mutant Taq DNA polymerase of claim 1, wherein the enhanced
template discrimination activity comprises enhanced 3'-mismatch
discrimination by rhPCR SNP discrimination assay, wherein an
average .DELTA..DELTA.Cq is at least about 5.0 when the mutant Taq
DNA polymerase is evaluated for enhanced 3'-mismatch discrimination
by rhPCR SNP discrimination assay of the SMAD7 gene NM_005904, C/T
SNP, rs4939827) with RDxxD blocked-cleavable rhPCR primers
consisting of SEQ ID NOs:78 and 79.
11. The mutant Taq DNA polymerase of claim 1, wherein the enhanced
template discrimination activity comprises enhanced rare allele
discrimination, wherein the enhanced rare allele discrimination is
at least 1:10,000 when the mutant Taq DNA polymerase is evaluated
by rhPCR SNP discrimination assay of the SMAD7 gene NM_005904, C/T
SNP, rs4939827) having a .DELTA.Cq of at least 3.0 with RDxxD
blocked-cleavable rhPCR primers consisting of SEQ ID NOs:78 and
79.
12. A mutant Taq DNA polymerase having an enhanced template
discrimination activity compared with an unmodified Taq DNA
polymerase, wherein the amino acid sequence of the mutant Taq DNA
polymerase is selected from the group of the following selected
substitutions: V783F, H784Q, or a combination of V783L and
H784Q.
13. The mutant Taq DNA polymerase of claim 12, wherein the mutant
Taq DNA polymerase has at least 80% sequence identity to one of SEQ
ID NOS: 83, 85, 87 or 89.
14. The mutant Taq DNA polymerase of claim 12, wherein the enhanced
template discrimination activity comprises at least one property
selected from the group consisting of enhanced 3'-mismatch
discrimination and enhanced 3'-nucleotide discrimination.
15. The mutant Taq DNA polymerase of claim 12, further comprising
polymerase activity at least comparable to about 0.02-fold the
polymerase activity of unmodified Taq DNA polymerase.
16. The mutant Taq DNA polymerase of claim 12, wherein the enhanced
template discrimination activity comprises enhanced 3'-mismatch
discrimination, wherein an average .DELTA..DELTA.Cq is at least
about 5.0 when the mutant Taq DNA polymerase is evaluated for
enhanced 3'-mismatch discrimination by allele-specific PCR
assay.
17. The mutant Taq DNA polymerase of claim 12, wherein the enhanced
template discrimination activity comprises enhanced 3'-nucleotide
discrimination, wherein an average .DELTA..DELTA.Cq is at least
about 3.0 when the mutant Taq DNA polymerase is evaluated for
enhanced 3'-nucleotide discrimination by quantitative PCR.
18. The mutant Taq DNA polymerase of claim 12, wherein the enhanced
template discrimination activity comprises enhanced 3'-mismatch
discrimination, wherein an average .DELTA..DELTA.Cq is at least
about 1.0 when the mutant Taq DNA polymerase is evaluated for
enhanced 3'-mismatch discrimination by rhPCR with an RDDDDx
blocked-cleavable rhPCR primer.
19. The mutant Taq DNA polymerase of claim 12, wherein the enhanced
template discrimination activity comprises enhanced 3'-mismatch
discrimination, wherein an average .DELTA..DELTA.Cq is at least
about 0.60 when the mutant Taq DNA polymerase is evaluated for
enhanced 3'-mismatch discrimination by rhPCR with an RDxxD
blocked-cleavable rhPCR primer.
20. The mutant Taq DNA polymerase of claim 12, wherein the enhanced
template discrimination activity comprises enhanced 3'-mismatch
discrimination by rhPCR SNP discrimination assay, wherein an
average .DELTA..DELTA.Cq is at least about 1.0 when the mutant Taq
DNA polymerase is evaluated for enhanced 3'-mismatch discrimination
by rhPCR SNP discrimination assay of the SMAD7 gene NM_005904, C/T
SNP, rs4939827) with RDDDDx blocked-cleavable rhPCR primers
consisting of SEQ ID NOs:76 and 77.
21. The mutant Taq DNA polymerase of claim 12, wherein the enhanced
template discrimination activity comprises enhanced 3'-mismatch
discrimination by rhPCR SNP discrimination assay, wherein an
.DELTA..DELTA.Cq is at least about 3.5 when the mutant Taq DNA
polymerase is evaluated for enhanced 3'-mismatch discrimination by
rhPCR SNP discrimination assay of the SMAD7 gene NM_005904, C/T
SNP, rs4939827) with RDxxD blocked-cleavable rhPCR primers
consisting of SEQ ID NOs:78 and 79.
22. The mutant Taq DNA polymerase of claim 12, wherein the enhanced
template discrimination activity comprises enhanced 3'-mismatch
discrimination by rhPCR SNP discrimination assay, wherein an
.DELTA..DELTA.Cq is at least about 15.0 when the mutant Taq DNA
polymerase is evaluated for enhanced 3'-mismatch discrimination by
rhPCR SNP discrimination assay of the SMAD7 gene NM_005904, C/T
SNP, rs4939827) with RDxxD blocked-cleavable rhPCR primers
consisting of SEQ ID NOs:78 and 79.
23. The mutant Taq DNA polymerase of claim 12, wherein the enhanced
template discrimination activity comprises enhanced rare allele
discrimination, wherein the enhanced rare allele discrimination is
at least 1:10,000 when the mutant Taq DNA polymerase is evaluated
by rhPCR SNP discrimination assay of the SMAD7 gene NM_005904, C/T
SNP, rs4939827) having a .DELTA.Cq of at least 3.0 with RDxxD
blocked-cleavable rhPCR primers consisting of SEQ ID NOs:78 and
79.
24. A kit for producing an extended primer, comprising: at least
one container providing a mutant DNA polymerase according to claim
1.
25. The kit according to claim 24, further comprising one or more
additional containers selected from the group consisting of: (a) a
container providing a primer hybridizable, under primer extension
conditions, to a predetermined polynucleotide template; (b) a
container providing nucleoside triphosphates; and (c) a container
providing a buffer suitable for primer extension.
26. The kit according to claim 24, further comprising one or more
additional containers selected from the group consisting of (a) a
container containing a blocked-cleavable primer and (b) a container
containing RNase H2.
27. A reaction mixture comprising a mutant DNA polymerase according
to claim 1, at least one primer, a polynucleotide template, and
nucleoside triphosphates.
28. The reaction mixture according to claim 27, wherein the at
least one primer comprises a blocked-cleavable primer.
29. The reaction mixture according to claim 27, further comprising
RNase H2.
30. A method for performing rhPCR, comprising performing primer
extension with a mutant DNA polymerase of claim 1.
31. A method for performing rhPCR, comprising performing primer
extension with a mutant Taq DNA polymerase of claim 12.
32. A mutant Taq DNA polymerase consisting of an amino acid
sequence selected from a group consisting of SEQ ID NO:83, SEQ ID
NO:85, SEQ ID NO:89, SEQ ID NO:147, SEQ ID NO:149, SEQ ID NO:155,
SEQ ID NO:151, SEQ ID NO:153, SEQ ID NO:157, SEQ ID NO:159, SEQ ID
NO:161, SEQ ID NO: 172, SEQ ID NO: 174, SEQ ID NO: 176, SEQ ID NO:
178, and SEQ ID NO: 180.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a divisional of U.S. patent application
Ser. No. 15/386,631, filed Dec. 21, 2016, which is a divisional of
U.S. patent application Ser. No. 14/542,539, filed Nov. 14, 2014,
which claims benefit of priority under 35 U.S.C. 119 to U.S.
provisional patent application Ser. No. 61/904,335, filed Nov. 14,
2013, and entitled "DNA POLYMERASE MUTANTS HAVING ENHANCED TEMPLATE
DISCRIMINATION ACTIVITY," the contents of which are herein
incorporated by reference in its entirety.
FIELD
[0002] This invention relates to mutant DNA polymerases having
enhanced primer and/or template discrimination activities and uses
of the same for polymerase-based assays for genetic diagnostic
analysis.
SEQUENCE LISTING
[0003] The instant application contains a Sequence Listing that has
been submitted in ASCII format via EFS-Web and is hereby
incorporated by reference in its entirety. The ASCII copy, created
on Sep. 29, 2021, is named IDT01-003-US-DIV2_ST25.txt, and is
362,522 bytes in size.
BACKGROUND
[0004] The ability to accurately diagnose a given genetic condition
and to predictably treat a genetically-based disorder requires
reliable methods for accurately determining genetic sequence
information. Many genetically-based disorders are associated with
single nucleotide polymorphisms (SNP's) in protein coding genes.
The presence of SNP's associated with a genetically-based disorder,
such as a cancer, can be difficult to detect owing to the small
numbers of genetically altered cells in the population that encode
the allele(s) ("rare alleles").
[0005] Polymerase-based assays, such as the polymerase chain
reaction (PCR), have important impact and widespread use in genetic
diagnostics and molecular medicine. Polymerases synthesize DNA
sequences by the addition of nucleotides to the 3' end of a short
oligonucleotide (abbreviated to "primer" in the following). The
primer is hybridized to the single stranded sequence that is going
to be amplified ("template"). DNA polymerases catalyze formation of
a phosphodiester bond between the 3'-oxygen at the 3'-terminus of
the primer and the incoming deoxynucleoside triphosphate ("dNTP").
This chemical reaction ("primer extension") adds a nucleotide to
the primer (e.g., to the nascent growing DNA chain). Primer
extension is base specific, in that the deoxynucleoside
triphosphate that is complementary to the base in the template is
added to the primer. The fidelity of DNA polymerase enzymes is very
high and the rate of mutations introduced into the replicated DNA
strand is low; however, the precise error rate varies between
different DNA polymerase enzymes and these rates have been well
characterized. The extension reaction can be repeated until the end
of the template is reached.
[0006] The majority of polymerase-based assays for detecting SNP's
rely upon having the polymerase enzyme discriminate between at
least two different substrates. The first substrate contains the
desired SNP that is to be detected; the second substrate contains
the normal nucleotide that is not to be detected. Polymerase-based
discrimination can be achieved by providing the first substrate as
the preferred polymerase-competent substrate for assay. This
discrimination can be maximized to the extent that the first
substrate is the only polymerase-competent substrate present for
assay.
[0007] Many strategies are known in the art for establishing
conditions that favor polymerase-based discrimination among
substrates having minimal nucleotide differences, such as those
containing only single nucleotide differences. One strategy relies
on a polymerase's inability to efficiently initiate synthesis on
substrates lacking a 3'-paired nucleotide on the primer. An
allele-specific primer design is a primer in which the
3'-nucleotide forms a perfect match with the complementary base at
the location containing the SNP-containing allele and forms a
mismatched pairing when annealed to an allele lacking the SNP. The
primer:template for the SNP-containing allele serves as the
preferred polymerase-competent substrate since the polymerase can
efficiently initiate primed synthesis from such substrates.
Examples of these strategies are described in Chen et al., "Single
nucleotide polymorphism genotyping: biochemistry, protocol, cost
and throughput" Pharmacogenomics J. 3(2):77-96 (2003); Kwok et al.,
"Detection of single nucleotide polymorphisms" Curr. Issues Mol.
Biol. 5(2):43-60 (April 2003); Shi, "Technologies for individual
genotyping: detection of genetic polymorphisms in drug targets and
disease genes" Am. J. Pharmacogenomics 2(3):197-205 (2002); and
Kwok, "Methods for genotyping single nucleotide polymorphisms"
Annu. Rev. Genomics Hum. Genet. 2:235-58 (2001). A strategy to
improve selectivity for this class of allele-specific PCR primers
is to introduce a second mutation at the penultimate base, next to
the 3'-terminal nucleotide of the primer (i.e., next to the SNP
site). As before, the 3'-terminal residue will either be a match or
mismatch to the base under interrogation in the sample nucleic acid
(SNP), but now the primer will either have two adjacent mismatches
to the target (both 3'-terminal and penultimate base) or a single
mismatch to the target (at only the penultimate base, with the
3'-terminal base being a match). See, for example, Newton et al.,
"Analysis of any point mutation in DNA. The amplification
refractory mutation systems (ARMS)" Nucleic Acids Res.
17(7):2503-15 (1989). Yet another strategy to improve selectivity
for this class of allele-specific PCR primers is to employ a
chemically modified nucleic acid residue at the 3'-end of the
primer, such as a locked nucleic acid (LNA), which reduces the
ability of DNA polymerase to initiate DNA synthesis from a
3'-terminal mismatch. See, for example, Latorra et al., "SNP
genotyping using 3' locked nucleic acid (LNA) primers" Human Mut.
22(1):79-85 (2003).
[0008] Template substrate discrimination can be enhanced in
polymerase-based assays by requiring a second nucleic acid enzyme
catalyze formation of one or more primers for use in the
polymerase-based assay. In one such assay, the ligase chain
reaction assay, a DNA ligase is used with a polymerase to detect a
template containing a SNP. Since polymerase-based assays require
primers having a minimum length to hybridize to the template
substrate, a DNA ligase can be used to generate polymerase primers
from sub-optimal length oligonucleotides. The assay relies upon
hybridizing two probes directly over the SNP polymorphic site,
whereby ligation can occur if the probes are identical to the
target DNA. Two probes are designed; an allele-specific probe which
hybridizes to the target DNA so that its 3' base is situated
directly over the SNP nucleotide and a second probe that hybridizes
the template downstream in the complementary strand of the SNP
polymorphic site providing a 5' end for the ligation reaction. If
the allele-specific probe matches the target DNA, it will fully
hybridize to the target DNA and ligation can occur. Ligation does
not generally occur in the presence of a mismatched 3'-base. Once
the oligonucleotide product is formed, it can serve as a primer or
as a template for polymerase-based assays. Examples of this
strategy are described in Barany F. "Genetic disease detection and
DNA amplification using cloned thermostable ligase." Proc Natl Acad
Sci USA. 1991 Jan. 1; 88(1):189-93 and Wiedmann M., Wilson W. J.,
Czajka J., Luo J., Barany F., Batt C. A. "Ligase chain reaction
(LCR)--overview and applications." PCR Methods and Applications
1994 Feb; 3(4):S51-64.
[0009] Since a polymerase-competent substrate requires a
primer:template having an available 3'-hydroxyl group on the
primer, another strategy known in the art, RNase H-based PCR
(rhPCR), can be used for improving polymerase-based discrimination.
The rhPCR method makes use of RNase H enzymes to convert a primer
lacking a 3'-hydroxyl group ("blocked primer") or a primer that is
otherwise disabled and cannot support PCR to a primer containing a
3'-hydroxyl group ("unblocked primer") that can support PCR. A
blocked primer in rhPCR includes an oligonucleotide having a
blocked 3'-end or other modification which prevents either priming
or template function of the oligonucleotide and an internal RNA
residue, which serves as a cleavage site. Type II RNase H
recognizes annealed primer:template duplexes containing these
blocked primers and cleaves the primer strand 5' of the RNA residue
to generate a 3'-hydroxyl group at the adjacent DNA residue. Since
RNase H enzymes do not cleave substrates containing an unpaired RNA
reside at a mismatched site, allele-specific template
discrimination can be achieved by placement of the RNA residue at
the location complementary to the SNP on the selected allele
template. The resultant Type II RNase H cleavage product can serve
as a polymerase competent substrate. Examples of this enzyme
cleaving strategy, similar RNase H strategies, and methods of
blocking primer extension or inhibiting template function and
thereby disabling PCR are described in U.S. Pat. No. 7,112,406 to
Behlke et al., entitled POLYNOMIAL AMPLIFICATION OF NUCLEIC ACIDS,
U.S. Pat. No. 5,763,181 to Han et al., entitled CONTINOUS
FLUOROMETRIC ASSAY FOR DETECTING NUCLEIC ACID CLEAVAGE, U.S. Pat.
No. 7,135,291 to Sagawa et al., entitled METHOD OF DETECTING
NUCLEOTIDE POLYMORPHISM; U.S. Pat. App. No. 20090068643 to Behlke
and Walder, entitled DUAL FUNCTION PRIMERS FOR AMPLIFYING DNA AND
METHODS OF USE; and U.S. Pat. App. No. 20100167353 to Walder et
al., entitled RNASE H-BASED ASSAYS UTILIZING MODIFIED RNA
MONOMERS.
[0010] The field has focused on substrate-based approaches, such as
those exemplified above, for improving detection of genetic
differences and rare alleles. Yet the sensitivity of
polymerase-based assays remains limited by the formation of
non-specific amplification products that arise from ectopic or
aberrant primer-related extension products independent of the
desired templates. The inherent reactivity of the polymerase
appears largely responsible for producing such artifacts during
amplification.
[0011] Any further improvements in mismatch discrimination may
therefore require a modified polymerase enzyme endowed with
inherently better 3'-nucleotide discrimination when used with one
or more of the described strategies. A modified polymerase enzyme
having activity differing from the unmodified form can be prepared
by chemical or enzymatic modification of the protein or mutagenesis
of corresponding gene that encodes the protein. The latter approach
is generally preferred owing to the fact that genetically altered
genes encoding a given mutant protein can be stably maintained,
expressed and purified to yield enzyme preparations having
well-characterized properties.
[0012] While an unbiased mutagenesis strategy can be used to
generate a library of mutant polymerase genes, this approach has
certain disadvantages. Many millions of mutant enzymes must be
screened for activity and success is often dependent upon the
chance that effective mutations are present in the limited pool
generated by random mutagenesis. Direct genetic selection methods
are not sufficiently sensitive for identifying mutations that
pertain to secondary functions falling outside of an essential
polymerase activity. The vast majority of mutant polymerase genes
in a positive selection assay will likely encode protein that
retains the functional attributes of the normal polymerase enzyme.
Thus, secondary screening procedures that use biochemical assays
must be done to identify whether any mutant polymerases have the
desired activity. Notwithstanding the technical difficulties of
setting up the initial selection process, the attendant costs
associated with performing the secondary screens using biochemical
assays is prohibitive if more than one hundred clones need to be
purified and assayed.
[0013] An alternative approach is to apply a biased mutagenesis
strategy that is specifically targeted to a preselected region of a
gene implicated in function. In this approach, one first identifies
genetic regions by a selection method. One such selection method is
a comparative phylogenetic analysis of a particular gene that is
required for organisms of diverse origins. The principle of
comparative phylogenetic analysis is premised on the hypothesis
that diverse organisms will not share protein coding sequences in
essential genes unless those sequences are evolutionary constrained
for reasons related to essential protein function.
[0014] A phylogenetic comparative analysis of genes encoding DNA
polymerases can provide insights about possible amino acid residues
important to polymerase functions. The overall folding pattern of
DNA polymerases resembles the human right hand and contains three
distinct subdomains of palm, fingers, and thumb. (See, for example.
Beese et al., Science 260:352-355, 1993; Patel et al., Biochemistry
34:5351-5363, 1995). While the structure of the fingers and thumb
subdomains vary greatly between polymerases that differ in size and
in cellular functions, the catalytic palm subdomains are all
superimposable. For example, motif A, which interacts with the
incoming dNTP and stabilizes the transition state during chemical
catalysis, is superimposable with a root mean deviation of about
one .ANG.ngstrom among mammalian pol .alpha. and prokaryotic pol I
family DNA polymerases (Wang et al., Cell 89:1087-1099, 1997).
Motif A begins structurally at an antiparallel .beta.-strand
containing predominantly hydrophobic residues and continues to an
.alpha.-helix. The primary amino acid sequence of DNA polymerase
active sites is exceptionally conserved.
[0015] In addition to being well-conserved, the active site of DNA
polymerases has also been shown to be relatively mutable, capable
of accommodating certain amino acid substitutions without reducing
DNA polymerase activity significantly. (See, e.g., U.S. Pat. No.
6,602,695). Such mutant DNA polymerases can offer various selective
advantages in, e.g., diagnostic and research applications
comprising nucleic acid synthesis reactions. We identify mutations
in protein sequence using the single-letter amino acid codes and an
integer number that indicates location of the mutation from the
beginning of the protein sequence. The single-letter amino acids
codes are well known in the art, e.g., Stryer et al., Biochemistry,
5.sup.th ed., Freeman and Company (2002). As an example, aspartic
acid ("D") is changed to glycine ("G") in D580G mutant and the
change is located 580 amino acids from the beginning of the protein
sequence.
[0016] Reichert et al. conducted a comparative phylogenetic
analysis of thermoactive DNA polymerases from thermophilic
bacteria, wherein the protein coding sequences of DNA Polymerase I
enzymes were aligned for thirteen phylogenetically distinct
species. The analysis revealed that eight amino acid positions
within a 15-amino acid long motif located at amino acid positions
645-685 (in reference to Thermus sp. Z05 DNA polymerase ("Z05 DNA
Polymerase") might tolerate alterations without compromising core
enzyme function.
[0017] Comparative phylogenetic analysis does not provide specific
functional information pertaining non-conserved amino acids, other
than to suggest that non-conserved amino acids are not likely
critical to core enzyme functions. For that reason, specific
mutations were introduced into a recombinant gene encoding a
variant of the Z05 DNA Polymerase ("Z05 D580G polymerase") and the
resultant Z05 D580G polymerase mutants were screened for their
ability to provide a reduced ability to extend an oligonucleotide
primer with a 3'-mismatch to a template. Reichert et al. found that
one such mutant, Z05 D580G V667E polymerase, displayed better
discrimination (.about.2-fold) than the parental Z05 D580G
polymerase. See U.S. Pat. App. No. 2012/0015405 to Reichert et al.,
entitled DNA POLYMERASES WITH INCREASED 3'-MISMATCH
DISCRIMINATION.
[0018] The comparative phylogenetic analysis has limitations with
respect to identifying DNA polymerase activities that display
improved 3'-nucleotide discrimination. This is due to the fact that
all DNA polymerases of a given enzyme class are confronted with
similar template substrates and nucleotide pools across the
spectrum of phylogenetically diverse organisms. Given the fact that
all DNA polymerases must display 3'-nucleotide mismatch
discrimination to preserve high fidelity replication of daughter
template strands, it is not surprising that one can apply
comparative phylogenetic analysis to identify possible amino acid
positions that might affect mismatch discrimination. For template
substrates having different 3'-end modifications that are presented
to a polymerase only in a biochemical assay, such as those used in
several PCR-based assays for rare allele detection, there is a need
for identifying DNA polymerases having improved 3'-nucleotide
discrimination.
[0019] Taq DNA Polymerase is an enzyme that was discovered in
Thermus aquaticus bacterium (Chien, A., et al., J Bacteriol. 1976,
127: 1550-1557). The enzyme is classified as deoxyribonucleic acid
polymerase, class I (enzyme code, EC 2.7.7.7). Its catalytic
activity is to amplify DNA sequences. The peptide and gene
sequences of Taq DNA polymerase enzyme isolated from nature are
well known in prior art and are listed in Table 1 (Lawyer, F. C.,
et al., J. Biol. Chem. 1989, 264: 6427-6437; Genbank database ID
J04639.1).
TABLE-US-00001 TABLE 1 DNA and amino acid sequence of native Taq
DNA polymerase. Type Sequence Protein
MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKED sequence
GDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGY (N to C
EADDVLASLAKKAEKEGYEVRILTADKDLYQLLSDRIHVLHPEGYLITPAWLWEKYGL
terminus)
RPDQWADYRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNLDRLKPAIREKI [SEQ ID
NO: 1] LAHMDDLKLSWDLAKVRTDLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLES
PKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEA
RGLLAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTEEAGERA
ALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVA
EETARLEAEVERLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKTGKRSTSAAVLEAL
REAHPIVEKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPN
LQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDI
HTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERY
FQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQ
GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP
LAVPLEVEVGIGEDWLSAKE DNA sequence aagctcagat ctacctgcct gagggcgtcc
ggttccagct ggcccttccc (5' to 3') gagggggaga gggaggcgtt tctaaaagcc
cttcaggacg ctacccgggg [SEQ ID NO: 2] gcgggtggtg gaagggtaac
atgaggggga tgctgcccct ctttgagccc aagggccggg tcctcctggt ggacggccac
cacctggcct accgcacctt ccacgccctg aagggcctca ccaccagccg gggggagccg
gtgcaggcgg tctacggctt cgccaagagc ctcctcaagg ccctcaagga ggacggggac
gcggtgatcg tggtctttga cgccaaggcc ccctccttcc gccacgaggc ctacgggggg
tacaaggcgg gccgggcccc cacgccggag gactttcccc ggcaactcgc cctcatcaag
gagctggtgg acctcctggg gctggcgcgc ctcgaggtcc cgggctacga ggcggacgac
gtcctggcca gcctggccaa gaaggcggaa aaggagggct acgaggtccg catcctcacc
gccgacaaag acctttacca gctcctttcc gaccgcatcc acgtcctcca ccccgagggg
tacctcatca ccccggcctg gctttgggaa aagtacggcc tgaggcccga ccagtgggcc
gactaccggg ccctgaccgg ggacgagtcc gacaaccttc ccggggtcaa gggcatcggg
gagaagacgg cgaggaagct tctggaggag tgggggagcc tggaagccct cctcaagaac
ctggaccggc tgaagcccgc catccgggag aagatcctgg cccacatgga cgatctgaag
ctctcctggg acctggccaa ggtgcgcacc gacctgcccc tggaggtgga cttcgccaaa
aggcgggagc ccgaccggga gaggcttagg gcctttctgg agaggcttga gtttggcagc
ctcctccacg agttcggcct tctggaaagc cccaaggccc tggaggaggc cccctggccc
ccgccggaag gggccttcgt gggctttgtg ctttcccgca aggagcccat gtgggccgat
cttctggccc tggccgccgc cagggggggc cgggtccacc gggcccccga gccttataaa
gccctcaggg acctgaagga ggcgcggggg cttctcgcca aagacctgag cgttctggcc
ctgagggaag gccttggcct cccgcccggc gacgacccca tgctcctcgc ctacctcctg
gacccttcca acaccacccc cgagggggtg gcccggcgct acggcgggga gtggacggag
gaggcggggg agcgggccgc cctttccgag aggctcttcg ccaacctgtg ggggaggctt
gagggggagg agaggctcct ttggctttac cgggaggtgg agaggcccct ttccgctgtc
ctggcccaca tggaggccac gggggtgcgc ctggacgtgg cctatctcag ggccttgtcc
ctggaggtgg ccgaggagat cgcccgcctc gaggccgagg tcttccgcct ggccggccac
cccttcaacc tcaactcccg ggaccagctg gaaagggtcc tctttgacga gctagggctt
cccgccatcg gcaagacgga gaagaccggc aagcgctcca ccagcgccgc cgtcctggag
gccctccgcg aggcccaccc catcgtggag aagatcctgc agtaccggga gctcaccaag
ctgaagagca cctacattga ccccttgccg gacctcatcc accccaggac gggccgcctc
cacacccgct tcaaccagac ggccacggcc acgggcaggc taagtagctc cgatcccaac
ctccagaaca tccccgtccg caccccgctt gggcagagga tccgccgggc cttcatcgcc
gaggaggggt ggctattggt ggccctggac tatagccaga tagagctcag ggtgctggcc
cacctctccg gcgacgagaa cctgatccgg gtcttccagg aggggcggga catccacacg
gagaccgcca gctggatgtt cggcgtcccc cgggaggccg tggaccccct gatgcgccgg
gcggccaaga ccatcaactt cggggtcctc tacggcatgt cggcccaccg cctctcccag
gagctagcca tcccttacga ggaggcccag gccttcattg agcgctactt tcagagcttc
cccaaggtgc gggcctggat tgagaagacc ctggaggagg gcaggaggcg ggggtacgtg
gagaccctct tcggccgccg ccgctacgtg ccagacctag aggcccgggt gaagagcgtg
cgggaggcgg ccgagcgcat ggccttcaac atgcccgtcc agggcaccgc cgccgacctc
atgaagctgg ctatggtgaa gctcttcccc aggctggagg aaatgggggc caggatgctc
cttcaggtcc acgacgagct ggtcctcgag gccccaaaag agagggcgga ggccgtggcc
cggctggcca aggaggtcat ggagggggtg tatcccctgg ccgtgcccct ggaggtggag
gtggggatag gggaggactg gctctccgcc aaggagtgat accacc
[0020] Taq DNA polymerase extends primers composed from
deoxyribonucleotides, however, some chemical modifications of the
primer are tolerated and do not decrease much the efficiency of
primer extension reactions. For example, when the nucleotide at 3'
primer terminus is ribonucleotide instead of deoxyribonucleotide,
Taq DNA polymerase can extend such primer with significant
efficiency and speed.
BRIEF SUMMARY OF THE INVENTION
[0021] In one aspect, a mutant Taq DNA polymerase having an
enhanced template discrimination activity compared with an
unmodified Taq DNA polymerase is provided. The amino acid sequence
of the mutant Taq DNA polymerase includes at least one substitution
at residue positions 783 or 784 of the unmodified Taq DNA
polymerase.
[0022] In another aspect, a mutant thermostable DNA polymerase
having an enhanced template discrimination activity compared with
an unmodified thermostable DNA polymerase is provided. The amino
acid sequence of the mutant thermostable DNA polymerase includes at
least one substitution at residue positions orthologous to
positions 783 or 784 of the unmodified Taq DNA polymerase.
[0023] In another aspect, a mutant DNA polymerase having an
enhanced template discrimination activity compared with the
corresponding unmodified DNA polymerase is provided, wherein the
mutant DNA polymerase includes a thermostable polymerase. The amino
acid sequence of the mutant DNA polymerase peptide includes at
least one substitution at residue positions orthologous to
positions 783 or 784 of the unmodified Taq DNA polymerase, wherein
the mutant DNA polymerase is selected from the group of species
consisting of E. coli, Eubacterium siraeum, Clostridium leptum,
Enterococcus, Facklamia hominis, Bacillus anthracis and Bacillus
cereus ATCC 10987.
[0024] In another aspect, a mutant non-VH-related DNA polymerase
having an enhanced template discrimination activity compared with
its unmodified non-VH-related DNA polymerase counterpart is
provided, wherein the mutant non-VH-related DNA polymerase includes
a thermostable polymerase. The amino acid sequence of the mutant
non-VH-related DNA polymerase includes at least one substitution at
residue positions orthologous to reside positions 783 and/or 784 of
the unmodified Taq DNA polymerase.
[0025] In another aspect, recombinant nucleic acid encoding any of
the mutant DNA polymerases of described above is provided.
[0026] In another aspect, a method for conducting primer extension
is provided. The method includes the step of contacting a mutant
DNA polymerase as described above with a primer, a polynucleotide
template, and nucleoside triphosphates under conditions suitable
for a primer extension method, thereby producing an extended
primer.
[0027] In another aspect, a kit for producing an extended primer,
comprising: at least one container providing a mutant DNA
polymerase as described above.
[0028] In another aspect, a reaction mixture is provided that
includes a mutant DNA polymerase as described above, at least one
primer, a polynucleotide template, and nucleoside
triphosphates.
[0029] In another aspect, a method for performing rhPCR is provided
that includes the step of performing primer extension with a mutant
DNA polymerase as described above.
[0030] In another aspect, a mutant Taq DNA polymerase having an
enhanced template discrimination activity compared with an
unmodified Taq DNA polymerase is provided. The amino acid sequence
of the mutant Taq DNA polymerase comprises one of following
selected substitutions: (1) A661E; I665W; F667L [SEQ ID NO:87]; (2)
V783F [SEQ ID NO:83]; (3) H784Q [SEQ ID NO:85]; (4) V783L; H784Q
[SEQ ID NO:89]; (5) H784A [SEQ ID NO:147]; (6) H784S [SEQ ID
NO:149]; (7) H784I [SEQ ID NO:155]; (8) H784T [SEQ ID NO:151], (9)
H784V [SEQ ID NO:153]; (10) H784M [SEQ ID NO:157]; (11) H784F [SEQ
ID NO:159]; or (12) H784Y [SEQ ID NO:161].
[0031] In another aspect, a mutant Taq DNA polymerase having a
deleted 5' exonuclease domain (KlenTaq) and containing additional
mutations, having an enhanced template discrimination activity
compared with an unmodified Taq DNA polymerase is provided. The
amino acid sequence of the mutant Taq DNA polymerase comprises one
of following selected substitutions: (1) A661E; 1665W; F667L [SEQ
ID NO: 170]; (2) V783F [SEQ ID NO: 172]; (3) H784Q [SEQ ID NO:
174]; (4) V783L; H784Q [SEQ ID NO: 176]; (5) H784S [SEQ ID NO:
178]; or (6) H784Y [SEQ ID NO: 180].
BRIEF DESCRIPTION OF THE DRAWINGS
[0032] FIG. 1 depicts a model of the active site constructed from
the known Taq DNA polymerase PDB ID 2KTQ crystal structure. The
polymerase backbone is displayed using ribbons. The "C2'" label
indicates the 2' carbon atom at the primer terminal nucleotide. The
dNTP is binding in the pocket above the primer.
[0033] FIG. 2A shows gel images depicting purified protein for the
Taq DNA polymerase mutants and wild type Taq DNA polymerase.
Legend: Aliquots of purified recombinant proteins were separated by
polyacrylamide gel electrophoresis (PAGE) and stained with
Coomassie Brilliant Blue. The Marker lane (M) is indicated, showing
protein size markers identified in kilodaltons (kDa).
[0034] FIG. 2B shows gel images depicting purified protein for the
Taq DNA polymerase mutants and wild type Taq DNA polymerase. Legend
as in FIG. 2A.
[0035] FIG. 2C shows gel images depicting purified protein for the
Taq DNA polymerase mutants and wild type Taq DNA polymerase. Legend
as in FIG. 2A.
[0036] FIG. 2D shows gel images depicting purified protein for the
Taq DNA polymerase mutants and wild type Taq DNA polymerase. Legend
as in FIG. 2A.
[0037] FIG. 3A shows graphical representations of the
allele-specific PCR (AS-PCR) data from Tables 10 and 31 for wild
type OptiTaq (sub-panel (i)), Mutant ID 2 (sub-panel (ii)) and
Mutant ID 3 (sub-panel (iii)). Legend: Average .DELTA.Cq values
obtained from AS-PCR reactions plus/minus standard deviation (error
bars) are shown (.DELTA.Cq=Cq mismatch-Cq match) comparing mismatch
discrimination of the wild-type OptiTaq with the mutant Taq DNA
polymerases. All possible pairwise mismatch base combinations are
included. The base identity of the SNP site in the target nucleic
acid is indicated on the X-axis (A, G, C, T) along with the 3'-DNA
residue of the AS-PCR reverse primer employed (dA, dG, dC, dT).
[0038] FIG. 3B shows graphical representations of the
allele-specific PCR (AS-PCR) data from Tables 10 and 31 for wild
type OptiTaq (sub-panel (i)), Mutant ID 10 (sub-panel (ii)) and
Mutant ID 18 (sub-panel (iii)). Legend as in FIG. 3A.
[0039] FIG. 3C shows graphical representations of the
allele-specific PCR (AS-PCR) data from Tables 10 and 31 for wild
type OptiTaq (sub-panel (i)), Mutant ID 3 (sub-panel (ii)) and
Mutant ID 20 (sub-panel (iii)). Legend as in FIG. 3A.
[0040] FIG. 3D shows graphical representations of the
allele-specific PCR (AS-PCR) data from Tables 10 and 31 for wild
type OptiTaq (sub-panel (i)), Mutant ID21 (sub-panel (ii)) and
Mutant ID 22 (sub-panel (iii)). Legend as in FIG. 3A.
[0041] FIG. 3E. shows graphical representations of the
allele-specific PCR (AS-PCR) data from Tables 10 and 31 for wild
type OptiTaq (sub-panel (i)), Mutant ID 24 (sub-panel (ii)) and
Mutant ID 26 (sub-panel (iii)). Legend as in FIG. 3A.
[0042] FIG. 3F shows graphical representations of the
allele-specific PCR (AS-PCR) data from Tables 10 and 31 for wild
type OptiTaq (sub-panel (i)), Mutant ID 27 (sub-panel (ii)) and
Mutant ID 29 (sub-panel (iii)). Legend as in FIG. 3A.
[0043] FIG. 3G shows graphical representations of the
allele-specific PCR (AS-PCR) data from Tables 10 and 31 for wild
type OptiTaq (sub-panel (i)) and Mutant ID 30 (sub-panel (ii)).
Legend as in FIG. 3A.
[0044] FIG. 4 shows a graphical representation of the .DELTA.Cq
values (Table 13) obtained from comparing qPCR results using
primers ending with a 3'-RNA residue and primers ending with a
3'-DNA residue for wild type OptiTaq with four mutant Taq DNA
polymerases, where .DELTA.Cq=Cq 3'-RNA-Cq 3'-DNA; rA is compared
with dA, rC is compared with dC, rG is compared with dG, and rU is
compared with dT. Identity of each DNA polymerase studied is shown
on the X-axis.
[0045] FIG. 5A shows graphical representations of the .DELTA.Cq
values (Tables 20 and 34) obtained from comparing mismatch
discrimination between wild type OptiTaq with Mutant ID 2, Mutant
ID 3, Mutant ID 10, and Mutant ID 18 Taq DNA polymerases detecting
a human genomic DNA SNP in the SMAD7 gene (NM_005904, C/T SNP,
rs4939827) using Gen1 RDDDDx blocked-cleavable primers in a
quantitative rhPCR assay. .DELTA.Cq=[Cq mismatch-Cq match]. Legend:
Identity of each DNA polymerase studied is shown on the X-axis. The
RDDDDx blocked-cleavable primer contained either a rC or rU residue
as the cleavable base, specific for the "C" or "T" allele, as
indicated.
[0046] FIG. 5B shows graphical representations of the .DELTA.Cq
values (Tables 20 and 34) obtained from comparing mismatch
discrimination between wild type OptiTaq with Mutant ID 3, Mutant
ID 20, Mutant ID 21, Mutant ID 22, and Mutant ID 24 Taq DNA
polymerases detecting a human genomic DNA SNP in the SMAD7 gene
(NM_005904, C/T SNP, rs4939827) using Gen1 RDDDDx blocked-cleavable
primers in a quantitative rhPCR assay. .DELTA.Cq=[Cq mismatch-Cq
match]. Legend as in FIG. 5A.
[0047] FIG. 5C shows graphical representations of the .DELTA.Cq
values (Tables 20 and 34) obtained from comparing mismatch
discrimination between wild type OptiTaq with Mutant ID 3, Mutant
ID 26, Mutant ID 27, Mutant ID 29, and Mutant ID 30 Taq DNA
polymerases detecting a human genomic DNA SNP in the SMAD7 gene
(NM_005904, C/T SNP, rs4939827) using Gen1 RDDDDx blocked-cleavable
primers in a quantitative rhPCR assay. .DELTA.Cq=[Cq mismatch-Cq
match]. Legend as in FIG. 5A.
[0048] FIG. 6A shows a graphical representation of the .DELTA.Cq
values (Tables 21 and 35) obtained from comparing mismatch
discrimination between wild type OptiTaq with Mutant ID 2, Mutant
ID 3, Mutant ID 10, and Mutant ID 18 Taq DNA polymerases detecting
a human genomic DNA SNP in the SMAD7 gene (NM_005904, C/T SNP,
rs4939827) using Gen2 RDxxD blocked-cleavable primers in a
quantitative rhPCR assay. .DELTA.Cq=[Cq mismatch-Cq match]. Legend:
Identity of each DNA polymerase studied is shown on the X-axis. The
RDxxD blocked-cleavable primer contained either a rC or rU residue
as the cleavable base, specific for the "C" or "T" allele, as
indicated.
[0049] FIG. 6B shows a graphical representation of the .DELTA.Cq
values (Tables 21 and 35) obtained from comparing mismatch
discrimination between wild type OptiTaq with Mutant ID 3, Mutant
ID 20, Mutant ID 21, Mutant ID 22, and Mutant ID 24 Taq DNA
polymerases detecting a human genomic DNA SNP in the SMAD7 gene
(NM_005904, C/T SNP, rs4939827) using Gen2 RDxxD blocked-cleavable
primers in a quantitative rhPCR assay. .DELTA.Cq=[Cq mismatch-Cq
match]. Legend as in FIG. 6A.
[0050] FIG. 6C shows a graphical representation of the .DELTA.Cq
values (Tables 21 and 35) obtained from comparing mismatch
discrimination between wild type OptiTaq with Mutant ID 3, Mutant
ID 26, Mutant ID 27, Mutant ID 29, and Mutant ID 30 Taq DNA
polymerases detecting a human genomic DNA SNP in the SMAD7 gene
(NM_005904, C/T SNP, rs4939827) using Gen2 RDxxD blocked-cleavable
primers in a quantitative rhPCR assay. .DELTA.Cq=[Cq mismatch-Cq
match]. Legend as in FIG. 6A.
[0051] FIG. 7A shows graphical representations of the
allele-specific PCR (AS-PCR) data from Tables 10 and 31 for OptiTaq
KlenTaq (Mutant ID 37) (sub-panel (i)), Mutant ID 38 (sub-panel
(ii)) and Mutant ID 39 (sub-panel (iii)). Legend: Average .DELTA.Cq
values obtained from AS-PCR reactions plus/minus standard deviation
(error bars) are shown (.DELTA.Cq=Cq mismatch-Cq match) comparing
mismatch discrimination of the wild-type OptiTaq with four mutant
Taq DNA polymerases. All possible pairwise mismatch base
combinations are included. The base identity of the SNP site in the
target nucleic acid is indicated on the X-axis (A, G, C, T) along
with the 3'-DNA residue of the AS-PCR reverse primer employed (dA,
dG, dC, dT).
[0052] FIG. 7B. shows graphical representations of the
allele-specific PCR (AS-PCR) data from Tables 10 and 31 for OptiTaq
KlenTaq (Mutant ID 37) (sub-panel (i)), Mutant ID 40 (sub-panel
(ii)) and Mutant ID 41 (sub-panel (iii)). Legend as in FIG. 7A.
[0053] FIG. 7C. shows graphical representations of the
allele-specific PCR (AS-PCR) data from Tables 10 and 31 for OptiTaq
KlenTaq (Mutant ID 37) (sub-panel (i)), Mutant ID 42 (sub-panel
(ii)) and Mutant ID 43 (sub-panel (iii)). Legend as in FIG. 7A.
DETAILED DESCRIPTION
[0054] The current invention provides novel thermostable DNA
polymerases, including specific examples derived from Thermus
aquaticus (Taq) DNA polymerase. These polymerases offer
improvements to existing methods for nucleic acid amplification,
genotyping, and detection of rare alleles. New assay formats
comprising the use of these novel thermostable DNA polymerases are
also provided.
Definitions
[0055] To aid in understanding the invention, several terms are
defined below.
[0056] Terms used herein are intended as "open" terms (for example,
the term "including" should be interpreted as "including but not
limited to," the term "having" should be interpreted as "having at
least," the term "includes" should be interpreted as "includes but
is not limited to," etc.).
[0057] The articles "a" and "an" refer to one or to more than one
(for example, to at least one) of the grammatical object of the
article.
[0058] The terms "about" and "approximately" shall generally mean
an acceptable degree of error for the quantity measured given the
nature or precision of the measurements. Exemplary degrees of error
are within 20-25 percent (%), typically, within 10%, and more
typically, within 5% of a given value or range of values.
[0059] Furthermore, in those instances where a convention analogous
to "at least one of A,B and C, etc." is used, in general such a
construction is intended in the sense of one having ordinary skill
in the art would understand the convention (for example, "a system
having at least one of A, B and C" would include but not be limited
to systems that have A alone, B alone, C alone, A and B together, A
and C together, B and C together, and/or A, B, and C together.). It
will be further understood by those within the art that virtually
any disjunctive word and/or phrase presenting two or more
alternative terms, whether in the description or figures, should be
understood to contemplate the possibilities of including one of the
terms, either of the terms, or both terms. For example, the phrase
"A or B" will be understood to include the possibilities of "A" or
`B or "A and B."
[0060] All language such as "from," "to," "up to," "at least,"
"greater than," "less than," and the like, include the number
recited and refer to ranges which can subsequently be broken down
into sub-ranges.
[0061] A range includes each individual member. Thus, for example,
a group having 1-3 members refers to groups having 1, 2, or 3
members. Similarly, a group having 6 members refers to groups
having 1, 2, 3, 4, or 6 members, and so forth.
[0062] The modal verb "may" refers to the preferred use or
selection of one or more options or choices among the several
described embodiments or features contained within the same. Where
no options or choices are disclosed regarding a particular
embodiment or feature contained in the same, the modal verb "may"
refers to an affirmative act regarding how to make or use and
aspect of a described embodiment or feature contained in the same,
or a definitive decision to use a specific skill regarding a
described embodiment or feature contained in the same. In this
latter context, the modal verb "may" has the same meaning and
connotation as the auxiliary verb "can."
[0063] The term "conventional" or "natural" when referring to
nucleic acid bases, nucleoside triphosphates, or nucleotides refers
to those which occur naturally in the polynucleotide being
described (i.e., for DNA these are dATP, dGTP, dCTP and dTTP).
Additionally, dITP, and 7-deaza-dGTP are frequently utilized in
place of dGTP and 7-deaza-dATP can be utilized in place of dATP in
in vitro DNA synthesis reactions, such as sequencing. Collectively,
these may be referred to as dNTPs.
[0064] The term "unconventional" or "modified" when referring to a
nucleic acid base, nucleoside, or nucleotide includes modification,
derivations, or analogues of conventional bases, nucleosides, or
nucleotides that naturally occur in a particular polynucleotide.
Certain unconventional nucleotides are modified at the 2' position
of the ribose sugar in comparison to conventional dNTPs. Thus,
although for RNA the naturally occurring nucleotides are
ribonucleotides (i.e., ATP, GTP, CTP, UTP, collectively rNTPs),
because these nucleotides have a hydroxyl group at the 2' position
of the sugar, which, by comparison is absent in dNTPs, as used
herein, ribonucleotides are unconventional nucleotides as
substrates for DNA polymerases. As used herein, unconventional
nucleotides include, but are not limited to, compounds used as
terminators for nucleic acid sequencing. Exemplary terminator
compounds include but are not limited to those compounds that have
a 2',3' dideoxy structure and are referred to as dideoxynucleoside
triphosphates. The dideoxynucleoside triphosphates ddATP, ddTTP,
ddCTP and ddGTP are referred to collectively as ddNTPs.
[0065] The term "nucleotide," in addition to referring to the
naturally occurring ribonucleotide or deoxyribonucleotide monomers,
shall herein be understood to refer to related structural variants
thereof, including derivatives and analogs, that are functionally
equivalent with respect to the particular context in which the
nucleotide is being used (e.g., hybridization to a complementary
base), unless the context clearly indicates otherwise.
[0066] The terms "nucleic acid" and "oligonucleotide," as used
herein, refer to polydeoxyribonucleotides (containing
2-deoxy-D-ribose), polyribonucleotides (containing D-ribose), and
to any other type of polynucleotide which is an N glycoside of a
purine or pyrimidine base. There is no intended distinction in
length between the terms "nucleic acid", "oligonucleotide" and
"polynucleotide", and these terms will be used interchangeably.
These terms refer only to the primary structure of the molecule.
Thus, these terms include double- and single-stranded DNA, as well
as double- and single-stranded RNA. For use in the present
invention, an oligonucleotide also can comprise nucleotide analogs
in which the base, sugar or phosphate backbone is modified as well
as non-purine or non-pyrimidine nucleotide analogs.
[0067] Oligonucleotides can be prepared by any suitable method,
including direct chemical synthesis by a method such as the
phosphotriester method of Narang et al., 1979, Meth. Enzymol.
68:90-99; the phosphodiester method of Brown et al., 1979, Meth.
Enzymol. 68:109-151; the diethylphosphoramidite method of Beaucage
et al., 1981, Tetrahedron Lett. 22:1859-1862; and the solid support
method of U.S. Pat. No. 4,458,066, each incorporated herein by
reference. A review of synthesis methods of conjugates of
oligonucleotides and modified nucleotides is provided in Goodchild,
1990, Bioconjugate Chemistry 1(3): 165-187, incorporated herein by
reference.
[0068] The term "primer," as used herein, refers to an
oligonucleotide capable of acting as a point of initiation of DNA
synthesis under suitable conditions. Such conditions include those
in which synthesis of a primer extension product complementary to a
nucleic acid strand is induced in the presence of four different
nucleoside triphosphates and an agent for extension (e.g., a DNA
polymerase or reverse transcriptase) in an appropriate buffer and
at a suitable temperature. Primer extension can also be carried out
in the absence of one or more of the nucleoside triphosphates in
which case an extension product of limited length is produced. As
used herein, the term "primer" is intended to encompass the
oligonucleotides used in ligation-mediated reactions, in which one
oligonucleotide is "extended" by ligation to a second
oligonucleotide which hybridizes at an adjacent position. Thus, the
term "primer extension", as used herein, refers to both the
polymerization of individual nucleoside triphosphates using the
primer as a point of initiation of DNA synthesis and to the
ligation of two oligonucleotides to form an extended product.
[0069] A primer is preferably a single-stranded DNA. The
appropriate length of a primer depends on the intended use of the
primer but typically ranges from 6 to 50 nucleotides, preferably
from 15-35 nucleotides. Short primer molecules generally require
cooler temperatures to form sufficiently stable hybrid complexes
with the template. A primer need not reflect the exact sequence of
the template nucleic acid, but must be sufficiently complementary
to hybridize with the template. The design of suitable primers for
the amplification of a given target sequence is well known in the
art and described in the literature cited herein.
[0070] Primers can incorporate additional features which allow for
the detection or immobilization of the primer but do not alter the
basic property of the primer, that of acting as a point of
initiation of DNA synthesis. For example, primers may contain an
additional nucleic acid sequence at the 5' end which does not
hybridize to the target nucleic acid, but which facilitates cloning
or detection of the amplified product. The region of the primer
which is sufficiently complementary to the template to hybridize is
referred to herein as the hybridizing region. Primers may
incorporate modified residues other than DNA, so long as these
alternations do not impede priming or template functionality.
[0071] The phrase "3'-nucleotide discrimination" refers to a
property of a DNA polymerase to catalyze a primer extension
reaction with greater specificity for deoxyribonucleotides and less
efficiently when the nucleotide at the primer 3' terminus was
chemically modified. For example, a mutated Taq DNA polymerase that
displays 3'-nucleotide discrimination exhibits selectivity for
deoxyribonucleotide primer and suppressed catalytic activity when
the primer is for example modified with ribonucleotides.
[0072] The term "3'-mismatch discrimination" refers to a property
of a DNA polymerase to distinguish a fully complementary sequence
from a mismatch-containing (nearly complementary) sequence where
the nucleic acid to be extended (for example, a primer or other
oligonucleotide) has a mismatch at the 3' terminus of the nucleic
acid compared to the template to which the nucleic acid hybridizes.
In some embodiments, the nucleic acid to be extended comprises a
mismatch at the 3' end relative to the fully complementary
sequence.
[0073] The term "rare allele discrimination" refers to a property
of a DNA polymerase to preferentially replicate a first nucleic
acid in a population of nucleic acids that includes a plurality of
a second nucleic acid, wherein the first nucleic acid is
under-represented in the population of nucleic acids relative to
the plurality of a second nucleic acid. Typically, the first
nucleic acid may be under-represented in the population of nucleic
acids that contain a plurality of a second nucleic acids by a ratio
of the first nucleic acid to the second nucleic acid in the range
from about 1:10 to about 1:1,000,000, including 1:100, 1:1,000;
1:10,000 and 1:100,000, among other ratios. Typically, though not
exclusively, a polymerase having rare allele discrimination can be
used to detect a SNP difference between a first nucleic acid and a
second nucleic acid, as further elaborated herein.
[0074] The phrase "template discrimination activity" refers to a
DNA polymerase having at least one of 3'-nucleotide discrimination,
3'-mismatch discrimination, rare allele discrimination and
combinations thereof.
[0075] The phrase "enhanced template discrimination activity"
refers to a DNA polymerase having at least one of 3'-nucleotide
discrimination, 3'-mismatch discrimination and rare allele
discrimination, or combinations thereof, wherein the DNA polymerase
displays greater activity than a reference DNA polymerase. For
example, a DNA polymerase mutant having "enhanced template
discrimination activity" displays at least one of 3'-nucleotide
discrimination, 3'-mismatch discrimination, rare allele
discrimination and combinations thereof that is greater than the
corresponding activity of the naturally-occurring, wild-type DNA
polymerase from which the DNA polymerase mutant was derived.
[0076] A "template discrimination activity assay" refers to an
assay for assessing the ability of a polymerase to discriminate
between two templates that differ in one or more variables. Assays
designed to reveal 3'-nucleotide discrimination, 3'-mismatch
discrimination or rare allele discrimination are examples of
template discrimination activity assays.
[0077] The term "quantification cycle value," denoted as Cq, refers
to the amplification cycle number at which positive signal is first
detected.
[0078] The term "discrimination quantification cycle value,"
denoted as .DELTA.Cq, refers to a calculated difference between a
first reference state and a second reference state, wherein both
the first and second reference states differ in terms of only one
variable. For examples, a first and second reference states can
refer to identical polymerase reactions that differ in polymerases,
such as a wild-type polymerase and a polymerase mutant, that differ
in primer template nucleotide sequence, such as a mismatched primer
template and a matched primer template, or that differ in primer
template 3'-nucleotide ribose structure, such as a primer template
containing a 3'-deoxyribose moiety and a primer template containing
a 3'-ribose moiety.
[0079] The term "differential discrimination quantification cycle
value," denoted as .DELTA..DELTA.Cq, refers to a calculated
difference between a first discrimination quantification cycle
value and a second discrimination quantification cycle value for
polymerase reactions that differ in two variables. In the context
of the present disclosure, the .DELTA..DELTA.Cq value is a measure
of the improvement that a given polymerase mutant displays relative
to the wild-type polymerase in a template discrimination activity
assay. A preferred .DELTA..DELTA.Cq value depends upon the nature
of the assay, but generally a preferred .DELTA..DELTA.Cq value is
at least 1.0 and is typically greater than 1.0.
[0080] The terms "target, "target sequence", "target region", and
"target nucleic acid," as used herein, are synonymous and refer to
a region or sequence of a nucleic acid which is to be amplified,
sequenced or detected.
[0081] The term "template" refers to a nucleic acid that includes
at least one single stranded region. The term "template" as it
modifies "substrate" refers to a nucleic acid that is used in a
hybridization reaction to anneal with a primer and/or an extension
reaction with a polymerase.
[0082] The term "hybridization," as used herein, refers to the
formation of a duplex structure by two single-stranded nucleic
acids due to complementary base pairing. Hybridization can occur
between fully complementary nucleic acid strands or between
"substantially complementary" nucleic acid strands that contain
minor regions of mismatch. Conditions under which hybridization of
fully complementary nucleic acid strands is strongly preferred are
referred to as "stringent hybridization conditions" or
"sequence-specific hybridization conditions". Stable duplexes of
substantially complementary sequences can be achieved under less
stringent hybridization conditions; the degree of mismatch
tolerated can be controlled by suitable adjustment of the
hybridization conditions. Those skilled in the art of nucleic acid
technology can determine duplex stability empirically considering a
number of variables including, for example, the length and base
pair composition of the oligonucleotides, ionic strength, and
incidence of mismatched base pairs, following the guidance provided
by the art (see, e.g., Sambrook et al., 1989, Molecular Cloning--A
Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring
Harbor, N.Y.; Wetmur, 1991, Critical Review in Biochem. and Mol.
Biol. 26(3/4):227-259; and Owczarzy et al., 2008, Biochemistry, 47:
5336-5353, which are incorporated herein by reference).
[0083] The term "amplification reaction" refers to any chemical
reaction, including an enzymatic reaction, which results in
increased copies of a template nucleic acid sequence or results in
transcription of a template nucleic acid. Amplification reactions
include reverse transcription, the polymerase chain reaction (PCR),
including Real Time PCR (see U.S. Pat. Nos. 4,683,195 and
4,683,202; PCR Protocols: A Guide to Methods and Applications
(Innis et al., eds, 1990)), and the ligase chain reaction (LCR)
(see Barany et al., U.S. Pat. No. 5,494,810). Exemplary
"amplification reactions conditions" or "amplification conditions"
typically comprise either two or three step cycles. Two step cycles
have a high temperature denaturation step followed by a
hybridization/elongation (or ligation) step. Three step cycles
comprise a denaturation step followed by a hybridization step
followed by a separate elongation or ligation step.
[0084] An "amino acid" refers to any monomer unit that can be
incorporated into a peptide, polypeptide, or protein. As used
herein, the term "amino acid" includes the following twenty natural
or genetically encoded alpha-amino acids: alanine (Ala or A),
arginine (Arg or R), asparagine (Asn or N), aspartic acid (Asp or
D), cysteine (Cys or C), glutamine (Gln or Q), glutamic acid (Glu
or E), glycine (Gly or G), histidine (His or H), isoleucine (Ile or
I), leucine (Leu or L), lysine (Lys or K), methionine (Met or M),
phenylalanine (Phe or F), proline (Pro or P), serine (Ser or S),
threonine (Thr or T), tryptophan (Trp or W), tyrosine (Tyr or Y),
and valine (Val or V). In cases where "X" residues are undefined,
these should be defined as "any amino acid." The structures of
these twenty natural amino acids are shown in, e.g., Stryer et al.,
Biochemistry, 5.sup.th ed., Freeman and Company (2002), which is
incorporated by reference. Additional amino acids, such as
selenocysteine and pyrrolysine, can also be genetically coded for
(Stadtman (1996) "Selenocysteine," Annu Rev Biochem. 65:83-100 and
Ibba et al. (2002) "Genetic code: introducing pyrrolysine," Curr
Biol. 12(13):R464-R466, which are both incorporated by reference).
The term "amino acid" also includes unnatural amino acids, modified
amino acids (e.g., having modified side chains and/or backbones),
and amino acid analogs. See, e.g., Zhang et al. (2004) "Selective
incorporation of 5-hydroxytryptophan into proteins in mammalian
cells," Proc. Natl. Acad. Sci. U.S.A. 101(24):8882-8887, Anderson
et al. (2004) "An expanded genetic code with a functional
quadruplet codon" Proc. Natl. Acad. Sci. U.S.A. 101(20):7566-7571,
Ikeda et al. (2003) "Synthesis of a novel histidine analogue and
its efficient incorporation into a protein in vivo," Protein Eng.
Des. Sel. 16(9):699-706, Chin et al. (2003) "An Expanded Eukaryotic
Genetic Code," Science 301(5635):964-967, James et al. (2001)
"Kinetic characterization of ribonuclease S mutants containing
photoisomerizable phenylazophenylalanine residues," Protein Eng.
Des. Sel. 14(12):983-991, Kohrer et al. (2001) "Import of amber and
ochre suppressor tRNAs into mammalian cells: A general approach to
site-specific insertion of amino acid analogues into proteins,"
Proc. Natl. Acad. Sci. U.S.A. 98(25):14310-14315, Bacher et al.
(2001) "Selection and Characterization of Escherichia coli Variants
Capable of Growth on an Otherwise Toxic Tryptophan Analogue," J.
Bacteriol. 183(18):5414-5425, Hamano-Takaku et al. (2000) "A Mutant
Escherichia coli Tyrosyl-tRNA Synthetase Utilizes the Unnatural
Amino Acid Azatyrosine More Efficiently than Tyrosine," J. Biol.
Chem. 275(51):40324-40328, and Budisa et al. (2001) "Proteins with
{beta}-(thienopyrrolyl)alanines as alternative chromophores and
pharmaceutically active amino acids," Protein Sci. 10(7):1281-1292,
which are each incorporated by reference.
[0085] The term "residue" is synonymous and interchangeable with
"amino acid" or "nucleotide" depending upon context.
[0086] As used herein, a "polymerase" refers to an enzyme that
catalyzes the polymerization of nucleotides. Generally, the enzyme
will initiate synthesis at the 3'-end of the primer annealed to a
nucleic acid template sequence. "DNA polymerase" catalyzes the
polymerization of deoxyribonucleotides. Known DNA polymerases
include, for example, Pyrococcus furiosus (Pfu) DNA polymerase
(Lundberg et al., 1991, Gene, 108:1), E. coli DNA polymerase I
(Lecomte and Doubleday, 1983, Nucleic Acids Res. 11:7505), T7 DNA
polymerase (Nordstrom et al., 1981, J. Biol. Chem. 256:3112),
Thermus thermophilus (Tth) DNA polymerase (Myers and Gelfand 1991,
Biochemistry 30:7661), Bacillus stearothermophilus DNA polymerase
(Stenesh and McGowan, 1977, Biochim Biophys Acta 475:32),
Thermococcus litoralis (Tli) DNA polymerase (also referred to as
Vent DNA polymerase, Cariello et al., 1991, Nucleic Acids Res, 19:
4193), Thermotoga maritima (Tma) DNA polymerase (Diaz and Sabino,
1998 Braz J. Med. Res, 31:1239), Thermus aquaticus (Taq) DNA
polymerase (Chien et al., 1976, J. Bacteoriol, 127: 1550),
Pyrococcus kodakaraensis KOD DNA polymerase (Takagi et al., 1997,
Appl. Environ. Microbiol. 63:4504), JDF-3 DNA polymerase (Patent
application WO 0132887), and Pyrococcus GB-D (PGB-D) DNA polymerase
(Juncosa-Ginesta et al., 1994, Biotechniques, 16:820). The
polymerase activity of any of the above enzymes can be determined
by means well known in the art.
[0087] The term "thermostable polymerase," refers to an enzyme that
is stable to heat, is heat resistant, and retains sufficient
activity to effect subsequent polynucleotide extension reactions
and does not become irreversibly denatured (inactivated) when
subjected to the elevated temperatures for the time necessary to
effect denaturation of double-stranded nucleic acids. The heating
conditions necessary for nucleic acid denaturation are well known
in the art and are exemplified in, e.g., U.S. Pat. Nos. 4,683,202,
4,683,195, and 4,965,188, which are incorporated herein by
reference. As used herein, a thermostable polymerase is suitable
for use in a temperature cycling reaction such as the polymerase
chain reaction ("PCR"). Irreversible denaturation for purposes
herein refers to permanent and complete loss of enzymatic activity.
For a thermostable polymerase, enzymatic activity refers to the
catalysis of the combination of the nucleotides in the proper
manner to form polynucleotide extension products that are
complementary to a template nucleic acid strand. Thermostable DNA
polymerases from thermophilic bacteria include, e.g., DNA
polymerases from Thermus aquaticus, among others.
[0088] The term "thermoactive" refers to an enzyme that maintains
catalytic properties at temperatures commonly used for reverse
transcription or anneal/extension steps in RT-PCR and/or PCR
reactions (i.e., 45-80.degree. C.). Thermostable enzymes are those
which are not irreversibly inactivated or denatured when subjected
to elevated temperatures necessary for nucleic acid denaturation.
Thermoactive enzymes may or may not be thermostable. Thermoactive
DNA polymerases can be DNA or RNA dependent from thermophilic
species or from mesophilic species including, but not limited to,
Escherichia coli, Moloney murine leukemia viruses, and Avian
myoblastosis virus.
[0089] As used herein, a primer is "specific," for a target
sequence if, when used in an amplification reaction under
sufficiently stringent conditions, the primer hybridizes primarily
to the target nucleic acid. Typically, a primer is specific for a
target sequence if the primer-target duplex stability is greater
than the stability of a duplex formed between the primer and any
other sequence found in the sample. One of skill in the art will
recognize that various factors, such as salt conditions as well as
base composition of the primer and the location of the mismatches,
will affect the specificity of the primer, and that routine
experimental confirmation of the primer specificity will be needed
in many cases. Hybridization conditions can be chosen under which
the primer can form stable duplexes only with a target sequence.
Thus, the use of target-specific primers under suitably stringent
amplification conditions enables the selective amplification of
those target sequences which contain the target primer binding
sites.
[0090] The term "non-specific amplification," as used herein,
refers to the amplification of nucleic acid sequences other than
the target sequence which results from primers hybridizing to
sequences other than the target sequence and then serving as a
substrate for primer extension. The hybridization of a primer to a
non-target sequence is referred to as "non-specific hybridization"
and is apt to occur especially during the lower temperature,
reduced stringency, pre-amplification conditions, or in situations
where there is a variant allele in the sample having a very closely
related sequence to the true target as in the case of a single
nucleotide polymorphism (SNP).
[0091] The term "primer dimer," as used herein, refers to a
template-independent non-specific amplification product, which is
believed to result from primer extensions wherein another primer
serves as a template. Although primer dimers frequently appear to
be a concatamer of two primers, i.e., a dimer, concatamers of more
than two primers also occur. The term "primer dimer" is used herein
generically to encompass a template-independent non-specific
amplification product.
[0092] The term "reaction mixture," as used herein, refers to a
solution containing reagents necessary to carry out a given
reaction. An "amplification reaction mixture", which refers to a
solution containing reagents necessary to carry out an
amplification reaction, typically contains oligonucleotide primers
and a DNA polymerase or ligase in a suitable buffer. A "PCR
reaction mixture" typically contains oligonucleotide primers, a DNA
polymerase (most typically a thermostable DNA polymerase), dNTPs,
and a divalent metal cation in a suitable buffer. A reaction
mixture is referred to as complete if it contains all reagents
necessary to enable the reaction, and incomplete if it contains
only a subset of the necessary reagents. It will be understood by
one of skill in the art that reaction components are routinely
stored as separate solutions, each containing a subset of the total
components, for reasons of convenience, storage stability, or to
allow for application-dependent adjustment of the component
concentrations, and that reaction components are combined prior to
the reaction to create a complete reaction mixture. Furthermore, it
will be understood by one of skill in the art that reaction
components are packaged separately for commercialization and that
useful commercial kits may contain any subset of the reaction
components which includes the blocked primers of the invention.
[0093] The terms "non-activated" or "inactivated," as used herein,
refer to a primer or other oligonucleotide that is incapable of
participating in a primer extension reaction or a ligation reaction
because either DNA polymerase or DNA ligase cannot interact with
the oligonucleotide for their intended purposes. In some
embodiments when the oligonucleotide is a primer, the non-activated
state occurs because the primer is blocked at or near the 3'-end so
as to prevent primer extension. When specific groups are bound at
or near the 3'-end of the primer, DNA polymerase cannot bind to the
primer and extension cannot occur. A non-activated primer is,
however, capable of hybridizing to a substantially complementary
nucleotide sequence.
[0094] The term "activated," as used herein, refers to a primer or
other oligonucleotide that is capable of participating in a
reaction with DNA polymerase or DNA ligase. A primer or other
oligonucleotide becomes activated after it hybridizes to a
substantially complementary nucleic acid sequence and is cleaved to
generate a functional 3'- or 5'-end so that it can interact with a
DNA polymerase or a DNA ligase. For example, when the
oligonucleotide is a primer, and the primer is hybridized to a
template, a 3'-blocking group can be removed from the primer by,
for example, a cleaving enzyme such that DNA polymerase can bind to
the 3' end of the primer and promote primer extension.
[0095] The term "cleavage domain" or "cleaving domain," as used
herein, are synonymous and refer to a region located between the 5'
and 3' end of a primer or other oligonucleotide that is recognized
by a cleavage compound, for example a cleavage enzyme, that will
cleave the primer or other oligonucleotide. For the purposes of
this invention, the cleavage domain is designed such that the
primer or other oligonucleotide is cleaved only when it is
hybridized to a complementary nucleic acid sequence, but will not
be cleaved when it is single-stranded. The cleavage domain or
sequences flanking it may include a moiety that a) prevents or
inhibits the extension or ligation of a primer or other
oligonucleotide by a polymerase or a ligase, b) enhances
discrimination to detect variant alleles, or c) suppresses
undesired cleavage reactions. One or more such moieties may be
included in the cleavage domain or the sequences flanking it.
[0096] The term "RNase H cleavage domain," as used herein, is a
type of cleavage domain that contains one or more ribonucleic acid
residue or an alternative analog which provides a substrate for an
RNase H. An RNase H cleavage domain can be located anywhere within
a primer or oligonucleotide, and is preferably located at or near
the 3'-end or the 5'-end of the molecule.
[0097] An "RNase H1 cleavage domain" generally contains at least
three consecutive RNA residues. An "RNase H2 cleavage domain" may
contain one RNA residue, a sequence of contiguously linked RNA
residues or RNA residues separated by DNA residues or other
chemical groups. For example, an RNase H2 cleavage domain may
include a 2'-fluoronucleoside residue, among others.
[0098] The terms "cleavage compound," or "cleaving agent" as used
herein, refers to any compound that can recognize a cleavage domain
within a primer or other oligonucleotide, and selectively cleave
the oligonucleotide based on the presence of the cleavage domain.
The cleavage compounds utilized in the invention selectively cleave
the primer or other oligonucleotide comprising the cleavage domain
only when it is hybridized to a substantially complementary nucleic
acid sequence, but will not cleave the primer or other
oligonucleotide when it is single stranded. The cleavage compound
cleaves the primer or other oligonucleotide within or adjacent to
the cleavage domain. The term "adjacent," as used herein, means
that the cleavage compound cleaves the primer or other
oligonucleotide at either the 5'-end or the 3' end of the cleavage
domain. Cleavage reactions preferred in the invention yield a
5'-phosphate group and a 3'-OH group.
[0099] In a preferred embodiment, the cleavage compound is a
"cleaving enzyme." A cleaving enzyme is a protein or a ribozyme
that is capable of recognizing the cleaving domain when a primer or
other nucleotide is hybridized to a substantially complementary
nucleic acid sequence, but that will not cleave the complementary
nucleic acid sequence (i.e., it provides a single strand break in
the duplex). The cleaving enzyme will also not cleave the primer or
other oligonucleotide comprising the cleavage domain when it is
single stranded. Examples of cleaving enzymes are RNase H enzymes
and other nicking enzymes.
[0100] The term "nicking," as used herein, refers to the cleavage
of only one strand of the double-stranded portion of a fully or
partially double-stranded nucleic acid. The position where the
nucleic acid is nicked is referred to as the "nicking site" (NS). A
"nicking agent" (NA) is an agent that nicks a partially or fully
double-stranded nucleic acid. It may be an enzyme or any other
chemical compound or composition. In certain embodiments, a nicking
agent may recognize a particular nucleotide sequence of a fully or
partially double-stranded nucleic acid and cleave only one strand
of the fully or partially double-stranded nucleic acid at a
specific position (i.e., the NS) relative to the location of the
recognition sequence. Such nicking agents (referred to as "sequence
specific nicking agents") include, but are not limited to, nicking
endonucleases (e.g., Nt.BstNBI).
[0101] A "nicking endonuclease" (NE), as used herein, thus refers
to an endonuclease that recognizes a nucleotide sequence of a
completely or partially double-stranded nucleic acid molecule and
cleaves only one strand of the nucleic acid molecule at a specific
location relative to the recognition sequence. In such a case the
entire sequence from the recognition site to the point of cleavage
constitutes the "cleavage domain".
[0102] The term "blocking group," as used herein, refers to a
chemical moiety that is bound to the primer or other
oligonucleotide such that an amplification reaction does not occur.
For example, primer extension and/or DNA ligation does not occur.
Once the blocking group is removed from the primer or other
oligonucleotide, the oligonucleotide is capable of participating in
the assay for which it was designed (PCR, ligation, sequencing,
etc.). Thus, the "blocking group" can be any chemical moiety that
inhibits recognition by a polymerase or DNA ligase. The blocking
group may be incorporated into the cleavage domain but is generally
located on either the 5'- or 3'-side of the cleavage domain. The
blocking group can be comprised of more than one chemical moiety.
In the present invention the "blocking group" is typically removed
after hybridization of the oligonucleotide to its target
sequence.
[0103] The term "blocked-cleavable primer" refers to a primer that
is inactive or inactivated for priming DNA synthesis from a
polymerase owing to the presence of a blocking group at or near the
3'-terminus of the primer. A blocked-cleavable primer can be
converted into a competent primer by removing the blocking group at
or near the 3'-terminus of the primer by a cleavage compound or a
cleaving agent (for example, a cleaving enzyme) resulting in an
active or activated primer.
[0104] An RDDDDx blocked-cleavable primer (also known as
"generation 1" or "Gen 1" blocked-cleavable primer) refers to a
blocked-cleavable primer having at its 3'-terminus the sequence
RDDDDx, wherein R is an RNA base, D is a DNA base and x is a C3
spacer group.
[0105] An RDxxD blocked-cleavable primer (also known as "generation
2" or "Gen 2" blocked-cleavable primer) refers to a
blocked-cleavable primer having at its 3'-terminus the sequence
RDxxD, wherein R is an RNA base, D is a DNA base and x is a C3
spacer group.
[0106] The term "fluorescent generation probe" refers either to a)
an oligonucleotide having an attached fluorophore and quencher, and
optionally a minor groove binder or to b) a DNA binding reagent
such as SYBR.TM. Green dye.
[0107] The terms "fluorescent label" or "fluorophore" refers to
compounds with a fluorescent emission maximum between about 350 and
900 nm. A wide variety of fluorophores can be used, including but
not limited to: 5-FAM (also called 5-carboxyfluorescein; also
called Spiro(isobenzofuran-1(3H), 9'-(9H)xanthene)-5-carboxylic
acid,3',6'-dihydroxy-3-oxo-6-carboxyfluorescein);
5-Hexachloro-Fluorescein;
([4,7,2',4',5',7'-hexachloro-(3',6'-dipivaloyl-fluoresceinyl)-6-carboxyli-
-c acid]); 6-Hexachloro-Fluorescein;
([4,7,2',4',5',7'-hexachloro-(3',6'-dipivaloylfluoresceinyl)-5-carboxylic
acid]); 5-Tetrachloro-Fluorescein;
([4,7,2',7'-tetra-chloro-(3',6'-dipivaloylfluoresceinyl)-5-carboxylic
acid]); 6-Tetrachloro-Fluorescein;
([4,7,2',7'-tetrachloro-(3',6'-dipivaloylfluoresceinyl)-6-carboxylic
acid]); 5-TAMRA (5-carboxytetramethylrhodamine); Xanthylium,
9-(2,4-dicarboxyphenyl)-3,6-bis(dimethyl-amino); 6-TAMRA
(6-carboxytetramethylrhodamine);
9-(2,5-dicarboxyphenyl)-3,6-bis(dimethylamino); EDANS
(5-((2-aminoethyl)amino)naphthalene-1-sulfonic acid); 1,5-IAEDANS
(5-((((2-iodoacetyl)amino)ethyl)amino)naphthalene-1-sulfonic acid);
Cy5 (Indodicarbocyanine-5); Cy3 (Indo-dicarbocyanine-3); and BODIPY
FL
(2,6-dibromo-4,4-difluoro-5,7-dimethyl-4-bora-3a,4a-diaza-s-indacene-3-pr-
oprionic acid); Quasar.RTM.-670 dye (Biosearch Technologies); Cal
Fluor.RTM. Orange dye (Biosearch Technologies); Rox dyes; Max dyes
(Integrated DNA Technologies), as well as suitable derivatives
thereof.
[0108] As used herein, the term "quencher" refers to a molecule or
part of a compound, which is capable of reducing the emission from
a fluorescent donor when attached to or in proximity to the donor.
Quenching may occur by any of several mechanisms including
fluorescence resonance energy transfer, photo-induced electron
transfer, paramagnetic enhancement of intersystem crossing, Dexter
exchange coupling, and exciton coupling such as the formation of
dark complexes. Fluorescence is "quenched" when the fluorescence
emitted by the fluorophore is reduced as compared with the
fluorescence in the absence of the quencher by at least 10%, for
example, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 98%,
99%, 99.9% or more. A number of commercially available quenchers
are known in the art, and include but are not limited to DABCYL,
Black Hole.TM. Quenchers (BHQ-1, BHQ-2, and BHQ-3), Iowa Black.RTM.
FQ and Iowa Black.RTM. RQ. These are so-called dark quenchers. They
have no intrinsic fluorescence in the wavelength range from 300 to
900 nm, virtually eliminating background problems seen with other
quenchers such as TAMRA which is intrinsically fluorescent.
[0109] The term "ligation" as used herein refers to the covalent
joining of two polynucleotide ends. In various embodiments,
ligation involves the covalent joining of a 3' end of a first
polynucleotide (the acceptor) to a 5' end of a second
polynucleotide (the donor). Ligation results in a phosphodiester
bond being formed between the polynucleotide ends. In various
embodiments, ligation may be mediated by any enzyme, chemical, or
process that results in a covalent joining of the polynucleotide
ends. In certain embodiments, ligation is mediated by a ligase
enzyme.
[0110] As used herein, "ligase" refers to an enzyme that is capable
of covalently linking the 3'-hydroxyl group of one polynucleotide
to the 5' phosphate group of a second polynucleotide. Examples of
ligases include E. coli DNA ligase, T4 DNA ligase, etc.
[0111] The ligation reaction can be employed in DNA amplification
methods such as the "ligase chain reaction" (LCR), also referred to
as the "ligase amplification reaction" (LAR), see Barany, Proc.
Natl. Acad. Sci., 88:189 (1991); and Wu and Wallace, Genomics 4:560
(1989) incorporated herein by reference. In LCR, four
oligonucleotides, two adjacent oligonucleotides which uniquely
hybridize to one strand of the target DNA, and a complementary set
of adjacent oligonucleotides, that hybridize to the opposite strand
are mixed and DNA ligase is added to the mixture. In the presence
of the target sequence, DNA ligase will covalently link each set of
hybridized molecules. Importantly, in LCR, two oligonucleotides are
ligated together only when they base-pair with sequences without
gaps. Repeated cycles of denaturation, hybridization and ligation
amplify a short segment of DNA. A mismatch at the junction between
adjacent oligonucleotides inhibits ligation. As in other
oligonucleotide ligation assays this property allows LCR to be used
to distinguish between variant alleles such as SNPs. LCR has also
been used in combination with PCR to achieve enhanced detection of
single-base changes, see Segev, PCT Public. No. WO9001069
(1990).
[0112] The term "unmodified form," in the context of the Taq DNA
polymerase, is a term used herein for purposes of defining a host
cell-specific, codon-optimized Taq DNA polymerase gene that
expresses Taq DNA polymerase in the host cell. The term "unmodified
form" refers to a functional DNA polymerase that has the amino acid
sequence of the naturally occurring polymerase. The term
"unmodified form" includes a functional DNA polymerase in a
recombinant form.
[0113] The term "mutant", in the context of DNA polymerases
disclosed, means a polypeptide, typically recombinant, that
comprises one or more amino acid substitutions relative to a
corresponding, naturally-occurring form or unmodified form of DNA
polymerase.
[0114] "Recombinant", as used herein, refers to an amino acid
sequence or a nucleotide sequence that has been intentionally
modified by recombinant methods. By the term "recombinant nucleic
acid" herein is meant a nucleic acid, originally formed in vitro,
in general, by the manipulation of a nucleic acid by endonucleases,
in a form not normally found in nature. Thus an isolated, mutant
DNA polymerase nucleic acid, in a linear form, or an expression
vector formed in vitro by ligating DNA molecules that are not
normally joined, are both considered recombinant for the purposes
of this invention. It is understood that once a recombinant nucleic
acid is made and reintroduced into a host cell, it will replicate
non-recombinantly, i.e., using the in vivo cellular machinery of
the host cell rather than in vitro manipulations; however, such
nucleic acids, once produced recombinantly, although subsequently
replicated non-recombinantly, are still considered recombinant for
the purposes of the invention. A "recombinant protein" is a protein
made using recombinant techniques, i.e., through the expression of
a recombinant nucleic acid as depicted above.
[0115] A nucleic acid is "operably linked" when it is placed into a
functional relationship with another nucleic acid sequence. For
example, a promoter or enhancer is operably linked to a coding
sequence if it affects the transcription of the sequence; or a
ribosome binding site is operably linked to a coding sequence if it
is positioned so as to facilitate translation.
[0116] The term "vector" refers to a piece of DNA, typically
double-stranded, which may have inserted into it a piece of foreign
DNA. The vector may be, for example, of plasmid origin. Vectors
contain "replicon" polynucleotide sequences that facilitate the
autonomous replication of the vector in a host cell. Foreign DNA is
defined as heterologous DNA, which is DNA not naturally found in
the host cell, which, for example, replicates the vector molecule,
encodes a selectable or screenable marker, or encodes a transgene.
The vector is used to transport the foreign or heterologous DNA
into a suitable host cell. Once in the host cell, the vector can
replicate independently of or coincidental with the host
chromosomal DNA, and several copies of the vector and its inserted
DNA can be generated. In addition, the vector can also contain the
necessary elements that permit transcription of the inserted DNA
into an mRNA molecule or otherwise cause replication of the
inserted DNA into multiple copies of RNA. Some expression vectors
additionally contain sequence elements adjacent to the inserted DNA
that increase the half-life of the expressed mRNA and/or allow
translation of the mRNA into a protein molecule. Many molecules of
mRNA and polypeptide encoded by the inserted DNA can thus be
rapidly synthesized.
[0117] The term "affinity tag" refers to a short polypeptide
sequence that permits detection and/or selection of the polypeptide
sequence. For the purposes of this disclosure, a recombinant gene
that encodes a recombinant DNA polymerase may include an affinity
tag. In particular, the affinity tag is positioned typically at
either the N-terminus or C-terminus of the coding sequence for a
DNA polymerase through the use of recombination technology.
Exemplary affinity tags include polyhistine (for example,(His6),),
glutathione-S-transferase (GST), HaloTag.RTM., AviTag,
Calmodulin-tag, polyglutamate tag, FLAG-tag, HA-tag, Myc-tag,
S-tag, SBP-tag, Softag 3, V5 tag, Xpress tag, among others.
[0118] The term "host cell" refers to both single-cellular
prokaryote and eukaryote organisms (e.g., bacteria, yeast, and
actinomycetes) and single cells from higher order plants or animals
when being grown in cell culture. Exemplary suitable host cells
include E. coli, S. cerevisiae and S. frugiperda.
[0119] As used herein, "percentage of sequence identity" is
determined by comparing two optimally aligned sequences over a
comparison window, wherein the portion of the sequence in the
comparison window can comprise additions or deletions (i.e., gaps)
as compared to the reference sequence (which does not comprise
additions or deletions) for optimal alignment of the two sequences.
The percentage is calculated by determining the number of positions
at which the identical nucleic acid base or amino acid residue
occurs in both sequences to yield the number of matched positions,
dividing the number of matched positions by the total number of
positions in the window of comparison and multiplying the result by
100 to yield the percentage of sequence identity.
[0120] The terms "identical" or "identity", in the context of two
or more nucleic acids or polypeptide sequences, refer to two or
more sequences or subsequences that are the same. Sequences are
"substantially identical" to each other if they have a specified
percentage of nucleotides or amino acid residues that are the same
(e.g., at least 20%, at least 25%, at least 30%, at least 35%, at
least 40%, at least 45%, at least 50%, at least 55%, at least 60%,
at least 65%, at least 70%, at least 75%, at least 80%, at least
85%, at least 90%, or at least 95% identity over a specified
region), when compared and aligned for maximum correspondence over
a comparison window, or designated region as measured using one of
the following sequence comparison algorithms or by manual alignment
and visual inspection. These definitions also refer to the
complement of a test sequence. Optionally, the identity exists over
a region that is at least about 50 nucleotides in length, or more
typically over a region that is 100 to 500 or 1000 or more
nucleotides in length.
[0121] The terms "similarity" or "percent similarity", in the
context of two or more polypeptide sequences, refer to two or more
sequences or subsequences that have a specified percentage of amino
acid residues that are either the same or similar as defined by a
conservative amino acid substitutions (e.g., 60% similarity,
optionally 65%, 70%, 75%, 80%, 85%, 90%, or 95% similar over a
specified region), when compared and aligned for maximum
correspondence over a comparison window, or designated region as
measured using one of the following sequence comparison algorithms
or by manual alignment and visual inspection. Sequences are
"substantially similar" to each other if they are at least 20%, at
least 25%, at least 30%, at least 35%, at least 40%, at least 45%,
at least 50%, or at least 55% similar to each other. Optionally,
this similarly exists over a region that is at least about 50 amino
acids in length, or more typically over a region that is at least
about 100 to 500 or 1000 or more amino acids in length.
[0122] For sequence comparison, typically one sequence acts as a
reference sequence, to which test sequences are compared. When
using a sequence comparison algorithm, test and reference sequences
are entered into a computer, subsequence coordinates are
designated, if necessary, and sequence algorithm program parameters
are designated. Default program parameters are commonly used, or
alternative parameters can be designated. The sequence comparison
algorithm then calculates the percent sequence identities or
similarities for the test sequences relative to the reference
sequence, based on the program parameters.
[0123] A "comparison window", as used herein, includes reference to
a segment of any one of the number of contiguous positions selected
from the group consisting of from 20 to 600, usually about 50 to
about 200, more usually about 100 to about 150 in which a sequence
may be compared to a reference sequence of the same number of
contiguous positions after the two sequences are optimally aligned.
Methods of alignment of sequences for comparison are well known in
the art. Optimal alignment of sequences for comparison can be
conducted, for example, by the local homology algorithm of Smith
and Waterman (Adv. Appl. Math. 2:482, 1970), by the homology
alignment algorithm of Needleman and Wunsch (J. Mol. Biol. 48:443,
1970), by the search for similarity method of Pearson and Lipman
(Proc. Natl. Acad. Sci. USA 85:2444, 1988), by computerized
implementations of these algorithms (e.g., GAP, BESTFIT, FASTA, and
TFASTA in the Wisconsin Genetics Software Package, Genetics
Computer Group, 575 Science Dr., Madison, Wis.), or by manual
alignment and visual inspection (see, e.g., Ausubel et al., Current
Protocols in Molecular Biology (1995 supplement)).
[0124] Algorithms suitable for determining percent sequence
identity and sequence similarity are the BLAST and BLAST 2.0
algorithms, which are described in Altschul et al. (Nuc. Acids Res.
25:3389-402, 1977), and Altschul et al. (J. Mol. Biol. 215:403-10,
1990), respectively. Software for performing BLAST analyses is
publicly available through publicly available online and internet
databases and the National Center for Biotechnology Information
within the National Library of Medicine of the U.S. National
Institutes of Health (http://www.ncbi.nlm.nih.gov/).
Rational Design of Taq DNA Polymerase Mutants
[0125] As outlined above, many strategies have been developed to
improve discrimination of the polymerase chain reaction to
selectively amplify a specific nucleic acid sequence based on the
identity of a single nucleotide polymorphism, which in the past
most often involved modifications introduced into the primer while
using a naturally occurring DNA polymerase. The ability of DNA
polymerases to discriminate between match and mismatch at the
3'-end of the primer nucleic acid is limited and varies greatly
with the identity of the specific base pairs present. An
alternative strategy to improve the selectivity of PCR
amplification is to alter the properties of the DNA polymerase to
improve discrimination between a primer that is a match versus one
which has a terminal mismatch to the template nucleic acid. The
present invention provides for DNA polymerase mutants having
improved mismatch discrimination for base pairing at the
3'-terminus of the primer, leading to improved specificity of the
ensuing amplification reaction.
[0126] The rhPCR method employs blocked-cleavable primers which
must be unblocked by the action of RNase H2 before amplification
can commence. The enzymatic unblocking step requires cleavage at a
single internal RNA base within the primer, which is typically
positioned at the SNP site. RNase H2 cleaves the RNA at the
5'-side, leaving a primer with a 3'-hydroxyl which is capable of
priming PCR. Cleavage by RNase H2 occurs with high efficiency when
the primer matches the template and with low efficiency when a
mismatch is present due to a SNP. Therefore match templates are
amplified with greater efficiency than mismatch templates. It is
thought that the primary mechanism that permits amplification of
mismatched templates begins with alternative cleavage of the
substrate (i.e., the blocked-cleavable primer) at the 3'-side of
the RNA residue, leading to inappropriate priming when a mismatch
is present, retention of the RNA base in the primer, and conversion
of the PCR product to primer sequence, which then faithfully
replicates as a match in subsequent PCR cycles. Fidelity of the
rhPCR process could be improved through improvements in the DNA
polymerase which limit its ability to initiate DNA synthesis from a
primer having a 3'-RNA residue. The present invention provides for
DNA polymerase mutants having a reduced ability to initiate DNA
synthesis from 3'-RNA containing primers, leading to improved
specificity of the ensuing amplification reaction.
[0127] The present invention includes novel DNA polymerase mutants
having improved discrimination for base identity at the 3'-end of
the primer nucleic acid and/or DNA polymerase mutants having
decreased priming efficiency from a 3'-RNA residue.
[0128] A novel design strategy was developed to rationally design
DNA polymerase mutants having improved discrimination at the
3'-terminal base of the primer compared to discrimination of the
native DNA polymerase, limiting the ability to initiate DNA
synthesis if a mismatch is present or if an RNA residue is present.
The process described herein employed the Taq DNA polymerase as the
parent enzyme; the approach can be applied to other DNA
polymerases, especially if crystal structure is known. The design
strategy includes a first component based upon theoretical analyses
of biophysical, biochemical and genetic information relating to the
native DNA polymerase and, to a lesser extent, related polymerases
which differ in amino acid sequence. The design strategy includes a
second component based upon molecular biological and biochemical
analyses of known genetically-engineered mutant polymerases to
assist as a guide in predicting the effects of novel mutations in
an attempt to rationally engineer new properties into the mutant
polymerase, in this case to improve 3'-nucleotide
discrimination.
[0129] In the first stage, the mechanism of Taq DNA polymerase
enzymatic reaction based upon published mutational
structure-activity-relationship (SAR) studies was analyzed and
correlated with protein structure, when known, and predicted using
molecular dynamic simulations when not known. The mechanism of
enzyme catalysis has been described in the prior art (Patel, P. H.,
et al., J. Mol. Biol. 2001, 308:823-837; Li, Y. & Waksman, G.,
Protein Sci 2001, 10:1225-1233). Amino acid residues located at the
C-terminus, from positions 424 to 832, are responsible for the
primer extension catalytic activity of the protein. Taq DNA
polymerase binds the primer-template duplex to form a binary
complex. This allows an incoming substrate dNTP to bind in the
pocket at the 3'-end of the primer to form an open ternary complex.
If the dNTP is complementary to the template nucleotide, the active
site changes conformation where the .alpha.-helix made from
residues 659 to 671 rotates towards the site, and template base
rotates towards the incoming dNTP, encouraging formation of a
Watson-Crick base pair. This event "closes" the ternary complex,
and brings the .alpha.-phosphate group of the dNTP close to the
primer 3'-OH group. The oxygen of this hydroxyl group makes a
nucleophilic attack on the phosphorus, forms a covalent bond and
pyrophosphate is released. Taq DNA polymerase catalytic activity
requires the presence of magnesium ions, which are assumed to
facilitate deprotonation of the attacking hydroxyl group.
[0130] One criteria for rational design of Taq DNA polymerase
mutants having improved 3'-nucleotide discrimination is to provide
for novel polymerase enzyme variants having normal or near-normal
polymerase processivity compared with the native DNA polymerase.
For this reason, the first step of analysis serves to narrow the
sequence space of amino acids that are available for alteration
that should not compromise core enzymatic functions. For example,
residues D610, D785, and E786 form the catalytic core. Their
carboxylate groups are assumed to bind divalent metal ions, which
in turn bind and stabilize the incoming dNTP and the terminal
nucleotide of the primer. Mutations of these three essential
residues are likely to render the polymerase inactive. Mutant
polymerases which include alterations of residues D610, D785 and
E786 were therefore excluded from consideration. Likewise,
mutations that affect fidelity of complementary base recognition,
such as residues that facilitate open to closed ternary complex
formation at a complementary dNTP and the template base, were
excluded from consideration.
[0131] Additional criteria of the first stage of analysis were to
identify the polymerase amino acid residues in the vicinity of the
3' terminal nucleotide of the primer. For this purpose, the atomic
three-dimensional structures of Taq DNA polymerase that are
available from prior art (Eom, S. H., et al., Nature 1996,
382:278-281; Li, Y., et al., EMBO J. 1998, 17: 7514-7525; Doublie,
S., et al., Structure 1999, 7:R31-R35; Li, Y., et al., Protein Sci
1998, 7:1116-1123) were selected for analyses. The structures were
downloaded from the Protein Data Bank (H. M. Berman, et al.,
Nucleic Acids Research 2000, 28: 235-242). The structures of PDB ID
2KTQ and 3KTQ were thoroughly analyzed because they show the open
and closed ternary complex of the large fragment of Taq DNA
polymerase co-crystalized with primer and template nucleic acids
(Li, Y., et al., EMBO J. 1998, 17: 7514-7525). This structure shows
the location of the primer 3'-terminus at the active site and its
interaction with key amino acid residues (FIG. 1).
[0132] For structure visualization, the hydrogen atom attached to
the 2' carbon is replaced with a hydroxyl group for primers
modified with a 3'-ribonucleotide. Those amino acid residues that
are in close proximity to the 2' carbon of the nucleotide at the 3'
terminus of the primer were selected for additional analysis. These
amino acid residues are listed in the Table 2 and are most likely
to interact with the primer 3'-terminal nucleotide. Mutation at
these sites may affect catalytic activity of the polymerase when
primer modifications, like OH, are attached to the 2' carbon atom
of the ribose.
TABLE-US-00002 TABLE 2 Chemical groups in close vicinity to the 2'
carbon of the terminal 3' primer nucleotide. Distance from C2' of
the primer terminal residue.sup.1 Chemical group .ltoreq.0.35 nm
dNTP to be added to primer 0.35-0.40 nm D785.sup.2 0.40-0.45 nm
H784, V783 0.45-0.50 nm R573 0.50-0.60 nm E786.sup.2 .sup.1The
distances were measured in the PDB ID 2KTQ structure.
.sup.2Residues D785 and E786 are catalytic core residues.
[0133] A further aspect of this criterion relates to approaches to
increase specificity while retaining catalytic activity of the
polymerase. One approach to increasing specificity of Taq DNA
polymerase would be to decrease the size of the binding pocket, so
that a modified primer would not fit within it. Any additional
chemical group will increases the volume of space occupied by the
3' nucleotide. To align atoms for effective catalysis and
nucleophilic attack, the active site pocket must be flexible to
accommodate additional atom(s), for example, the oxygen of the OH
group of an RNA residue. The size of the active site can be
decreased by substitution of neighboring amino acids with larger
amino acids. Additional consideration is given to the amino acid
properties and abilities of their side chains to engage in
electrostatic and van der Waals interactions. Amino acid can be
categorized into groups of positively charged (R, H, K), negatively
charged (D, E), uncharged polar (S, T, N, Q), hydrophobic (A, V, I,
L, M, F, Y, W), and special (C, G, P) side chains. Mutations within
a group are conservative and are more likely to maintain existing
properties while mutations across groups or within the special
group amino acids are more likely to result in substantial changes
of enzyme activity and/or specificity.
[0134] Another approach to increasing 3'-nucleotide discrimination
of Taq DNA polymerase is to employ residue substitutions that
decrease the flexibility of the binding pocket. Examples include
substitution of amino acid aliphatic side chains with aromatic side
chains, which lead to a higher energetic barrier to change rotamer
conformations. As explained above, the residues of the catalytic
core are preferably unaltered, residues spatially near the
catalytic core are given the greatest attention for change. For
example, three non-catalytic core residues of Table 2, H784, V783,
and R573 are herein proposed to be substituted for larger or less
flexible amino acids while the maintaining the general physical
characteristics of their side chains. These residues exhibit key
interactions with the ribose moiety of the primer through a
water-mediated hydrogen-bonding network. R573 also binds to the
primer base in the minor groove of primer-template duplex. Mutants
ID 1 to ID 4 were designed using this strategy (Table 3). The next
mutant, ID 5, Q582K, was designed to alter interactions with and
the position of the important H784 residue. It is seen from the
known crystal structure that Q582 is situated on the opposite side
of H784 from the oligonucleotide primer. Substitution of Q582H may
shift H784 towards the terminal primer nucleotide, leading to a
more constrained binding pocket. The interactions of residue 582
with the next-to-terminal nucleotide may also be affected.
[0135] Residues that stack above the incoming dNTP molecule can
also influence the size of the binding pocket in the polymerase
active site. For example, substitutions at F667, which is located
at this position, are known to change selectivity towards the
incoming dNTP. For example, the F667Y substitution significantly
improves incorporation of dideoxynucleoside triphosphates by Taq
DNA polymerase (Tabor, S. & Richardson, C. C., Proc. Nat. Acad.
Sci. USA 1995, 92:6339-6343), a useful property for DNA polymerases
employed in Sanger method terminator DNA sequencing. Mutant ID 6
increases the size of the aromatic side chain of F667 from
phenylalanine to tryptophan, in an attempt to push the dNTP against
the primer terminal ribonucleotide and decrease ability of binding
pocket to accommodate a 2' hydroxyl group, thereby biasing this
mutant against primers containing a 3'-RNA residue. Mutant ID7 was
designed based on similar conceptual framework. The H639 interacts
with F667 amino acid and H639W mutant might also push F667 towards
the incoming dNTP.
[0136] Additional mutations were considered that can effectively
reduce the binding pocket size of the polymerase. Mutants IDs 8 to
16 were designed from a negative inferential analysis based on
published studies of "relaxed specificity" mutant polymerases.
Mutations have been reported that can modify polymerase specificity
towards the ribose of the incoming dNTP. The prior art Taq DNA
polymerase variants described were evolved from large random
libraries either through selection or screening. Chen et al.
described mutations that allow Taq DNA polymerase to incorporate a
dNTP with large substituents on the ribose 3' carbon atom (Chen,
F., et al., Proc. Nat. Acad. Sci. USA 2010, 107:1948-1953). This
residue was found to be important because it also interacts with
F667. The substitution L616A decreases specificity by giving more
space to the phenylalanine residue. Mutant ID 8 (L616M) was
designed to produce the opposite effect. The methionine
substitution may subtly increase the steric constraints at this
site compared to leucine. This restriction may make the active site
less likely to accommodate extra substituents in a dNTP or in a
primer nucleotide, which could reduce activity of 3'-RNA containing
primers or those having a mismatch to template, which presumably
occupies more space than primers having a perfect match to the
template nucleic acid.
[0137] A similar conceptual framework was applied to design Taq DNA
polymerase mutant ID 9. Mutations I614E, E615G were reported to
relax the active site pocket, so that the polymerase could extend a
primer using 2'-O-methyl ribonucleoside triphosphates (Fa, M., et
al., J. Am. Chem. Soc. 2004, 126:1748-1754). The nature of these
mutations is essentially the shift of glutamic acid from residue
615 to 614. A shift in the opposing direction, E615L, L616E may
therefore impose constraints on the active site and produce a Taq
DNA polymerase mutant that will not accept ribonucleotide
residues.
[0138] Another approach to increasing 3'-nucleotide discrimination
is to focus on sites of interest identified in Taq DNA polymerase
studies that reported amino acid substitutions which increased base
selection fidelity and decreased incorporation of mispaired base
pairs (i.e., those mutation that improve replication fidelity).
These changes could potentially affect selectivity of Taq DNA
polymerase regarding to modifications of terminal primer nucleotide
as well. One location that was reported to improve fidelity
involves the F667 residue and neighboring amino acids (Suzuki, M.,
et al., J. Biol. Chem. 2000, 275:32728-32735). Another site of
potential interest includes residues 782 to 784, adjacent to an
essential aspartic acid residue (Strerath, M., et al., ChemBioChem
2007, 8:395-401). Mutants ID 10 to ID 13 were designed to alter
amino acid character at these positions. F667 affects specificity
as it interacts with the terminal base of the primer and stacks on
the base of the incoming dNTP; this residue resides in the O-helix.
Residues I665 and A661 are located on the opposite side of the
helix. Mutation here to larger amino acids (A661E,I665W) may move
the O-helix towards the active site, restricting the size of the
active pocket and limiting ability of the polymerase to accept
mispaired bases or RNA residues (Mutant ID 10:
A661E,I665W,F667L).
[0139] Data derived from mutagenesis studies of different
polymerases can also be used to help select positions for
modification, but use of this data is more difficult in the absence
of crystal structure or due to possible differences in effects
between the polymerases. Polymerase I from Escherichia coli ("E.
coli Pol") shows a somewhat similar structure at the active site
when compared to Taq DNA polymerase and maintains identical
essential catalytic residues. Both protein sequences exhibit high
degree of homology (Li, Y., et al., EMBO J. 1998, 17: 7514-7525).
Thus, mutations reported for Escherichia coli DNA polymerase were
also considered, by extrapolating amino acid position to the
corresponding positions in the Taq DNA polymerase. For example, the
triplet amino acid substitutions, Q879P, V880L, H881Q, improved
base fidelity of E. coli DNA polymerase (Summerer, D., et al.,
Angew. Chem. Int. Ed. 2005, 44:4712 -4715). Substitutions in mutant
ID 14 includes substitutions at Q782, V783, H784 in the Taq DNA
polymerase active site, which appear to correspond to this E. coli
residue triplet.
[0140] A number of additional substitutions in the E. coli DNA
polymerase are known which decrease or increase the specificity of
primer extension (Minnick, D. T., et al., J. Biol. Chem. 1999,
274:3067-3075). Mutants Q849A and R754A improved fidelity. These
have locations equivalent to Q754 and R659 in the Taq DNA
polymerase active site, respectively. Arginine 659 has a
significant impact on selection of the base complementary to the
template base. This appears to be general feature in the polymerase
A family. For example, in Thermotoga neapolitana polymerase I, the
equivalent residue is R722. Mutation of this residue to histidine
increases fidelity of this polymerase (Yang, S. W., et al., Nucleic
Acids Res. 2002, 30:4314-4320). These two residues were also
selected for study (mutants ID 15 and 16 of Table 3). Mutant ID 17
represents combination of the mutations studied in Mutants ID 2 and
3. Mutant ID 18 represents a modification of triple mutant ID 14
(Q782P, V783L, H784Q) reduced to a double mutant (V783L, H784Q) by
eliminating the Q782P mutation; the substitution of a less flexible
P for Q residue will likely cause significant structural
perturbation which would alter function, and Mut ID 18 may avoid
this problem. Initial testing indicated that more than one mutant
at position H784 showed improved mismatch discrimination,
suggesting that this position was generally important for
determining primer specifcity. Therefore a comprehensive study of
amino acid substitutions at this site was performed, comprising Mut
IDs 19-36.
TABLE-US-00003 TABLE 3 Novel Taq DNA polymerase mutants selected
for study. Specific amino acid changes from Mutant ID sequence in
Table I 1 V783I 2 V783F 3 H784Q 4 R573H 5 Q582K 6 F667W 7 H639W 8
L616M 9 E615L, L616E 10 A661E, I665W, F667L 11 Q782I, H784F 12
Q782I, V783L, H784L 13 Q782S, V783F, H784N 14 Q782P, V783L, H784Q
15 Q754A 16 R659H 17 V783F, H784Q 18 V783L, H784Q 19 H784G 20 H784A
21 H784S 22 H784T 23 H784C 24 H784V 25 H784L 26 H784I 27 H784M 28
H784P 29 H784F 30 H784Y 31 H784W 32 H784D 33 H784E 34 H784N 35
H784K 36 H784R
[0141] The second component of the design strategy includes
molecular biological and biochemical analyses of
genetically-engineered Taq DNA polymerase mutants to identify novel
enzymes having improved 3'-nucleotide discrimination. This requires
expression of native Taq DNA polymerase and the series of designed
mutants in a suitable host, such as the bacterium E. coli. To
maximize expression, the codons of the native gene sequence
encoding Taq DNA polymerase were altered and optimized for
expression in E. coli using standard codon usage tables for this
organism (see: Codon usage tabulated from the international DNA
sequence databases: status for the year 2000. Nakamura, Y.,
Gojobori, T. and Ikemura, T. (2000) Nucleic Acids Res. 28:292).
Codon optimization does not alter the amino acid sequence of the
expressed protein. A recombinant form of a codon-optimized gene
encoding the unaltered Taq DNA polymerase peptide was assembled and
cloned into a plasmid vector as an artificial gene made from
synthetic oligonucleotides using standard methods (Example 1). The
plasmid vector for this purpose can be any plasmid vector routinely
available in the art. Synthetic recombinant forms of the series of
identified desired Taq DNA polymerase mutants (Table 3, Mutant IDs
1-36) were prepared by site directed mutagenesis of the previously
assembled codon-optimized recombinant native Taq DNA polymerase as
the substrate for site directed mutagenesis (SDM), using techniques
well known to those with skill in the art (Example 1). The
unmodified and mutant Taq DNA polymerases were prepared from E.
coli host cells following introduction of expression vectors that
contain the corresponding recombinant forms of the genes operably
linked to suitable transcriptional and translational control
elements.
[0142] The enzymatic properties of the unmodified Taq DNA
polymerase and mutant Taq DNA polymerases were evaluated for primer
extension assays, thermostability, PCR assays, allele-specific PCR
assays, ability to employ primers having a 3'-ribonucleotide, as
well as their suitability for use in rhPCR assays. The mutant Taq
DNA polymerases displayed one of four categories of enzymatic
properties: (1) inactivated polymerase activity; (2) normal
polymerase activity; (3) improved 3'-nucleotide discrimination
activity, but having reduced activity (for example, reduced
processivity); and (4) improved 3'-nucleotide discrimination and
having normal or near normal polymerase activity (for example,
processivity comparable to the native polymerase).
[0143] Mutant Taq DNA polymerases having the fourth category of
enzymatic properties displayed comparable or enhanced 3'-mismatch
discrimination (that is, comparable or improved performance in
standard primer extension assays and allele-specific PCR assays
when compared to the wild-type Taq DNA polymerase); enhanced
3'-nucleotide discrimination (that is, reduced primer extension
activity from templates containing RNA-containing primers when
compared to the wild-type Taq DNA polymerase) and enhanced rare
allele discrimination (for example, improved specificity in rhPCR
assay when compared to the wild-type Taq DNA polymerase). These
mutant Taq DNA polymerases include mutations at one of the
following residue position(s): (1) A661E; I665W; F667L triple
substitution mutant peptide (Mutant ID 10 of Table 3); (2) V783F
single substitution mutant peptide (Mutant ID 2 of Table 3); H784Q
single substitution mutant peptide (Mutant ID 3 of Table 3); and
V783L; H784Q double substitution mutant peptide (Mutant ID 18 of
Table 3), H784A, single substitution mutant peptide (Mutant ID 20
of Table 3); H784S, single substitution mutant peptide (Mutant ID
21 of Table 3); H784T, single substitution mutant peptide (Mutant
ID 22 of Table 3); H784V, single substitution mutant peptide
(Mutant ID 24 of Table 3); H784I, single substitution mutant
peptide (Mutant ID 26 of Table 3); H784M, single substitution
mutant peptide (Mutant ID 27 of Table 3); H784F, single
substitution mutant peptide (Mutant ID 29 of Table 3); and H784Y
single substitution mutant peptide (Mutant ID 30 of Table 3).
[0144] Thus, the novel design algorithm provides a robust approach
to predict mutant DNA polymerases having improved 3'-nucleotide
discrimination, as adjudged by their activity in allele-specific
PCR, rare allele detection assays and rhPCR assays that utilize
templates with or without a 3'-RNA residue in the primer.
Specifically, residues V783 and H784 were identified as critical
residues which influence the ability of the polymerase to
interrogate the status of the 3'-base of the primer oligonucleotide
(e.g., whether this residue is matched or mismatched with template
and/or whether this residue is DNA or RNA). The significance of
these residues in polymerase function was heretofore not
appreciated. In addition to the mutations directly testing in the
example, the present invention also contemplates other amino acid
substitutions at these two positions, or double-mutants affecting
both the V783 and H784 sites.
[0145] The properties of these mutants are further described in the
Examples presented herein. Importantly, however, the design
strategy employed herein enables access to functional space for
novel Taq DNA polymerase mutants that were previously unrecognized
or predicted or otherwise not obtained using other approaches (for
example, phylogenetic comparative analysis or earlier attempts
using random mutagenesis).
Evaluation of Taq DNA Polymerase Mutants at Residue Positions 783
and 784
[0146] The present disclosure demonstrates that mutation at residue
positions 783 and/or 784 results in active Taq DNA polymerase
mutants having enhanced template discrimination activity, as
compared to unmodified Taq DNA polymerase. Thus, the entirety of
the sequence space that includes every conceivable single amino
acid substitution at the individual positions 783 or 784 as well as
every conceivable double amino acid substitution at both positions
783 and 784 fall within the scope of the present disclosure as
related to Taq DNA polymerase. Accordingly, those active Taq DNA
polymerase mutants selected from the mutant sets of 19 single
residue 783 mutants, 19 single residue 784 mutants (Table 3 Mut IDs
19-30) and 361 double residue 783/784 mutants that also possess
enhanced template discrimination activity fall within the scope of
the present disclosure.
[0147] Because Taq DNA polymerase is a thermostable enzyme, one
facile approach to screening the candidate collection of 399
single- and double-substitution mutants at residue positions 783
and 784 is to perform a PCR assay with a pre-treated sample
encoding a candidate Taq DNA polymerase mutant enzyme. The sample
can be a selected individual colony or corresponding micro-cultures
(for example, 50 .mu.L to 1.0 mL cultures) obtained from the
individual colony transformed with recombinant DNA that expresses a
desired recombinant Taq DNA polymerase mutant gene. The
pre-treatment regimen can include the step of pre-incubating the
sample at 70-95.degree. C., followed by the step of clarifying the
supernatant to remove the denatured cellular debris. For samples
that express thermostable polymerase activity under standard PCR
assay conditions, the corresponding recombination DNA can be
further characterized to confirm the sequence of the desired
recombinant Taq DNA polymerase mutant genotype and the polymerase
protein purified for additional biochemical analysis. For the
purposes of this disclosure, a Taq DNA polymerase mutant that
expresses thermostable polymerase activity at a level of at least
0.01 of that expressed by wild-type Taq DNA polymerase under
comparable PCR assay conditions can be adjudged as possessing
thermostable polymerase activity.
Evaluation of Other Select Polymerase Candidate Mutants
Functionally Homologous to Taq DNA Polymerase at Residue Positions
783 and 784
[0148] Comparative phylogenetic analysis tools can be used to
identify the sequence space of other thermoactive polymerases
having homologous sequence information relative to the unmodified
Taq DNA polymerase at residue positions corresponding to V783 and
H784. As explained supra, a strong prediction of the comparative
phylogenetic analysis is that structural sequences shared among DNA
polymerases across phylogenetically diverse species are conserved
for functional reasons. If the identified V783/H784 residues of Taq
DNA polymerase are invariant in sequence identity among wild-type
polymerases from diverse species, that observation strongly
supports the conclusion that nature selected against the specific
variation of amino acid substitutions at those positions that
result the observed enhanced template discrimination activity of
the engineered Taq DNA polymerase mutants disclosed herein.
[0149] Example 11 provides an exemplary BLAST search using Taq DNA
polymerase sequences encompassing positions V783 and H784 as a
comparison window to identify candidate wild-type DNA polymerases
from other species sharing extensive sequence identity with Taq DNA
polymerase. As further elaborated in Example 11, the BLAST results
revealed that virtually every identified DNA polymerase from
diverse species has maintained Val and His at positions orthologous
to V783 and H784 of Taq DNA polymerase. Thus, the BLAST results
confirm a natural counter-selection against DNA polymerases having
enhanced template discrimination activity and provide strong
evidence that the disclosed engineered Taq DNA polymerase mutants
having these properties are novel and non-obvious. Like that
observed with the engineered Taq DNA polymerase mutants, each of
the identified non-Taq DNA polymerases represent a sequence space
from which engineered mutant enzymes can be generated having
enhanced template discrimination activity, as compared to their
respective unmodified counterparts.
[0150] In those cases where comparative phylogenetic analysis
cannot access the sequence space of more evolutionary distant
organisms, a comparative biophysical crystallographic analysis can
provide clues to the relevant sequence residues having functional
homology to Taq DNA polymerase resides V783 and H784. As explained
supra, the Q782, V783 and H784 residue triplet of Taq DNA
polymerase was selected for analysis based upon the corresponding
triplet amino acid substitutions Q879P, V880L and H881Q of E. coli
DNA polymerase having improved base fidelity and a similar active
site architecture to that of Taq DNA polymerase. Conversely, based
upon the noted enhanced template discrimination activity of V783
and H784 Taq DNA polymerase mutants relative to wild-type Taq DNA
polymerase, the present disclosure contemplates that the
corresponding substitutions at V880 and H881 of the E. coli DNA
polymerase will possess enhanced template discrimination activity
relative to wild-type E. coli DNA polymerase.
Identification and Characterization of Non-VH-Related Polymerase
Mutants having Enhanced Template Discrimination Activity.
[0151] The foregoing collection of DNA polymerases share
extensively conserved sequences in the region corresponding to V783
and H784 of Taq DNA polymerase ("VH-related polymerases").
Comparative biophysical analysis is useful for identifying
wild-type DNA polymerases having different amino acid sequences in
the functionally homologous positions as V783 and H784 of Taq DNA
polymerase ("non-VH-related DNA polymerases"). The instant
disclosure contemplates engineering mutant polymerases having
enhanced template discrimination activity from these non-VH-related
DNA polymerases in the same manner as disclosed for the VH-related
DNA polymerases. Candidate non-VH resides for directed mutagenesis
and analysis by enhanced template discrimination activity assays
include those resides within 0.40-0.45 nm of the C2' of the primer
terminal residue, as revealed in the polymerase:template co-crystal
structure.
Combination of Site-Specific Taq DNA Mutants with Deletion of the
5'-Exonuclease Domain.
[0152] The present invention discloses novel Taq DNA Polymerase
mutants that show improved discrimination of mismatches positioned
at the 3'-residue of the primer oligonucleotide and/or
discrimination against the presence of an RNA residue at the 3'-end
of the primer oligonucleotide. Improved mismatch discrimination has
been described for the "KlenTaq" deletion mutant of Taq DNA
Polymerase, which entirely removes the domain having 5'-exonuclease
activity (Barnes, W. M., Gene 112:29-35, 1992). Combination of the
novel mutants of the present invention with the KlenTaq
5'-exonuclease domain deletion led to further improvements in
mismatch discrimination (Examples 18-22), however this comination
led to decreases in enzymatic activity which may reduce utility of
this family of double-mutants. In some circumstances, particularly
when amplicon size is small and limited processivity could be
tolerated, the enhanced decrimination of these mutants will have
benefit.
Reaction Mixtures
[0153] In another aspect, reaction mixtures are provided comprising
the polymerases with increased 3'-nucleotide discrimination
activity. The reaction mixtures can further comprise reagents for
use in, for example, nucleic acid amplification procedures (for
example, PCR, RT-PCR, rhPCR), DNA sequencing procedures, or DNA
labeling procedures. For example, in certain embodiments, the
reaction mixtures comprise a buffer suitable for a primer extension
reaction. The reaction mixtures can also contain a template nucleic
acid (DNA and/or RNA), one or more primer or probe polynucleotides,
nucleoside triphosphates (including, for example,
deoxyribonucleotides, ribonucleotides, labeled nucleotides,
unconventional nucleotides), salts (for example, Mn.sup.2+,
Mg.sup.2+), and labels (for example, fluorophores). In some
embodiments, the reaction mixture further comprises double stranded
DNA binding dyes, such as SYBR green, or double stranded DNA
intercalating dyes, such as ethidium bromide. In some embodiments,
the reaction mixtures contain a 5'-sense primer hybridizable, under
primer extension conditions, to a predetermined polynucleotide
template, or a primer pair comprising the 5'-sense primer and a
corresponding 3'-antisense primer. In certain embodiments, the
reaction mixture further comprises a fluorogenic FRET hydrolysis
probe for detection of amplified template nucleic acids, for
example a Taqman.RTM. or PrimeTime.RTM. probe. In some embodiments,
the reaction mixture contains two or more primers that are fully
complementary to single nucleotide polymorphisms or multiple
nucleotide polymorphisms. In some embodiments, the reaction
mixtures contain alpha-phosphorothioate dNTPs, dUTP, dITP, and/or
labeled dNTPs such as, for example, fluorescein- or cyanin-dye
family dNTPs. In some embodiments, the reaction mixtures contain
blocked-cleavable primers and RNase H2.
Kits
[0154] In another aspect, kits are provided for use in primer
extension methods described herein. In some embodiments, the kit is
compartmentalized for ease of use and contains at least one
container providing a DNA polymerase of the invention having
increased 3'-nucleotide discrimination in accordance with the
present disclosure. One or more additional containers providing
additional reagent(s) can also be included. Such additional
containers can include any reagents or other elements recognized by
the skilled artisan for use in primer extension procedures in
accordance with the methods described above, including reagents for
use in, for example, nucleic acid amplification procedures (for
example, PCR, RT-PCR, rhPCR), DNA sequencing procedures, or DNA
labeling procedures. For example, in certain embodiments, the kit
further includes a container providing a 5'-sense primer
hybridizable, under primer extension conditions, to a predetermined
polynucleotide template, or a primer pair comprising the 5'-sense
primer and a corresponding 3'-antisense primer. In some
embodiments, the kit includes one or more containers containing one
or more primers that are fully complementary to single nucleotide
polymorphisms or multiple nucleotide polymorphisms, wherein the
primers are useful for multiplex reactions, as described above. In
some embodiments, the reaction mixtures contain one or more
containers containing blocked-cleavable primers. In some
embodiments, the reaction mixtures contain one or more containers
containing RNase H2. In other, non-mutually exclusive variations,
the kit includes one or more containers providing nucleoside
triphosphates (conventional and/or unconventional). In specific
embodiments, the kit includes alpha-phosphorothioate dNTPs, dUTP,
dITP, and/or labeled dNTPs such as, for example, fluorescein- or
cyanine-dye family dNTPs. In still other, non-mutually exclusive
embodiments, the kit includes one or more containers providing a
buffer suitable for a primer extension reaction. In some
embodiments, the kit includes one or more labeled or unlabeled
probes. Examples of probes include dual-labeled FRET (fluorescence
resonance energy transfer) probes and molecular beacon probes. In
another embodiment, the kit contains an aptamer, for example, for
hot start PCR assays.
[0155] The present disclosure contemplates kits that provide novel
DNA polymerases having enhanced template discrimination activity.
As demonstrated in more detail in the examples, each DNA polymerase
can display a unique signature of enhanced template discrimination
activity. Certain DNA polymerases can display a relatively greater
3'-nucleotide discrimination, as compared to its other activities
(3'-mismatch discrimination and rare allele discrimination), while
other DNA polymerases can display a relatively greater 3'-mismatch
discrimination, as compared to its other activities (3'-nucleotide
discrimination and rare allele discrimination), and yet other DNA
polymerases can display a relatively greater rare allele
discrimination, as compared to its other activities (3'-nucleotide
discrimination and 3'-mismatch discrimination). Accordingly, kits
can include individual containers of specific DNA polymerases
having an activity profile optimally tailored to a specific
enhanced template discrimination activity for a specific assay
platform. Alternatively, kits can include a single container that
includes a plurality of DNA polymerases having an activity profile
optimally tailored to accommodate enhanced template discrimination
activity as may be needed for a plurality of assay platforms.
EXAMPLES
[0156] The present invention is further illustrated by reference to
the following Examples. However, it should be noted that these
Examples, like the embodiments described above, are illustrative
and are not to be construed as restricting the enabled scope of the
invention in any way.
Example 1
Cloning and Expression of a Codon Optimized DNA Polymerase from
Thermus aquaticus
[0157] The amino acid and gene sequences for Taq DNA polymerase are
known (Table 1, SEQ ID NOs. 1 and 2). Because codon usage differs
among organisms, the codons of the native gene sequence encoding
Taq DNA polymerase were optimized for expression in E. coli using
standard codon usage tables (see: Codon usage tabulated from the
international DNA sequence databases: status for the year 2000.
Nakamura, Y., Gojobori, T. and Ikemura, T. (2000) Nucleic Acids
Res. 28:292); synonymous codon changes were introduced to avoid
repeated use of identical codons over a 20 amino acid stretch. A
recombinant codon-optimized gene encoding the Taq DNA polymerase
unmodified peptide was assembled from synthetic oligonucleotides
using standard methods. The gene was made in three fragments, each
of which was subcloned in a plasmid vector; sequences are shown in
Table 4 (SEQ ID NOs. 3-5). Sequence identity was verified by Sanger
DNA sequencing. The three Taq DNA polymerase subfragments were
assembled together using the Gibson assembly method (Gibson, D. G.
et al. Nature Methods, 343-345 (2009)) and cloned into a the
plasmid expression vector pET-27b(+) using terminal Nde I and Not I
restrictions sites to create a final, full-length codon optimized
Taq DNA polymerase gene (designated "OptiTaq"). Sequence was
verified by Sanger DNA sequencing; sequence is shown in Table 4
(SEQ ID NO. 6). The translated amino acid sequence of the new codon
optimized gene is identical to native Taq DNA polymerase (Table 1,
SEQ ID NO. 1).
TABLE-US-00004 TABLE 4 DNA sequence of Tag DNA Polymerase
codon-optimized for expression in E. coli. Name Sequence SEQ ID NO.
3 CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTTAGTCGATGGTCA
Taq subfragment
TCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTCTGACGACCAGTCGTGGCGAACCGG #1
TCCAGGCTGTTTATGGTTTCGCTAAGTCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCG
GTAATTGTTGTATTTGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAA
GGCAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATTAAGGAGTTAG
TAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTATGAGGCGGACGATGTCCTTGCA
TCCTTGGCTAAAAAGGCCGAAAAAGAGGGCTACGAAGTCCGCATCTTGACGGCAGACAAAGA
TCTGTACCAGCTTCTGTCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTC
CGGCCTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATCGGGCTTTG
ACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATTGGTGAAAAAACCGCACGTAA
GCTGCTTGAAGAGTGGGGTTCCCTGGAAGCCTTGTTAAAAAATCTGGATCGTCTCAAGCCCG
CAATTCGTGAAAAGATCCTGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAG
GTGCGCACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCGGGAACG
TTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTCATGAATTCGGTCTGT SEQ ID
NO. 4
TCGGTTCACTGCTTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCG Taq
subfragment
TGGCCGCCCCCAGAAGGTGCTTTTGTTGGCTTCGTACTTTCCCGTAAGGAGCCTATGTGGGC #2
AGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGTTCACCGGGCCCCTGAGCCATACA
AAGCGTTACGTGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTGTTTTGGCC
CTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGA
CCCTAGCAATACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACTGAGGAAG
CCGGAGAGCGCGCCGCATTGTCCGAACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGG
GAGGAACGTCTGTTATGGTTGTATCGGGAAGTCGAACGTCCTCTTTCGGCCGTATTAGCGCA
TATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTATCACTGGAAGTTG
CAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTAACCTC
AACTCCCGTGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAA
AACCGAAAAGACTGGCAAACGCAGTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTC
ACCCTATTGTAGAAAAGATCCTGCAATACCGTGAGTTGACGAAGCTTAAAAGCACTTATATT
GATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACGTTTCAACCAGAC
GGCGACTGCAAC SEQ ID NO. 5
CACACGTTTCAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCC Taq
subfragment
AGAACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTATCGCTGAGGAA #3
GGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCTGCGCGTCCTCGCACATCTCTC
TGGTGACGAAAATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACACAGAAACTGCCT
CATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACA
ATTAATTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGGCAATCCC
CTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCAT
GGATCGAGAAGACGCTCGAGGAAGGTCGTCGTCGGGGCTATGTCGAAACTCTGTTTGGTCGC
CGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGGCTGCGGAGCGTAT
GGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGTCAAGC
TTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGGTCCATGACGAGCTGGTG
TTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGG
CGTTTACCCATTGGCCGTACCCCTCGAAGTGGAGGTCGGTATTGGAGAAGATTGGTTATCTG
CAAAGGAAGCGGCCGC SEQ ID NO. 6
CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTTAGTCGATGGTCA
Complete codon-
TCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTCTGACGACCAGTCGTGGCGAACCGG
optimized Taq
TCCAGGCTGTTTATGGTTTCGCTAAGTCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCG DNA
polymerase
GTAATTGTTGTATTTGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAA
"OptiTaq"
GGCAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATTAAGGAGTTAG
TAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTATGAGGCGGACGATGTCCTTGCA
TCCTTGGCTAAAAAGGCCGAAAAAGAGGGCTACGAAGTCCGCATCTTGACGGCAGACAAAGA
TCTGTACCAGCTTCTGTCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTC
CGGCCTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATCGGGCTTTG
ACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATTGGTGAAAAAACCGCACGTAA
GCTGCTTGAAGAGTGGGGTTCCCTGGAAGCCTTGTTAAAAAATCTGGATCGTCTCAAGCCCG
CAATTCGTGAAAAGATCCTGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAG
GTGCGCACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCGGGAACG
TTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTCATGAATTCGGTCTGTTAG
AGTCTCCTAAAGCACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTTGTTGGCTTC
GTACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGG
CCGTGTTCACCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGTGGCT
TGCTGGCAAAAGACCTTTCTGTTTTGGCCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGAC
GATCCCATGTTATTGGCCTATCTGTTAGACCCTAGCAATACCACACCTGAAGGGGTCGCTCG
TCGGTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTCCGAACGGCTCT
TTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAGTC
GAACGTCCTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTGCGTTTAGATGTCGC
GTACCTTCGGGCCTTATCACTGGAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGT
TCCGGTTGGCCGGTCACCCGTTTAACCTCAACTCCCGTGACCAGCTGGAACGCGTTTTATTC
GATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAACGCAGTACGAGCGC
TGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCCTGCAATACCGTG
AGTTGACGAAGCTTAAAAGCACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACC
GGCCGCTTGCACACACGTTTCAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGA
TCCAAATCTCCAGAACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTA
TCGCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCTGCGCGTCCTC
GCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACAC
AGAAACTGCCTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCCGTG
CAGCTAAAACAATTAATTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAA
CTGGCAATCCCCTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCGTTTCCGAA
AGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCGTCGGGGCTATGTCGAAACTC
TGTTTGGTCGCCGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGGCT
GCGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGC
AATGGTCAAGCTTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGGTCCATG
ACGAGCTGGTGTTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTCGCGCGCCTCGCTAAAGAA
GTGATGGAGGGCGTTTACCCATTGGCCGTACCCCTCGAAGTGGAGGTCGGTATTGGAGAAGA
TTGGTTATCTGCAAAGGAAGCGGCCGC For the final completed "OptiTaq"
clone, Nde I and Not I restrictions sites are underlined. The ATG
start codon is identified in bold font.
Example 2
Production of Codon Optimized Taq DNA Polymerase Mutants
[0158] Eighteen mutant versions of Taq DNA polymerase (Table 3, Mut
IDs 1-18) were made by site directed mutagenesis of the cloned
OptiTaq codon-optimized Taq DNA polymerase. Specific mutations were
introduced into the OptiTaq sequence using the method of PCR
site-directed mutagenesis (Weiner M P, et al., Gene.
151(1-2):119-23 (1994)). Each mutagenesis reaction employed 10
pmoles of two complementary oligonucleotides (Table 5) containing
the desired base changes, annealed to the double-stranded OptiTaq
plasmid (20 ng), 5 U KOD DNA polymerase (Novagen-EMD Chemicals, San
Diego, Calif.), 1.5 mM MgSO.sub.4, in 1.times. KOD PCR buffer.
Thermal cycling parameters were 95.degree. C. for 3 minutes
(95.degree. C. for 20 sec-55.degree. C. for 20 sec-70.degree. C.
for 2.5 minutes) for 16 cycles followed by a 70.degree. C. soak for
4 minutes. After PCR site-directed mutagenesis, the amplified
product was treated with 10 U of Dpn I (NEB, Ipswich, Mass.), at
37.degree. C. for 1 hour, followed by inactivation at 80.degree. C.
for 20 minutes. 1/110.sup.th of the digestion material was
transformed into XL-1 Blue competent bacteria. Bacterial clones
were isolated, plasmid DNA prepared, and individual mutations were
confirmed by Sanger DNA sequencing. All mutants remained in the
pET-27b(+) expression vector, which is suitable for expressing the
recombinant proteins in E. coli.
TABLE-US-00005 TABLE 5 Oligonucleotides used for site-directed
mutagenesis to produce 18 Tag DNA Polymerase mutants. Amino
Sequence'' Sequence'' Mutant acid Sense mutagenesis SEQ Antisense
mutagenesis SEQ ID changes oligonucleotide ID No. oligonucleotide
ID No. 1 V783I aatgggcgcacgtatgcttct 7 gggcttctaacaccagctcgtca 8
gcagATTcatgacgagctggt tgAATctgcagaagcatacgtgc gttagaagccc gcccatt 2
V783F aatgggcgcacgtatgcttct 9 gggcttctaacaccagctcgtca 10
gcagTTCcatgacgagctggt tgGAActgcagaagcatacgtgc gttagaagccc gcccatt 3
H784Q gggcgcacgtatgcttctgca 11 taggggcttctaacaccagctcg 12
ggtcCAGgacgagctggtgtt tcCTGgacctgcagaagcatacg agaagccccta tgcgccc 4
R573H caaccagacggcgactgcaac 13 ggagatttggatccgagctagac 14
cggcCATctgtctagctcgga agATGgccggttgcagtcgccgt tccaaatctcc ctggttg 5
Q582K tctgtctagctcggatccaaa 15 ccaagggtgtacggaccggaatg 16
tctcAAAaacattccggtccg ttTTTgagatttggatccgagct tacacccttgg agacaga 6
F667W gcgccgtgcagctaaaacaat 17 gagcgctcattccgtacagcact 18
taatTGGggagtgctgtacgg ccCCAattaattgttttagctgc aatgagcgctc acggcgc 7
H639W cgtgtttcaagaggggcgtga 19 cgaacatccatgaggcagtttct 20
tattTGGacagaaactgcctc gtCCAaatatcacgcccctcttg atggatgttcg aaacacg 8
L616M cgcattggactactcgcagat 21 caccagagagatgtgcgaggacg 22
tgagATGcgcgtcctcgcaca cgCATctcaatctgcgagtagtc tctctctggtg caatgcg 9
E615L ggtcgcattggactactcgca 23 caccagagagatgtgcgaggacg 24 L616E
gattCTGGAGcgcgtcctcgc cgCTCCAGaatctgcgagtagtc acatctctctggtg
caatgcgacc 10 A661E cgtgaagcagtggatcctttg 25
gcgatgagcgctcattccgtaca 26 I665W atgcgccgtGAAgctaaaaca
gcactccCAAattCCAtgtttta F667L TGGaatTTGggagtgctgtac
gcTTCacggcgcatcaaaggatc ggaatgagcgctcatcgc cactgcttcacg 28 11 Q782I
ggaaatgggcgcacgtatgct 27 taggggcttctaacaccagctcg H784F
tctgATCgtcTTCgacgagct tcGAAgacGATcagaagcatacg ggtgttagaagccccta
tgcgcccatttcc 12 Q782I ggaaatgggcgcacgtatgct 29
taggggcttctaacaccagctcg 30 V783L tctgATTTTGCTGgacgagct
tcCAGCAAAATcagaagcatacg H784L ggtgttagaagccccta tgcgcccatttcc 13
Q782S ggaaatgggcgcacgtatgct 31 taggggcttctaacaccagctcg 32 V783F
tctgTCCTTCAACgacgagct tcGTTGAAGGAcagaagcatacg H784N
ggtgttagaagccccta tgcgcccatttcc 14 Q782P ggaaatgggcgcacgtatgct 33
taggggcttctaacaccagctcg 34 V783L tctgCCGTTACAGgacgagct
tcCTGTAACGGcagaagcatacg H784Q ggtgttagaagccccta tgcgcccatttcc 15
Q754A gcgtatggcatttaatatgcc 35 gtttcatgaggtcagctgcagta 36
tgtaGCGggtactgcagctga ccCGCtacaggcatattaaatgc cctcatgaaac catacgc
16 R659H acgtgaagcagtggatccttt 37 caaaattaattgttttagctgca 38
gatgCACcgtgcagctaaaac cgGTGcatcaaaggatccactgc aattaattttg ttcacgt
17 V783F aatgggcgcacgtatgcttct 39 GcttctaacaccagctcgtcCTG 40 H784Q
gcagTTCCAGgacgagctggt GAActgcagaagcatacgtgcgc gttagaagc ccatt 18
V783L aatgggcgcacgtatgcttct 41 gggcttctaacaccagctcgtcC 42 H784Q
gcagCTGCAGgacgagctggt TGCAGctgcagaagcatacgtgc gttagaagccc gcccatt
DNA bases identical to codon optimized OptiTaq are shown in lower
case; those specific for the mutations introduced by site-directed
mutagenesis are shown in upper case.
Example 3
Expression of Recombinant Taq DNA Polymerases
[0159] The following example demonstrates the expression of
recombinant Taq DNA polymerase unmodified and mutant peptides. The
synthetic gene sequences from Examples 1, 2 and 12 were cloned in
the pET-27b(+) expression vector (Novagen, EMD Biosciences, La
Jolla, Calif.). This vector places six histidine residues (which
together comprise a "His-tag") at the carboxy terminus of the
expressed peptide, followed by a stop codon. A "His-tag" permits
use of rapid, simple purification of recombinant proteins using
Ni.sup.2+ affinity chromatography methods which are well known to
those with skill in the art. Alternatively, the synthetic genes
could be expressed in native form without the His-tag and purified
using size exclusion chromatography, anion-exchange chromatography,
or other such methods, which are also well known to a person of
ordinary skill in the art.
[0160] BL21(DE3) competent E. coli cells (Novagen) were transformed
with .about.1 ng of each plasmid. Briefly, plasmids were added to
the cells on ice and gently stirred. After a 5 minute incubation on
ice, cells were heat shocked at 42.degree. C. for 30 seconds, then
returned to ice for 2 minutes. Room temperature SOC (80 .mu.L) was
added to the transformed cells, followed by a 1 hour outgrow period
at 37.degree. C., with agitation at 250 rpm. Cells were plated (20
.mu.L) on 37.degree. C. pre-warmed LB/Kan plates (Luria Broth agar
plates supplemented with 50 .mu.g/mL kanamycin) and were placed at
37.degree. C. overnight. The next morning, one colony was picked
and grown (37.degree. C., 250 rpm) in 10 mL LB/Kan broth (50
.mu.g/mL) to log phase (OD600 0.3-0.9). Cells were then induced
with Overnight Express.TM. Autoinduction System 1 (Novagen) in
Terrific Broth at 37.degree. C., 250 rpm following the protocol
recommended by the manufacturer. Culture volumes were 100 mL for
wild type OptiTaq and 200 mL for mutants. Growth saturation was
reached after 18 hours, and the culture was pelleted at
10,000.times.g for 10 minutes in a Beckman Avanti.TM. J-25
Centrifuge. The pellet (.about.6 g) was lysed using 30 mL
BugBuster.RTM. Protein Extraction Reagent (Novagen), 30 kU
rLysozyme.TM. Solution (Novagen) and 1500 U DNase I (Life
Technologies, Grand Island, N.Y.) to release soluble proteins and
degrade nucleic acids according to the manufacturer's instructions.
Following centrifugation at 15,000.times.g for 20 minutes to remove
cell debris, the lysates were heated at 75.degree. C. for 15
minutes to inactive DNase I and other cellular nucleases. The
lysates were then spun at 15,000.times.g for 20 minutes to sediment
denatured protein. The heat denaturation and centrifugation steps
provide significant purity enrichment of the recombinant enzymes.
Both "total" and "soluble" fractions of the bacterial lysates were
analyzed using SDS 4-20% polyacrylamide gel electrophoresis for 1
hour at 125 V. Proteins were visualized with Coomassie Blue
staining for 1 hour, followed by 3-4 rounds of destaining until
protein bands were clear.
[0161] The recovered soluble protein was passed over a Ni.sup.2+
affinity column containing His Bind Resin (Novagen) and eluted with
a buffer containing 200 mM imidazole (200 mM imidazole, 500 mM
NaCl, 20 mM Tris-HCl, pH 7.9). The purified protein (.about.6 mL)
was then concentrated at 3210.times.g in a Beckman Coulter 6R
tabletop centrifuge swinging bucket rotor using an Amicon Ultra-15,
PLGC Ultracel-PL Membrane, 10 KDa concentrator (EMD Millipore,
Billerica, Mass.) to .about.200 .mu.L and stored at -20.degree. C.
until dialysis. The concentrated protein was then dialyzed against
storage buffer (20 mM Tris pH 7.5, 100 mM NaCl, 1 mM DTT, 0.1 mM
EDTA, 50% glycerol, 0.1% Triton X-100) at 4.degree. C. overnight,
followed by 3.times.2 hours (at 1000 fold ratio of protein solution
to dialysis buffer each time). The final purified protein was
stored at -20.degree. C. Using this protocol, 100 mL of an
autoinduced culture yielded .about.1.2 mg/67.6 .mu.M/12,168 pmol of
purified soluble protein for OptiTaq. Similar yields were obtained
for the mutant DNA polymerases.
[0162] To determine protein concentration, samples were examined
alongside known quantities of BSA (bovine serum albumin) using SDS
4-20% polyacrylamide gel electrophoresis for 1 hour. Proteins were
visualized with Coomassie Blue staining for 1 hour, followed by 3-4
rounds of destaining until protein bands were clear. Band intensity
was analyzed using ImageJ software (National Institutes of Health,
Bethesda, Md.).
[0163] To evaluate purity and quality of the recombinant protein
preparations, 500 ng of each recombinant protein (wild type OptiTaq
and each mutant) were separated on a 4-20% SDS-PAGE gel, stained
with Coomassie Blue, and visualized. The recombinant proteins all
migrate at the appropriate position on the gel for proteins having
a molecular weight of 97.1 kDa. The preparations show relatively
high purity with few additional species detected. Gel images are
shown in FIGS. 2A, 2B, 2C, and 2D. Similar gels were run for MUT
IDs 22 (H784T), 24 (H784V), 30 (H784Y), 31 (H784W), and 35 (H784K),
and single bands corresponding to the desired recombinant protein
were visualized (data not shown).
[0164] The purified enzymes were tested for nuclease contamination
using DNaseAlert.TM. and RNaseAlert.RTM. nuclease detection kits
(Integrated DNA Technologies, Coralville, Iowa) following protocols
recommended by the manufacturer. All enzyme preparations were
determined to be free of contaminating nucleases.
Example 4
Characterization of Properties of 18 Mutant Taq DNA Polymerases in
PCR
[0165] The 18 mutant Taq DNA polymerase enzymes described in
Example 3 were characterized for polymerase activity and the
ability to discriminate a 3'-RNA residue in the primer
oligonucleotide.
[0166] The unit activity of the purified wild-type protein was
determined by comparing performance in qPCR of known quantities of
OptiTaq and each mutant compared to a commercial non-hot-start Taq
DNA polymerase, Taq-B DNA Polymerase (Enzymatics, Beverly, Mass.).
Quantification cycle values (Cq, the amplification cycle number at
which positive signal is first detected) and amplification curve
shapes were analyzed to determine the nanogram amounts at which
both enzymes performed similarly in the suboptimal range for each.
Using these nanogram amounts and known unit values of Taq-B DNA
polymerase, relative activity unit values could be extrapolated for
all of the mutant DNA polymerase enzymes having sufficient activity
to support PCR.
[0167] The following reaction conditions were employed: 1.times.
qPCR buffer (20 mM Tris pH 8.4, 50 mM KCl, 3 mM MgCl.sub.2, 0.01%
Triton-X100), 800 .mu.M dNTPs (200 .mu.M each), 500 nM For primer
(Hs HPRT F517, SEQ ID NO. 43), 500 nM Rev primer (Hs HPRT R591, SEQ
ID NO. 44), 250 nM probe (Hs HPRT P554, SEQ ID NO. 45),
2.times.10.sup.3 copies of linearized cloned plasmid template
(HPRT-targ, SEQ ID NO. 46), in 10 .mu.L final volume. The amount of
DNA polymerase added to each reaction was varied as follows: for
wild type (OptiTaq), reactions were set using 10, 1, 0.1, 0.01, and
0.001 U/.mu.L (220, 22, 2.2, 0.22, or 0.022 ng of protein per 10
.mu.L reaction). Mutant polymerases were run in similar
concentrations. In addition, those mutant enzymes showing
polymerase activity were more finely titrated testing 220, 22,
10.6, 4.8, 2.2, 1.1, 0.48, and 0.22 ng of protein per 10 .mu.L
reaction. Enzyme dilutions were made in enzyme dilution buffer (20
mM Tris pH 7.5, 100 mM NaCl, 1 mM DTT, 0.1% Triton-X100, 1 mg/mL
BSA, 10% glycerol). Reactions were run in 384 well format on a
BIO-RAD CFX384.TM. Real-Time System (BIO-RAD, Hercules, Calif.)
using cycling parameters 95.degree. C. for 30 seconds followed by
60 cycles of [95.degree. C. for 15 seconds followed by 60.degree.
C. for 1 minutes]. Detection was achieved using a
fluorescence-quenched probe (5'-nuclease assay format, note that
the mutations introduced into the present series of Taq mutants do
not lie in the 5'-nuclease domain). Sequences of the primers,
probe, and template (plasmid insert) are shown in Table 6.
TABLE-US-00006 TABLE 6 Sequence of oligonucleotides employed in Taq
DNA polymerase activity assay. Name Sequence SEQ ID NO. Hs HPRT
GACTTTGCTTTCCTTGGTCAG SEQ ID NO. 43 F517 Hs HPRT
GGCTTATATCCAACACTTCGTG SEQ ID NO. 44 R591 Hs HPRT
FAM-ATGGTCAAG(ZEN)GTCGCAAGCTTGCTGGT-IBFQ SEQ ID NO. 45 P554 HPRT-
GACTTTGCTTTCCTTGGTCAGGCAGTATAATCCAAAGATG SEQ ID NO. 46 targ
GTCAAGGTCGCAAGCTTGCTGGTGAAAAGGACCCCACGAA GTGTTGGATATAAGCC Nucleic
acid sequences are shown 5'-3'. FAM = 6-carboxyfluorescein, IBFQ =
Iowa Black FQ (fluorescence quencher), and ZEN = ZEN internal
fluorescence quencher.
[0168] These 18 Taq DNA polymerase mutants were characterized as
outlined above. Results are summarized in Table 7. Six mutants,
including Mutant IDs 4, 5, 9 12, 13, and 17, did not show
detectable DNA polymerase activity and were not studied further.
Six mutants, Mutant IDs 6, 7, 11, 14, 15, and 16 had DNA polymerase
activity; however, processivity was reduced from 4-50 fold relative
to the wild type enzyme. Six mutants, Mutant IDs 1, 2, 3, 8, 10,
and 18, showed DNA polymerase activity similar to wild type
OptiTaq.
TABLE-US-00007 TABLE 7 Novel Taq DNA polymerase mutants selected
for initial study. Amino acid .DELTA.Cq Delay in Mutant changes
from Polymerase Relative priming from ID wild-type Taq Activity
activity* an RNA base** 1 V783I Yes 1 0 2 V783F Yes 1 1 3 H784Q Yes
1 1 4 R573H No -- -- 5 Q582K No -- -- 6 F667W Yes 0.25 9 7 H639W
Yes 0.02 20 8 L616M Yes 1 0 9 E615L, L616E No -- -- 10 A661E,
I665W, Yes 1 2.9 F667L 11 Q782I, H784F Yes 0.20 2 12 Q782I, V783L,
No -- -- H784L 13 Q782S, V783F, No -- -- H784N 14 Q782P, V783L, Yes
0.02 2.5 H784Q 15 Q754A Yes 0.2 >35 16 R659H Yes 0.1 >35 17
V783F, H784Q No -- -- 18 V783L, H784Q Yes 1 1 *Wild-type OptiTaq
was set to "1" and the relative activity of each of the mutant
polymerases was normalized to this amplification efficiency, with 1
as the maximum. **.DELTA.Cq = [Cq Mutant ID X] - [Cq OptiTaq] when
qPCR reactions are run using primers having a 3'-RNA residue.
[0169] The subset of these mutant Taq DNA polymerases which showed
DNA polymerase activity were studied for their ability to
discriminate between primers having a 3'-DNA versus a 3'-RNA
residue relative to the wild type OptiTaq enzyme. Real-time PCR was
performed as before, employing in the reactions the amount of each
mutant DNA polymerase equal to 0.5 units of wild-type OptiTaq per
10 .mu.L reaction. The following reaction conditions were employed:
1.times. qPCR buffer (20 mM Tris pH 8.4, 50 mM KCl, 3 mM
MgCl.sub.2, 0.01% Triton-X100), 800 .mu.M dNTPs (200 .mu.M each),
500 nM For primer (Hs SFRS9 F569 rU, SEQ ID NO. 47), 500 nM Rev
primer (Hs SFRS9 R712 rA, SEQ ID NO. 48), 250 nM probe (Hs SFRS9
P644, SEQ ID NO. 49), 2.times.10.sup.3 copies of linearized cloned
plasmid template (SFRS9-targ, SEQ ID NO. 50), in 10 .mu.L final
volume. Reactions were run in 384 well format on a BIO-RAD
CFX384.TM. Real-Time System (BIO-RAD, Hercules, Calif.) using
cycling parameters 95.degree. C. for 30 seconds followed by 60
cycles of [95.degree. C. for 15 seconds followed by 60.degree. C.
for 1 minutes]. Detection was achieved using a
fluorescence-quenched probe (5'-nuclease assay format). Sequences
of the primers, probe, and template (plasmid insert) are shown in
Table 8.
TABLE-US-00008 TABLE 8 Sequence of oligonucleotides employed in the
primer 3'-RNA discrimination assay. Name Sequence SEQ ID NO. Hs
SFRS9 TGTGCAGAAGGATGGAGu SEQ ID NO. 47 F569 rU Hs SFRS9
CTGGTGCTTCTCTCAGGATa SEQ ID NO. 48 R712 rA Hs SFRS9
HEX-TGGAATATG(ZEN)CCCTGCGTAAACTGGA-IBFQ SEQ ID NO. 48 P644 SFRS9-
TGTGCAGAAGGATGGAGTGGGGATGGTCGAGTATCTCAG SEQ ID NO. 50 targ
AAAAGAAGACATGGAATATGCCCTGCGTAAACTGGATGA
CACCAAATTCCGCTCTCATGAGGGTGAAACTTCCTACAT CCGAGTTTATCCTGAGAGAAGCACCAG
Nucleic acid sequences are shown 5'-3' with DNA uppercase and RNA
lowercase. HEX = hexachlorofluorescein, IBFQ = Iowa Black FQ
(fluorescence quencher), and ZEN = ZEN fluorescence quencher.
[0170] The 12 Taq DNA polymerase mutants that supported PCR were
tested for the ability to use a 3'-RNA modified primer as outlined
above. Results are summarized in Table 7. Mutant IDs 1 and 8 did
not show any difference between primers having a 3'-DNA versus a
3'-RNA residue. Mutant IDs 2, 3, 6, 7, 10, 11, 14, 15, 16, and 18
showed an amplification delay using 3'-RNA primers. Thus the
rational design strategy employed herein was successful and Taq DNA
polymerase mutants were identified which discriminated against
priming from a 3'-RNA residue. Those mutants which showed some
delay with RNA priming and showed high processivity were studied
for improvements in primer 3'-residue mismatch discrimination.
Example 5
Improved Mismatch Discrimination in Allele-Specific PCR Using
Mutant Taq DNA Polymerases
[0171] Of the 18 mutant enzymes studied in Example 4, Mutant IDs 2,
3, 10, and 18 showed the ability to discriminate against a 3'-RNA
residue in the primer and retained high enzymatic
activity/processivity. These four mutants were studied for the
ability to discriminate against a 3'-terminal DNA mismatch compared
with wild type OptiTaq DNA polymerase using an allele-specific qPCR
assay. Amplification reactions were performed against a synthetic
oligonucleotide template where a single base was varied (SNP) which
was positioned to lie at the 3'-end of the reverse primer.
Synthetic templates were employed having each of the 4 possible
bases at this position. Reverse primers were employed having each
of the 4 possible bases at the 3'-end. Relative amplification
efficiency for all pairwise combinations was assessed using
qPCR.
[0172] Quantitative allele-specific real-time PCR (AS-qPCR) was
performed in 10 .mu.L reaction volumes in 384 well format with
2.times.10.sup.3 copies of a 103 bp synthetic template (SEQ ID NOs.
51-4). Final reaction conditions used were 20 mM Tris-HCL (pH 8.4
at 25.degree. C.), 50 mM KCL, and 3 mM MgCl.sub.2, 0.01% Triton
X-100, 800 .mu.M total dNTPs, and 200 nM of the universal forward
primer (SEQ ID NO. 60), 200 nM of a reverse primer (separate
reactions were set up for each of the allele-specific primers SEQ
ID NOs. 55-58 or the control universal primer SEQ ID NO. 59) and
200 nM of the 5' nuclease detection probe (SEQ ID NO. 61). Each
allele-specific primer was tested on each SNP template. Reactions
utilized either 0.5 U (10.8 ng/11.1 nM/111 fmol) of the wild type
OptiTaq DNA polymerase or 0.5 U of one of the 4 Taq DNA polymerase
mutants studied (MUT ID No. 2 V783F, MUT ID NO. 3 H784Q, MUT ID NO.
10 A661E I665W F667L, or MUT ID NO. 18 V783L H784Q). Amplification
was performed on a CFX384.TM. C1000.TM. Thermo Cycler system
(Bio-Rad, Hercules, Calif.) using the following cycling parameters:
95.degree. C. for 30 seconds initial denaturation followed by 60
cycles of 95.degree. C. for 10 seconds, then 60.degree. C. for 30
seconds. Oligonucleotide reagents used in this example are shown in
Table 9.
TABLE-US-00009 TABLE 9 Synthetic oligonucleotides employed in
Example 5. Name Sequence (5'-3') SEQ ID NO. A Template
AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 51
GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGAACAGT AAAGGCATGAAGCTCAG C
Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 52
GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGCACAGT AAAGGCATGAAGCTCAG G
Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 53
GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGGACAGT AAAGGCATGAAGCTCAG T
Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 54
GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGTACAGT AAAGGCATGAAGCTCAG Syn
Rev T CTGAGCTTCATGCCTTTACTGTT SEQ ID NO. 55 Syn Rev C
CTGAGCTTCATGCCTTTACTGTC SEQ ID NO. 56 Syn Rev A
CTGAGCTTCATGCCTTTACTGTA SEQ ID NO. 57 Syn Rev G
CTGAGCTTCATGCCTTTACTGTG SEQ ID NO. 58 Syn Rev
CTGAGCTTCATGCCTTTACTGT SEQ ID NO. 59 Syn For
AGCTCTGCCCAAAGATTACCCTG SEQ ID NO. 60 Syn Probe
FAM-TTCTGAGGC(ZEN)CAACTTCCACTGCCACTTA-IBFQ SEQ ID NO. 61 DNA bases
are uppercase; FAM = 6-carboxyfluorescein; IBFQ = Iowa Black.TM. FQ
fluorescence quencher; ZEN = internal ZEN fluorescence quencher;
underlined base indicates the SNP site in the synthetic template
DNA.
[0173] Initially all reactions were run in triplicate. Similar
results were obtained for all replicates when using the wild type
OptiTaq. However, results showed greater variation for the mutant
polymerases. To obtain statistically meaningful results, each
reaction was therefore performed 96 times for the mutant
polymerases and 81 times for the wild type enzyme. .DELTA.Cq values
were calculated as the Cq value obtained for each mismatched base
pair minus the Cq value obtained for the matched base pair
(.DELTA.Cq=Cq mismatch-Cq match). The .DELTA.Cq values for all 96
replicates were averaged and standard deviations were calculated.
Results are shown in Table 10 and are graphically summarized in
FIGS. 3A and 3B. Note that the reverse primer is the
allele-specific primer, so the "Syn Rev T" primer (SEQ ID NO. 55)
is the perfect match to the Template A (SEQ ID NO. 51), etc.
TABLE-US-00010 TABLE 10 .DELTA.Cq values for AS-qPCR reactions
using WT OptiTaq and mutant Taq DNA polymerases. Reverse Primer
Template SEQ A C G T DNA ID SEQ ID SEQ ID SEQ ID SEQ ID Polymerase
Name NO. NO. 51 NO. 52 NO. 53 NO. 54 OptiTaq Syn Rev T 55 -- 2.3
+/- 0.2 1.4 +/- 0.2 3.8 +/- 0.2 Syn Rev G 58 7.6 +/- 0.6 -- 5.6 +/-
0.3 1.9 +/- 0.2 Syn Rev C 56 1.8 +/- 0.2 7.6 +/- 0.6 -- 2.0 +/- 0.2
Syn Rev A 57 6.6 +/- 0.4 1.5 +/- 0.2 8.0 +/- 0.6 -- MUT ID 2 Syn
Rev T 55 -- 7.3 +/- 2.9 4.5 +/- 0.5 9.5 +/- 1.8 V783F Syn Rev G 58
17.9 +/- 8.3 -- 16.4 +/- 7.5 4.1 +/- 0.2 Syn Rev C 56 6.5 +/- 1.2
15.0 +/- 8.9 -- 5.3 +/- 0.5 Syn Rev A 57 7.8 +/- 4.0 3.5 +/- 0.4
14.6 +/- 9.7 -- MUT ID 3 Syn Rev T 55 -- 7.5 +/- 0.8 7.0 +/- 0.6
10.4 +/- 2.3 H784Q Syn Rev G 58 13.3 +/- 7.6 -- 10.1 +/- 4.8 4.6
+/- 0.2 Syn Rev C 56 6.9 +/- 0.5 8.6 +/- 2.6 -- 5.6 +/- 0.4 Syn Rev
A 57 17.1 +/- 7.2 6.3 +/- 0.5 21.2 +/- 8.7 -- MUT ID 10 Syn Rev T
55 -- 9.0 +/- 0.9 5.7 +/- 0.3 11.2 +/- 2.6 A661E Syn Rev G 58 19.9
+/- 8.4 -- 13.9 +/- 5.3 3.9 +/- 0.3 I665W Syn Rev C 56 8.7 +/- 4.3
19.2 +/- 9.7 -- 7.4 +/- 0.8 F667L Syn Rev A 57 13.3 +/- 8.2 6.1 +/-
0.8 13.1 +/- 8.6 -- MUT ID 18 Syn Rev T 55 -- 5.8 +/- 1.3 6.0 +/-
0.4 9.4 +/- 1.2 V783L Syn Rev G 58 22.7 +/- 8.0 -- 18.9 +/- 8.4 4.9
+/- 0.3 H784Q Syn Rev C 56 6.8 +/- 0.5 17.6 +/- 9.6 -- 4.8 +/- 0.4
Syn Rev A 57 19.3 +/- 8.2 6.1 +/- 0.4 26.6 +/- 6.4 -- Average
.DELTA.Cq values are shown, where .DELTA.Cq = [Cq mismatch - Cq
match], +/- standard deviation calculated from 96 replicates.
[0174] The wild type OptiTaq showed an average .DELTA.Cq for
AS-qPCR in this synthetic amplicon system of 4.2 with a range of
1.4 to 8.0. Mutant ID 2 (V783F) showed an average .DELTA.Cq of 9.4
with a range of 3.5 to 17.9. Mutant ID 3 (H784Q) showed an average
.DELTA.Cq of 9.9 with a range of 4.6 to 21.2. Mutant ID 10 (A661E,
I665W, F667L) showed an average .DELTA.Cq of 10.9 with a range of
3.9 to 19.9. Mutant ID 18 (V783L, H784Q) showed an average
.DELTA.Cq of 12.4 with a range of 4.9 to 26.6. Therefore in all
pairwise combinations of 4 template bases and 4 3'-terminal primer
bases the mutant Taq DNA polymerases of the present invention
showed greater discrimination to mismatch than did the wild type
OptiTaq DNA polymerase. The magnitude of improvement for each
mismatch pair is defined by the .DELTA..DELTA.Cq, which is the
difference of discrimination between the mutant and wild type
enzymes (.DELTA..DELTA.Cq=.DELTA.Cq mutant-.DELTA.Cq wild type).
The .DELTA..DELTA.Cq values were calculated and are shown in Table
11.
TABLE-US-00011 TABLE 11 .DELTA..DELTA.Cq values for AS-qPCR
reactions for the mutant Taq DNA polymerases compared with wild
type OptiTaq. Reverse Primer Template SEQ A C G T DNA ID SEQ ID SEQ
ID SEQ ID SEQ ID Polymerase Name NO. NO. 51 NO. 52 NO. 53 NO. 54
MUT ID Syn Rev T 55 -- 5.0 3.1 5.7 NO. 2 Syn Rev G 58 10.3 -- 10.8
2.2 V783F Syn Rev C 56 4.7 7.4 -- 3.3 Syn Rev A 57 1.2 2.0 6.6 --
MUT ID Syn Rev T 55 -- 5.2 5.6 6.6 NO. 3 Syn Rev G 58 5.7 -- 4.5
2.7 H784Q Syn Rev C 56 5.1 1.0 -- 3.6 Syn Rev A 57 10.5 4.8 13.2 --
MUT ID Syn Rev T 55 -- 6.7 4.3 7.4 NO. 10 Syn Rev G 58 12.3 -- 8.3
2.0 A661E Syn Rev C 56 6.9 11.6 -- 5.4 I665W Syn Rev A 57 6.7 4.6
5.1 -- F667L MUT ID Syn Rev T 55 -- 3.5 4.6 5.6 NO. 18 Syn Rev G 58
15.1 -- 13.3 3.0 V783L Syn Rev C 56 5.0 10.0 -- 2.8 H784Q Syn Rev A
57 12.7 4.6 18.6 -- Average .DELTA..DELTA.Cq values are shown,
where .DELTA..DELTA.Cq = [.DELTA.Cq mutant - .DELTA.Cq wild type],
from data in Table 10.
[0175] Mutant ID 2 (V783F) showed an average .DELTA..DELTA.Cq of
5.2 compared to wild type OptiTaq. Mutant ID 3 (H784Q) showed an
average .DELTA..DELTA.Cq of 5.7 compared to wild type OptiTaq.
Mutant ID 10 (A661E, 1665W, F667L) showed an average
.DELTA..DELTA.Cq of 6.7 compared to wild type OptiTaq. Mutant ID 18
(V783L, H784Q) showed an average .DELTA..DELTA.Cq of 8.2 compared
to wild type OptiTaq. Therefore each of the mutant Taq DNA
polymerases of the present invention showed a significant
improvement over wild type OptiTaq in mismatch discrimination, and,
importantly, mismatch discrimination was improved for every
possible mismatch base pair combination. Overall, mutant ID 18
(V783L, H784Q) showed the best SNP discrimination within the set of
4 mutant enzymes studied in this example using an AS-PCR assay.
Example 6
Discrimination Against a Primer 3'-RNA Residue by Taq DNA
Polymerase Mutants
[0176] All 18 Taq DNA polymerase mutants were screened for the
ability to discriminate against priming from a 3'-RNA residue in
Example 4. The four mutants studied in AS-PCR in Example 5 (MUT IDs
2, 3, 10, and 18) which showed good 3'-mismatch discrimination were
studied in greater detail in the present example for the ability to
discriminate against the presence of a 3'-terminal RNA residue in
the primer, examining for possible base-specific effects.
Amplification reactions were performed against a synthetic
oligonucleotide template where a single base was varied (SNP) which
was positioned to lie at the 3'-end of the reverse primer.
Synthetic templates were employed having each of the 4 possible
bases at this position. Reverse primers were employed having each
of the 4 possible RNA bases at the 3'-end and results were compared
to control reactions using primers having each of the 4 possible
DNA bases at the 3'-end. Relative amplification efficiency was
assessed using qPCR.
[0177] Quantitative real-time PCR (qPCR) was performed in 10 .mu.L
reaction volumes in 384 well format with 2.times.10.sup.3 copies of
a 103 bp synthetic template (SEQ ID NOs. 51-54). Final reaction
conditions used were 20 mM Tris-HCL (pH 8.4 at 25.degree. C.), 50
mM KCL, and 3 mM MgCl.sub.2, 0.01% Triton X-100, 800 .mu.M total
dNTPs, and 200 nM of the universal forward primer (SEQ ID NO. 60),
200 nM of a reverse primer (separate reactions were set up for each
of the four 3'-RNA primers SEQ ID NOs. 62-65, each of the four
3'DNA primers SEQ ID NOs. 55-58, or the control universal primer
SEQ ID NO. 59) and 200 nM of the 5' nuclease detection probe (SEQ
ID NO. 61). Each primer was tested only on the complementary
template (mismatch conditions were not tested). Reactions utilized
either 0.5 U (10.8 ng/11.1 nM/111 fmol) of the wild type OptiTaq
DNA polymerase or 0.5 U of one of the 4 Taq DNA polymerase mutants
studied (MUT ID No. 2 V783F, MUT ID NO. 3 H784Q, MUT ID NO. 10
A661E I665W F667L, or MUT ID NO. 18 V783L H784Q). Amplification was
performed on a CFX384.TM. C1000.TM. Thermo Cycler system (Bio-Rad,
Hercules, Calif.) using the following cycling parameters:
95.degree. C. for 30 seconds initial denaturation followed by 60
cycles of 95.degree. C. for 10 seconds, then 60.degree. C. for 30
seconds. Oligonucleotide reagents used in this example are shown in
Table 12. A total of 96 replicates were performed for each pairwise
combination.
TABLE-US-00012 TABLE 12 Synthetic oligonucleotides employed in
Example 6. Name Sequence (5'-3') SEQ ID NO. A Template
AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 51
GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGAACAGT AAAGGCATGAAGCTCAG C
Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 52
GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGCACAGT AAAGGCATGAAGCTCAG G
Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 53
GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGGACAGT AAAGGCATGAAGCTCAG T
Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 54
GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGTACAGT AAAGGCATGAAGCTCAG Syn
Rev T CTGAGCTTCATGCCTTTACTGTT SEQ ID NO. 55 Syn Rev C
CTGAGCTTCATGCCTTTACTGTC SEQ ID NO. 56 Syn Rev A
CTGAGCTTCATGCCTTTACTGTA SEQ ID NO. 57 Syn Rev G
CTGAGCTTCATGCCTTTACTGTG SEQ ID NO. 58 Syn Rev rU
CTGAGCTTCATGCCTTTACTGTu SEQ ID NO. 62 Syn Rev rC
CTGAGCTTCATGCCTTTACTGTc SEQ ID NO. 63 Syn Rev TA
CTGAGCTTCATGCCTTTACTGTa SEQ ID NO. 64 Syn Rev rG
CTGAGCTTCATGCCTTTACTGTg SEQ ID NO. 65 Syn Rev
CTGAGCTTCATGCCTTTACTGT SEQ ID NO. 59 Syn For
AGCTCTGCCCAAAGATTACCCTG SEQ ID NO. 60 Syn Probe
FAM-TTCTGAGGC(ZEN)CAACTTCCACTGCCACTTA-IBFQ SEQ ID NO. 61 DNA bases
are uppercase and RNA bases are lowercase; FAM =
6-carboxyfluorescein; IBFQ = Iowa Black.TM. FQ fluorescence
quencher; ZEN = internal ZEN fluorescence quencher; underlined base
indicates the SNP site in the synthetic template DNA.
[0178] Average Cq values were calculated for the 96-replicate sets.
.DELTA.Cq values were calculated as the difference between the
average Cq values for the 3'-RNA primer reactions from the average
Cq values for the 3'-DNA primer reactions (.DELTA.Cq=Cq 3'-RNA-Cq
3'-DNA). Higher .DELTA.Cq values indicate a greater degree of
discrimination against priming from a 3'-RNA primer. Results are
shown in Table 13 and are graphically summarized in FIG. 4.
TABLE-US-00013 TABLE 13 .DELTA.Cq values for qPCR reactions using
WT OptiTaq and mutant Taq DNA polymerases comparing 3'-DNA vs.
3'-RNA primers. DNA Reverse Primers compared Polymerase Name SEQ ID
NO. Template .DELTA.Cq OptiTaq Syn Rev T 55 A 0.1 Syn Rev rU 62 SEQ
ID NO. 51 Syn Rev G 58 C 0.2 Syn Rev rG 65 SEQ ID NO. 52 Syn Rev C
56 G 0.0 Syn Rev rC 63 SEQ ID NO. 53 Syn Rev A 57 T 0.1 Syn Rev rA
64 SEQ ID NO. 54 MUT ID 2 Syn Rev T 55 A 5.4 V783F Syn Rev rU 62
SEQ ID NO. 51 Syn Rev G 58 C 1.5 Syn Rev rG 65 SEQ ID NO. 52 Syn
Rev C 56 G 4.8 Syn Rev rC 63 SEQ ID NO. 53 Syn Rev A 57 T 2.2 Syn
Rev rA 64 SEQ ID NO. 54 MUT ID 3 Syn Rev T 55 A 6.9 H784Q Syn Rev
rU 62 SEQ ID NO. 51 Syn Rev G 58 C 2.0 Syn Rev rG 65 SEQ ID NO. 52
Syn Rev C 56 G 9.8 Syn Rev rC 63 SEQ ID NO. 53 Syn Rev A 57 T 1.4
Syn Rev rA 64 SEQ ID NO. 54 MUT ID 10 Syn Rev T 55 A 5.5 A661E Syn
Rev rU 62 SEQ ID NO. 51 I665W Syn Rev G 58 C 1.3 F667L Syn Rev rG
65 SEQ ID NO. 52 Syn Rev C 56 G 4.2 Syn Rev rC 63 SEQ ID NO. 53 Syn
Rev A 57 T 0.8 Syn Rev rA 64 SEQ ID NO. 54 MUT ID 18 Syn Rev T 55 A
9.3 V783L Syn Rev rU 62 SEQ ID NO. 51 H784Q Syn Rev G 58 C 2.4 Syn
Rev rG 65 SEQ ID NO. 52 Syn Rev C 56 G 9.5 Syn Rev rC 63 SEQ ID NO.
53 Syn Rev A 57 T 2.3 Syn Rev rA 64 SEQ ID NO. 54 Average .DELTA.Cq
values are shown, where .DELTA.Cq = Cq 3'-RNA primer - Cq 3'-DNA
primer.
[0179] Wild type OptiTaq did not show any significant
discrimination between a 3'-DNA and a 3'-RNA primer. All four
mutant Taq DNA polymerases, however, showed reduced priming
efficiency when using a 3'-RNA primer. Thus the goal of creating
novel polymerases which discriminate against a 3'-RNA residue in a
primer was achieved using the intelligent mutagenesis design
strategy described herein. Interestingly, the magnitude of
discrimination was much greater for RNA pyrimidine residues (rC or
rU) than for RNA purine residues (rA or rG).
Example 7
Improved Mismatch Discrimination in rhPCR using Mutant Taq DNA
Polymerases
[0180] RNase H-based PCR (rhPCR) employs the enzyme RNase H2 to
convert a blocked-cleavable oligonucleotide which cannot prime DNA
synthesis into a form that can prime DNA synthesis and initiate
PCR. The blocked-cleavable oligonucleotide, or blocked-cleavable
primer, contains a single RNA residue near the 3'-end of the
oligonucleotide (which comprises the cleavage site) and is modified
at or near the 3'-end so that the primer cannot prime DNA synthesis
and/or has lost template function and so is incompetent to support
PCR even if primer extension can occur. This method can be used for
genotyping (SNP discrimination) and relies on the ability of RNase
H2 to distinguish between base-pair match vs. mismatch at the RNA
base cleavage site when hybridized to the target nucleic acid. In
rhPCR, SNP discrimination occurs at the primer unblocking step, not
at the primer extension step (in AS-PCR, discrimination occurs at
the primer extension step). Examples of this enzyme cleaving
strategy, similar RNase H strategies, and methods of blocking
primer extension or inhibiting template function and thereby
disabling PCR are described in U.S. Pat. No. 7,112,406 to Behlke et
al., entitled POLYNOMIAL AMPLIFICATION OF NUCLEIC ACIDS, U.S. Pat.
No. 5,763,181 to Han et al., entitled CONTINOUS FLUOROMETRIC ASSAY
FOR DETECTING NUCLEIC ACID CLEAVAGE, U.S. Pat. No. 7,135,291 to
Sagawa et al., entitled METHOD OF DETECTING NUCLEOTIDE
POLYMORPHISM; U.S. Pat. App. No. 20090068643 to Behlke and Walder,
entitled DUAL FUNCTION PRIMERS FOR AMPLIFYING DNA AND METHODS OF
USE; and U.S. Pat. App. No. 20100167353 to Walder et al., entitled
RNASE H-BASED ASSAYS UTILIZING MODIFIED RNA MONOMERS and in Dobosy
et al., RNase H-dependent PCR (rhPCR): improved specificity and
single nucleotide polymorphism detection using blocked cleavable
primers, BMC Biotechnology., 11:e80 (2011).
[0181] In AS-PCR the SNP is positioned at the 3'-end of the primer.
In this configuration, a mispriming event (where DNA synthesis is
initiated in the presence of a 3'-terminal mismatch) leads to
incorporation of the base present in the primer into the nascent
DNA strand and thereby into the PCR amplicon. This event converts
the PCR product to the primer sequence so that the amplified DNA
now matches primer and no longer matches the original input sample
nucleic acid sequence. Since the amplicon sequence now matches the
primer and not the input sample, amplification proceeds at high
efficiency.
[0182] In rhPCR, cleavage of the blocked-cleavable primer by RNase
H2 occurs at the 5'-side of the RNA residue; if the SNP is
positioned at the RNA residue (e.g., the RNA base pairs with the
SNP), then the first base incorporated by DNA polymerase during
primer extension and PCR is the SNP site and results in daughter
products which remain identical to the input nucleic acid sequence.
Rarely, non-canonical RNase H2 cleavage occurs at the 3'-side of
the RNA base, which leaves the RNA residue at the 3'-end of the
primer positioned overlying the SNP. In this case, the rhPCR
reaction proceeds like AS-PCR, where the 3'-end of the primer is
positioned at the SNP site and is either a match or mismatch to the
target nucleic acid. Like AS-PCR, in the case of a mismatch, the
sequence of the DNA extension product and PCR amplicon converts to
the sequence of the primer and thus might not faithfully replicate
the sequence of the sample during amplification. Any method which
reduces the frequency of this undesired mispriming event will
improve mismatch discrimination in the rhPCR assay. Therefore,
although base discrimination in rhPCR is primarily mediated by
RNase H2 at the primer cleavage stage, use of a DNA polymerase that
has an improved ability to discriminate against a 3'-terminal
mismatch and/or a 3'-terminal RNA residue may improve the overall
mismatch discrimination capacity of rhPCR by preventing extension
when undesired 3'-cleavage events occur. The DNA polymerase mutants
described herein both reduce priming efficiency when a 3'-mismatch
is present (improve mismatch discrimination) and reduce priming
efficiency when a 3'-terminal RNA residue is present in the primer
(discriminate against a primer 3'-RNA residue) compared with wild
type Taq DNA polymerase. The present example demonstrates that the
novel mutant Taq DNA polymerases of the present invention improve
specificity and SNP discrimination of rhPCR.
[0183] Quantitative real-time rhPCR was performed comparing
performance of wild type OptiTaq DNA polymerase with mutant Taq DNA
polymerases Mutant IDs 2, 3, 10, and 18. Two different
blocked-cleavable primer designs were tested, including the
generation 1 (Gen1) "RDDDDx" primers and the generation 2 (Gen2)
"RDxxD" primers (see: US Patent Application 2012/0258455 by Behlke
et al., entitled, RNASE H-BASED ASSAYS UTILIZING MODIFIED RNA
MONOMERS). Amplification reactions were performed using the same
synthetic oligonucleotide template employed in Example 5 where a
single base was varied (the SNP site) which was positioned to lie
at the RNA residue in both Gen1 and Gen2 blocked-cleavable (rhPCR)
primers. Synthetic templates were employed having each of the 4
possible bases at this position. Reverse primers were employed
having each of the 4 possible complementary bases at this position
(the RNA base). The same forward primer was used for all reactions.
Relative amplification efficiency was assessed using real-time
PCR.
[0184] Quantitative rhPCR was performed in 10 .mu.L reaction
volumes in 384 well format with 2.times.10.sup.6 copies of a 103 bp
synthetic template (SEQ ID NOs. 51-4). Final reaction conditions
used were 20 mM Tris-HCL (pH 8.4 at 25.degree. C.), 50 mM KCL, 3 mM
MgCl.sub.2, 0.01% Triton X-100, 800 .mu.M total dNTPs, 200 nM of
the universal forward primer (SEQ ID NO. 60), 200 nM of a reverse
primer, and 200 nM of the 5' nuclease detection probe (SEQ ID NO.
61). Reverse primers included Gen1 RDDDDx configuration
allele-specific rhPCR primers (SEQ ID NOs. 66-69), Gen2 RDxxD
configuration allele-specific rhPCR primers (SEQ ID NOs. 70-73) and
a control universal reverse primer (SEQ ID NO.59). Each of the
rhPCR blocked-cleavable reverse primers were tested on each of the
four SNP templates. Reactions utilized either 0.5 U (10.8 ng/11.1
nM/111 fmol) of the wild type OptiTaq DNA polymerase or 0.5 U of
one of the four Taq DNA polymerase mutants (MUT ID 2, V783F; MUT ID
3, H784Q; MUT ID 10, A661E I665W F667L; or MUT ID 18, V783L H784Q).
P. abyssi RNase H2 was added to each reaction in 1 .mu.L volume.
Reactions using the control and Gen1 blocked-cleavable RDDDDx rhPCR
primers employed 2.6 mU RNase H2 per 10 .mu.L reaction (5 fmoles,
0.5 nM enzyme). Reactions using the Gen2 blocked-cleavable RDxxD
rhPCR primers employed 25 mU RNase H2 10 .mu.L reaction (48 fmoles,
4.8 nM enzyme) for the rC and rA primers (SEQ ID NOs. 71 and 72)
and 200 mU RNase H2 per 10 .mu.L reaction (384 fmoles, 38 nM
enzyme) for the rG and rU primers (SEQ ID NOs. 70 and 73). Cycling
was performed on a Roche LightCycler.RTM. 480 (Roche Applied
Science, Indianapolis, Ind., USA) as follows: 95.degree. C. for 3
minutes followed by 75 cycles of 95.degree. C. for 10 seconds and
60.degree. C. for 30 seconds. All reactions were performed in
triplicate. Oligonucleotide reagents used in this example are shown
in Table 14.
TABLE-US-00014 TABLE 14 Synthetic oligonucleotides employed in
Example 7. Name Sequence (5'-3') SEQ ID NO. A Template
AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 51
GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGAACAGT AAAGGCATGAAGCTCAG C
Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 52
GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGCACAGT AAAGGCATGAAGCTCAG G
Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 53
GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGGACAGT AAAGGCATGAAGCTCAG T
Template AGCTCTGCCCAAAGATTACCCTGACAGCTAAGTGGCAGTGGAA SEQ ID NO. 54
GTTGGCCTCAGAAGTAGTGGCCAGCTGTGTGTCGGGGTACAGT AAAGGCATGAAGCTCAG Syn
Rev CTGAGCTTCATGCCTTTACTGT SEQ ID NO. 59 Syn For
AGCTCTGCCCAAAGATTACCCTG SEQ ID NO. 60 Syn Probe
FAM-TTCTGAGGC(ZEN)CAACTTCCACTGCCACTTA-IBFQ SEQ ID NO. 61 Syn Rev rU
CTGAGCTTCATGCCTTTACTGTuCCCCx SEQ ID NO. 66 DDDDx Syn Rev rC
CTGAGCTTCATGCCTTTACTGTcCCCCx SEQ ID NO. 67 DDDDx Syn Rev rA
CTGAGCTTCATGCCTTTACTGTaCCCCx SEQ ID NO. 68 DDDDx Syn Rev rG
CTGAGCTTCATGCCTTTACTGTgCCCCx SEQ ID NO. 69 DDDDx Syn Rev rU
CTGAGCTTCATGCCTTTACTGTuCxxC SEQ ID NO. 70 DxxD Syn Rev rC
CTGAGCTTCATGCCTTTACTGTcCxxC SEQ ID NO. 71 DxxD Syn Rev rA
CTGAGCTTCATGCCTTTACTGTaCxxC SEQ ID NO. 72 DxxD Syn Rev rG
CTGAGCTTCATGCCTTTACTGTgCxxC SEQ ID NO. 73 DxxD DNA bases are
uppercase and RNA bases are lowercase; FAM = 6-carboxyfluorescein;
IBFQ = Iowa Black.TM. FQ fluorescence quencher; ZEN = internal ZEN
fluorescence quencher; underlined base indicates the SNP site in
the synthetic template DNA; "x" = C3 Spacer (propanediol).
[0185] MUT ID 10 (A661E, 1665W, F667L) unexpectedly showed large
amplification delays when the primers matched the SNP site in the
target in the rhPCR reactions using this synthetic amplicon system.
This polymerase, however, did not show any delays when using a
human genomic DNA system for rhPCR (see Examples 8 and 9). MUT ID
10 was therefore excluded from analysis in the synthetic system
experiments. Data generated using the other three mutant
polymerases were analyzed and .DELTA.Cq values were calculated
comparing matched versus mismatched primer/template pairs, where
.DELTA.Cq=Cq mismatch-Cq match. Results are shown in Table 15 for
the Gen1 RDDDDx blocked-cleavable rhPCR primers and in Table 16 for
the Gen2 RDxxD blocked-cleavable rhPCR primers.
TABLE-US-00015 TABLE 15 .DELTA.Cq values for rhPCR reactions using
WT OptiTaq and mutant Taq DNA polymerases with Gen1 RDDDDx
blocked-cleavable rhPCR primers. Reverse Primer Template SEQ A G T
C DNA ID SEQ ID SEQ ID SEQ ID SEQ ID Polymerase Name NO. NO. 51 NO.
53 NO. 54 NO. 52 OptiTaq Syn Rev 66 -- 10.5 3.4 6.6 rU DDDDx Syn
Rev 67 3.3 -- 1.3 2.2 rC DDDDx Syn Rev 68 9.5 10.5 -- 3.5 rA DDDDx
Syn Rev 69 9.5 10.8 11.8 -- rG DDDDx MUT ID 2 Syn Rev 66 -- 11.1
5.1 9.0 V783F rU DDDDx Syn Rev 67 4.0 -- 1.9 3.6 rC DDDDx Syn Rev
68 10.4 11.1 -- 5.6 rA DDDDx Syn Rev 69 10.2 10.5 10.7 -- rG DDDDx
MUT ID 3 Syn Rev 66 -- 11.3 5.0 10.0 H784Q rU DDDDx Syn Rev 67 7.6
-- 4.3 5.9 rC DDDDx Syn Rev 68 10.8 11.3 -- 7.6 rA DDDDx Syn Rev 69
10.9 10.9 11.0 -- rG DDDDx MUT ID 18 Syn Rev 66 -- 12.3 6.7 11.5
V783L rU DDDDx H784Q Syn Rev 67 9.9 -- 8.3 10.4 rC DDDDx Syn Rev 68
11.5 13.2 -- 6.8 rA DDDDx Syn Rev 69 11.3 12.0 12.6 -- rG DDDDx
Average .DELTA.Cq values are shown, where .DELTA.Cq = [Cq mismatch
- Cq match].
TABLE-US-00016 TABLE 16 .DELTA.Cq values for rhPCR reactions using
WT OptiTaq and mutant Taq DNA polymerases with Gen2 RDxxD
blocked-cleavable rhPCR primers. Reverse Primer Template SEQ A G T
C DNA ID SEQ ID SEQ ID SEQ ID SEQ ID Polymerase Name NO. NO. 51 NO.
53 NO. 54 NO. 52 OptiTaq Syn Rev 70 -- 11.6 15.1 12.8 rU DxxD Syn
Rev 71 6.3 -- 6.7 4.6 rC DxxD Syn Rev 72 13.7 15.6 -- 14.3 rA DxxD
Syn Rev 73 13.2 11.4 10.2 -- rG DxxD MUT ID 2 Syn Rev 70 -- 12.2
15.0 14.0 V783F rU DxxD Syn Rev 71 8.3 -- 6.5 4.4 rC DxxD Syn Rev
72 14.1 15.9 -- 14.2 rA DxxD Syn Rev 73 13.8 12.2 11.6 -- rG DxxD
MUT ID 3 Syn Rev 70 -- 12.4 15.0 14.1 H784Q rU DxxD Syn Rev 71 9.5
-- 7.8 6.4 rC DxxD Syn Rev 72 16.9 19.1 -- 18.4 rA DxxD Syn Rev 73
15.0 13.0 12.7 -- rG DxxD MUT ID 18 Syn Rev 70 -- 13.0 15.3 14.3
V783L rU DxxD H784Q Syn Rev 71 6.9 -- 9.6 3.6 rC DxxD Syn Rev 72
15.8 15.3 -- 14.5 rA DxxD Syn Rev 73 15.0 13.4 13.7 -- rG DxxD
Average .DELTA.Cq values are shown, where .DELTA.Cq = [Cq mismatch
- Cq match].
[0186] In almost all cases, mismatch discrimination was superior
for rhPCR reactions run using the mutant Taq DNA polymerases than
wild type OptiTaq. The magnitude of improvement is best seen by
examining the .DELTA..DELTA.Cq values, which is the difference of
discrimination seen using wild type OptiTaq and the mutants
(.DELTA..DELTA.Cq=.DELTA.Cq mutant-.DELTA.Cq wild type). These
results are shown in Table 17 for the Gen1 RDDDDx primers and in
Table 18 for the Gen2 RDxxD primers. When using the Gen1 RDDDDx
primers, the overall greatest benefit was seen when the mismatched
base was a "C" in the target nucleic acid and least benefit was
seen when the blocked-cleavable primer contained a rG paired with a
mismatched T in the target. The greatest improvements were obtained
using the mutant Taq DNA polymerase MUT ID 18 (V783L H784Q). The
average .DELTA..DELTA.Cq for MUT ID 2 (V783F) was 1.0. The average
.DELTA..DELTA.Cq for MUT ID 3 (H784Q) was 2.0. The average
.DELTA..DELTA.Cq for MUT ID 18 (V783L, H784Q) was 3.6. Benefits
obtained using mutant Taq DNA polymerases was lower for the Gen2
RDxxD primers, which already showed high .DELTA.Cq values using
wild type OptiTaq. Average .DELTA..DELTA.Cq for the three mutant
polymerases studied in the Example were 0.6, 2.1, and 1.2.
Therefore greatest benefit when using the Gen2 RDxxD primers was
seen with MUT ID 3 (H784Q).
TABLE-US-00017 TABLE 17 .DELTA..DELTA.Cq values for rhPCR reactions
using mutant Taq DNA polymerases compared with wild type OptiTaq
for Gen1 RDDDDx blocked-cleavable rhPCR primers. Reverse Primer
Template SEQ A G T C DNA ID SEQ ID SEQ ID SEQ ID SEQ ID Polymerase
Name NO. NO. 51 NO. 53 NO. 54 NO. 52 MUT ID 2 Syn Rev 66 -- 0.6 1.7
2.4 V783F rU DDDDx Syn Rev 67 0.7 -- 0.6 1.4 rC DDDDx Syn Rev 68
0.9 0.6 -- 2.1 rA DDDDx Syn Rev 69 0.7 -0.3 1.1 -- rG DDDDx MUT ID
3 Syn Rev 66 -- 0.8 1.6 3.4 H784Q rU DDDDx Syn Rev 67 4.3 -- 3.0
3.7 rC DDDDx Syn Rev 68 1.3 0.8 -- 4.1 rA DDDDx Syn Rev 69 1.4 0.1
-0.8 -- rG DDDDx MUT ID 18 Syn Rev 66 -- 1.8 3.3 4.9 V783L rU DDDDx
H784Q Syn Rev 67 6.6 -- 7.0 8.2 rC DDDDx Syn Rev 68 2.0 2.7 -- 3.3
rA DDDDx Syn Rev 69 1.8 1.2 0.8 -- rG DDDDx .DELTA..DELTA.Cq values
are shown, where .DELTA..DELTA.Cq = [.DELTA.Cq mutant - .DELTA.Cq
wild type polymerase].
TABLE-US-00018 TABLE 18 .DELTA..DELTA.Cq values for rhPCR reactions
using mutant Taq DNA polymerases compared with wild type OptiTaq
for Gen2 RDxxD blocked-cleavable rhPCR primers. Reverse Primer
Template SEQ A G T C DNA ID SEQ ID SEQ ID SEQ ID SEQ ID Polymerase
Name NO. NO. 51 NO. 53 NO. 54 NO. 52 MUT ID 2 Syn Rev 70 -- 0.6
-0.1 1.2 V783F rU DxxD Syn Rev 71 2.0 -- -0.2 -0.2 rC DxxD Syn Rev
72 0.4 0.3 -- -0.1 rA DxxD Syn Rev 73 0.6 0.8 1.4 -- rG DxxD MUT ID
3 Syn Rev 70 -- 0.8 -0.1 1.3 H784Q rU DxxD Syn Rev 71 3.2 -- 1.1
1.8 rC DxxD Syn Rev 72 3.2 3.5 -- 4.1 rA DxxD Syn Rev 73 2.8 1.6
2.5 -- rG DxxD MUT ID 18 Syn Rev 70 -- 1.4 0.2 1.5 V783L rU DxxD
H784Q Syn Rev 71 0.6 -- 2.9 -1.0 rC DxxD Syn Rev 72 2.1 -0.3 -- 0.2
rA DxxD Syn Rev 73 1.8 2.0 3.5 -- rG DxxD .DELTA..DELTA.Cq values
are shown, where .DELTA..DELTA.Cq = [.DELTA.Cq mutant - .DELTA.Cq
wild type polymerase].
Example 8
Improved Mismatch Discrimination in rhPCR using Mutant Taq DNA
Polymerases in a Human Genomic DNA SNP Assay
[0187] Example 7 demonstrated utility of the novel mutant Taq DNA
polymerases of the present invention in a synthetic amplicon rhPCR
SNP discrimination assay system. The present Example demonstrates
utility of the novel mutant Taq DNA polymerases in a human genomic
DNA rhPCR SNP discrimination assays system, examining a SNP site in
the SMAD7 gene (NM_005904, C/T SNP, rs4939827). The assays employed
target DNAs GM18562 (homozygous C/C) and GM18537 (homozygous T/T)
from the Coriell Institute for Medical Research (Camden, N.J.,
USA). Two different blocked-cleavable primer designs were tested,
including the generation 1 (Gen1) "RDDDDx" primers and the
generation 2 (Gen2) "RDxxD" primers (see: US Patent Application
2012/0258455 by Behlke et al., entitled, RNASE H-BASED ASSAYS
UTILIZING MODIFIED RNA MONOMERS).
[0188] Quantitative real-time rhPCR was performed in 10 .mu.L
reaction volumes in 384 well format with 20 ng (the equivalent of
6600 copies of target) of human genomic DNA (GM18562 or GM18537).
Reactions utilized either 0.5 U (10.8 ng/11.1 nM/111 fmol) of wild
type OptiTaq DNA polymerase or 0.5 U of one of the four Taq DNA
polymerase mutants (MUT ID 2, V783F; MUT ID 3, H784Q; MUT ID 10,
A661E I665W F667L; or MUT ID 18, V783L H784Q). Final reaction
conditions used were 20 mM Tris-HCL (pH 8.4 at 25.degree. C.), 50
mM KCL, 3 mM MgCl.sub.2, 0.01% Triton X-100, 800 .mu.M total dNTPs,
200 nM of a forward primer (SEQ ID NOs. 75-79), 200 nM of the
universal reverse primer (SEQ ID NO. 74), and 200 nM of the SMAD7
probe (SEQ ID NO. 80). Sequence of the 85 bp SMAD7 amplicon is
shown as SEQ ID NO. 81. Forward primers included RDDDDx
configuration Gen1 allele-specific rhPCR primers (SEQ ID NOs. 76
and 77), RDxxD configuration Gen2 allele-specific rhPCR primers
(SEQ ID NOs. 78 and 79) and the control universal forward primer
(SEQ ID NO.75) which is not allele specific. Oligonucleotide
reagents employed in this Example are shown in Table 19. Reactions
included 1 .mu.L of P.a. RNase H2 at a concentration of 2.6 mU per
10 .mu.L reaction (5 fmoles, 0.5 nM) for the Gen1 RDDDDx primers
and control primer (SEQ ID NOs. 75-77) or 200 mU per 10 .mu.L
reaction (384 fmoles, 38.4 nM) for the Gen2 RDxxD primers (SEQ ID
NOs. 78 and 79). Amplification was performed on a Roche
LightCycler.RTM. 480 (Roche Applied Science, Indianapolis, Ind.,
USA) as follows: 95.degree. C. for 3 minutes followed by 75 cycles
of 95.degree. C. for 10 seconds and 60.degree. C. for 30 seconds.
All reactions were performed in triplicate.
TABLE-US-00019 TABLE 19 Synthetic oligonucleotides employed in
Example 8. SEQ ID Name Sequence (5'-3') NO. SMAD7 Rev
CTCACTCTAAACCCCAGCATT 74 SMAD7 For CAGCCTCATCCAAAAGAGGAAA 75 SMAD7
For rC CAGCCTCATCCAAAAGAGGAAAcAGGAx 76 DDDDx SMAD7 For rU
CAGCCTCATCCAAAAGAGGAAAuAGGAx 77 DDDDx SMAD7 For rC
CAGCCTCATCCAAAAGAGGAAAcAxxA 78 DxxD SMAD7 For rU
CAGCCTCATCCAAAAGAGGAAAuAxxA 79 DxxD SMAD7 probe
FAM-CCCAGAGCTCCCTCAGACTCCT-IBFQ 80 SMAD7 target
CAGCCTCATCCAAAAGAGGAAATAGGACCCC 81 AGAGCTCCCTCAGACTCCTCAGGAAACACAG
ACAATGCTGGGGTTTAGAGTGAG DNA bases are uppercase and RNA bases are
lowercase; FAM = 6-carboxyfluorescein; IBFQ = Iowa Black.TM. FQ
fluorescence quencher; "x" = C3 Spacer (propanediol). Primer and
probe binding sites in the SMAD7 target are underlined.
[0189] Results using the Gen1 RDDDDx rhPCR primers are shown in
Table 20 and using the Gen2 RDxxD rhPCR primers are shown in Table
21. Overall, use of the mutant Taq DNA polymerases showed small but
real improvements in SNP discrimination in this human genomic DNA
rhPCR assay using the Gen1 RDDDDx primers. However, large
improvements in discrimination were seen using the Gen2 RDxxD
primers. The Gen2 RDxxD primers inherently show greater SNP
discrimination and these levels were increased so that .DELTA.Cq
values are in some cases were greater than 40 amplification cycles
between match and mismatch; this level of discrimination would be
"greater than assay" for most users, as qPCR reactions are seldom
run for over 45-50 cycles and positive signal was not detected in
these cases until after 70 cycles (Table 21). Therefore use of the
new mutant Taq DNA polymerases improves SNP discrimination in rhPCR
genotyping assays.
TABLE-US-00020 TABLE 20 SNP discrimination of a site in the SMAD7
gene using Gen1 RDDDDx primers comparing wild type OptiTaq with
four mutant Taq DNA polymerases. Cq Cq SEQ mU RNase Value Value DNA
ID H2 per C/C T/T Polymerase For Primer NO. 10 .mu.L rxn DNA DNA
.DELTA.Cq Wild type SMAD7 For 75 2.6 24.3 25.3 -- OptiTaq SMAD7 For
76 2.6 26.1 38.1 11.9 rC DDDDx SMAD7 For 77 2.6 36.6 26.8 9.8 rU
DDDDx MUT ID 2 SMAD7 For 75 2.6 24.7 25.5 -- V783F SMAD7 For 76 2.6
26.2 40.3 14.1 rC DDDDx SMAD7 For 77 2.6 37.8 27.6 10.1 rU DDDDx
MUT ID 3 SMAD7 For 75 2.6 25.3 27.1 -- H784Q SMAD7 For 76 2.6 26.2
46.1 19.9 rC DDDDx SMAD7 For 77 2.6 38.9 32.4 6.5 rU DDDDx MUT ID
10 SMAD7 For 75 2.6 24.3 25.8 -- A661E SMAD7 For 76 2.6 25.6 43.9
18.3 I665W rC DDDDx F667L SMAD7 For 77 2.6 42.6 28.5 14.1 rU DDDDx
MUT ID 18 SMAD7 For 75 50 24.6 25.6 -- V783L SMAD7 For 76 50 25.2
35.7 10.5 H784Q rC DDDDx SMAD7 For 77 50 37.9 26.4 11.5 rU DDDDx
DNA targets included GM18562 (homozygous C/C) and GM18537
(homozygous T/T) from the Coriell Institute for Medical Research.
.DELTA.Cq = [Cq mismatch - Cq match].
TABLE-US-00021 TABLE 21 SNP discrimination of a site in the SMAD7
gene using Gen2 RDxxD primers comparing wild type OptiTaq with four
mutant Taq DNA polymerases. Cq Cq SEQ mU RNase Value Value DNA ID
H2 per C/C T/T Polymerase For Primer NO. 10 .mu.L rxn DNA DNA
.DELTA.Cq Wild type SMAD7 For 75 2.6 24.3 25.3 -- OptiTaq SMAD7 For
78 200 25.9 40.4 14.5 rC DxxD SMAD7 For 79 200 47.9 26.6 21.3 rU
DxxD MUT ID 2 SMAD7 For 75 2.6 24.7 25.5 -- V783F SMAD7 For 78 200
26.6 64.4 37.7 rC DxxD SMAD7 For 79 200 59.7 28.0 31.6 rU DxxD MUT
ID 3 SMAD7 For 75 2.6 25.3 27.1 -- H784Q SMAD7 For 78 200 26.7 71.7
45.0 rC DxxD SMAD7 For 79 200 62.5 28.9 33.7 rU DxxD MUT ID 10
SMAD7 For 75 2.6 24.3 25.8 -- A661E SMAD7 For 78 200 25.6 74.4 48.8
I665W rC DxxD F667L SMAD7 For 79 200 54.3 28.2 26.0 rU DxxD MUT ID
18 SMAD7 For 75 50 24.6 25.6 -- V783L SMAD7 For 78 200 25.1 52.7
27.6 H784Q rC DxxD SMAD7 For 79 200 43.0 27.6 15.3 rU DxxD DNA
targets included GM18562 (homozygous C/C) and GM18537 (homozygous
T/T) from the Coriell Institute for Medical Research. .DELTA.Cq =
[Cq mismatch - Cq match].
[0190] The .DELTA.Cq values for the SMAD7 SNP genotyping assays are
graphically summarized in FIG. 5A for the Gen1 RDDDDx primers and
in FIG. 6A for the Gen2 RDxxD primers. It is interesting to note
that, for the rhPCR genotyping assays studied in Example 8, MUT ID
10 (A661E I665W F667L) showed the greatest improvement compare with
wild type OptiTaq, especially when using the Gen2 RDxxD primers.
Example 5 demonstrated utility of the mutant Taq DNA polymerases in
AS-PCR, and in this case use of MUT ID 18 (V783L H784Q) showed the
greatest benefit and MUT ID 3 (H784Q) showed the next greatest
relative benefit. It is clear that not only do the different mutant
Taq DNA polymerases of the present invention have utility in
different amplification assays but that the different mutants show
varying levels of benefit depending on the nature of the assay
used. It is therefore useful to have a collection of mutant
polymerases whose properties can be matched to different
assays/applications so that maximal benefit is obtained.
Example 9
Improved Discrimination of Rare Alleles in Genomic DNA using rhPCR
with Mutant Taq DNA Polymerases
[0191] Use of the Gen2 RDxxD blocked-cleavable primers in rhPCR can
detect the presence of a SNP at a level of 1:1,000 to 1:10,000 in
the background of wild type genomic DNA using native (wild type)
Taq DNA polymerase (see: US Patent Application 2012/0258455 by
Behlke et al., entitled, RNASE H-BASED ASSAYS UTILIZING MODIFIED
RNA MONOMERS). The present example demonstrates that the mutant Taq
DNA polymerases of the present invention improve rare allele
discrimination in the rhPCR assay.
[0192] Rare allele detection experiments were designed to detect
the base identity of a SNP site in the SMAD7 gene (NM_005904, C/T
SNP, rs4939827) and employed target DNAs GM18562 (homozygous C/C)
and GM18537 (homozygous T/T) (Coriell Institute for Medical
Research, Camden, N.J., USA). Control reactions were set up using 2
ng (660 copies), 0.2 ng (66 copies), or 0.02 ng (6.6 copies) of
input matched target DNA. Rare allele detection reactions were set
up using 2 ng (660 copies), 0.2 ng (66 copies), or 0.02 ng (6.6
copies) of input matched target DNA of one allele plus 200 ng
(66,000 copies) of the other (mismatched) allele. Background was
established in reactions that contained 0 copies of matched target
DNA plus 200 ng (66,000 copies) of the mismatched target DNA. Both
combinations were tested: GM18562 (C/C) as the rare allele in the
presence of excess GM18537 (T/T) and GM18537 (T/T) as the rare
allele in the presence of excess GM18562 (C/C).
[0193] Quantitative real-time rhPCR was performed in 10 .mu.L
reaction volumes in 384 well format. Final reaction conditions used
were 10 mM Tris-HCL (pH 8.4 at 25.degree. C.), 50 mM KCL, 3.5 mM
MgCl.sub.2, 0.01% Triton-X100, 0.8 mM dNTPs, 200 nM of one of the
SMAD7 forward primers (SEQ ID NOs. 75, 78, and 79), 200 nM of the
SMAD7 reverse primer (SEQ ID NO. 74), and 200 nM of the SMAD7 probe
(SEQ ID NO. 80). The 85 bp SMAD7 amplicon defined by these primers
is shown as SEQ ID NO. 81. Note that the forward primers were
either unmodified (control, SEQ ID NO. 75) or were specific for the
SMAD7 C-allele (SEQ ID NO. 78) or the SMAD7 T-allele (SEQ ID NO.
79) using blocked-cleavable rhPCR Gen2 RDxxD design. Reactions
utilized either 0.5 U of the wild type OptiTaq DNA polymerase or
0.5 U of one of the four Taq DNA polymerase mutants studied (MUT ID
No. 2, V783F; MUT ID NO. 3, H784Q; MUT ID NO. 10, A661E I665W
F667L; or MUT ID NO. 18, V783L H784Q). Reactions included P. abyssi
RNase H2 at a concentration of 200 mU per 10 .mu.L reaction (384
fmoles) when using the SMAD7 For rC DxxD (SEQ ID NO. 78) primer and
control reactions or 500-600 mU per 10 .mu.L reaction (960-1152
fmoles) when using the SMAD7 For rU DxxD (SEQ ID NO. 79) primer.
Oligonucleotide reagents used in this Example are shown in Table
22. Cycling was performed on a Roche LightCycler.RTM. 480 (Roche
Applied Science, Indianapolis, Ind., USA) as follows: 95.degree. C.
for 3 minutes followed by 65 cycles of 95.degree. C. for 10 seconds
and 60.degree. C. for 30 seconds. All reactions were performed in
triplicate.
TABLE-US-00022 TABLE 22 Synthetic oligonucleotides employed in
Example 9. SEQ ID Name Sequence (5'-3') NO. SMAD7 Rev
CTCACTCTAAACCCCAGCATT 74 SMAD7 For CAGCCTCATCCAAAAGAGGAAA 75 SMAD7
For rC CAGCCTCATCCAAAAGAGGAAAcAxxA 78 DxxD SMAD7 For rU
CAGCCTCATCCAAAAGAGGAAAuAxxA 79 DxxD SMAD7 probe
FAM-CCCAGAGCTCCCTCAGACTCCT-IBFQ 80 SMAD7 target
CAGCCTCATCCAAAAGAGGAAATAGGACCCC 81 AGAGCTCCCTCAGACTCCTCAGGAAACACAG
ACAATGCTGGGGTTTAGAGTGAG DNA bases are uppercase and RNA bases are
lowercase; FAM = 6-carboxyfluorescein; IBFQ = Iowa Black.TM. FQ
fluorescence quencher; "x" = C3 Spacer (propanediol). Primer and
probe binding sites in the SMAD7 target are underlined.
[0194] Results were analyzed and are shown in Table 23. The control
columns show Cq values for matched primer/target reactions with no
mismatched target present and establish a quantification standard
curve. The rare allele detection columns show Cq values for
detection of 660, 66, 6, or 0 (background control) copies of
matched primer/target in the presence of 66,000 copies of
mismatched target. It is generally assumed that at least a 3 cycle
difference (.DELTA.Cq=3.0 or greater) between background and
positive signal is needed to call a reaction "positive" for rare
allele detection; a 5 cycle difference (.DELTA.Cq=5.0 or greater)
is preferred. In this system, background is the signal observed
when amplification is done using no input target that is matched to
the primer, so signal arises solely from amplification originating
off the mismatched target.
[0195] Using wild type OptiTaq DNA polymerase, detection of the "C"
allele in an excess of "T" background and detection of the "T"
allele in an excess of "C" background both met the .DELTA.Cq 3.0
and .DELTA.Cq 5.0 levels of stringency to call a 1:1000 rare allele
detection event (66 copies of match target in the presence of
66,000 copies of mismatch target). The 1:10,000 reactions (6 copies
of match target in the presence of 66,000 copies of mismatch
target) did not meet either of these criteria. Thus rhPCR had a
1:1000 rare allele detection limit using wild type OptiTaq in this
genomic DNA SNP system.
[0196] In contrast, rhPCR using each of the four mutants showed a
1:10,000 rare allele detection limit for both the "C" and "T"
allele targets with a .DELTA.Cq stringency cutoff of 3.0. MUT ID 3
(H784Q) showed a 1:10,000 rare allele detection limit for both the
"C" and "T" targets in this genomic SNP system for the higher
.DELTA.Cq stringency cutoff of 5.0. The other three mutant Taq DNA
polymerases (MUT ID No. 2, V783F; MUT ID NO. 10, A661E I665W F667L;
and MUT ID NO. 18, V783L H784Q) showed a 1:10,000 rare allele
detection limit for the "C" allele target with a .DELTA.Cq
stringency cutoff of 5.0 and a 1:10,000 rare allele detection limit
for the "T" allele target with a .DELTA.Cq stringency cutoff of
3.0. We therefore conclude that the new mutant Taq DNA polymerases
of the present invention provide for improved rare allele detection
reactions using blocked-cleavable primers in rhPCR compared with
use of the wild type DNA polymerase.
TABLE-US-00023 TABLE 23 Rare allele detection using Gen2 RDxxD
rhPCR primers comparing wild type OptiTaq with new mutant Taq DNA
polymerases 200 ng mismatched template RNase H2 (66,000 copies of
"wild type") Control DNA SEQ ID per 10 660 Match 66 Match 6 Match 0
Match (No mismatched template) Polymerase For Primer NO. .mu.L rxn
(1:100) (1:1,000) (1:10,000) (background) 660 Match 66 Match 6
Match 0 Match Wild type SMAD7 For 75 200 mU 22.1 21.2 21.2 21.8
27.9 31.3 34.4 >65 OptiTaq SMAD7 For 78 200 mU 28.2 31.5 35.1
37.0 28.8 33.3 37.3 >65 rC DxxD SMAD7 For 79 500 mU 31.0 34.7
37.7 39.7 31.2 34.6 41.0 >65 rU DxxD MUT ID 2 SMAD7 For 75 200
mU 22.2 22.2 22.1 22.2 28.9 32.7 35.7 >65 (V783F) SMAD7 For 78
200 mU 28.2 31.7 35.4 45.4 29.0 33.3 37.5 >65 rC DxxD SMAD7 For
79 500 mU 28.6 32.5 36.7 41.3 28.2 34.0 42.0 >65 rU DxxD MUT ID
3 SMAD7 For 75 200 mU 23.5 23.6 24.5 24.1 30.5 33.4 38.0 >65
(H784Q) SMAD7 For 78 200 mU 29.8 33.8 37.6 >65 30.5 35.5 39.6
>65 rC DxxD SMAD7 For 79 500 mU 32.9 37.7 44.0 52.3 30.1 35.9
44.9 >65 rU DxxD MUT ID 10 SMAD7 For 75 200 mU 22.2 22.4 22.5
22.8 28.3 31.9 35.5 >65 (A661E SMAD7 For 78 200 mU 31.8 34.7
38.5 59.3 30.0 33.9 37.8 >65 I665W rC DxxD F667L) SMAD7 For 79
600 mU 33.5 38.4 43.2 46.2 31.9 36.5 41.0 >65 rU DxxD MUT ID 18
SMAD7 For 75 200 mU 22.4 22.4 22.7 22.5 27.8 31.5 34.8 >65
(V783L SMAD7 For 78 200 mU 28.8 32.9 37.5 46.5 29.5 33.4 37.8
>65 H784Q) rC DxxD SMAD7 For 79 500 mU 30.1 34.0 38.4 41.8 29.4
36.0 44.7 >65 rU DxxD Cq values are shown. For the rare allele
detection series (selective detection of 6-660 copes one genotype
in the presence of 66,000 copies of the other genotype), those
reactions having a .DELTA.Cq of 3.0 or better are highlighted in
bold font and those having a .DELTA.Cq of 5.0 or better are
highlighted in bold font with underline. .DELTA.Cq = [(Cq 0 copies
match) - (Cq 6 copies match)], or .DELTA.Cq = [(Cq 0 copies match)
- (Cq 66 copies match)], or .DELTA.Cq = [(Cq 0 copies match) - (Cq
660 copies match)].
Example 10
Sequence of Taq DNA Polymerase Mutants Showing Improved
Discrimination for Mismatch or the Presence of an RNA Residue at
the 3'-End of the Primer
[0197] The complete amino acid and nucleotide sequences of the
codon optimized mutant enzymes employed in Examples 5-9 are shown
below. Although these sequences are easily derived from information
provided in Tables 1, 3, 4 and 5 by one with skill in the art, the
final assembled sequences are provided below for clarity. Base
changes are identified in bold underlined font for the nucleic acid
and amino acid substitutions.
TABLE-US-00024 SEQ ID NO. 82, nucleotide sequence of Mutant ID 2
(V783F)
CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTTAGTCGATGGTCATCACTTGGCCTA-
TCG
GACGTTCCATGCACTCAAAGGTCTGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAGT-
CTT
TGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATTTGATGCCAAAGCACCGAGCTTCCGCCAC-
GAA
GCTTATGGTGGCTACAAGGCAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATTAAGGA-
GTT
AGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTATGAGGCGGACGATGTCCTTGCATCCTTGGCTA-
AAA
AGGCCGAAAAAGAGGGCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTGTCTGACCGT-
ATT
CATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGCCTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCA-
GTG
GGCGGATTATCGGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATTGGTGAAAAAACCG-
CAC
GTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGCCTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGT-
GAA
AAGATCCTGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGCACCGATTTACCGCTTGA-
AGT
GGATTTTGCAAAACGCCGTGAGCCGGACCGGGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCAC-
TGC
TTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTT-
GTT
GGCTTCGTACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGT-
TCA
CCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTG-
TTT
TGGCCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTAGC-
AAT
ACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTC-
CGA
ACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAGTCGAAC-
GTC
CTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTATCA-
CTG
GAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTAACCTCAACTC-
CCG
TGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAAC-
GCA
GTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCCTGCAATACCGTGAG-
TTG
ACGAAGCTTAAAAGCACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACG-
TTT
CAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGAACATTCCGGTCCGTACAC-
CCT
TGGGCCAACGTATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATT-
GAG
CTGCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACAC-
AGA
AACTGCCTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTA-
ATT
TTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCA-
TTC
ATCGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCGTCG-
GGG
CTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGG-
CTG
CGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGTCAAGCTT-
TTC
CCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGTTCCATGACGAGCTGGTGTTAGAAGCCCCTAAGGA-
GCG
CGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACCCCTCGAAGTGG-
AGG TCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 83,
amino acid sequence of Mutant ID 2 (V783F)
MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFR-
HEA
YGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSD-
RIH
VLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNLDRLKPAI-
REK
ILAHMDDLKLSWDLAKVRTDLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWPPPEGA-
FVG
FVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLAYLLDP-
SNT
TPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRAL-
SLE
VAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGLPAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYR-
ELT
KLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQ-
IEL
RVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQ-
AFI
ERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVK-
LFP
RLEEMGARMLLQFHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA.
SEQ ID NO. 84, nucleotide sequence of Mutant ID 3 (H784Q)
CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTTAGTCGATGGTCATCACTTGGCCTA-
TCG
GACGTTCCATGCACTCAAAGGTCTGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAGT-
CTT
TGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATTTGATGCCAAAGCACCGAGCTTCCGCCAC-
GAA
GCTTATGGTGGCTACAAGGCAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATTAAGGA-
GTT
AGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTATGAGGCGGACGATGTCCTTGCATCCTTGGCTA-
AAA
AGGCCGAAAAAGAGGGCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTGTCTGACCGT-
ATT
CATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGCCTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCA-
GTG
GGCGGATTATCGGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATTGGTGAAAAAACCG-
CAC
GTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGCCTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGT-
GAA
AAGATCCTGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGCACCGATTTACCGCTTGA-
AGT
GGATTTTGCAAAACGCCGTGAGCCGGACCGGGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCAC-
TGC
TTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTT-
GTT
GGCTTCGTACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGT-
TCA
CCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTG-
TTT
TGGCCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTAGC-
AAT
ACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTC-
CGA
ACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAGTCGAAC-
GTC
CTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTATCA-
CTG
GAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTAACCTCAACTC-
CCG
TGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAAC-
GCA
GTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCCTGCAATACCGTGAG-
TTG
ACGAAGCTTAAAAGCACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACG-
TTT
CAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGAACATTCCGGTCCGTACAC-
CCT
TGGGCCAACGTATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATT-
GAG
CTGCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACAC-
AGA
AACTGCCTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTA-
ATT
TTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCA-
TTC
ATCGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCGTCG-
GGG
CTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGG-
CTG
CGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGTCAAGCTT-
TTC
CCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGGTCCAGGACGAGCTGGTGTTAGAAGCCCCTAAGGA-
GCG
CGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACCCCTCGAAGTGG-
AGG TCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 85,
amino acid sequence of Mutant ID3 (H784Q)
MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFR-
HEA
YGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSD-
RIH
VLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNLDRLKPAI-
REK
ILAHMDDLKLSWDLAKVRTDLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWPPPEGA-
FVG
FVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLAYLLDP-
SNT
TPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRAL-
SLE
VAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGLPAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYR-
ELT
KLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQ-
IEL
RVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQ-
AFI
ERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVK-
LFP
RLEEMGARMLLQVQDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA.
SEQ ID NO. 86, nucleotide sequence of Mutant ID 10 (A661E, I665W,
F667L)
CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTTAGTCGATGGTCATCACTTGGCCTA-
TCG
GACGTTCCATGCACTCAAAGGTCTGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAGT-
CTT
TGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATTTGATGCCAAAGCACCGAGCTTCCGCCAC-
GAA
GCTTATGGTGGCTACAAGGCAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATTAAGGA-
GTT
AGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTATGAGGCGGACGATGTCCTTGCATCCTTGGCTA-
AAA
AGGCCGAAAAAGAGGGCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTGTCTGACCGT-
ATT
CATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGCCTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCA-
GTG
GGCGGATTATCGGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATTGGTGAAAAAACCG-
CAC
GTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGCCTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGT-
GAA
AAGATCCTGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGCACCGATTTACCGCTTGA-
AGT
GGATTTTGCAAAACGCCGTGAGCCGGACCGGGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCAC-
TGC
TTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTT-
GTT
GGCTTCGTACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGT-
TCA
CCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTG-
TTT
TGGCCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTAGC-
AAT
ACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTC-
CGA
ACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAGTCGAAC-
GTC
CTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTATCA-
CTG
GAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTAACCTCAACTC-
CCG
TGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAAC-
GCA
GTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCCTGCAATACCGTGAG-
TTG
ACGAAGCTTAAAAGCACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACG-
TTT
CAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGAACATTCCGGTCCGTACAC-
CCT
TGGGCCAACGTATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATT-
GAG
CTGCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACAC-
AGA
AACTGCCTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGAAGCTAAAACATGGA-
ATT
TGGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCA-
TTC
ATCGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCGTCG-
GGG
CTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGG-
CTG
CGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGTCAAGCTT-
TTC
CCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGGTCCATGACGAGCTGGTGTTAGAAGCCCCTAAGGA-
GCG
CGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACCCCTCGAAGTGG-
AGG TCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 87,
amino acid sequence of Mutant ID 10 (A661E, I665W, F667L)
MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFR-
HEA
YGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSD-
RIH
VLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNLDRLKPAI-
REK
ILAHMDDLKLSWDLAKVRTDLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWPPPEGA-
FVG
FVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLAYLLDP-
SNT
TPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRAL-
SLE
VAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGLPAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYR-
ELT
KLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQ-
IEL
RVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRREAKTWNLGVLYGMSAHRLSQELAIPYEEAQ-
AFI
ERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVK-
LFP
RLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA.
SEQ ID NO. 88, nucleotide sequence of Mutant ID 18 (V783L, H784Q)
CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTTAGTCGATGGTCATCACTTGGCCTA-
TCG
GACGTTCCATGCACTCAAAGGTCTGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAGT-
CTT
TGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATTTGATGCCAAAGCACCGAGCTTCCGCCAC-
GAA
GCTTATGGTGGCTACAAGGCAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATTAAGGA-
GTT
AGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTATGAGGCGGACGATGTCCTTGCATCCTTGGCTA-
AAA
AGGCCGAAAAAGAGGGCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTGTCTGACCGT-
ATT
CATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGCCTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCA-
GTG
GGCGGATTATCGGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATTGGTGAAAAAACCG-
CAC
GTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGCCTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGT-
GAA
AAGATCCTGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGCACCGATTTACCGCTTGA-
AGT
GGATTTTGCAAAACGCCGTGAGCCGGACCGGGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCAC-
TGC
TTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTT-
GTT
GGCTTCGTACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGT-
TCA
CCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTG-
TTT
TGGCCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTAGC-
AAT
ACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTC-
CGA
ACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAGTCGAAC-
GTC
CTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTATCA-
CTG
GAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTAACCTCAACTC-
CCG
TGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAAC-
GCA
GTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCCTGCAATACCGTGAG-
TTG
ACGAAGCTTAAAAGCACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACG-
TTT
CAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGAACATTCCGGTCCGTACAC-
CCT
TGGGCCAACGTATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATT-
GAG
CTGCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACAC-
AGA
AACTGCCTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTA-
ATT
TTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCA-
TTC
ATCGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCGTCG-
GGG
CTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGG-
CTG
CGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGTCAAGCTT-
TTC
CCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGCTGCAGGACGAGCTGGTGTTAGAAGCCCCTAAGGA-
GCG
CGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACCCCTCGAAGTGG-
AGG TCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 89,
amino acid sequence of Mutant ID 18 (V783L, H784Q)
MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFDAKAPSFR-
HEA
YGGYKAGRAPTPEDFPRQLALIKELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLSD-
RIH
VLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIGEKTARKLLEEWGSLEALLKNLDRLKPAI-
REK
ILAHMDDLKLSWDLAKVRTDLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWPPPEGA-
FVG
FVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLAYLLDP-
SNT
TPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVRLDVAYLRAL-
SLE
VAEETARLEAEVERLAGHPFNLNSRDQLERVLFDELGLPAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYR-
ELT
KLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQ-
IEL
RVLAHLSGDENLIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQ-
AFI
ERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVK-
LFP
RLEEMGARMLLQLQDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA.
Example 11
BLAST Search for Additional Wild-Type VH-Related DNA
Polymerases
[0198] A BLAST search using Taq DNA polymerase sequences G755
through P812 (SEQ ID NO. 90) as a comparison window was performed
using available on-line databases through the National Center for
Biotechnology Information of the National Library of Medicine of
the National Institutes of Health (http://www.ncbi.nlm.nih.gov).
The BLAST search revealed numerous wild-type DNA polymerase from
other species sharing extensive sequence identity with Taq DNA
polymerase, including identity at positions V783 and H784 of Taq
DNA polymerase ("VH-related DNA polymerases"). An exemplary listing
of these thermostable polymerases is illustrated in Table 24 and
similar listing of putatively thermosenstive polymerases is
illustrated in Table 25. In all the identified wild-type polymerase
genes except one (Facklamia hominis), the amino acids corresponding
to V783 and H784 of Taq DNA polymerase are preserved. In the
exceptional case, however, namely, Facklamia hominis, an Ile
naturally occurs at the residue position of the Taq DNA polymerase
corresponding to V783. However, the Taq DNA polymerase mutant
corresponding to Mutant ID 1 that includes this particular
substitution behaves like the wild-type Taq DNA polymerase. Thus,
the DNA polymerase of Facklamia hominis apparently deviates from
the strong selection of Val at this position is postulated to
maintain wild-type activity if either a Val or Ile residue is
present. These BLAST results confirm a natural counter-selection
against DNA polymerases having enhanced template discrimination
activity and provide strong evidence that the disclosed engineered
Taq DNA polymerase mutants having these properties are novel and
non-obvious.
[0199] These identified DNA polymerases share extensive sequence
homology with Taq DNA polymerase in the region that includes
residues V783 and V784 of Taq DNA polymerase. Like that observed
with the engineered Taq DNA polymerase mutants, each of the
identified non-Taq DNA polymerases represent a sequence space from
which engineered mutant enzymes can be generated having enhanced
template discrimination activity, as compared to their respective
unmodified counterparts. The magnitude of the enhanced template
discrimination activity obtained for identical amino acid
substitutions for non-Taq DNA polymerases may not be identical when
compared to the respective unmodified non-Taq DNA polymerases or
even when compared to the magnitude of enhanced template
discrimination activity observed for the corresponding Taq DNA
polymerase mutant. Nevertheless, a strong prediction of this
disclosure is that at least some amino acid substitutions in
non-Taq DNA polymerases having homology to residues V783 and/or
H784 of Taq DNA polymerase will display enhanced template
discrimination activity relative to their respective unmodified
counterparts.
TABLE-US-00025 TABLE 24 Non-Taq thermostable DNA polymerases having
homology to Taq sequences in region of V783 and H784 SEQ Accession
No. Species Alignment (Query: Taq; Sbjct: Species) Identity* ref|WP
018111631.1| Thermus Query 1
GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP 58 88%
SEQ ID NO. 91 igniterrae GTAADLMKLAMV + LFPRL + E +
GARMLLQVHDELVLEAPK + RAE VA LAKEVMEGV + P Sbjct 752
GTAADLMKLAMVRLFPRLQELGARMLLQVHDELVLEAPKDRAERVAALAKEVMEGVVVP 809
ref|WP_022798807.1| Thermus Query 1
GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP 58 90%
SEQ ID NO 92 islandicus GTAADLMKLAMVKLFPRL E GARMLLQVHDEL + LEAPK +
RAE VA LAKEVMEGVYP Sbjct 752
GTAADLMKLAMVKLFPRLREAGARMLLQVHDELLLEAPKDRAEEVAALAKEVMEGVYP 809
ref|YP 005654546.1| Thermus sp. Query 1
GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP 58 84%
SEQ ID NO. 93 CCB_US3_UF1 GTAADLMKLAMV + LFP L + GARMLLQVHDEL +
LEAPKERAE VARLA + EVMEGV + P Sbjct 756
GTAADLMKLAMVRLFPLLPGVGARMLLQVHDELLLEAPKERAEEVARLAREVMEGVVVP 813
ref|WP 018461567.1| Thermus Query 1
GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP 58 83%
SEQ ID NO. 94 oshimai GTAADLMKLAMVKLFPRL + G R + LLQVHDELVLEAPK RAE
A + LAKE MEGVYP Sbjct 753
GTAADLMKLAMVKLFPRLRPLGVRILLQVHDELVLEAPKARAEEAAQLAKETMEGVYP 810
ref|WP 008632471.1| Thermus sp. RL Query 1
GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP 58 84%
SEQ ID NO. 95 GTAADLMKLAMVKLFPRL EMGARMLLQVHDEL + LEAP + RAE VA
LAKE ME YP Sbjct 754
GTAADLMKLAMVKLFPRLREMGARMLLQVHDELLLEAPQARAEEVAALAKEAMEKAYP 811
ref|YP 005640602.1| Thermus Query 1
GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP 58 84%
SEQ ID NO: 96 thermophilus SG0.5JP17-16 GTAADLMKLAMVKLFPRL
EMGARMLLQVHDEL + LEAP + RAE VA LAKE ME YP Sbjct 754
GTAADLMKLAMVKLFPRLREMGARMLLQVHDELLLEAPQARAEEVAALAKEAMEKAYP 811
ref|WP 019550117.1|\ Thermus Query 1
GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP 58 83%
SEQ ID NO. 97 scotoductus GTAADLMKLAMVKLFPRL + E +
GARMLLQVHDELVLEAPKE + AE VA + AK ME V + P Sbjct 753
GTAADLMKLAMVKLFPRLQELGARMLLQVHDELVLEAPKEQAEEVAQEAKRTMEEVVVP 810
gb|AAB81398.1| Thermus Query 1
GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP 58 83%
SEQ ID NO. 98 caldophilus GTAADLMKLAMVKLFPRL EMGARMLLQVHDEL + LEAP
+ AE VA LAKE ME YP Sbjct 757
GTAADLMKLAMVKLFPRLREMGARMLLQVHDELLLEAPQAGAEEVAALAKEAMEKAYP 814
ref|YP 004367987.1| Marini-thermus Query 1
GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVY 57 75%
SEQ ID NO. 99 hydro-thermalis DSM 14884 GTAADLMKLAMVKL P + + GAR +
+ LQVHDELVLEAP + ERAEAVAR + + EVMEG + Sbjct 758
GTAADLMKLAMVKLAPEIRSLGARLILQVHDELVLEAPQERAEAVARVVREVMEGAW 814
gb|AAR11876..1| Thermus Query 1
GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYP 58 72%
SEQ ID NO. 100 filiformis GTAADLMK + AMVKLFPRL + + GA + LLQVHDELVLE
P + + RAE L KEVME YP Sbjct 755
GTAADLMKIAMVKLFPRLKPLGAHLLLQVHDELVLEVPEDRAEEAKALVKEVMENTYP 812
ref|WP 0184.65880.1| Meiothermus Query 1
GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVY 57 68%
SEQ ID NO. 101 timidus GTAADLMKLAMVKL P+ LE + A + + LQVHDELV + EAP
+ ERAE VA LA + E M Sbjct 774
GTAADLMKLAMVKLGPKLEPLDAHLVLQVHDELVIEAPRERAEEVAELARETMRTAW 830
ref|WP 013637959.1| Desulfuro-bacterium Query 1
GTAADLMKLAMVKLFPRLEEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEGV 56 61% SEQ
ID NO. 102 thermolithot rophum GTAAD+MKLAMVKL + + LE + + GA M +
LQVHDE + V + EA + E + E + + + KE ME V Sbjct 765
GTAADIMKLAMVKLYKKLEKLGAYMVLQVHDEIVIEALEEKTEEIMKIVKETMENV 820 ref|YP
005442159.1| Caldilinea Query 1
GTAADLMKLAMVKLFPRLEEMG--ARMLLQVHDELVLEAPKERAEAVARLAKEVMEGVY 57 54%
SEQ ID NO. 103 aerophila GTAAD + MK + AM + + L + RL + G R + L +
QVHDELVLEAP E E + L + E M Y Sbjct 875
GTAADIMKIAMIRLYERLQNDGYRTRLLIQVHDELVLEAPPEELESATHLVRETMANAY 933
*Sequence identity refers to the percent identity of the query
sequence with wild type Taq DNA polymerase.
TABLE-US-00026 TABLE 25 Non-Taq putatively thermosensitive DNA
polymerasess having homology to Taq sequence in the region of V783
and H784 Acces- SEQ sion Iden- No. Species Alignment (Query: Taq;
Sbjct: Species) tity* ref| Eubacterium Query 1
GTAADLMKLAMVKLFPRLEEMG--ARMLLQVHDELVLEAPKERAEAVARLAKEVMEG 55 60% WP
siraeum GTAAD + + K + AM + K + + RLEE G AR + + LQVHDEL + + 015519
EA + + AE VA L KE ME 435.1| Sbjct 751
GTAADIIKIAMIKVYNRLEESGLDARLILQVHDELIVEAKEDCAEKVALLLKEEMEN 807 SEQ
ID NO: 104 ref| Clostridium Query 1
GTAADLMKLAMVKLFPRL--EEMGARMLLQVHDELVLEAPKERAEAVARLAKEVMEG 55 58% WP
leptum GTAAD + + K + AMV + + RL E M AR + + LQVHDEL + + EAP + +
022236 AE AR + E MEG 670.1| Sbjct 320
GTAADIIKIAMVRVDRRLKRENMRARLILQVHDELIVEAPEDEAEQAARILTEEMEG 376 SEQ
ID NO: 105 ref| Entero- Query 1
GTAADLMKLAMVKLFPRLEEMG--ARMLLQVHDELVLEAPKERAEAVARLAKEVME 54 59% WP
coccus G + AAD + + K + AM + + L RL + E G A MLLQVHDELV E PK + 002333
E + + + L KEVME 048.1| Sbjct 803
GSAADILKIAMIELDKRLKETGLQATMLLQVHDELVFEVPKKELESLDKLVKEVME 858 SEQ ID
NO: 106 ref| Facklamia Query 1
GTAADLMKLAMVKLFPRLEEMG--ARMLLQVHDELVLEAPKERAEAVARLAKEVMEG 55 60% WP
hominis GTAAD + + KLAMV + L RLEE G + R + LLQ + HDEL + LE PKE + +
016648 L EVME 372.1| Sbjct 803
GTAADIIKLAMVRLQARLEEAGLSSRLLLQIHDELILEGPKEEMPQLQKLVVEVMES 859 SEQ
ID NO: 107 Ref| Bacillus Query 1
GTAADLMKLAMVKLFPRLEEMG--ARMLLQVHDELVLEAPKERAEAVARLAKEVME 54 61% WP
anthmcis GTAAD + + K AM + + RLEE G AR + LLQVHDEL + EAPKE E + + L
00041 EVME 2792| Sbjct 799
GTAADIIKKAMIIMADRLEEEGLQARLLLQVHDELIFEAPKEEVEKLEKLVPEVME 854 SEQ ID
NO: 108 ref| Bacillus Query 1
GTAADLMKLAMVKLFPRLEEMG--ARMLLQVHDELVLEAPKERAEAVARLAKEVME 54 61% NP
9810 cereus GTAAD + + K AM + + RLEE G AR + LLQVHDEL + EAPKE E + + L
11.1| ATCC EVME SEQ ID 10987 Sbjct 799
GTAADIIKKAMIIMADRLEEEGLQARLLLQVHDELIFEAPKEEIEKLEKLVPEVME 854 NO:
109 *Sequence identity refers to the percent identity of the query
sequence with wild type Taq DNA polymerase.
Example 12
Production of Additional Codon Optimized Taq DNA Polymerase Mutants
at Position H784
[0200] After determining the properties of the first eighteen
mutant versions of the Taq polymerase (Table 3, Mut IDs 1-18), an
additional eighteen mutant versions of Taq DNA polymerase (Table 3,
Mut IDs 19-30) were made by site directed mutagenesis of the cloned
OptiTaq codon-optimized WT Taq DNA polymerase. The full set
represents all possible amino acid variations at position 784 in
Taq polymerase. Specific mutations were introduced into the OptiTaq
sequence using the method of PCR site-directed mutagenesis (Weiner
M P, et al., Gene. 151(1-2):119-23 (1994)). Each mutagenesis
reaction employed 10 pmoles of two complementary oligonucleotides
(Table 26) containing the desired base changes, annealed to the
double-stranded OptiTaq plasmid (20 ng), 5 U KOD DNA polymerase
(Novagen-EMD Chemicals, San Diego, Calif.), 1.5 mM MgSO.sub.4, in
1.times. KOD PCR buffer. Thermal cycling parameters were 95.degree.
C. for 3 minutes (95.degree. C. for 20 sec-55.degree. C. for 20
sec-70.degree. C. for 2.5 minutes) for 16 cycles followed by a
70.degree. C. soak for 4 minutes. After PCR site-directed
mutagenesis, the amplified product was treated with 10 U of Dpn I
(NEB, Ipswich, Mass.), at 37.degree. C. for 1 hour, followed by
inactivation at 80.degree. C. for 20 minutes. 1/110.sup.th of the
digestion material was transformed into XL-1 Blue competent
bacteria. Bacterial clones were isolated, plasmid DNA prepared, and
individual mutations were confirmed by Sanger DNA sequencing. All
mutants remained in the pET-27b(+) expression vector, which is
suitable for expressing the recombinant proteins in E. coli.
Expression and purification of the recombinant mutants of the Taq
polymerase were performed as described in Example 3.
TABLE-US-00027 TABLE 26 Oligonucleotides used for site-directed
mutagenesis to produce 18 Taq DNA Polymerase mutants at position
784. Amino Sequence'' SEQ Sequence'' SEQ Mutant acid Sense
mutagenesis ID Antisense mutagenesis ID ID changes oligonucleotide
No. oligonucleotide No. 19 H784G gggcgcacgtatgcttctgca 110
taggggcttctaacaccagctcg 111 ggtcGGTgacgagctggtgtt
tcACCgacctgcagaagcatacg agaagccccta tgcgccc 20 H784A
gggcgcacgtatgcttctgca 112 taggggcttctaacaccagctcg 113
ggtcGCGgacgagctggtgtt tcCGCgacctgcagaagcatacg agaagccccta tgcgccc
21 H784S gggcgcacgtatgcttctgca 114 taggggcttctaacaccagctcg 115
ggtcAGCgacgagctggtgtt tcGCTgacctgcagaagcatacg agaagccccta tgcgccc
22 H784T gggcgcacgtatgcttctgca 116 taggggcttctaacaccagctcg 117
ggtcACGgacgagctggtgtt tcCGTgacctgcagaagcatacg agaagccccta tgcgccc
23 H784C gggcgcacgtatgcttctgca 118 taggggcttctaacaccagctcg 119
ggtcTGCgacgagctggtgtt tcGCAgacctgcagaagcatacg agaagccccta tgcgccc
24 H784V gggcgcacgtatgcttctgca 120 taggggcttctaacaccagctcg 121
ggtcGTAgacgagctggtgtt tcTACgacctgcagaagcatacg agaagccccta tgcgccc
25 H784L gggcgcacgtatgcttctgca 122 taggggcttctaacaccagctcg 123
ggtcTTGgacgagctggtgtt tcCAAgacctgcagaagcatacg agaagccccta tgcgccc
26 H784I gggcgcacgtatgcttctgca 124 taggggcttctaacaccagctcg 125
ggtcATTgacgagctggtgtt tcAATgacctgcagaagcatacg agaagccccta tgcgccc
27 H784M gggcgcacgtatgcttctgca 126 taggggcttctaacaccagctcg 127
ggtcATGgacgagctggtgtt tcCATgacctgcagaagcatacg agaagccccta tgcgccc
28 H784P gggcgcacgtatgcttctgca 128 taggggcttctaacaccagctcg 129
ggtcCCAgacgagctggtgtt tcTGGgacctgcagaagcatacg agaagccccta tgcgccc
29 H784F gggcgcacgtatgcttctgca 130 taggggcttctaacaccagctcg 131
ggtcTTTgacgagctggtgtt tcAAAgacctgcagaagcatacg agaagccccta tgcgccc
30 H784Y gggcgcacgtatgcttctgca 132 taggggcttctaacaccagctcg 133
ggtcTATgacgagctggtgtt tcATAgacctgcagaagcatacg agaagccccta tgcgccc
31 H784W gggcgcacgtatgcttctgca 134 taggggcttctaacaccagctcg 135
ggtcTGGgacgagctggtgtt tcCCAgacctgcagaagcatacg agaagccccta tgcgccc
32 H784D gggcgcacgtatgcttctgca 136 taggggcttctaacaccagctcg 137
ggtcGATgacgagctggtgtt tcATCgacctgcagaagcatacg agaagccccta tgcgccc
33 H784E gggcgcacgtatgcttctg 138 taggggcttctaacaccagctcg 139
caggtcGAAgacgagctgg tcTTCgacctgcagaagcatacg tgttagaagccccta tgcgccc
34 H784N gggcgcacgtatgcttctgca 140 taggggcttctaacaccagctcg 141
ggtcAACgacgagctggtgtt tcGTTgacctgcagaagcatacg agaagccccta tgcgccc
35 H784K gggcgcacgtatgcttctgca 142 taggggcttctaacaccagctcg 143
ggtcAAAgacgagctggtgtt tcTTTgacctgcagaagcatacg agaagccccta tgcgccc
36 H784R gggcgcacgtatgcttctgca 144 taggggcttctaacaccagctcg 145
ggtcCGGgacgagctggtgtt tcCCGgacctgcagaagcatacg agaagccccta tgcgccc
DNA bases identical to codon optimized OptiTaq are shown in lower
case; those specific for the mutations introduced by site-directed
mutagenesis are shown in upper case.
Example 13
Characterization of Properties of 18 Mutant Taq DNA Polymerases
Altered at Position H784 in PCR
[0201] The 18 mutant Taq DNA polymerase enzymes described in
Example 12 were characterized for polymerase activity and ability
to discriminate a 3'-RNA residue in the primer oligonucleotide.
[0202] The unit activity of the purified wild-type protein was
determined by comparing performance in qPCR of known quantities of
OptiTaq and each mutant compared to a commercial native
non-hot-start Taq DNA polymerase, Taq-B DNA Polymerase (Enzymatics,
Beverly, Mass.). Quantification cycle values (Cq, the amplification
cycle number at which positive signal is first detected) and
amplification curve shapes were analyzed to determine the nanogram
amounts at which both enzymes performed similarly in the suboptimal
range for each. Using these nanogram amounts and known unit values
of Taq-B DNA polymerase, relative activity unit values could be
extrapolated for all of the mutant DNA polymerase enzymes having
sufficient activity to support PCR.
[0203] The following reaction conditions were employed: 1.times.
qPCR buffer (20 mM Tris pH 8.4, 50 mM KCl, 3 mM MgCl.sub.2, 0.01%
Triton-X100), 800 .mu.M dNTPs (200 .mu.M each), 500 nM For primer
(Hs HPRT F517, SEQ ID NO. 43), 500 nM Rev primer (Hs HPRT R591, SEQ
ID NO. 44), 250 nM probe (Hs HPRT P554, SEQ ID NO. 45),
2.times.10.sup.3 copies of linearized cloned plasmid template
(HPRT-targ, SEQ ID NO. 46), in 10 .mu.L final volume. The amount of
DNA polymerase added to each reaction was varied as follows: for
wild type (OptiTaq), reactions were set using 10, 1, 0.1, 0.01, and
0.001 U/.mu.L (220, 22, 2.2, 0.22, or 0.022 ng of protein per 10
.mu.L reaction). Mutant polymerases were run in similar
concentrations. In addition, those mutant enzymes showing
polymerase activity were more finely titrated testing 220, 22,
10.6, 4.8, 2.2, 1.1, 0.48, and 0.22 ng of protein per 10 .mu.L
reaction. Enzyme dilutions were made in enzyme dilution buffer (20
mM Tris pH7.5, 100 mM NaCl, 1 mM DTT, 0.1% Triton-X100, 1 mg/mL
BSA, 10% glycerol). Reactions were run in 384 well format on a
BIO-RAD CFX384.TM. Real-Time System (BIO-RAD, Hercules, Calif.)
using cycling parameters 95.degree. C. for 30 seconds followed by
60 cycles of [95.degree. C. for 15 seconds followed by 60.degree.
C. for 1 minutes]. Detection was achieved using a
fluorescence-quenched probe (5'-nuclease assay format, note that
the mutations introduced into the present series of Taq mutants do
not lie in the 5'-nuclease domain). Sequences of the primers,
probe, and template (plasmid insert) are shown in Table 27.
TABLE-US-00028 TABLE 27 Sequence of oligonucleotides employed in
Taq DNA polymerase activity assay. Name Sequence SEQ ID NO. Hs HPRT
GACTTTGCTTTCCTTGGTCAG SEQ ID NO. 43 F517 Hs HPRT
GGCTTATATCCAACACTTCGTG SEQ ID NO. 44 R591 Hs HPRT
FAM-ATGGTCAAG(ZEN)GTCG SEQ ID NO. 45 P554 CAAGCTTGCTGGT-IBFQ HPRT-
GACTTTGCTTTCCTTGGTCAGGCAG SEQ ID NO. 46 targ
TATAATCCAAAGATGGTCAAGGTCG CAAGCTTGCTGGTGAAAAGGACCCC
ACGAAGTGTTGGATATAAGCC Nucleic acid sequences are shown 5'-3'. FAM =
6-carboxyfluorescein, IBFQ = Iowa Black FQ (fluorescence quencher),
and ZEN = ZEN internal fluorescence quencher.
[0204] These 18 Taq DNA polymerase mutants were characterized as
outlined above. Results are summarized in Table 28. Ten mutants,
including Mutant IDs 19, 23, 25, 28, and 31 to 36, did not show
detectable DNA polymerase activity and were not studied further.
Four mutants, Mutant IDs 20, 21, 27 and 29 had DNA polymerase
activity; however, processivity was reduced from 4-6 fold relative
to the wild type enzyme. Three mutants, Mutant IDs 24, 26, and 30,
showed DNA polymerase activity similar to wild type OptiTaq.
TABLE-US-00029 TABLE 28 Activity of novel Taq DNA polymerase
mutants. Amino acid .DELTA.Cq Delay in Mutant changes from
Polymerase Relative priming from ID wild-type Taq Activity
activity* an RNA base** 19 H784G No -- -- 20 H784A Yes 0.2 1 21
H784S Yes 0.16 2 22 H784T Yes 1 0 23 H784C No -- -- 24 H784V Yes
0.45 >35 25 H784L No -- -- 26 H784I Yes 0.5 6 27 H784M Yes 0.22
>35 28 H784P No -- -- 29 H784F Yes 0.22 3 30 H784Y Yes 0.45 5 31
H784W No -- -- 32 H784D No -- -- 33 H784E No -- -- 34 H784N No --
-- 35 H784K No -- -- 36 H784R No -- -- *Wild-type OptiTaq was set
to "1" and the relative activity of each of the mutant polymerases
was normalized to this amplification efficiency, with 1 as the
maximum. **.DELTA.Cq = [Cq Mutant ID X] - [Cq OptiTaq] when qPCR
reactions are run using primers having a 3'-RNA residue.
[0205] The subset of these mutant Taq DNA polymerases which showed
suitable levels of DNA polymerase activity were studied for their
ability to discriminate between primers have a 3'-DNA versus a
3'-RNA residue relative to the wild type OptiTaq enzyme. Real-time
PCR was performed as before, employing in the reactions the amount
of each mutant DNA polymerase equal to 0.5 units of wild-type
OptiTaq per 10 .mu.L reaction. The following reaction conditions
were employed: 1.times. qPCR buffer (20 mM Tris pH 8.4, 50 mM KCl,
3 mM MgCl.sub.2, 0.01% Triton-X100), 800 .mu.M dNTPs (200 .mu.M
each), 500 nM For primer (Hs SFRS9 F569 rU, SEQ ID NO. 47), 500 nM
Rev primer (Hs SFRS9 R712 rA, SEQ ID NO. 48), 250 nM probe (Hs
SFRS9 P644, SEQ ID NO. 49), 2.times.10.sup.3 copies of linearized
cloned plasmid template (SFRS9-targ, SEQ ID NO. 50), in 10 .mu.L
final volume. Reactions were run in 384 well format on a BIO-RAD
CFX384.TM. Real-Time System (BIO-RAD, Hercules, Calif.) using
cycling parameters 95.degree. C. for 30 seconds followed by 60
cycles of [95.degree. C. for 15 seconds followed by 60.degree. C.
for 1 minutes]. Detection was achieved using a
fluorescence-quenched probe (5'-nuclease assay format). Sequences
of the primers, probe, and template (plasmid insert) are shown in
Table 29.
TABLE-US-00030 TABLE 29 Sequence of oligonucleotides employed in
the primer 3'-RNA discrimination assay. Name Sequence SEQ ID NO. Hs
SFRS9 TGTGCAGAAGGATGGAGu SEQ ID NO. 47 F569 rU Hs SFRS9
CTGGTGCTTCTCTCAGGATa SEQ ID NO. 48 R712 rA Hs SFRS9
HEX-TGGAATATG(ZEN)CC SEQ ID NO. 48 P644 CTGCGTAAACTGGA-IBFQ SFRS9-
TGTGCAGAAGGATGGAGTGG SEQ ID NO. 50 targ GGATGGTCGAGTATCTCAGA
AAAGAAGACATGGAATATGC CCTGCGTAAACTGGATGACA CCAAATTCCGCTCTCATGAG
GGTGAAACTTCCTACATCCG AGTTTATCCTGAGAGAAGCA CCAG Nucleic acid
sequences are shown 5'-3' with DNA uppercase and RNA lowercase. HEX
= hexachlorofluorescein, IBFQ = Iowa Black FQ (fluorescence
quencher), and ZEN = ZEN fluorescence quencher.
[0206] The eight Taq DNA polymerase mutants that supported PCR were
tested for the ability to use a 3'-RNA modified primer as outlined
above. Results are summarized in Table 28. Mutant IDs 20 and 22 did
not show any significant difference between primers having a 3'-DNA
versus a 3'-RNA residue. Mutant IDs 21, 24, 26, 27, 29, and 30
showed an amplification delay using 3'-RNA primers. Thus,
additional Taq DNA polymerase mutants were identified which
discriminate against priming from a 3'-RNA residue. Those mutants
which showed some delay with RNA priming and showed high
processivity were further studied for improvements in primer
3'-residue mismatch discrimination.
Example 14
Improved Mismatch Discrimination in Allele-Specific PCR using
Mutant Taq DNA Polymerases Altered at Position H784
[0207] Of the 18 mutant enzymes studied in Example 12 and 13,
Mutant IDs 21, 24, 26, 27, 29, and 30 showed the ability to
discriminate against a 3'-RNA residue in the primer and retained
high enzymatic activity/processivity. These six mutants and
additionally Mutant IDs 20 and 22 were studied for the ability to
discriminate against a 3'-terminal DNA mismatch compared with wild
type OptiTaq DNA polymerase using an allele-specific qPCR assay.
Amplification reactions were performed against a synthetic
oligonucleotide template where a single base was varied (SNP) which
was positioned to lie at the 3'-end of the reverse primer.
Synthetic templates were employed having each of the 4 possible
bases at this position. Reverse primers were employed having each
of the 4 possible bases at the 3'-end. Relative amplification
efficiencies of all pairwise primer/template combinations were
assessed using qPCR.
[0208] Quantitative allele-specific real-time PCR (AS-qPCR) was
performed in 10 .mu.L reaction volumes in 384 well format with
2.times.10.sup.5 copies of a 103 bp synthetic template (SEQ ID NOs.
51-4). Final reaction conditions used were 20 mM Tris-HCL (pH 8.4
at 25.degree. C.), 50 mM KCL, and 3 mM MgCl.sub.2, 0.01% Triton
X-100, 800 .mu.M total dNTPs, and 200 nM of the universal forward
primer (SEQ ID NO. 60), 200 nM of a reverse primer (separate
reactions were set up for each of the allele-specific primers SEQ
ID NOs. 55-58 or the control universal primer SEQ ID NO. 59) and
200 nM of the 5' nuclease detection probe (SEQ ID NO. 61). Each
allele-specific primer was tested on each SNP template. Reactions
utilized either 0.5 U (10.8 ng/11.1 nM/111 fmol) of the wild type
OptiTaq DNA polymerase or 0.5 U of one of the nine Taq DNA
polymerase mutants studied (Mutant ID 3 (H784Q) (10.8 ng/11.1
nM/111 fmol); Mutant ID 20 H784A (54 ng/55.5 nM/555 fmol); Mutant
ID22 H784T (10.8 ng/11.1 nM/111 fmol); Mutant ID 24 H784V (24
ng/24.7 nM/246.7 fmol); Mutant ID 26 H784I (21.6 ng/22.2 nM/222
fmol); Mutant ID 27 H784M (10.8 ng/11.1 nM/111 fmol); Mutant ID 29
H784F (49.1 ng/49.4 nM/494.5 fmol); Mutant ID 30 H784Y) (24 ng/24.7
nM/246.7 fmol). Amplification was performed on a CFX384.TM.
C1000.TM. Thermo Cycler system (Bio-Rad, Hercules, Calif.) using
the following cycling parameters: 95.degree. C. for 30 seconds
initial denaturation followed by 60 cycles of 95.degree. C. for 10
seconds, then 60.degree. C. for 30 seconds. Oligonucleotide
reagents used in this example are shown in Table 30.
TABLE-US-00031 TABLE 30 Synthetic oligonucleotides employed in
Example 13. Name Sequence (5'-3') SEQ ID NO. A AGCTCTGCCCAAAGATTACC
SEQ ID NO. 51 Template CTGACAGCTAAGTGGCAGTG GAAGTTGGCCTCAGAAGTAG
TGGCCAGCTGTGTGTCGGGG AACAGTAAAGGCATGAAGCT CAG C
AGCTCTGCCCAAAGATTACC SEQ ID NO. 52 Template CTGACAGCTAAGTGGCAGTG
GAAGTTGGCCTCAGAAGTAG TGGCCAGCTGTGTGTCGGGG CACAGTAAAGGCATGAAGCT CAG
G AGCTCTGCCCAAAGATTACC SEQ ID NO. 53 Template CTGACAGCTAAGTGGCAGTG
GAAGTTGGCCTCAGAAGTAG TGGCCAGCTGTGTGTCGGGG GACAGTAAAGGCATGAAGCT CAG
T AGCTCTGCCCAAAGATTACC SEQ ID NO. 54 Template CTGACAGCTAAGTGGCAGTG
GAAGTTGGCCTCAGAAGTAG TGGCCAGCTGTGTGTCGGGG TACAGTAAAGGCATGAAGCT CAG
Syn Rev T CTGAGCTTCATGCCTTTACT SEQ ID NO. 55 GTT Syn Rev C
CTGAGCTTCATGCCTTTACT SEQ ID NO. 56 GTC Syn Rev A
CTGAGCTTCATGCCTTTACT SEQ ID NO. 57 GTA Syn Rev G
CTGAGCTTCATGCCTTTACT SEQ ID NO. 58 GTG Syn Rev CTGAGCTTCATGCCTTTACT
SEQ ID NO. 59 GT Syn For AGCTCTGCCCAAAGATTACC SEQ ID NO. 60 CTG Syn
Probe FAM-TTCTGAGGC(ZEN)CA SEQ ID NO. 61 ACTTCCACTGCCACTTA- IBFQ
DNA bases are uppercase; FAM = 6-carboxyfluorescein; IBFQ = Iowa
Black .TM. FQ fluorescence quencher; ZEN = internal ZEN
fluorescence quencher; underlined base indicates the SNP site in
the synthetic template DNA.
[0209] Initially all reactions were run in triplicate. Similar
results were obtained for all replicates when using the wild type
OptiTaq. However, results showed greater variation for the mutant
polymerases. To obtain statistically meaningful results, each
reaction was therefore performed 24 times for the mutant
polymerases and 21 times for the wild type enzyme. .DELTA.Cq values
were calculated as the Cq value obtained for each mismatched base
pair minus the Cq value obtained for the matched base pair
(.DELTA.Cq=Cq mismatch-Cq match). The .DELTA.Cq values for all 24
replicates were averaged and standard deviations were calculated.
Results are shown in Table 31 and are graphically summarized in
FIGS. 3C, 3D, 3E, 3F, and 3G. Note that the reverse primer is the
allele-specific primer, so the "Syn Rev T" primer (SEQ ID NO. 55)
is the perfect match to the Template A (SEQ ID NO. 51), etc.
TABLE-US-00032 TABLE 31 .DELTA.Cq values for AS-qPCR reactions
using WT OptiTaq and H784 mutant Taq DNA polymerases. Reverse
Primer Template SEQ A C G T DNA ID SEQ ID SEQ ID SEQ ID SEQ ID
Polymerase Name NO. NO. 51 NO. 52 NO. 53 NO. 54 OptiTaq Syn Rev T
55 -- 1.4 +/- 0.1 0.6 +/- 0.2 4.8 +/- 0.2 Syn Rev G 58 8.5 +/- 0.2
-- 5.9 +/- 0.2 3.5 +/- 0.2 Syn Rev C 56 2.8 +/- 0.2 7.7 +/- 0.1 --
3.9 +/- 0.1 Syn Rev A 57 5.3 +/- 0.2 -0.8 +/- 0.1 6.1 +/- 0.1 --
MUT ID 3 Syn Rev T 55 -- 5.7 +/- 0.2 5.7 +/- 0.3 10.8 +/- 0.4 H784Q
Syn Rev G 58 14.5 +/- 0.6 -- 12.5 +/- 0.5 6.8 +/- 0.2 Syn Rev C 56
8.5 +/- 1.5 10.6 +/- 0.2 -- 7.7 +/- 0.3 Syn Rev A 57 10.3 +/- 0.5
4.1 +/- 0.1 11.0 +/- 0.7 -- MUT ID 20 Syn Rev T 55 -- 7.6 +/- 0.3
7.7 +/- 0.4 12.3 +/- 0.8 H784A Syn Rev G 58 19.1 +/- 6.0 -- 14.8
+/- 1.4 6.3 +/- 0.5 Syn Rev C 56 9.6 +/- 0.5 12.4 +/- 4.7 -- 8.2
+/- 0.4 Syn Rev A 57 14.9 +/- 4.4 7.6 +/- 0.2 14.2 +/- 1.9 -- MUT
ID 21 Syn Rev T 55 -- 7.9 +/- 0.5 19.6 +/- 8.5 8.6 +/- 0.8 H784S
Syn Rev G 58 25.8 +/- 9.2 -- 23.9 +/- 9.6 6.6 +/- 0.3 Syn Rev C 56
11.4 +/- 4.0 16.4 +/- 9.2 -- 9.1 +/- 1.5 Syn Rev A 57 23.1 +/- 8.2
8.4 +/- 0.4 22.9 +/- 8.6 -- MUT ID 22 Syn Rev T 55 -- 1.5 +/- 0.3
3.7 +/- 0.3 5.6 +/- 0.3 H784T Syn Rev G 58 13.3 +/- 0.6 -- 10.7 +/-
0.5 3.9 +/- 0.2 Syn Rev C 56 5.2 +/- 0.3 9.3 +/- 0.5 -- 3.3 +/- 0.3
Syn Rev A 57 9.8 +/- 0.3 2.4 +/- 0.2 11.0 +/- 0.4 -- MUT ID 24 Syn
Rev T 55 -- -0.3 +/- 0.2 1.8 +/- 0.2 2.6 +/- 0.2 H784V Syn Rev G 58
10.2 +/- 0.2 -- 8.4 +/- 0.1 2.8 +/- 0.2 Syn Rev C 56 2.8 +/- 0.1
4.6 +/- 0.1 -- 1.8 +/- 0.1 Syn Rev A 57 5.4 +/- 0.1 0.2 +/- 0.1 9.2
+/- 0.2 -- MUT ID 26 Syn Rev T 55 -- 0.3 +/- 0.2 3.1 +/- 0.1 2.4
+/- 0.2 H784I Syn Rev G 58 11.3 +/- 0.2 -- 9.0 +/- 0.2 3.4 +/- 0.2
Syn Rev C 56 4.3 +/- 0.2 6.7 +/- 0.1 -- 2.5 +/- 0.2 Syn Rev A 57
6.3 +/- 0.1 0.7 +/- 0.1 10.0 +/- 0.2 -- MUT ID 27 Syn Rev T 55 --
4.5 +/- 0.2 6.9 +/- 0.2 9.6 +/- 0.5 H784M Syn Rev G 58 16.7 +/- 3.9
-- 13.7 +/- 0.7 6.5 +/- 0.3 Syn Rev C 56 9.5 +/- 0.3 11.0 +/- 0.4
-- 7.4 +/- 0.3 Syn Rev A 57 12.7 +/- 0.1 5.1 +/- 0.1 14.0 +/- 2.0
-- MUT ID 29 Syn Rev T 55 -- 5.6 +/- 0.2 3.5 +/- 0.1 7.0 +/- 0.2
H784F Syn Rev G 58 13.3 +/- 0.6 -- 10.3 +/- 0.3 3.0 +/- 0.2 Syn Rev
C 56 8.1 +/- 0.2 9.7 +/- 0.3 -- 5.7 +/- 0.2 Syn Rev A 57 10.9 +/-
0.3 4.6 +/- 0.2 11.3 +/- 0.4 -- MUT ID 30 Syn Rev T 55 -- 5.3 +/-
0.2 4.9 +/- 0.2 8.8 +/- 0.2 H784Y Syn Rev G 58 15.7 +/- 4.6 -- 11.8
+/- 0.5 5.5 +/- 0.3 Syn Rev C 56 7.3 +/- 0.2 9.9 +/- 0.3 -- 6.0 +/-
0.2 Syn Rev A 57 10.2 +/- 0.2 4.5 +/- 0.2 10.5 +/- 0.3 -- Average
.DELTA.Cq values are shown, where .DELTA.Cq = [Cq mismatch - Cq
match], +/- standard deviation calculated from 96 replicates.
[0210] The wild type OptiTaq showed an average .DELTA.Cq for
AS-qPCR in this synthetic amplicon system of 4.1 with a range of
-0.8 to 8.5. Mutant ID 3 (H784Q) showed an average .DELTA.Cq of 9.9
with a range of 4.6 to 21.2. Mutant ID 20 (H784A) showed an average
.DELTA.Cq of 11.2 with a range of 6.3 to 14.9. Mutant ID 21 (H784S)
showed an average .DELTA.Cq of 15.3 with a range of 6.6 to 25.8.
Mutant ID 22 (H784T) showed an average .DELTA.Cq of 6.6 with a
range of 1.5 to 13.3. Mutant ID 24 (H784V) showed an average
.DELTA.Cq of 4.1 with a range of -0.3 to 10.2. Mutant ID 26 (H7841)
showed an average .DELTA.Cq of 5.0 with a range of 0.3 to 11.3.
Mutant ID 27 (H784M) showed an average .DELTA.Cq of 9.8 with a
range of 4.5 to 16.7. Mutant ID 29 (H784F) showed an average
.DELTA.Cq of 7.8 with a range of 3.5 to 13.3. Mutant ID 30 (H784Y)
showed an average .DELTA.Cq of 8.3 with a range of 5.3 to 15.7.
Therefore, in nearly all pairwise combinations of 4 template bases
and 4 3'-terminal primer bases, the mutant Taq DNA polymerases of
the present invention showed greater discrimination to mismatch
than did the wild type OptiTaq DNA polymerase. The magnitude of
improvement for each mismatch pair is defined by the
.DELTA..DELTA.Cq, which is the difference of discrimination between
the mutant and wild type enzymes (.DELTA..DELTA.Cq=.DELTA.Cq
mutant-.DELTA.Cq wild type). The .DELTA..DELTA.Cq values were
calculated and are shown in Table 32.
TABLE-US-00033 TABLE 32 .DELTA..DELTA.Cq values for AS-qPCR
reactions for the H784 mutant Taq DNA polymerases compared with
wild type OptiTaq Reverse Primer Template SEQ A C G T DNA ID SEQ ID
SEQ ID SEQ ID SEQ ID Polymerase Name NO. NO. 51 NO. 52 NO. 53 NO.
54 MUT ID Syn Rev T 55 -- 4.3 5.1 6.0 NO. 3 Syn Rev G 58 6.0 -- 6.6
3.3 H784Q Syn Rev C 56 5.7 2.9 -- 3.8 Syn Rev A 57 5.0 4.9 4.9 --
MUT ID 20 Syn Rev T 55 -- 6.2 7.1 7.5 H784A Syn Rev G 58 10.6 --
8.9 2.8 Syn Rev C 56 6.8 4.7 -- 4.3 Syn Rev A 57 9.6 8.4 8.1 -- MUT
ID 21 Syn Rev T 55 -- 6.5 19.0 3.8 H784S Syn Rev G 58 17.3 -- 18.0
3.1 Syn Rev C 56 8.6 8.7 -- 5.2 Syn Rev A 57 17.8 9.2 16.8 -- MUT
ID 22 Syn Rev T 55 -- 0.1 3.1 0.8 H784T Syn Rev G 58 4.8 -- 4.8 0.4
Syn Rev C 56 2.4 1.6 -- -0.6 Syn Rev A 57 4.5 3.2 4.9 -- MUT ID 24
Syn Rev T 55 -- -1.7 1.2 -2.2 H784V Syn Rev G 58 1.7 -- 2.5 -0.7
Syn Rev C 56 0.0 -3.1 -- -2.1 Syn Rev A 57 0.1 1.0 3.1 -- MUT ID 26
Syn Rev T 55 -- -1.1 2.5 -2.4 H784I Syn Rev G 58 2.8 -- 3.1 -0.1
Syn Rev C 56 1.5 -1.0 -- -1.4 Syn Rev A 57 1.0 1.5 3.9 -- MUT ID 27
Syn Rev T 55 -- 3.1 6.3 4.8 H784M Syn Rev G 58 8.2 -- 7.8 3.0 Syn
Rev C 56 6.7 3.3 -- 3.5 Syn Rev A 57 7.4 5.9 7.9 -- MUT ID 29 Syn
Rev T 55 -- 4.2 2.9 2.2 H784F Syn Rev G 58 4.8 -- 4.4 -0.5 Syn Rev
C 56 5.3 2.0 -- 1.8 Syn Rev A 57 5.6 5.4 5.2 -- MUT ID 30 Syn Rev T
55 -- 3.9 4.3 4.0 H784Y Syn Rev G 58 7.2 -- 5.9 2.0 Syn Rev C 56
4.5 2.2 -- 2.1 Syn Rev A 57 4.9 5.3 4.4 -- Average .DELTA..DELTA.Cq
values are shown, where .DELTA..DELTA.Cq = [.DELTA.Cq mutant -
.DELTA.Cq wild type], from data in Table 17.
[0211] Mutant ID 3 (H784Q) showed an average .DELTA..DELTA.Cq of
4.9 compared to wild type OptiTaq. Mutant ID 20 (H784A) showed an
average .DELTA..DELTA.Cq of 7.1 compared to wild type OptiTaq.
Mutant ID 21 (H784S) showed an average .DELTA..DELTA.Cq of 11.2
compared to wild type OptiTaq. Mutant ID 22 (H784T) showed an
average .DELTA..DELTA.Cq of 2.5 compared to wild type OptiTaq.
Mutant ID 24 (H784V) showed an average .DELTA..DELTA.Cq of -0.2
compared to wild type OptiTaq. Mutant ID 26 (H7841) showed an
average .DELTA..DELTA.Cq of 1.0 compared to wild type OptiTaq.
Mutant ID 27 (H784M) showed an average .DELTA..DELTA.Cq of 5.7
compared to wild type OptiTaq. Mutant ID 29 (H784F) showed an
average .DELTA..DELTA.Cq of 3.6 compared to wild type OptiTaq.
Mutant ID 30 (H784Y) showed an average .DELTA..DELTA.Cq of 4.2
compared to wild type OptiTaq. Therefore, with the exception of
Mutant ID 24 (H784V), each of the mutant Taq DNA polymerases of the
present invention showed a significant improvement over wild type
OptiTaq in mismatch discrimination. Overall, mutant ID 21 (H784S)
showed the best SNP discrimination within the set of 9 mutant
enzymes studied in this example using this AS-PCR assay.
Example 15
Improved Mismatch Discrimination in rhPCR using Mutant Taq DNA
Polymerases in a Human Genomic DNA SNP Assay
[0212] Example 14 demonstrated utility of the novel mutant Taq DNA
polymerases of the present invention in a synthetic amplicon rhPCR
SNP discrimination assay system. The present Example demonstrates
utility of the novel mutant Taq DNA polymerases in a human genomic
DNA rhPCR SNP discrimination assays system, examining a SNP site in
the SMAD7 gene (NM_005904, C/T SNP, rs4939827). The assays employed
target DNAs GM18562 (homozygous C/C) and GM18537 (homozygous T/T)
from the Coriell Institute for Medical Research (Camden, N.J.,
USA). Two different blocked-cleavable primer designs were tested,
including the generation 1 (Gen1) "RDDDDx" primers and the
generation 2 (Gen2) "RDxxD" primers (see: US Patent Application
2012/0258455 by Behlke et al., entitled, RNASE H-BASED ASSAYS
UTILIZING MODIFIED RNA MONOMERS).
[0213] Quantitative real-time rhPCR was performed in 10 .mu.L
reaction volumes in 384 well format with 20 ng (the equivalent of
6600 copies of target) of human genomic DNA (GM18562 or GM18537).
Reactions utilized either 0.5 U (10.8 ng/11.1 nM/111 fmol) of wild
type OptiTaq DNA polymerase or 0.5 U of one of the nine Taq DNA
polymerase mutants (MUT ID 3, H784Q; MUT ID 20, H784A; MUT ID 21,
H784S; MUT ID 22, H784T; MUT ID 24, H784V; MUT ID 26, H784I; MUT ID
27 H784M MUT ID 29, H784F; MUT ID 30, H784Y). Final reaction
conditions used were 20 mM Tris-HCL (pH 8.4 at 25.degree. C.), 50
mM KCL, 3 mM MgCl2, 0.01% Triton X-100, 800 .mu.M total dNTPs, 200
nM of a forward primer (SEQ ID NOs. 75-79), 200 nM of the universal
reverse primer (SEQ ID NO. 74), and 200 nM of the SMAD7 probe (SEQ
ID NO. 80). Sequence of the 85 bp SMAD7 amplicon is shown as SEQ ID
NO. 81. Forward primers included RDDDDx configuration Gen1
allele-specific rhPCR primers (SEQ ID NOs. 76 and 77), RDxxD
configuration Gen2 allele-specific rhPCR primers (SEQ ID NOs. 78
and 79) and the control universal forward primer (SEQ ID NO.75)
which is not allele specific. Oligonucleotide reagents employed in
this Example are shown in Table 33. Reactions included 1 .mu.L of
P.a. RNase H2 at a concentration of 2.6 mU per 10 .mu.L reaction (5
fmoles, 0.5 nM) with the exception of MUT ID 21 (H784S) for which
200 mU per 10 .mu.L (384 fmoles, 38.4 nM) was used for the Gen1
RDDDDx primers and control primer (SEQ ID NOs. 75-77) or 200 mU per
10 .mu.L reaction (384 fmoles, 38.4 nM) for the Gen2 RDxxD primers
(SEQ ID NOs. 78 and 79). Amplification was performed on a Roche
LightCycler.RTM. 480 (Roche Applied Science, Indianapolis, Ind.,
USA) as follows: 95.degree. C. for 3 minutes followed by 95 cycles
of 95.degree. C. for 10 seconds and 60.degree. C. for 30 seconds.
All reactions were performed in triplicate.
TABLE-US-00034 TABLE 33 Synthetic oligonucleotides employed in
Example 14. Name Sequence (5'-3') SEQ ID NO. SMAD7 Rev
CTCACTCTAAACCCCAGCATT 74 SMAD7 For CAGCCTCATCCAAAAGAGGAAA 75 SMAD7
For CAGCCTCATCCAAAAGAGGAAAc 76 rC DDDDx AGGAx SMAD7 For
CAGCCTCATCCAAAAGAGGAAAu 77 rU DDDDx AGGAx SMAD7 For
CAGCCTCATCCAAAAGAGGAAAc 78 rC DxxD AxxA SMAD7 For
CAGCCTCATCCAAAAGAGGAAAu 79 rU DxxD AxxA SMAD7
FAM-CCCAGAGCTCCCTCAGACT 80 probe CCT-IBFQ SMAD7
CAGCCTCATCCAAAAGAGGAAAT 81 target AGGACCCCAGAGCTCCCTCAGAC
TCCTCAGGAAACACAGACAATGC TGGGGTTTAGAGTGAG DNA bases are uppercase
and RNA bases are lowercase; FAM = 6-carboxyfluorescein; IBFQ =
Iowa Black .TM. FQ fluorescence quencher; "x" = C3 Spacer
(propanediol). Primer and probe binding sites in the SMAD7 target
are underlined.
[0214] Results using the Gen1 RDDDDx rhPCR primers are shown in
Table 34 using the Gen2 RDxxD rhPCR primers are shown in Table 35.
Use of the mutant Taq DNA polymerases showed significant
improvements in SNP discrimination in this human genomic DNA rhPCR
assay using the Gen1 RDDDDx primers, although amplification
efficiency was often reduced, as shown by the increases in the
match Cqs. Large improvements in discrimination were seen using the
Gen2 RDxxD primers, although amplification efficiency was often
lost here as well. The Gen2 RDxxD primers inherently show greater
SNP discrimination and these levels were increased so that
.DELTA.Cq values are in some cases were greater than 40
amplification cycles between match and mismatch; this level of
discrimination would be "greater than assay" for most users, as
qPCR reactions are seldom run for over 45-50 cycles and positive
signal was not detected in these cases until after 70 cycles (Table
35). Therefore use of the new mutant Taq DNA polymerases improves
SNP discrimination in rhPCR genotyping assays.
TABLE-US-00035 TABLE 34 SNP discrimination of a site in the SMAD7
gene using Gen1 RDDDDx primers comparing wild type OptiTaq with
four mutant Taq DNA polymerases. Cq Cq SEQ mU RNase Value Value DNA
ID H2 per C/C T/T Polymerase For Primer NO. 10 .mu.L rxn DNA DNA
.DELTA.Cq Wild type SMAD7 For 75 2.6 24.1 24.9 -- OptiTaq SMAD7 For
76 2.6 24.3 36.3 11.9 rC DDDDx SMAD7 For 77 2.6 35.1 27.5 7.6 rU
DDDDx MUT ID 3 SMAD7 For 75 2.6 26.0 28.1 -- H784Q SMAD7 For 76 2.6
29.4 49.1 19.7 rC DDDDx SMAD7 For 77 2.6 48.1 37.6 10.4 rU DDDDx
MUT ID 20 SMAD7 For 75 2.6 31.4 33.9 -- H784A SMAD7 For 76 2.6 37.4
75.9 38.4 rC DDDDx SMAD7 For 77 2.6 65.4 46.2 19.3 rU DDDDx MUT ID
21 SMAD7 For 75 200 29.7 30.4 -- H784S SMAD7 For 76 200 32.0 46.1
14.1 rC DDDDx SMAD7 For 77 200 47.1 32.8 14.3 rU DDDDx MUT ID 22
SMAD7 For 75 2.6 24.2 24.9 -- H784T SMAD7 For 76 2.6 25.8 39.0 13.3
rC DDDDx SMAD7 For 77 2.6 37.6 28.8 8.8 rU DDDDx MUT ID 24 SMAD7
For 75 2.6 24.4 24.1 H784V SMAD7 For 76 2.6 24.7 34.5 9.8 rC DDDDx
SMAD7 For 77 2.6 36.0 25.6 10.4 rU DDDDx MUT ID 26 SMAD7 For 75 2.6
24.4 24.9 H784I SMAD7 For 76 2.6 28.5 40.5 12.0 rC DDDDx SMAD7 For
77 2.6 42.5 30.6 11.8 rU DDDDx MUT ID 27 SMAD7 For 75 2.6 30.9 30.5
H784M SMAD7 For 76 2.6 36.1 58.8 22.7 rC DDDDx SMAD7 For 77 2.6
51.7 37.7 14.0 rU DDDDx MUT ID 29 SMAD7 For 75 2.6 25.8 26.5 H784F
SMAD7 For 76 2.6 30.9 50.9 19.9 rC DDDDx SMAD7 For 77 2.6 46.9 36.2
10.7 rU DDDDx MUT ID 29 SMAD7 For 75 2.6 27.3 26.7 H784Y SMAD7 For
76 2.6 31.4 46.6 15.3 rC DDDDx SMAD7 For 77 2.6 50.2 37.1 13.1 rU
DDDDx DNA targets included GM18562 (homozygous C/C) and GM18537
(homozygous T/T) from the Coriell Institute for Medical Research.
.DELTA.Cq = [Cq mismatch - Cq match].
TABLE-US-00036 TABLE 35 SNP discrimination of a site in the SMAD7
gene using Gen2 RDxxD primers comparing wild type OptiTaq with four
mutant Taq DNA polymerases. Cq Cq SEQ mU RNase Value Value DNA ID
H2 per C/C T/T Polymerase For Primer NO. 10 .mu.L rxn DNA DNA
.DELTA.Cq Wild type SMAD7 For 75 200 24.7 25.1 -- OptiTaq SMAD7 For
78 200 24.9 39.6 14.7 rC DxxD SMAD7 For 79 200 43.4 26.0 17.4 rU
DxxD MUT ID 3 SMAD7 For 75 200 26.5 27.5 -- H784Q SMAD7 For 78 200
27.2 56.0 28.8 rC DxxD SMAD7 For 79 200 73.4 37.1 36.3 rU DxxD MUT
ID 20 SMAD7 For 75 200 26.0 26.7 -- H784A SMAD7 For 78 200 26.1
58.7 32.6 rC DxxD SMAD7 For 79 200 64.1 33.2 31.2 rU DxxD MUT ID 21
SMAD7 For 75 200 27.0 27.3 -- H784S SMAD7 For 78 200 29.9 69.1 39.3
rC DxxD SMAD7 For 79 200 >95 62.6 >32.4 rU DxxD MUT ID 22
SMAD7 For 75 200 24.8 25.2 -- H784T SMAD7 For 78 200 24.8 45.2 20.4
rC DxxD SMAD7 For 79 200 57.5 26.8 30.8 rU DxxD MUT ID 24 SMAD7 For
75 200 25.3 24.8 H784V SMAD7 For 78 200 25.3 39.9 14.6 rC DxxD
SMAD7 For 79 200 39.3 24.8 39.3 rU DxxD MUT ID 26 SMAD7 For 75 200
24.6 24.8 H784I SMAD7 For 78 200 24.8 44.0 19.2 rC DxxD SMAD7 For
79 200 46.2 26.9 46.2 rU DxxD MUT ID 27 SMAD7 For 75 200 30.0 29.7
H784M SMAD7 For 78 200 31.9 80.1 48.2 rC DxxD SMAD7 For 79 200 83.1
40.6 83.1 rU DxxD MUT ID 29 SMAD7 For 75 200 27.3 26.1 H784F SMAD7
For 78 200 27.8 51.3 23.6 rC DxxD SMAD7 For 79 200 56.3 29.1 56.3
rU DxxD MUT ID 30 SMAD7 For 75 200 29.0 28.7 H784Y SMAD7 For 78 200
29.2 71.8 42.5 rC DxxD SMAD7 For 79 200 73.5 30.4 73.5 rU DxxD DNA
targets included GM18562 (homozygous C/C) and GM18537 (homozygous
T/T) from the Coriell Institute for Medical Research. .DELTA.Cq =
[Cq mismatch - Cq match].
[0215] The .DELTA.Cq values for the SMAD7 SNP genotyping assays are
graphically summarized in FIG. 5B and 5C for the Gen1 RDDDDx
primers and in FIG. 6B and 6C for the Gen2 RDxxD primers. It is
clear that not only do the different mutant Taq DNA polymerases of
the present invention have utility in different amplification
assays but that the different mutants show varying levels of
benefit depending on the nature of the assay used. It is therefore
useful to have a collection of mutant polymerases whose properties
can be matched to different assays/applications so that maximal
benefit is obtained.
Example 16
Improved Discrimination of Rare Alleles in Genomic DNA using rhPCR
with Mutant Taq DNA Polymerases
[0216] Use of the Gen2 RDxxD blocked-cleavable primers in rhPCR can
detect the presence of a SNP at a level of 1:1,000 to 1:10,000 in
the background of wild type genomic DNA using native (wild type)
Taq DNA polymerase (see: US Patent Application 2012/0258455 by
Behlke et al., entitled, RNASE H-BASED ASSAYS UTILIZING MODIFIED
RNA MONOMERS). The present example demonstrates that the mutant Taq
DNA polymerases of the present invention improve rare allele
discrimination in the rhPCR assay.
[0217] Rare allele detection experiments were designed to detect
the base identity of a SNP site in the SMAD7 gene (NM_005904, C/T
SNP, rs4939827) and employed target DNAs GM18562 (homozygous C/C)
and GM18537 (homozygous T/T) (Coriell Institute for Medical
Research, Camden, N.J., USA). Control reactions were set up using 2
ng (660 copies), 0.2 ng (66 copies), or 0.02 ng (6.6 copies) of
input matched target DNA. Rare allele detection reactions were set
up using 2 ng (660 copies), 0.2 ng (66 copies), or 0.02 ng (6.6
copies) of input matched target DNA of one allele plus 200 ng
(66,000 copies) of the other (mismatched) allele. Background was
established in reactions that contained 0 copies of matched target
DNA plus 200 ng (66,000 copies) of the mismatched target DNA. Both
combinations were tested: GM18562 (C/C) as the rare allele in the
presence of excess GM18537 (T/T) and GM18537 (T/T) as the rare
allele in the presence of excess GM18562 (C/C).
[0218] Quantitative real-time rhPCR was performed in 10 .mu.L
reaction volumes in 384 well format. Final reaction conditions used
were 10 mM Tris-HCL (pH 8.4 at 25.degree. C.), 50 mM KCL, 3.5 mM
MgCl.sub.2, 0.01% Triton-X100, 0.8 mM dNTPs, 200 nM of one of the
SMAD7 forward primers (SEQ ID NOs. 75, 78, and 79), 200 nM of the
SMAD7 reverse primer (SEQ ID NO. 74), and 200 nM of the SMAD7 probe
(SEQ ID NO. 80). The 85 bp SMAD7 amplicon defined by these primers
is shown as SEQ ID NO. 81. Note that the forward primers were
either unmodified (control, SEQ ID NO. 75) or were specific for the
SMAD7 C-allele (SEQ ID NO. 78) or the SMAD7 T-allele (SEQ ID NO.
79) using blocked-cleavable rhPCR Gen2 RDxxD design. Reactions
utilized either 0.5 U of the wild type OptiTaq DNA polymerase or
0.5 U of one of three example Taq DNA polymerase mutants studied
(MUT ID 20(H784A); MUT ID 27(H784M); MUT ID 30(H784Y)). Reactions
included P. abyssi RNase H2 at a concentration of 200 mU per 10
.mu.L reaction (384 fmoles) when using the SMAD7 For rC DxxD (SEQ
ID NO. 78) primer and control reactions or 500-600 mU per 10 .mu.L
reaction (960-1152 fmoles) when using the SMAD7 For rU DxxD (SEQ ID
NO. 79) primer. Oligonucleotide reagents used in this Example are
shown in Table 36. Cycling was performed on a Roche
LightCycler.RTM. 480 (Roche Applied Science, Indianapolis, Ind.,
USA) as follows: 95.degree. C. for 3 minutes followed by 65 cycles
of 95.degree. C. for 10 seconds and 60.degree. C. for 30 seconds.
All reactions were performed in triplicate.
TABLE-US-00037 TABLE 36 Synthetic oligonucleotides employed in
Example 16. Name Sequence (5'-3') SEQ ID NO. SMAD7 Rev
CTCACTCTAAACCCCAGCATT 74 SMAD7 For CAGCCTCATCCAAAAGAGGAAA 75 SMAD7
For CAGCCTCATCCAAAAGAGGAAAc 78 rC DxxD AxxA SMAD7 For
CAGCCTCATCCAAAAGAGGAAAu 79 rU DxxD AxxA SMAD7
FAM-CCCAGAGCTCCCTCAGACT 80 probe CCT-IBFQ SMAD7
CAGCCTCATCCAAAAGAGGAAAT 81 target AGGACCCCAGAGCTCCCTCAGAC
TCCTCAGGAAACACAGACAATGC TGGGGTTTAGAGTGAG DNA bases are uppercase
and RNA bases are lowercase; FAM = 6-carboxyfluorescein; IBFQ =
Iowa Black .TM. FQ fluorescence quencher; "x" = C3 Spacer
(propanediol). Primer and probe binding sites in the SMAD7 target
are underlined.
[0219] Results were analyzed and are shown in Table 37. The control
columns show Cq values for matched primer/target reactions with no
mismatched target present and establish a quantification standard
curve. MUT ID NO. 3, H784Q is included in data analysis for
comparison. The rare allele detection columns show Cq values for
detection of 660, 66, 6, or 0 (background control) copies of
matched primer/target in the presence of 66,000 copies of
mismatched target. It is generally assumed that at least a 3 cycle
difference (.DELTA.Cq=3.0 or greater) between background and
positive signal is needed to call a reaction "positive" for rare
allele detection; a 5 cycle difference (.DELTA.Cq=5.0 or greater)
is preferred. In this system, background is the signal observed
when amplification is done using no input target that is matched to
the primer, so signal arises solely from amplification originating
off the mismatched target.
[0220] Using wild type OptiTaq DNA polymerase, detection of the "C"
allele in an excess of "T" background and detection of the "T"
allele in an excess of "C" background both met the .DELTA.Cq 3.0
and .DELTA.Cq 5.0 levels of stringency to call a 1:1000 rare allele
detection event (66 copies of match target in the presence of
66,000 copies of mismatch target). The 1:10,000 reactions (6 copies
of match target in the presence of 66,000 copies of mismatch
target) did not meet either of these criteria. Thus rhPCR had a
1:1000 rare allele detection limit using wild type OptiTaq in this
genomic DNA SNP system.
[0221] In contrast, rhPCR using each of the four mutants showed a
1:10,000 rare allele detection limit for both the "C" and "T"
allele targets with a .DELTA.Cq stringency cutoff of 3.0. MUT ID 3
(H784Q) showed a 1:10,000 rare allele detection limit for both the
"C" and "T" targets in this genomic SNP system for the higher
.DELTA.Cq stringency cutoff of 5.0. The other three mutant Taq DNA
polymerases (MUT ID 20(H784A); MUT ID 27(H784M); MUT ID 30(H784Y))
showed a 1:10,000 rare allele detection limit for the "C" allele
target with a .DELTA.Cq stringency cutoff of 5.0 and a 1:10,000
rare allele detection limit for the "T" allele target with a
.DELTA.Cq stringency cutoff of 3.0. We therefore conclude that the
new mutant Taq DNA polymerases of the present invention provide for
improved rare allele detection reactions using blocked-cleavable
primers in rhPCR compared with use of the wild type DNA
polymerase.
TABLE-US-00038 TABLE 37 Rare allele detection using Gen2 RDxxD
rhPCR primers comparing wild type OptiTaq with new mutant Taq DNA
polymerases 200 ng mismatched template RNase H2 (66,000 copies of
"wild type") Control DNA SEQ ID per 10 660 Match 66 Match 6 Match 0
Match (No mismatched template) Polymerase For Primer NO. .mu.L rxn
(1:100) (1:1,000) (1:10,000) (background) 660 Match 66 Match 6
Match 0 Match Wild type SMAD7 For 75 200 mU 22.1 21.2 21.2 21.8
27.9 31.3 34.4 >65 OptiTaq SMAD7 For 78 200 mU 28.2 31.5 35.1
37.0 28.8 33.3 37.3 >65 rC DxxD SMAD7 For 79 500 mU 31.0 34.7
37.7 39.7 31.2 34.6 41.0 >65 rU DxxD MUT ID 3 SMAD7 For 75 200
mU 23.5 23.6 24.5 24.1 30.5 33.4 38.0 >65 (H784Q) SMAD7 For 78
200 mU 29.8 33.8 37.6 >65 30.5 35.5 39.6 >65 rC DxxD SMAD7
For 79 500 mU 32.9 37.7 44.0 52.3 30.1 35.9 44.9 >65 rU DxxD MUT
ID 20 SMAD7 For 75 200 mU 23.5 24.1 24.7 24.9 31.6 36.1 40.2 >65
(H784A) SMAD7 For 78 200 mU 31.3 36.7 43.2 55.3 33.5 39.5 44.7
>65 rC DxxD SMAD7 For 79 500 mU 35.7 40.0 43.8 54.7 33.3 38.8
41.5 >65 rU DxxD MUT ID 27 SMAD7 For 75 200 mU 24.2 24.8 25.4
26.4 31.6 36.2 40.2 >65 (H784M) SMAD7 For 78 200 mU 33.7 38.5
42.0 54.4 33.6 37.8 41.7 >65 rC DxxD SMAD7 For 79 600 mU 39.7
43.2 45.8 50.0 31.9 36.5 41.0 >65 rU DxxD MUT ID 30 SMAD7 For 75
200 mU 24.8 24.9 24.8 26.3 38.6 38.9 46.9 >65 (H784Y) SMAD7 For
78 200 mU 28.8 32.9 37.5 46.5 29.5 33.4 37.8 >65 rC DxxD SMAD7
For 79 500 mU 39.9 45.8 54.6 57.0 37.7 44.6 53.1 >65 rU DxxD Cq
values are shown. For the rare allele detection series (selective
detection of 6-660 copes one genotype in the presence of 66,000
copies of the other genotype), those reactions having a .DELTA.Cq
of 3.0 or better are highlighted in bold font and those having a
.DELTA.Cq of 5.0 or better are highlighted in bold font with
underline. .DELTA.Cq = [(Cq 0 copies match) - (Cq 6 copies match)],
or .DELTA.Cq = [(Cq 0 copies match) - (Cq 66 copies match)], or
.DELTA.Cq = [(Cq 0 copies match) - (Cq 660 copies match)].
Example 17
Sequence of Taq DNA Polymerase Mutants Showing Improved
Discrimination for Mismatch or the Presence of an RNA Residue at
the 3'-End of the Primer
[0222] The complete amino acid and nucleotide sequences of the
codon optimized mutant enzymes employed in Examples 11-15 are shown
below. Although these sequences are easily derived from information
provided in Tables 1, 3, 4 and 26 by one with skill in the art, the
final assembled sequences are provided below for clarity. Base
changes are identified in bold underlined font for the nucleic acid
and amino acid substitutions.
TABLE-US-00039 SEQ ID NO. 146, nucleotide sequence of Mutant ID 20
(H784A) CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTT
AGTCGATGGTCATCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTC
TGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAG
TCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATT
TGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAAGG
CAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATT
AAGGAGTTAGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTA
TGAGGCGGACGATGTCCTTGCATCCTTGGCTAAAAAGGCCGAAAAAGAGG
GCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTG
TCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGC
CTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATC
GGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATT
GGTGAAAAAACCGCACGTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGC
CTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGTGAAAAGATCC
TGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGC
ACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCG
GGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTC
ATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGG
CCGCCCCCAGAAGGTGCTTTTGTTGGCTTCGTACTTTCCCGTAAGGAGCC
TATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGTTC
ACCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGT
GGCTTGCTGGCAAAAGACCTTTCTGTTTTGGCCCTGCGCGAGGGTCTTGG
ACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTA
GCAATACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACT
GAGGAAGCCGGAGAGCGCGCCGCATTGTCCGAACGGCTCTTTGCAAACTT
ATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAG
TCGAACGTCCTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTG
CGTTTAGATGTCGCGTACCTTCGGGCCTTATCACTGGAAGTTGCAGAGGA
AATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTA
ACCTCAACTCCCGTGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGG
CTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAACGCAGTACGAGCGC
TGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCC
TGCAATACCGTGAGTTGACGAAGCTTAAAAGCACTTATATTGATCCTCTC
CCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACGTTTCAACCA
GACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGA
ACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTATC
GCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCT
GCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTC
AAGAGGGGCGTGATATTCACACAGAAACTGCCTCATGGATGTTCGGTGTC
CCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTAA
TTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGG
CAATCCCCTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCG
TTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCG
TCGGGGCTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATC
TTGAAGCCCGCGTCAAATCGGTACGGGAGGCTGCGGAGCGTATGGCATTT
AATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGT
CAAGCTTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGG
TCGCGGACGAGCTGGTGTTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTC
GCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACC
CCTCGAAGTGGAGGTCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAG CGGCCGC. SEQ ID
NO. 147, amino acid sequence of Mutant ID 20 (H784A)
MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKS
LLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIK
ELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLS
DRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIG
EKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDLAKVRT
DLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWP
PPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARG
LLAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTE
EAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVR
LDVAYLRALSLEVAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGL
PAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLP
DLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIA
EEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVP
REAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSF
PKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFN
MPVQGTAADLMKLAMVKLFPRLEEMGARMLLQVADELVLEAPKERAEAVA
RLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA. SEQ ID NO. 148, nucleotide
sequence of Mutant ID 21 (H784S)
CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTT
AGTCGATGGTCATCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTC
TGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAG
TCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATT
TGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAAGG
CAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATT
AAGGAGTTAGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTA
TGAGGCGGACGATGTCCTTGCATCCTTGGCTAAAAAGGCCGAAAAAGAGG
GCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTG
TCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGC
CTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATC
GGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATT
GGTGAAAAAACCGCACGTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGC
CTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGTGAAAAGATCC
TGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGC
ACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCG
GGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTC
ATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGG
CCGCCCCCAGAAGGTGCTTTTGTTGGCTTCGTACTTTCCCGTAAGGAGCC
TATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGTTC
ACCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGT
GGCTTGCTGGCAAAAGACCTTTCTGTTTTGGCCCTGCGCGAGGGTCTTGG
ACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTA
GCAATACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACT
GAGGAAGCCGGAGAGCGCGCCGCATTGTCCGAACGGCTCTTTGCAAACTT
ATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAG
TCGAACGTCCTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTG
CGTTTAGATGTCGCGTACCTTCGGGCCTTATCACTGGAAGTTGCAGAGGA
AATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTA
ACCTCAACTCCCGTGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGG
CTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAACGCAGTACGAGCGC
TGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCC
TGCAATACCGTGAGTTGACGAAGCTTAAAAGCACTTATATTGATCCTCTC
CCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACGTTTCAACCA
GACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGA
ACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTATC
GCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCT
GCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTC
AAGAGGGGCGTGATATTCACACAGAAACTGCCTCATGGATGTTCGGTGTC
CCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTAA
TTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGG
CAATCCCCTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCG
TTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCG
TCGGGGCTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATC
TTGAAGCCCGCGTCAAATCGGTACGGGAGGCTGCGGAGCGTATGGCATTT
AATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGT
CAAGCTTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGG
TCAGCGACGAGCTGGTGTTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTC
GCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACC
CCTCGAAGTGGAGGTCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAG CGGCCGC. SEQ ID
NO. 149, amino acid sequence of Mutant ID 21 (H784S)
MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKS
LLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIK
ELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLS
DRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIG
EKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDLAKVRT
DLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWP
PPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARG
LLAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTE
EAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVR
LDVAYLRALSLEVAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGL
PAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLP
DLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIA
EEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVP
REAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSF
PKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFN
MPVQGTAADLMKLAMVKLFPRLEEMGARMLLQVSDELVLEAPKERAEAVA
RLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA. SEQ ID NO. 150, nucleotide
sequence of Mutant ID 22 (H784T)
CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTT
AGTCGATGGTCATCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTC
TGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAG
TCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATT
TGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAAGG
CAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATT
AAGGAGTTAGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTA
TGAGGCGGACGATGTCCTTGCATCCTTGGCTAAAAAGGCCGAAAAAGAGG
GCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTG
TCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGC
CTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATC
GGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATT
GGTGAAAAAACCGCACGTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGC
CTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGTGAAAAGATCC
TGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGC
ACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCG
GGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTC
ATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGG
CCGCCCCCAGAAGGTGCTTTTGTTGGCTTCGTACTTTCCCGTAAGGAGCC
TATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGTTC
ACCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGT
GGCTTGCTGGCAAAAGACCTTTCTGTTTTGGCCCTGCGCGAGGGTCTTGG
ACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTA
GCAATACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACT
GAGGAAGCCGGAGAGCGCGCCGCATTGTCCGAACGGCTCTTTGCAAACTT
ATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAG
TCGAACGTCCTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTG
CGTTTAGATGTCGCGTACCTTCGGGCCTTATCACTGGAAGTTGCAGAGGA
AATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTA
ACCTCAACTCCCGTGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGG
CTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAACGCAGTACGAGCGC
TGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCC
TGCAATACCGTGAGTTGACGAAGCTTAAAAGCACTTATATTGATCCTCTC
CCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACGTTTCAACCA
GACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGA
ACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTATC
GCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCT
GCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTC
AAGAGGGGCGTGATATTCACACAGAAACTGCCTCATGGATGTTCGGTGTC
CCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTAA
TTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGG
CAATCCCCTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCG
TTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCG
TCGGGGCTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATC
TTGAAGCCCGCGTCAAATCGGTACGGGAGGCTGCGGAGCGTATGGCATTT
AATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGT
CAAGCTTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGG
TCACGGACGAGCTGGTGTTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTC
GCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACC
CCTCGAAGTGGAGGTCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAG CGGCCGC. SEQ ID
NO. 151, amino acid sequence of Mutant ID 22 (H784T)
MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKS
LLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIK
ELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLS
DRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIG
EKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDLAKVRT
DLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWP
PPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARG
LLAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTE
EAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVR
LDVAYLRALSLEVAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGL
PAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLP
DLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIA
EEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVP
REAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSF
PKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFN
MPVQGTAADLMKLAMVKLFPRLEEMGARMLLQVTDELVLEAPKERAEAVA
RLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA. SEQ ID NO. 152, nucleotide
sequence of Mutant ID 24 (H784V)
CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTT
AGTCGATGGTCATCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTC
TGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAG
TCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATT
TGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAAGG
CAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATT
AAGGAGTTAGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTA
TGAGGCGGACGATGTCCTTGCATCCTTGGCTAAAAAGGCCGAAAAAGAGG
GCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTG
TCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGC
CTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATC
GGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATT
GGTGAAAAAACCGCACGTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGC
CTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGTGAAAAGATCC
TGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGC
ACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCG
GGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTC
ATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGG
CCGCCCCCAGAAGGTGCTTTTGTTGGCTTCGTACTTTCCCGTAAGGAGCC
TATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGTTC
ACCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGT
GGCTTGCTGGCAAAAGACCTTTCTGTTTTGGCCCTGCGCGAGGGTCTTGG
ACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTA
GCAATACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACT
GAGGAAGCCGGAGAGCGCGCCGCATTGTCCGAACGGCTCTTTGCAAACTT
ATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAG
TCGAACGTCCTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTG
CGTTTAGATGTCGCGTACCTTCGGGCCTTATCACTGGAAGTTGCAGAGGA
AATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTA
ACCTCAACTCCCGTGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGG
CTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAACGCAGTACGAGCGC
TGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCC
TGCAATACCGTGAGTTGACGAAGCTTAAAAGCACTTATATTGATCCTCTC
CCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACGTTTCAACCA
GACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGA
ACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTATC
GCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCT
GCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTC
AAGAGGGGCGTGATATTCACACAGAAACTGCCTCATGGATGTTCGGTGTC
CCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTAA
TTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGG
CAATCCCCTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCG
TTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCG
TCGGGGCTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATC
TTGAAGCCCGCGTCAAATCGGTACGGGAGGCTGCGGAGCGTATGGCATTT
AATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGT
CAAGCTTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGG
TCGTAGACGAGCTGGTGTTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTC
GCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACC
CCTCGAAGTGGAGGTCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAG CGGCCGC. SEQ ID
NO. 153, amino acid sequence of Mutant ID 24 (H784V)
MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKS
LLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIK
ELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLS
DRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIG
EKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDLAKVRT
DLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWP
PPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARG
LLAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTE
EAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVR
LDVAYLRALSLEVAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGL
PAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLP
DLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIA
EEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVP
REAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSF
PKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFN
MPVQGTAADLMKLAMVKLFPRLEEMGARMLLQVVDELVLEAPKERAEAVA
RLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA. SEQ ID NO. 154, nucleotide
sequence of Mutant ID 26 (H784I)
CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTT
AGTCGATGGTCATCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTC
TGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAG
TCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATT
TGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAAGG
CAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATT
AAGGAGTTAGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTA
TGAGGCGGACGATGTCCTTGCATCCTTGGCTAAAAAGGCCGAAAAAGAGG
GCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTG
TCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGC
CTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATC
GGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATT
GGTGAAAAAACCGCACGTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGC
CTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGTGAAAAGATCC
TGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGC
ACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCG
GGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTC
ATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGG
CCGCCCCCAGAAGGTGCTTTTGTTGGCTTCGTACTTTCCCGTAAGGAGCC
TATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGTTC
ACCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGT
GGCTTGCTGGCAAAAGACCTTTCTGTTTTGGCCCTGCGCGAGGGTCTTGG
ACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTA
GCAATACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACT
GAGGAAGCCGGAGAGCGCGCCGCATTGTCCGAACGGCTCTTTGCAAACTT
ATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAG
TCGAACGTCCTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTG
CGTTTAGATGTCGCGTACCTTCGGGCCTTATCACTGGAAGTTGCAGAGGA
AATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTA
ACCTCAACTCCCGTGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGG
CTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAACGCAGTACGAGCGC
TGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCC
TGCAATACCGTGAGTTGACGAAGCTTAAAAGCACTTATATTGATCCTCTC
CCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACGTTTCAACCA
GACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGA
ACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTATC
GCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCT
GCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTC
AAGAGGGGCGTGATATTCACACAGAAACTGCCTCATGGATGTTCGGTGTC
CCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTAA
TTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGG
CAATCCCCTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCG
TTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCG
TCGGGGCTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATC
TTGAAGCCCGCGTCAAATCGGTACGGGAGGCTGCGGAGCGTATGGCATTT
AATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGT
CAAGCTTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGG
TCATTGACGAGCTGGTGTTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTC
GCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACC
CCTCGAAGTGGAGGTCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAG CGGCCGC. SEQ ID
NO. 155, amino acid sequence of Mutant ID 26 (H784I)
MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKS
LLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIK
ELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLS
DRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIG
EKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDLAKVRT
DLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWP
PPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARG
LLAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTE
EAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVR
LDVAYLRALSLEVAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGL
PAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLP
DLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIA
EEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVP
REAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSF
PKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFN
MPVQGTAADLMKLAMVKLFPRLEEMGARMLLQVVDELVLEAPKERAEAVA
RLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA. SEQ ID NO. 156, nucleotide
sequence of Mutant ID 27 (H784M)
CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTT
AGTCGATGGTCATCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTC
TGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAG
TCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATT
TGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAAGG
CAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATT
AAGGAGTTAGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTA
TGAGGCGGACGATGTCCTTGCATCCTTGGCTAAAAAGGCCGAAAAAGAGG
GCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTG
TCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGC
CTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATC
GGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATT
GGTGAAAAAACCGCACGTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGC
CTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGTGAAAAGATCC
TGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGC
ACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCG
GGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTC
ATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGG
CCGCCCCCAGAAGGTGCTTTTGTTGGCTTCGTACTTTCCCGTAAGGAGCC
TATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGTTC
ACCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGT
GGCTTGCTGGCAAAAGACCTTTCTGTTTTGGCCCTGCGCGAGGGTCTTGG
ACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTA
GCAATACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACT
GAGGAAGCCGGAGAGCGCGCCGCATTGTCCGAACGGCTCTTTGCAAACTT
ATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAG
TCGAACGTCCTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTG
CGTTTAGATGTCGCGTACCTTCGGGCCTTATCACTGGAAGTTGCAGAGGA
AATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTA
ACCTCAACTCCCGTGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGG
CTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAACGCAGTACGAGCGC
TGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCC
TGCAATACCGTGAGTTGACGAAGCTTAAAAGCACTTATATTGATCCTCTC
CCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACGTTTCAACCA
GACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGA
ACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTATC
GCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCT
GCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTC
AAGAGGGGCGTGATATTCACACAGAAACTGCCTCATGGATGTTCGGTGTC
CCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTAA
TTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGG
CAATCCCCTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCG
TTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCG
TCGGGGCTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATC
TTGAAGCCCGCGTCAAATCGGTACGGGAGGCTGCGGAGCGTATGGCATTT
AATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGT
CAAGCTTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGG
TCATGGACGAGCTGGTGTTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTC
GCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACC
CCTCGAAGTGGAGGTCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAG CGGCCGC. SEQ ID
NO. 157, amino acid sequence of Mutant ID 27 (H784M)
MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKS
LLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIK
ELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLS
DRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIG
EKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDLAKVRT
DLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWP
PPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARG
LLAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTE
EAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVR
LDVAYLRALSLEVAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGL
PAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLP
DLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIA
EEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVP
REAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSF
PKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFN
MPVQGTAADLMKLAMVKLFPRLEEMGARMLLQVMDELVLEAPKERAEAVA
RLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA. SEQ ID NO. 158, nucleotide
sequence of Mutant ID 29 (H784F)
CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTT
AGTCGATGGTCATCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTC
TGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAG
TCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATT
TGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAAGG
CAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATT
AAGGAGTTAGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTA
TGAGGCGGACGATGTCCTTGCATCCTTGGCTAAAAAGGCCGAAAAAGAGG
GCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTG
TCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGC
CTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATC
GGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATT
GGTGAAAAAACCGCACGTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGC
CTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGTGAAAAGATCC
TGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGC
ACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCG
GGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTC
ATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGG
CCGCCCCCAGAAGGTGCTTTTGTTGGCTTCGTACTTTCCCGTAAGGAGCC
TATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGTTC
ACCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGT
GGCTTGCTGGCAAAAGACCTTTCTGTTTTGGCCCTGCGCGAGGGTCTTGG
ACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTA
GCAATACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACT
GAGGAAGCCGGAGAGCGCGCCGCATTGTCCGAACGGCTCTTTGCAAACTT
ATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAG
TCGAACGTCCTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTG
CGTTTAGATGTCGCGTACCTTCGGGCCTTATCACTGGAAGTTGCAGAGGA
AATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTA
ACCTCAACTCCCGTGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGG
CTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAACGCAGTACGAGCGC
TGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCC
TGCAATACCGTGAGTTGACGAAGCTTAAAAGCACTTATATTGATCCTCTC
CCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACGTTTCAACCA
GACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGA
ACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTATC
GCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCT
GCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTC
AAGAGGGGCGTGATATTCACACAGAAACTGCCTCATGGATGTTCGGTGTC
CCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTAA
TTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGG
CAATCCCCTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCG
TTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCG
TCGGGGCTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATC
TTGAAGCCCGCGTCAAATCGGTACGGGAGGCTGCGGAGCGTATGGCATTT
AATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGT
CAAGCTTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGG
TCTTTGACGAGCTGGTGTTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTC
GCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACC
CCTCGAAGTGGAGGTCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAG CGGCCGC. SEQ ID
NO. 159, amino acid sequence of Mutant ID 29 (H784F)
MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKS
LLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIK
ELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLS
DRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIG
EKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDLAKVRT
DLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWP
PPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARG
LLAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTE
EAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVR
LDVAYLRALSLEVAEETARLEAEVERLAGHPFNLNSRDQLERVLEDELGL
PAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLP
DLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIA
EEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVP
REAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSF
PKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFN
MPVQGTAADLMKLAMVKLFPRLEEMGARMLLQVFDELVLEAPKERAEAVA
RLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA. SEQ ID NO. 160, nucleotide
sequence of Mutant ID 30 (H784Y)
CATATGCGTGGTATGCTGCCGTTGTTCGAGCCTAAAGGCCGCGTACTGTT
AGTCGATGGTCATCACTTGGCCTATCGGACGTTCCATGCACTCAAAGGTC
TGACGACCAGTCGTGGCGAACCGGTCCAGGCTGTTTATGGTTTCGCTAAG
TCTTTGCTCAAAGCACTGAAAGAAGACGGGGACGCGGTAATTGTTGTATT
TGATGCCAAAGCACCGAGCTTCCGCCACGAAGCTTATGGTGGCTACAAGG
CAGGACGCGCCCCTACCCCAGAAGATTTCCCCCGTCAGCTGGCATTAATT
AAGGAGTTAGTAGACCTTCTCGGCTTAGCGCGTCTGGAAGTTCCGGGTTA
TGAGGCGGACGATGTCCTTGCATCCTTGGCTAAAAAGGCCGAAAAAGAGG
GCTACGAAGTCCGCATCTTGACGGCAGACAAAGATCTGTACCAGCTTCTG
TCTGACCGTATTCATGTTTTGCACCCTGAAGGCTACTTAATCACTCCGGC
CTGGCTCTGGGAAAAGTACGGTCTGCGTCCCGATCAGTGGGCGGATTATC
GGGCTTTGACGGGAGATGAGAGCGACAACCTGCCAGGAGTTAAGGGCATT
GGTGAAAAAACCGCACGTAAGCTGCTTGAAGAGTGGGGTTCCCTGGAAGC
CTTGTTAAAAAATCTGGATCGTCTCAAGCCCGCAATTCGTGAAAAGATCC
TGGCTCATATGGACGATCTTAAATTAAGTTGGGACCTGGCCAAGGTGCGC
ACCGATTTACCGCTTGAAGTGGATTTTGCAAAACGCCGTGAGCCGGACCG
GGAACGTTTACGCGCTTTCTTAGAGCGTCTGGAATTCGGTTCACTGCTTC
ATGAATTCGGTCTGTTAGAGTCTCCTAAAGCACTCGAAGAGGCACCGTGG
CCGCCCCCAGAAGGTGCTTTTGTTGGCTTCGTACTTTCCCGTAAGGAGCC
TATGTGGGCAGATCTTCTGGCTTTAGCGGCTGCACGCGGTGGCCGTGTTC
ACCGGGCCCCTGAGCCATACAAAGCGTTACGTGATCTGAAGGAAGCACGT
GGCTTGCTGGCAAAAGACCTTTCTGTTTTGGCCCTGCGCGAGGGTCTTGG
ACTGCCGCCAGGCGACGATCCCATGTTATTGGCCTATCTGTTAGACCCTA
GCAATACCACACCTGAAGGGGTCGCTCGTCGGTATGGCGGTGAATGGACT
GAGGAAGCCGGAGAGCGCGCCGCATTGTCCGAACGGCTCTTTGCAAACTT
ATGGGGTCGTCTGGAAGGGGAGGAACGTCTGTTATGGTTGTATCGGGAAG
TCGAACGTCCTCTTTCGGCCGTATTAGCGCATATGGAGGCAACAGGTGTG
CGTTTAGATGTCGCGTACCTTCGGGCCTTATCACTGGAAGTTGCAGAGGA
AATCGCCCGTCTCGAGGCTGAAGTGTTCCGGTTGGCCGGTCACCCGTTTA
ACCTCAACTCCCGTGACCAGCTGGAACGCGTTTTATTCGATGAGCTTGGG
CTTCCCGCAATTGGCAAAACCGAAAAGACTGGCAAACGCAGTACGAGCGC
TGCCGTCCTTGAGGCACTCCGCGAGGCTCACCCTATTGTAGAAAAGATCC
TGCAATACCGTGAGTTGACGAAGCTTAAAAGCACTTATATTGATCCTCTC
CCGGATCTGATCCATCCTCGTACCGGCCGCTTGCACACACGTTTCAACCA
GACGGCGACTGCAACCGGCCGTCTGTCTAGCTCGGATCCAAATCTCCAGA
ACATTCCGGTCCGTACACCCTTGGGCCAACGTATCCGCCGGGCGTTTATC
GCTGAGGAAGGATGGTTACTGGTCGCATTGGACTACTCGCAGATTGAGCT
GCGCGTCCTCGCACATCTCTCTGGTGACGAAAATTTAATCCGCGTGTTTC
AAGAGGGGCGTGATATTCACACAGAAACTGCCTCATGGATGTTCGGTGTC
CCACGTGAAGCAGTGGATCCTTTGATGCGCCGTGCAGCTAAAACAATTAA
TTTTGGAGTGCTGTACGGAATGAGCGCTCATCGCTTGAGTCAGGAACTGG
CAATCCCCTACGAGGAAGCGCAGGCATTCATCGAACGTTACTTTCAATCG
TTTCCGAAAGTTCGCGCATGGATCGAGAAGACGCTCGAGGAAGGTCGTCG
TCGGGGCTATGTCGAAACTCTGTTTGGTCGCCGTCGGTACGTACCAGATC
TTGAAGCCCGCGTCAAATCGGTACGGGAGGCTGCGGAGCGTATGGCATTT
AATATGCCTGTACAGGGTACTGCAGCTGACCTCATGAAACTGGCAATGGT
CAAGCTTTTCCCGCGCTTGGAGGAAATGGGCGCACGTATGCTTCTGCAGG
TCTATGACGAGCTGGTGTTAGAAGCCCCTAAGGAGCGCGCCGAAGCTGTC
GCGCGCCTCGCTAAAGAAGTGATGGAGGGCGTTTACCCATTGGCCGTACC
CCTCGAAGTGGAGGTCGGTATTGGAGAAGATTGGTTATCTGCAAAGGAAG CGGCCGC. SEQ ID
NO. 161, amino acid sequence of Mutant ID 30 (H784Y)
MRGMLPLFEPKGRVLLVDGHHLAYRTFHALKGLTTSRGEPVQAVYGFAKS
LLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIK
ELVDLLGLARLEVPGYEADDVLASLAKKAEKEGYEVRILTADKDLYQLLS
DRIHVLHPEGYLITPAWLWEKYGLRPDQWADYRALTGDESDNLPGVKGIG
EKTARKLLEEWGSLEALLKNLDRLKPAIREKILAHMDDLKLSWDLAKVRT
DLPLEVDFAKRREPDRERLRAFLERLEFGSLLHEFGLLESPKALEEAPWP
PPEGAFVGFVLSRKEPMWADLLALAAARGGRVHRAPEPYKALRDLKEARG
LLAKDLSVLALREGLGLPPGDDPMLLAYLLDPSNTTPEGVARRYGGEWTE
EAGERAALSERLFANLWGRLEGEERLLWLYREVERPLSAVLAHMEATGVR
LDVAYLRALSLEVAEETARLEAEVERLAGHPFNLNSRDQLERVLFDELGL
PAIGKTEKTGKRSTSAAVLEALREAHPIVEKILQYRELTKLKSTYIDPLP
DLIHPRTGRLHTRFNQTATATGRLSSSDPNLQNIPVRTPLGQRIRRAFIA
EEGWLLVALDYSQIELRVLAHLSGDENLIRVFQEGRDIHTETASWMFGVP
REAVDPLMRRAAKTINFGVLYGMSAHRLSQELAIPYEEAQAFIERYFQSF
PKVRAWIEKTLEEGRRRGYVETLFGRRRYVPDLEARVKSVREAAERMAFN
MPVQGTAADLMKLAMVKLFPRLEEMGARMLLQVYDELVLEAPKERAEAVA
RLAKEVMEGVYPLAVPLEVEVGIGEDWLSAKEAA.
Example 18
Production of Codon Optimized Taq DNA Polymerase Mutants Modified
to Eliminate 5'Exonuclease Activity
[0223] Additional Taq DNA Polymerase mutants were made that
eliminated the 5' exonuclease activity of several of the mutants
from Table 3. Taq DNA Polymerase missing the 5'-exonuclease
activity was previously named "KlenTaq" (Barnes, W. M., Gene
112:29-35, 1992). Deletion of the N-terminal 5' exonuclease domain
of Taq polymerase improves the mismatch discrimination properties
of the enzyme (Barnes, W. M., Gene 112:29-35, 1992). The present
study characterized whether specificity improvements seen in the
Taq DNA Polymerase mutants of the present invention were combined
with mutations which eliminated 5'-exonuclease activity. The
examples shown here are meant to be exemplary, and in no way limit
the range of the claims. Specific mutations were introduced into
the OptiTaq sequence using the method of PCR site-directed
mutagenesis (Weiner MP, et al., Gene. 151(1-2):119-23 (1994)). Each
mutagenesis reaction employed 10 pmoles of two oligonucleotides
(Table 38) to amplify around the plasmid containing the DNA
polymerase, excluding the 5' exonuclease domain. These primers were
manufactured to contain a 5' phosphate, which allowed for
re-ligation after amplification. Briefly, these primers were
annealed to the double-stranded plasmid containing previously
characterized mutant DNA polymerases (MUT IDs 2, 3, 10, 18, 21, and
30) (20 ng each), 5 U KOD DNA polymerase (Novagen-EMD Chemicals,
San Diego, Calif.), 1.5 mM MgSO.sub.4, in 1.times. KOD PCR buffer.
Thermal cycling parameters were 95.degree. C. for 3 minutes
(95.degree. C. for 20 sec-55.degree. C. for 20 sec-70.degree. C.
for 2 minutes) for 25 cycles followed by a 70.degree. C. soak for 4
minutes. After PCR site-directed mutagenesis, the amplified product
was treated with 10 U of Dpn I (NEB, Ipswich, Mass.), at 37.degree.
C. for 1 hour, followed by inactivation at 80.degree. C. for 20
minutes. 1/6.sup.th of the digestion material was ligated together
with T4 DNA ligase (NEB, Ipswich, Mass.) at 16.degree. C. for 20
minutes, followed by inactivation at 65.degree. C. for 10 minutes.
1/15.sup.th of the ligated material was transformed into XL-1 Blue
competent bacteria. Bacterial clones were isolated, plasmid DNA
prepared, and deletion of the 5' exonuclease domains were confirmed
by Sanger DNA sequencing. All mutants remained in the pET-27b(+)
expression vector, which is suitable for expressing the recombinant
proteins in E. coli. Expression and purification of the recombinant
mutants of the Taq polymerase were performed as described in
Example 3.
TABLE-US-00040 TABLE 38 Oligonucleotides used for site-directed
mutagenesis to produce 18 Taq DNA Polymerase mutants. Sequence''
SEQ Sequence'' SEQ Mutant Mutant Sense mutagenesis ID Antisense
mutagenesis ID ID name oligonucleotide No. oligonucleotide No. 37
OptiTaq Phos- 162 Phos- 163 KlenTaq ggttcactgcttcatgaattc
catatgtattctccttcttaa ggtc agttaaacaaa 38 A661E, Phos- 162 Phos-
163 I665W, ggttcactgcttcatgaattc catatgtattctccttcttaa F667L ggtc
agttaaacaaa KlenTaq 39 V783F Phos- 162 Phos- 163 KlenTaq
ggttcactgcttcatgaattc catatgtattctccttcttaa ggtc agttaaacaaa 40
H784Q Phos- 162 Phos- 163 KlenTaq ggttcactgcttcatgaattc
catatgtattctccttcttaa ggtc agttaaacaaa 41 V783L Phos- 162 Phos- 163
H784Q ggttcactgcttcatgaattc catatgtattctccttcttaa KlenTaq ggtc
agttaaacaaa 42 H784S Phos- 162 Phos- 163 KlenTaq
ggttcactgcttcatgaattc catatgtattctccttcttaa ggtc agttaaacaaa 43
H784Y Phos- 162 Phos- 163 KlenTaq ggttcactgcttcatgaattc
catatgtattctccttcttaa ggtc agttaaacaaa DNA bases identical to codon
optimized OptiTaq are shown in lower case; those specific for the
mutations introduced by site-directed mutagenesis are shown in
upper case.
Example 19
Characterization of Properties of 7 5'-Exonuclease-Deficient Mutant
Taq DNA Polymerases in PCR
[0224] The 7 mutant Taq DNA polymerase enzymes described in Example
18 were characterized for polymerase activity.
[0225] The unit activity of the purified wild-type protein was
determined by comparing performance in qPCR of known quantities of
OptiTaq and each mutant compared to a commercial non-hot-start Taq
DNA polymerase, Taq-B DNA Polymerase (Enzymatics, Beverly, Mass.).
Quantification cycle values (Cq, the amplification cycle number at
which positive signal is first detected) and amplification curve
shapes were analyzed to determine the nanogram amounts at which
both enzymes performed similarly in the suboptimal range for each.
Using these nanogram amounts and known unit values of Taq-B DNA
polymerase, relative activity unit values could be extrapolated for
all of the mutant DNA polymerase enzymes having sufficient activity
to support PCR. Testing was also done to determine the MgCl.sub.2
concentrations at which the polymerases would show optimal
activity.
[0226] The following reaction conditions were employed: 1.times.
qPCR buffer (20 mM Tris pH 8.4, 50 mM KCl, 0.01% Triton-X100), 800
.mu.M dNTPs (200 .mu.M each), 500 nM For primer (Hs HPRT F517, SEQ
ID NO. 43), 500 nM Rev primer (Hs HPRT R591, SEQ ID NO. 44), 250 nM
RNase H2 cleavable probe (Hs HPRT RN2 Probe, SEQ ID NO. 164), 20 mU
Pyrococcus abyssi RNase H2, 2.times.10.sup.3 copies of linearized
cloned plasmid template (HPRT-targ, SEQ ID NO. 46), in 10 .mu.L
final volume. MgC.sub.2 was tested at 3, 4, or 5 mM in each case.
The amount of DNA polymerase added to each reaction was varied as
follows: for wild type (OptiTaq), reactions were set using 10, 1,
0.1, 0.01, and 0.001 U/.mu.L (220, 22, 2.2, 0.22, or 0.022 ng of
protein per 10 .mu.L reaction). Mutant polymerases were run in
similar concentrations. In addition, those mutant enzymes showing
polymerase activity were more finely titrated testing 220, 22,
10.6, 4.8, 2.2, 1.1, 0.48, and 0.22 ng of protein per 10 .mu.L
reaction. Polymerase dilutions were made in enzyme dilution buffer
(20 mM Tris pH 7.5, 100 mM NaCl, 1 mM DTT, 0.1% Triton-X100, 1
mg/mL BSA, 10% glycerol). Reactions were run in 384 well format on
a BIO-RAD CFX384.TM. Real-Time System (BIO-RAD, Hercules, Calif.)
using cycling parameters 95.degree. C. for 30 seconds followed by
60 cycles of [95.degree. C. for 15 seconds followed by 60.degree.
C. for 1 minutes]. Detection was achieved using a
fluorescence-quenched probe (cleaved by the action of the P.a.
RNase H2 enzyme). Sequences of the primers, probe, and template
(plasmid insert) are shown in Table 39.
TABLE-US-00041 TABLE 39 Sequence of oligonucleotides employed in
Taq DNA polymerase activity assay. Name Sequence SEQ ID NO. Hs HPRT
GACTTTGCTTTCCTTGGTCAG SEQ ID NO. 43 F517 Hs HPRT
GGCTTATATCCAACACTTCGTG SEQ ID NO. 44 R591 Hs HPRT
FAM-ATGGTCAAGGTCGCAAGc SEQ ID NO. RN2 TTGCTGGT-IBFQ 164 Probe HPRT-
GACTTTGCTTTCCTTGGTCAGGCAG SEQ ID NO. 46 targ
TATAATCCAAAGATGGTCAAGGTCG CAAGCTTGCTGGTGAAAAGGACCCC
ACGAAGTGTTGGATATAAGCC DNA bases are uppercase and RNA bases are
lowercase; Nucleic acid sequences are shown 5'-3'. FAM =
6-carboxyfluorescein, IBFQ = Iowa Black FQ (fluorescence quencher),
and ZEN = ZEN internal fluorescence quencher.
These 7 Taq DNA polymerase 5'-exonuclease-deficient mutants were
characterized as outlined above. Results are summarized in Table
40. All seven mutants had DNA polymerase activity; however,
processivity in Mutant IDs 38, 39, 40, 41, 42, and 43 was reduced
from 10-50 fold relative to the wild type enzyme. One mutant,
Mutant ID 37 (OptiTaq KlenTaq), showed DNA polymerase activity
nearly identical to wild type OptiTaq. Therefore the combination of
complete deletion of the 5'-exonuclease domain of Taq DNA
Polymerase coupled with point mutations that improve polymerase
specificity all significantly compromised enzyme activity and
processivity.
TABLE-US-00042 TABLE 40 Novel Taq DNA polymerase mutants selected
for initial study. Optimal Amino acid MgCl.sub.2 Mutant changes
from Polymerase Relative concentration ID wild-type Taq Activity
activity* (mM) 37 OptiTaq KlenTaq Yes 1 3 38 A661E, I665W, Yes 0.1
5 F667L KlenTaq 39 V783F KlenTaq Yes 0.05 4 40 H784Q KlenTaq Yes
0.03 4 41 V783L H784Q Yes 0.02 5 KlenTaq 42 H784S KlenTaq Yes 0.02
5 43 H784Y KlenTaq Yes 0.05 5 *Wild-type OptiTaq was set to "1" and
the relative activity of each of the mutant polymerases was
normalized to this amplification efficiency, with 1 as the
maximum.
Example 20
Improved Mismatch Discrimination in Allele-Specific PCR using
Mutant Taq DNA Polymerases also having Deletion of the
5'-Exonuclease Domain
[0227] Of the 7 mutant enzymes studied in Example 18 and 19, Mutant
IDs 37, 38, 39, 40, 41, 42, and 43 retained sufficient enzymatic
activity/processivity to characterize. These seven mutants were
studied for the ability to discriminate against a 3'-terminal DNA
mismatch compared with wild type OptiTaq DNA polymerase using an
allele-specific qPCR assay. Amplification reactions were performed
against a synthetic oligonucleotide template where a single base
was varied (SNP) which was positioned to lie at the 3'-end of the
reverse primer. Synthetic templates were employed having each of
the 4 possible bases at this position. Reverse primers were
employed having each of the 4 possible bases at the 3'-end.
Relative amplification efficiency was assessed using qPCR.
[0228] Quantitative allele-specific real-time PCR (AS-qPCR) was
performed in 10 .mu.L reaction volumes in 384 well format with
2.times.10.sup.5 copies of a 103 bp synthetic template (SEQ ID NOs.
51-4). Final reaction conditions used were 20 mM Tris-HCL (pH 8.4
at 25.degree. C.), 50 mM KCL, the amount of MgCl.sub.2 which was
determined to be optimal for each polymerase in Example 19, 0.01%
Triton X-100, 800 .mu.M total dNTPs, and 200 nM of the universal
forward primer (SEQ ID NO. 60), 200 nM of a reverse primer
(separate reactions were set up for each of the allele-specific
primers SEQ ID NOs. 55-58 or the control universal primer SEQ ID
NO. 59) and 200 nM of the RNase H2 cleavable probe (SEQ ID NO.
165). 20 mU Pyrococcus abyssi RNase H2 was also include in each
reaction. Each allele-specific primer was tested on each SNP
template. Reactions utilized either 0.5 U (10.8 ng/11.1 nM/111
fmol) of the OptiTaq KlenTaq DNA polymerase (Mutant ID 37) or 0.5 U
of one of the six Taq DNA polymerase mutants studied (Mutant ID 38
(108 ng/111 nM/1110 fmol); Mutant ID 39 (216 ng/222 nM/2220 fmol);
Mutant ID 40 (360 ng/370 nM/3700 fmol); Mutant ID 41 (1060 ng/555
nM/5550 fmol); Mutant ID 42 (1060 ng/555 nM/5550 fmol); Mutant ID
43 (216 ng/222 nM/2220 fmol)). Amplification was performed on a
CFX384.TM. C1000.TM. Thermo Cycler system (Bio-Rad, Hercules,
Calif.) using the following cycling parameters: 95.degree. C. for
30 seconds initial denaturation followed by 60 cycles of 95.degree.
C. for 10 seconds, then 60.degree. C. for 30 seconds.
Oligonucleotide reagents used in this example are shown in Table
41.
TABLE-US-00043 TABLE 41 Synthetic oligonucleotides employed in
Example 20. Name Sequence (5'-3') SEQ ID NO. A AGCTCTGCCCAAAGATTACC
SEQ ID NO. 51 Template CTGACAGCTAAGTGGCAGTG GAAGTTGGCCTCAGAAGTAG
TGGCCAGCTGTGTGTCGGGG AACAGTAAAGGCATGAAGCT CAG C
AGCTCTGCCCAAAGATTACC SEQ ID NO. 52 Template CTGACAGCTAAGTGGCAGTG
GAAGTTGGCCTCAGAAGTAG TGGCCAGCTGTGTGTCGGGG CACAGTAAAGGCATGAAGCT CAG
G AGCTCTGCCCAAAGATTACC SEQ ID NO. 53 Template CTGACAGCTAAGTGGCAGTG
GAAGTTGGCCTCAGAAGTAG TGGCCAGCTGTGTGTCGGGG GACAGTAAAGGCATGAAGCT CAG
T AGCTCTGCCCAAAGATTACC SEQ ID NO. 54 Template CTGACAGCTAAGTGGCAGTG
GAAGTTGGCCTCAGAAGTAG TGGCCAGCTGTGTGTCGGGG TACAGTAAAGGCATGAAGCT CAG
Syn Rev T CTGAGCTTCATGCCTTTACT SEQ ID NO. 55 GTT Syn Rev C
CTGAGCTTCATGCCTTTACT SEQ ID NO. 56 GTC Syn Rev A
CTGAGCTTCATGCCTTTACT SEQ ID NO. 57 GTA Syn Rev G
CTGAGCTTCATGCCTTTACT SEQ ID NO. 58 GTG Syn Rev CTGAGCTTCATGCCTTTACT
SEQ ID NO. 59 GT Syn For AGCTCTGCCCAAAGATTACC SEQ ID NO. 60 CTG RN2
Probe FAM-TTCTGAGGCCAACuCC SEQ ID NO. ACTGCCACTTA-IBFQ 165 DNA
bases are uppercase and RNA bases are lowercase; FAM =
6-carboxyfluorescein; IBFQ = Iowa Black .TM. FQ fluorescence
quencher; ZEN = internal ZEN fluorescence quencher; underlined base
indicates the SNP site in the synthetic template DNA.
[0229] Initially all reactions were run in triplicate. Similar
results were obtained for all replicates when using the wild type
OptiTaq. However, results showed greater variation for the mutant
polymerases. To obtain statistically meaningful results, each
reaction was therefore performed 24 times for the mutant
polymerases and 21 times for the wild type enzyme. .DELTA.Cq values
were calculated as the Cq value obtained for each mismatched base
pair minus the Cq value obtained for the matched base pair
(.DELTA.Cq=Cq mismatch-Cq match). The .DELTA.Cq values for all 24
replicates were averaged and standard deviations were calculated.
Results are shown in Table 42 and are graphically summarized in
FIGS. 7A, 7B, and 7C. Note that the reverse primer is the
allele-specific primer, so the "Syn Rev T" primer (SEQ ID NO. 55)
is the perfect match to the Template A (SEQ ID NO. 51), etc.
TABLE-US-00044 TABLE 42 .DELTA.Cq values for AS-qPCR reactions
using KlenTaq mutant Taq DNA polymerases. Reverse Primer Template
SEQ A C G T DNA ID SEQ ID SEQ ID SEQ ID SEQ ID Polymerase Name NO.
NO. 51 NO. 52 NO. 53 NO. 54 Mutant ID 37 Syn Rev T 55 -- 9.2 +/-
0.3 6.9 +/- 0.4 10.0 +/- 0.4 OptiTaq Syn Rev G 58 14.7 +/- 1.2 --
11.3 +/- 0.5 3.9 +/- 0.3 KlenTaq Syn Rev C 56 9.4 +/- 0.2 10.4 +/-
0.2 -- 7.5 +/- 0.2 Syn Rev A 57 13.3 +/- 0.4 8.7 +/- 0.2 12.4 +/-
0.4 -- Mutant ID 38 Syn Rev T 55 -- 11.8 +/- 0.5 9.9 +/- 0.6 11.7
+/- 0.7 A661E, Syn Rev G 58 17.4 +/- 5.8 -- 13.1 +/- 1.5 7.9 +/-
2.9 I665W, Syn Rev C 56 10.8 +/- 0.4 11.0 +/- 0.5 -- 10.5 +/- 0.2
F667L Syn Rev A 57 13.8 +/- 0.6 11.5 +/- 0.4 13.6 +/- 0.8 --
KlenTaq Mutant ID 39 Syn Rev T 55 -- 10.9 +/- 0.3 8.7 +/- 0.3 11.3
+/- 0.4 V783F Syn Rev G 58 17.1 +/- 6.7 -- 12.9 +/- 0.7 6.9 +/- 0.3
KlenTaq Syn Rev C 56 10.5 +/- 0.2 10.5 +/- 0.6 -- 10.0 +/- 0.2 Syn
Rev A 57 13.4 +/- 0.6 10.6 +/- 0.2 13.0 +/- 0.4 -- Mutant ID 40 Syn
Rev T 55 -- 11.5 +/- 0.4 10.1 +/- 0.3 12.0 +/- 0.9 H784Q Syn Rev G
58 18.2 +/- 6.4 -- 13.2 +/- 0.5 7.9 +/- 0.3 KlenTaq Syn Rev C 56
10.7 +/- 0.4 10.5 +/- 0.6 -- 10.2 +/- 0.3 Syn Rev A 57 13.8 +/- 0.7
11.3 +/- 0.3 13.5 +/- 0.6 -- Mutant ID 41 Syn Rev T 55 -- 8.9 +/-
0.3 7.8 +/- 0.3 10.5 +/- 0.4 V783L Syn Rev G 58 15.8 +/- 4.3 --
12.4 +/- 0.5 5.8 +/- 0.3 H784Q Syn Rev C 56 10.1 +/- 0.5 10.2 +/-
0.2 -- 8.5 +/- 0.4 KlenTaq Syn Rev A 57 13.3 +/- 0.8 9.5 +/- 0.3
12.6 +/- 0.4 -- Mutant ID 42 Syn Rev T 55 -- 12.1 +/- 0.7 10.2 +/-
0.4 11.4 +/- 0.6 H784S Syn Rev G 58 15.8 +/- 1.0 -- 13.3 +/- 0.6
8.3 +/- 0.5 KlenTaq Syn Rev C 56 10.3 +/- 0.3 10.6 +/- 0.5 -- 10.1
+/- 0.4 Syn Rev A 57 14.1 +/- 0.4 12.0 +/- 0.4 14.1 +/- 0.3 --
Mutant ID 43 Syn Rev T 55 -- 11.3 +/- 0.4 8.5 +/- 0.4 11.0 +/- 0.4
H784Y Syn Rev G 58 15.5 +/- 1.2 -- 12.4 +/- 0.7 6.5 +/- 0.3 KlenTaq
Syn Rev C 56 9.9 +/- 0.3 10.3 +/- 0.5 -- 9.3 +/- 0.4 Syn Rev A 57
13.7 +/- 1.2 11.6 +/- 1.2 13.9 +/- 1.5 -- Average .DELTA.Cq values
are shown, where .DELTA.Cq = [Cq mismatch - Cq match], +/- standard
deviation calculated from 24 replicates.
[0230] The OptiTaq KlenTaq Mutant ID 37 showed an average .DELTA.Cq
for AS-qPCR in this synthetic amplicon system of 9.8 with a range
of 3.9 to 14.7. Mutant ID 38 (A661E, 1665W, F667L KlenTaq) showed
an average .DELTA.Cq of 11.9 with a range of 7.9 to 17.4. Mutant ID
39 (V783F KlenTaq) showed an average .DELTA.Cq of 11.3 with a range
of 6.9 to 17.1. Mutant ID 40 (H784Q KlenTaq) showed an average
.DELTA.Cq of 11.9 with a range of 7.9 to 18.2. Mutant ID 41 (V783L
H784Q KlenTaq) showed an average .DELTA.Cq of 10.5 with a range of
5.8 to 15.8. Mutant ID 42 (H784S KlenTaq) showed an average
.DELTA.Cq of 11.9 with a range of 8.3 to 15.8. Mutant ID 43 (H784Y
KlenTaq) showed an average .DELTA.Cq of 11.2 with a range of 6.5 to
15.5. Therefore, in all pairwise combinations of 4 template bases
and 4 3'-terminal primer bases the mutant Taq DNA polymerases of
the present invention showed greater discrimination to mismatch
than did the OptiTaq or OptiTaq KlenTaq DNA polymerases. The
magnitude of improvement for each mismatch pair is defined by the
.DELTA..DELTA.Cq, which is the difference of discrimination between
the mutant and wild type KlenTaq enzymes
(.DELTA..DELTA.Cq=.DELTA.Cq mutant KlenTaq-.DELTA.Cq OptiTaq
KlenTaq). The .DELTA..DELTA.Cq values were calculated and are shown
in Table 43.
TABLE-US-00045 TABLE 43 .DELTA..DELTA.Cq values for AS-qPCR
reactions for the mutant KlenTaq DNA polymerases compared with
OptiTaq KlenTaq. Reverse Primer Template SEQ A C G T DNA ID SEQ ID
SEQ ID SEQ ID SEQ ID Polymerase Name NO. NO. 51 NO. 52 NO. 53 NO.
54 Mutant Syn Rev T 55 -- 2.6 3 1.7 ID 38 Syn Rev G 58 2.7 -- 1.8 4
A661E, Syn Rev C 56 1.4 0.6 -- 3 I665W, Syn Rev A 57 0.7 2.8 1.2 --
F667L KlenTaq Mutant Syn Rev T 55 -- 1.7 1.8 1.3 ID 39 Syn Rev G 58
2.4 -- 1.6 3 V783F Syn Rev C 56 1.1 0.1 -- 2.5 KlenTaq Syn Rev A 57
0.3 1.9 0.6 -- Mutant Syn Rev T 55 -- 2.3 3.2 2 ID 40 Syn Rev G 58
3.5 -- 1.9 4 H784Q Syn Rev C 56 1.3 0.4 -- 2.7 KlenTaq Syn Rev A 57
0.7 2.6 1.1 Mutant Syn Rev T 55 -- -0.3 0.9 0.5 ID 41 Syn Rev G 58
1.1 -- 1.1 1.9 V783L Syn Rev C 56 0.7 -0.2 -- 1 H784Q Syn Rev A 57
0.2 0.8 0.2 -- KlenTaq Mutant Syn Rev T 55 -- 2.9 3.3 1.4 ID 42 Syn
Rev G 58 1.1 -- 2 4.4 H784S Syn Rev C 56 0.9 0.2 -- 2.6 KlenTaq Syn
Rev A 57 1 3.3 1.7 -- Mutant Syn Rev T 55 -- 2.1 1.6 1 ID 43 Syn
Rev G 58 0.8 -- 1.1 2.6 H784Y Syn Rev C 56 0.5 -0.1 -- 1.8 KlenTaq
Syn Rev A 57 0.6 2.9 1.5 -- Average .DELTA..DELTA.Cq values are
shown, where .DELTA..DELTA.Cq = [.DELTA.Cq mutant KlenTaq -
.DELTA.Cq OptiTaq KlenTaq], from data in Table 42.
[0231] Mutant ID 38 (A661E, I665W, F667L KlenTaq) showed an average
.DELTA..DELTA.Cq of 1.7 compared to OptiTaq KlenTaq. Mutant ID 39
(V783F KlenTaq) showed an average .DELTA..DELTA.Cq of 2.0 compared
to OptiTaq KlenTaq. Mutant ID 40 (H784Q KlenTaq) showed an average
.DELTA..DELTA.Cq of 2.1 compared to OptiTaq KlenTaq. Mutant ID 41
(V783L H784Q KlenTaq) showed an average .DELTA..DELTA.Cq of 0.7
compared to OptiTaq KlenTaq. Mutant ID 42 (H784S KlenTaq) showed an
average .DELTA..DELTA.Cq of 2.1 compared to OptiTaq KlenTaq. Mutant
ID 43 (H784Y KlenTaq) showed an average .DELTA..DELTA.Cq of 2.0
compared to OptiTaq KlenTaq. Therefore, each of the mutant Taq DNA
polymerases of the present invention showed a significant
improvement in mismatch discrimination over OptiTaq KlenTaq which
had complete deletion of the 5'-exonuclease domain but contained no
other secondary mutations. Overall, mutant IDs 40 and 42 (H784Q
KlenTaq and H784S KlenTaq) showed the best SNP discrimination
within the set of mutant enzymes studied in this example using an
AS-PCR assay.
Example 21
Improved Mismatch Discrimination in rhPCR using Mutant KlenTaq DNA
Polymerases in a Human Genomic DNA SNP Assay
[0232] Example 20 demonstrated utility of the novel mutant Taq DNA
polymerases of the present invention in a synthetic amplicon rhPCR
SNP discrimination assay system. The present Example demonstrates
utility of the novel mutant Taq DNA polymerases in a human genomic
DNA rhPCR SNP discrimination assays system, examining a SNP site in
the SMAD7 gene (NM_005904, C/T SNP, rs4939827). The assays employed
target DNAs GM18562 (homozygous C/C) and GM18537 (homozygous T/T)
from the Coriell Institute for Medical Research (Camden, N.J.,
USA). One blocked-cleavable primer design was tested, the
generation 1 (Gen1) "RDDDDx" primers (see: US Patent Application
2012/0258455 by Behlke et al., entitled, RNASE H-BASED ASSAYS
UTILIZING MODIFIED RNA MONOMERS).
[0233] Quantitative real-time rhPCR was performed in 10 .mu.L
reaction volumes in 384 well format with 20 ng (the equivalent of
6600 copies of target) of human genomic DNA (GM18562 or GM18537).
Reactions utilized either 0.5 U (10.8 ng/11.1 nM/111 fmol) of
OptiTaq KlenTaq DNA polymerase or 0.5 U of one of the three Taq DNA
polymerase mutants (Mutant ID 40 (360 ng/370 nM/3700 fmol); Mutant
ID 41 (1060 ng/555 nM/5550 fmol); Mutant ID 43 (216 ng/222 nM/2220
fmol)). Final reaction conditions used were 20 mM Tris-HCL (pH 8.4
at 25.degree. C.), 50 mM KCL, 3 mM MgCl.sub.2, 0.01% Triton X-100,
800 .mu.M total dNTPs, 200 nM of a forward primer (SEQ ID NOs.
75-79), 200 nM of the universal reverse primer (SEQ ID NO. 74), and
200 nM of the RNase H2 cleavable SMAD7 probe (SEQ ID NO. 166).
Sequence of the 85 bp SMAD7 amplicon is shown as SEQ ID NO. 81.
Forward primers included RDDDDx configuration Gen1 allele-specific
rhPCR primers (SEQ ID NOs. 76 and 77), and the control universal
forward primer (SEQ ID NO.75) which is not allele specific.
Oligonucleotide reagents employed in this Example are shown in
Table 44. Reactions included 1 .mu.L of P.a. RNase H2 at a
concentration of 2.6 mU per 10 .mu.L reaction (5 fmoles, 0.5 nM).
Amplification was performed on a Roche LightCycler.RTM. 480 (Roche
Applied Science, Indianapolis, Ind., USA) as follows: 95.degree. C.
for 3 minutes followed by 95 cycles of 95.degree. C. for 10 seconds
and 60.degree. C. for 30 seconds. All reactions were performed in
triplicate.
TABLE-US-00046 TABLE 44 Synthetic oligonucleotides employed in
Example 21. Name Sequence (5'-3') SEQ ID NO. SMAD7 Rev
CTCACTCTAAACCCCAGCATT 74 SMAD7 For CAGCCTCATCCAAAAGAGGAAA 75 SMAD7
For CAGCCTCATCCAAAAGAGGAAA 76 rC DDDDx cAGGAx SMAD7 For
CAGCCTCATCCAAAAGAGGAAA 77 rU DDDDx uAGGAx SMAD7 RN2
FAM-CCCAGAGCTCcCTCAGAC 166 probe TCCT-IBFQ SMAD7
CAGCCTCATCCAAAAGAGGAAA 81 target TAGGACCCCAGAGCTCCCTCAG
ACTCCTCAGGAAACACAGACAA TGCTGGGGTTTAGAGTGAG DNA bases are uppercase
and RNA bases are lowercase; FAM = 6-carboxyfluorescein; IBFQ =
Iowa Black .TM. FQ fluorescence quencher; "x" = C3 Spacer
(propanediol). Primer and probe binding sites in the SMAD7 target
are underlined.
[0234] Results using the Gen1 RDDDDx rhPCR primers are shown in
Table 45. Use of the mutant Taq DNA polymerases showed significant
improvements in SNP discrimination in this human genomic DNA rhPCR
assay using the Gen1 RDDDDx primers, although amplification
efficiency was often reduced, as shown by the increases in the
match Cqs. Therefore use of the new mutant KlenTaq DNA polymerases
improves SNP discrimination in rhPCR genotyping assays.
TABLE-US-00047 TABLE 45 SNP discrimination of a site in the SMAD7
gene using Gen1 RDDDDx primers comparing wild type OptiTaq with
four mutant Taq DNA polymerases. Cq Cq SEQ mU RNase Value Value DNA
ID H2 per C/C T/T Polymerase For Primer NO. 10 .mu.L rxn DNA DNA
.DELTA.Cq MUT ID 37 SMAD7 For 75 2.6 24.4 23.5 OptiTaq SMAD7 For 76
2.6 31.1 38.4 7.3 KlenTaq rC DDDDx SMAD7 For 77 2.6 46.1 33.0 13.1
rU DDDDx MUT ID 40 SMAD7 For 75 2.6 24.6 24.5 H784Q SMAD7 For 76
2.6 28.1 38.8 10.7 KlenTaq rC DDDDx SMAD7 For 77 2.6 42.1 28.8 13.3
rU DDDDx MUT ID 41 SMAD7 For 75 2.6 24.5 24.3 V783L SMAD7 For 76
2.6 26.2 37.6 11.4 H784Q rC DDDDx KlenTaq SMAD7 For 77 2.6 41.2
27.8 13.4 rU DDDDx MUT ID 43 SMAD7 For 75 2.6 24.7 24.8 H784Y SMAD7
For 76 2.6 33.8 45.1 11.2 KlenTaq rC DDDDx SMAD7 For 77 2.6 50.4
35.2 15.2 rU DDDDx DNA targets included GM18562 (homozygous C/C)
and GM18537 (homozygous T/T) from the Coriell Institute for Medical
Research. .DELTA.Cq = [Cq mismatch - Cq match].
Example 22
Sequence of Taq DNA Polymerase Mutants Showing Improved
Discrimination for Mismatch or the Presence of an RNA Residue at
the 3'-End of the Primer
[0235] The complete amino acid and nucleotide sequences of the
codon optimized mutant enzymes employed in Examples 18-21 are shown
below. Although these sequences are easily derived from information
provided in Tables 1, 3, 4 26 and 38 by one with skill in the art,
the final assembled sequences are provided below for clarity. Base
changes are identified in bold underlined font for the nucleic acid
and amino acid substitutions.
TABLE-US-00048 SEQ ID NO. 167, nucleotide sequence of Mutant ID 37
(OptiTaq KlenTaq)
CATATGGGTTCACTGCTTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGC
ACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTTGTTGGCTTCG
TACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCT
GCACGCGGTGGCCGTGTTCACCGGGCCCCTGAGCCATACAAAGCGTTACG
TGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTGTTTTGG
CCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTG
GCCTATCTGTTAGACCCTAGCAATACCACACCTGAAGGGGTCGCTCGTCG
GTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTCCG
AACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTG
TTATGGTTGTATCGGGAAGTCGAACGTCCTCTTTCGGCCGTATTAGCGCA
TATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTAT
CACTGGAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGG
TTGGCCGGTCACCCGTTTAACCTCAACTCCCGTGACCAGCTGGAACGCGT
TTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTG
GCAAACGCAGTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCAC
CCTATTGTAGAAAAGATCCTGCAATACCGTGAGTTGACGAAGCTTAAAAG
CACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCT
TGCACACACGTTTCAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGC
TCGGATCCAAATCTCCAGAACATTCCGGTCCGTACACCCTTGGGCCAACG
TATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGG
ACTACTCGCAGATTGAGCTGCGCGTCCTCGCACATCTCTCTGGTGACGAA
AATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACACAGAAACTGC
CTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCC
GTGCAGCTAAAACAATTAATTTTGGAGTGCTGTACGGAATGAGCGCTCAT
CGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCATTCAT
CGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGA
CGCTCGAGGAAGGTCGTCGTCGGGGCTATGTCGAAACTCTGTTTGGTCGC
CGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGGC
TGCGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACC
TCATGAAACTGGCAATGGTCAAGCTTTTCCCGCGCTTGGAGGAAATGGGC
GCACGTATGCTTCTGCAGGTCCATGACGAGCTGGTGTTAGAAGCCCCTAA
GGAGCGCGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCG
TTTACCCATTGGCCGTACCCCTCGAAGTGGAGGTCGGTATTGGAGAAGAT
TGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 168, amino acid sequence of
Mutant ID 37 (OptiTaq KlenTaq)
MGSLLHEFGLLESPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAA
RGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLA
YLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLL
WLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEETARLEAEVERL
AGHPFNLNSRDQLERVLEDELGLPAIGKTEKTGKRSTSAAVLEALREAHP
IVEKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSS
DPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIELRVLAHLSGDEN
LIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHR
LSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRR
RYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLEEMGA
RMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDW LSAKEAA. SEQ ID
NO. 169, nucleotide sequence of Mutant ID 38 (A661E, I665W, F667L
KlenTaq) CATATGGGTTCACTGCTTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGC
ACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTTGTTGGCTTCG
TACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCT
GCACGCGGTGGCCGTGTTCACCGGGCCCCTGAGCCATACAAAGCGTTACG
TGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTGTTTTGG
CCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTG
GCCTATCTGTTAGACCCTAGCAATACCACACCTGAAGGGGTCGCTCGTCG
GTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTCCG
AACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTG
TTATGGTTGTATCGGGAAGTCGAACGTCCTCTTTCGGCCGTATTAGCGCA
TATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTAT
CACTGGAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGG
TTGGCCGGTCACCCGTTTAACCTCAACTCCCGTGACCAGCTGGAACGCGT
TTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTG
GCAAACGCAGTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCAC
CCTATTGTAGAAAAGATCCTGCAATACCGTGAGTTGACGAAGCTTAAAAG
CACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCT
TGCACACACGTTTCAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGC
TCGGATCCAAATCTCCAGAACATTCCGGTCCGTACACCCTTGGGCCAACG
TATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGG
ACTACTCGCAGATTGAGCTGCGCGTCCTCGCACATCTCTCTGGTGACGAA
AATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACACAGAAACTGC
CTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCC
GTGAAGCTAAAACATGGAATTTGGGAGTGCTGTACGGAATGAGCGCTCAT
CGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCATTCAT
CGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGA
CGCTCGAGGAAGGTCGTCGTCGGGGCTATGTCGAAACTCTGTTTGGTCGC
CGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGGC
TGCGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACC
TCATGAAACTGGCAATGGTCAAGCTTTTCCCGCGCTTGGAGGAAATGGGC
GCACGTATGCTTCTGCAGGTCCATGACGAGCTGGTGTTAGAAGCCCCTAA
GGAGCGCGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCG
TTTACCCATTGGCCGTACCCCTCGAAGTGGAGGTCGGTATTGGAGAAGAT
TGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 170, amino acid sequence of
Mutant ID 38 (A661E, I665W, F667L KlenTaq)
MGSLLHEFGLLESPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAA
RGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLA
YLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLL
WLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEETARLEAEVERL
AGHPFNLNSRDQLERVLEDELGLPAIGKTEKTGKRSTSAAVLEALREAHP
IVEKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSS
DPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIELRVLAHLSGDEN
LIRVFQEGRDIHTETASWMFGVPREAVDPLMRREAKTWNLGVLYGMSAHR
LSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRR
RYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLEEMGA
RMLLQVHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDW LSAKEAA. SEQ ID
NO. 171, nucleotide sequence of Mutant ID 39 (V783F KlenTaq)
CATATGGGTTCACTGCTTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGC
ACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTTGTTGGCTTCG
TACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCT
GCACGCGGTGGCCGTGTTCACCGGGCCCCTGAGCCATACAAAGCGTTACG
TGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTGTTTTGG
CCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTG
GCCTATCTGTTAGACCCTAGCAATACCACACCTGAAGGGGTCGCTCGTCG
GTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTCCG
AACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTG
TTATGGTTGTATCGGGAAGTCGAACGTCCTCTTTCGGCCGTATTAGCGCA
TATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTAT
CACTGGAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGG
TTGGCCGGTCACCCGTTTAACCTCAACTCCCGTGACCAGCTGGAACGCGT
TTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTG
GCAAACGCAGTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCAC
CCTATTGTAGAAAAGATCCTGCAATACCGTGAGTTGACGAAGCTTAAAAG
CACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCT
TGCACACACGTTTCAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGC
TCGGATCCAAATCTCCAGAACATTCCGGTCCGTACACCCTTGGGCCAACG
TATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGG
ACTACTCGCAGATTGAGCTGCGCGTCCTCGCACATCTCTCTGGTGACGAA
AATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACACAGAAACTGC
CTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCC
GTGCAGCTAAAACAATTAATTTTGGAGTGCTGTACGGAATGAGCGCTCAT
CGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCATTCAT
CGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGA
CGCTCGAGGAAGGTCGTCGTCGGGGCTATGTCGAAACTCTGTTTGGTCGC
CGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGGC
TGCGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACC
TCATGAAACTGGCAATGGTCAAGCTTTTCCCGCGCTTGGAGGAAATGGGC
GCACGTATGCTTCTGCAGTTCCATGACGAGCTGGTGTTAGAAGCCCCTAA
GGAGCGCGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCG
TTTACCCATTGGCCGTACCCCTCGAAGTGGAGGTCGGTATTGGAGAAGAT
TGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 172, amino acid sequence of
Mutant ID 39 (V783F KlenTaq)
MGSLLHEFGLLESPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAA
RGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLA
YLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLL
WLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEEIARLEAEVERL
AGHPFNLNSRDQLERVLFDELGLPAIGKTEKTGKRSTSAAVLEALREAHP
IVEKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSS
DPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIELRVLAHLSGDEN
LIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHR
LSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRR
RYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLEEMGA
RMLLQLHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDW LSAKEAA. SEQ ID
NO. 173, nucleotide sequence of Mutant ID 40 (H784Q KlenTaq)
CATATGGGTTCACTGCTTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGC
ACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTTGTTGGCTTCG
TACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCT
GCACGCGGTGGCCGTGTTCACCGGGCCCCTGAGCCATACAAAGCGTTACG
TGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTGTTTTGG
CCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTG
GCCTATCTGTTAGACCCTAGCAATACCACACCTGAAGGGGTCGCTCGTCG
GTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTCCG
AACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTG
TTATGGTTGTATCGGGAAGTCGAACGTCCTCTTTCGGCCGTATTAGCGCA
TATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTAT
CACTGGAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGG
TTGGCCGGTCACCCGTTTAACCTCAACTCCCGTGACCAGCTGGAACGCGT
TTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTG
GCAAACGCAGTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCAC
CCTATTGTAGAAAAGATCCTGCAATACCGTGAGTTGACGAAGCTTAAAAG
CACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCT
TGCACACACGTTTCAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGC
TCGGATCCAAATCTCCAGAACATTCCGGTCCGTACACCCTTGGGCCAACG
TATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGG
ACTACTCGCAGATTGAGCTGCGCGTCCTCGCACATCTCTCTGGTGACGAA
AATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACACAGAAACTGC
CTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCC
GTGCAGCTAAAACAATTAATTTTGGAGTGCTGTACGGAATGAGCGCTCAT
CGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCATTCAT
CGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGA
CGCTCGAGGAAGGTCGTCGTCGGGGCTATGTCGAAACTCTGTTTGGTCGC
CGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGGC
TGCGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACC
TCATGAAACTGGCAATGGTCAAGCTTTTCCCGCGCTTGGAGGAAATGGGC
GCACGTATGCTTCTGCAGGTCCAGGACGAGCTGGTGTTAGAAGCCCCTAA
GGAGCGCGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCG
TTTACCCATTGGCCGTACCCCTCGAAGTGGAGGTCGGTATTGGAGAAGAT
TGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 174, amino acid sequence of
Mutant ID 40 (H784Q KlenTaq)
MGSLLHEFGLLESPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAA
RGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLA
YLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLL
WLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEETARLEAEVERL
AGHPFNLNSRDQLERVLEDELGLPAIGKTEKTGKRSTSAAVLEALREAHP
IVEKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSS
DPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIELRVLAHLSGDEN
LIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHR
LSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRR
RYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLEEMGA
RMLLQVQDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDW LSAKEAA. SEQ ID
NO. 175, nucleotide sequence of Mutant ID 41 (V783L H784Q KlenTaq)
CATATGGGTTCACTGCTTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGC
ACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTTGTTGGCTTCG
TACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCT
GCACGCGGTGGCCGTGTTCACCGGGCCCCTGAGCCATACAAAGCGTTACG
TGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTGTTTTGG
CCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTG
GCCTATCTGTTAGACCCTAGCAATACCACACCTGAAGGGGTCGCTCGTCG
GTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTCCG
AACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTG
TTATGGTTGTATCGGGAAGTCGAACGTCCTCTTTCGGCCGTATTAGCGCA
TATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTAT
CACTGGAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGG
TTGGCCGGTCACCCGTTTAACCTCAACTCCCGTGACCAGCTGGAACGCGT
TTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTG
GCAAACGCAGTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCAC
CCTATTGTAGAAAAGATCCTGCAATACCGTGAGTTGACGAAGCTTAAAAG
CACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCT
TGCACACACGTTTCAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGC
TCGGATCCAAATCTCCAGAACATTCCGGTCCGTACACCCTTGGGCCAACG
TATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGG
ACTACTCGCAGATTGAGCTGCGCGTCCTCGCACATCTCTCTGGTGACGAA
AATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACACAGAAACTGC
CTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCC
GTGCAGCTAAAACAATTAATTTTGGAGTGCTGTACGGAATGAGCGCTCAT
CGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCATTCAT
CGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGA
CGCTCGAGGAAGGTCGTCGTCGGGGCTATGTCGAAACTCTGTTTGGTCGC
CGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGGC
TGCGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACC
TCATGAAACTGGCAATGGTCAAGCTTTTCCCGCGCTTGGAGGAAATGGGC
GCACGTATGCTTCTGCAGCTGCAGGACGAGCTGGTGTTAGAAGCCCCTAA
GGAGCGCGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCG
TTTACCCATTGGCCGTACCCCTCGAAGTGGAGGTCGGTATTGGAGAAGAT
TGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 176, amino acid sequence of
Mutant ID 41 (V783L H784Q KlenTaq)
MGSLLHEFGLLESPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAA
RGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLA
YLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLL
WLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEETARLEAEVERL
AGHPFNLNSRDQLERVLEDELGLPAIGKTEKTGKRSTSAAVLEALREAHP
IVEKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSS
DPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIELRVLAHLSGDEN
LIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHR
LSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRR
RYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLEEMGA
RMLLQLHDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDW LSAKEAA. SEQ ID
NO. 177, nucleotide sequence of Mutant ID 42 (H784S KlenTaq)
CATATGGGTTCACTGCTTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGC
ACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTTGTTGGCTTCG
TACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCT
GCACGCGGTGGCCGTGTTCACCGGGCCCCTGAGCCATACAAAGCGTTACG
TGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTGTTTTGG
CCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTG
GCCTATCTGTTAGACCCTAGCAATACCACACCTGAAGGGGTCGCTCGTCG
GTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTCCG
AACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTG
TTATGGTTGTATCGGGAAGTCGAACGTCCTCTTTCGGCCGTATTAGCGCA
TATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTAT
CACTGGAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGG
TTGGCCGGTCACCCGTTTAACCTCAACTCCCGTGACCAGCTGGAACGCGT
TTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTG
GCAAACGCAGTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCAC
CCTATTGTAGAAAAGATCCTGCAATACCGTGAGTTGACGAAGCTTAAAAG
CACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCT
TGCACACACGTTTCAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGC
TCGGATCCAAATCTCCAGAACATTCCGGTCCGTACACCCTTGGGCCAACG
TATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGG
ACTACTCGCAGATTGAGCTGCGCGTCCTCGCACATCTCTCTGGTGACGAA
AATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACACAGAAACTGC
CTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCC
GTGCAGCTAAAACAATTAATTTTGGAGTGCTGTACGGAATGAGCGCTCAT
CGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCATTCAT
CGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGA
CGCTCGAGGAAGGTCGTCGTCGGGGCTATGTCGAAACTCTGTTTGGTCGC
CGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGGC
TGCGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACC
TCATGAAACTGGCAATGGTCAAGCTTTTCCCGCGCTTGGAGGAAATGGGC
GCACGTATGCTTCTGCAGGTCAGCGACGAGCTGGTGTTAGAAGCCCCTAA
GGAGCGCGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCG
TTTACCCATTGGCCGTACCCCTCGAAGTGGAGGTCGGTATTGGAGAAGAT
TGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 178, amino acid sequence of
Mutant ID 42 (H784S KlenTaq)
MGSLLHEFGLLESPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAA
RGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLA
YLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLL
WLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEETARLEAEVERL
AGHPFNLNSRDQLERVLEDELGLPAIGKTEKTGKRSTSAAVLEALREAHP
IVEKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSS
DPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIELRVLAHLSGDEN
LIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHR
LSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRR
RYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLEEMGA
RMLLQVSDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDW LSAKEAA. SEQ ID
NO. 179, nucleotide sequence of Mutant ID 43 (H784Y KlenTaq)
CATATGGGTTCACTGCTTCATGAATTCGGTCTGTTAGAGTCTCCTAAAGC
ACTCGAAGAGGCACCGTGGCCGCCCCCAGAAGGTGCTTTTGTTGGCTTCG
TACTTTCCCGTAAGGAGCCTATGTGGGCAGATCTTCTGGCTTTAGCGGCT
GCACGCGGTGGCCGTGTTCACCGGGCCCCTGAGCCATACAAAGCGTTACG
TGATCTGAAGGAAGCACGTGGCTTGCTGGCAAAAGACCTTTCTGTTTTGG
CCCTGCGCGAGGGTCTTGGACTGCCGCCAGGCGACGATCCCATGTTATTG
GCCTATCTGTTAGACCCTAGCAATACCACACCTGAAGGGGTCGCTCGTCG
GTATGGCGGTGAATGGACTGAGGAAGCCGGAGAGCGCGCCGCATTGTCCG
AACGGCTCTTTGCAAACTTATGGGGTCGTCTGGAAGGGGAGGAACGTCTG
TTATGGTTGTATCGGGAAGTCGAACGTCCTCTTTCGGCCGTATTAGCGCA
TATGGAGGCAACAGGTGTGCGTTTAGATGTCGCGTACCTTCGGGCCTTAT
CACTGGAAGTTGCAGAGGAAATCGCCCGTCTCGAGGCTGAAGTGTTCCGG
TTGGCCGGTCACCCGTTTAACCTCAACTCCCGTGACCAGCTGGAACGCGT
TTTATTCGATGAGCTTGGGCTTCCCGCAATTGGCAAAACCGAAAAGACTG
GCAAACGCAGTACGAGCGCTGCCGTCCTTGAGGCACTCCGCGAGGCTCAC
CCTATTGTAGAAAAGATCCTGCAATACCGTGAGTTGACGAAGCTTAAAAG
CACTTATATTGATCCTCTCCCGGATCTGATCCATCCTCGTACCGGCCGCT
TGCACACACGTTTCAACCAGACGGCGACTGCAACCGGCCGTCTGTCTAGC
TCGGATCCAAATCTCCAGAACATTCCGGTCCGTACACCCTTGGGCCAACG
TATCCGCCGGGCGTTTATCGCTGAGGAAGGATGGTTACTGGTCGCATTGG
ACTACTCGCAGATTGAGCTGCGCGTCCTCGCACATCTCTCTGGTGACGAA
AATTTAATCCGCGTGTTTCAAGAGGGGCGTGATATTCACACAGAAACTGC
CTCATGGATGTTCGGTGTCCCACGTGAAGCAGTGGATCCTTTGATGCGCC
GTGCAGCTAAAACAATTAATTTTGGAGTGCTGTACGGAATGAGCGCTCAT
CGCTTGAGTCAGGAACTGGCAATCCCCTACGAGGAAGCGCAGGCATTCAT
CGAACGTTACTTTCAATCGTTTCCGAAAGTTCGCGCATGGATCGAGAAGA
CGCTCGAGGAAGGTCGTCGTCGGGGCTATGTCGAAACTCTGTTTGGTCGC
CGTCGGTACGTACCAGATCTTGAAGCCCGCGTCAAATCGGTACGGGAGGC
TGCGGAGCGTATGGCATTTAATATGCCTGTACAGGGTACTGCAGCTGACC
TCATGAAACTGGCAATGGTCAAGCTTTTCCCGCGCTTGGAGGAAATGGGC
GCACGTATGCTTCTGCAGGTCTATGACGAGCTGGTGTTAGAAGCCCCTAA
GGAGCGCGCCGAAGCTGTCGCGCGCCTCGCTAAAGAAGTGATGGAGGGCG
TTTACCCATTGGCCGTACCCCTCGAAGTGGAGGTCGGTATTGGAGAAGAT
TGGTTATCTGCAAAGGAAGCGGCCGC. SEQ ID NO. 180, amino acid sequence of
Mutant ID 43 (H784Y KlenTaq)
MGSLLHEFGLLESPKALEEAPWPPPEGAFVGFVLSRKEPMWADLLALAAA
RGGRVHRAPEPYKALRDLKEARGLLAKDLSVLALREGLGLPPGDDPMLLA
YLLDPSNTTPEGVARRYGGEWTEEAGERAALSERLFANLWGRLEGEERLL
WLYREVERPLSAVLAHMEATGVRLDVAYLRALSLEVAEETARLEAEVERL
AGHPFNLNSRDQLERVLEDELGLPAIGKTEKTGKRSTSAAVLEALREAHP
IVEKILQYRELTKLKSTYIDPLPDLIHPRTGRLHTRFNQTATATGRLSSS
DPNLQNIPVRTPLGQRIRRAFIAEEGWLLVALDYSQIELRVLAHLSGDEN
LIRVFQEGRDIHTETASWMFGVPREAVDPLMRRAAKTINFGVLYGMSAHR
LSQELAIPYEEAQAFIERYFQSFPKVRAWIEKTLEEGRRRGYVETLFGRR
RYVPDLEARVKSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLEEMGA
RMLLQVYDELVLEAPKERAEAVARLAKEVMEGVYPLAVPLEVEVGIGEDW LSAKEAA.
INCORPORATION BY REFERENCE
[0236] All publications, patents, patent applications, Accession
No. data mentioned herein are hereby incorporated by reference in
their entirety as if each individual publication, patent, patent
application or Accession No. data was specifically and individually
indicated to be incorporated by reference. In the case of Accession
No. data citations and references, the corresponding DNA polymerase
amino acid and nucleotide sequences are incorporated herein by
reference as if such sequences are disclosed by way of a SEQ ID NO.
In case of conflict, the present application, including any
definitions herein, will control.
[0237] The terminology used herein is for the purpose of describing
particular embodiments only, and is not intended to be limiting.
With respect to the use of substantially, any plural and/or
singular terms herein, those having skill in the art can translate
from the plural as is appropriate to the context and/or
application. The various singular/plural permutations may be
expressly set forth herein for the sake of clarity.
[0238] While the present invention has been described with
reference to certain embodiments, it will be understood by those
skilled in the art that various changes may be made and equivalents
may be substituted without departing from the scope of the present
invention. In addition, many modifications may be made to adapt a
particular situation or material to the teachings of the present
invention without departing from its scope. Therefore, it is
intended that the present invention not be limited to the
particular embodiments or examples disclosed, but that the present
invention will include all embodiments falling within the scope of
the appended claims.
Sequence CWU 1
1
1801832PRTArtificial SequenceTAQ DNA POLYMERASE PROTEIN SEQUENCE
1Met Arg Gly Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val Leu Leu1 5
10 15Val Asp Gly His His Leu Ala Tyr Arg Thr Phe His Ala Leu Lys
Gly 20 25 30Leu Thr Thr Ser Arg Gly Glu Pro Val Gln Ala Val Tyr Gly
Phe Ala 35 40 45Lys Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala
Val Ile Val 50 55 60Val Phe Asp Ala Lys Ala Pro Ser Phe Arg His Glu
Ala Tyr Gly Gly65 70 75 80Tyr Lys Ala Gly Arg Ala Pro Thr Pro Glu
Asp Phe Pro Arg Gln Leu 85 90 95Ala Leu Ile Lys Glu Leu Val Asp Leu
Leu Gly Leu Ala Arg Leu Glu 100 105 110Val Pro Gly Tyr Glu Ala Asp
Asp Val Leu Ala Ser Leu Ala Lys Lys 115 120 125Ala Glu Lys Glu Gly
Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp 130 135 140Leu Tyr Gln
Leu Leu Ser Asp Arg Ile His Val Leu His Pro Glu Gly145 150 155
160Tyr Leu Ile Thr Pro Ala Trp Leu Trp Glu Lys Tyr Gly Leu Arg Pro
165 170 175Asp Gln Trp Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu Ser
Asp Asn 180 185 190Leu Pro Gly Val Lys Gly Ile Gly Glu Lys Thr Ala
Arg Lys Leu Leu 195 200 205Glu Glu Trp Gly Ser Leu Glu Ala Leu Leu
Lys Asn Leu Asp Arg Leu 210 215 220Lys Pro Ala Ile Arg Glu Lys Ile
Leu Ala His Met Asp Asp Leu Lys225 230 235 240Leu Ser Trp Asp Leu
Ala Lys Val Arg Thr Asp Leu Pro Leu Glu Val 245 250 255Asp Phe Ala
Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe 260 265 270Leu
Glu Arg Leu Glu Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu 275 280
285Glu Ser Pro Lys Ala Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly
290 295 300Ala Phe Val Gly Phe Val Leu Ser Arg Lys Glu Pro Met Trp
Ala Asp305 310 315 320Leu Leu Ala Leu Ala Ala Ala Arg Gly Gly Arg
Val His Arg Ala Pro 325 330 335Glu Pro Tyr Lys Ala Leu Arg Asp Leu
Lys Glu Ala Arg Gly Leu Leu 340 345 350Ala Lys Asp Leu Ser Val Leu
Ala Leu Arg Glu Gly Leu Gly Leu Pro 355 360 365Pro Gly Asp Asp Pro
Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn 370 375 380Thr Thr Pro
Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu385 390 395
400Glu Ala Gly Glu Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu
405 410 415Trp Gly Arg Leu Glu Gly Glu Glu Arg Leu Leu Trp Leu Tyr
Arg Glu 420 425 430Val Glu Arg Pro Leu Ser Ala Val Leu Ala His Met
Glu Ala Thr Gly 435 440 445Val Arg Leu Asp Val Ala Tyr Leu Arg Ala
Leu Ser Leu Glu Val Ala 450 455 460Glu Glu Ile Ala Arg Leu Glu Ala
Glu Val Phe Arg Leu Ala Gly His465 470 475 480Pro Phe Asn Leu Asn
Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp 485 490 495Glu Leu Gly
Leu Pro Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg 500 505 510Ser
Thr Ser Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile 515 520
525Val Glu Lys Ile Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser Thr
530 535 540Tyr Ile Asp Pro Leu Pro Asp Leu Ile His Pro Arg Thr Gly
Arg Leu545 550 555 560His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr
Gly Arg Leu Ser Ser 565 570 575Ser Asp Pro Asn Leu Gln Asn Ile Pro
Val Arg Thr Pro Leu Gly Gln 580 585 590Arg Ile Arg Arg Ala Phe Ile
Ala Glu Glu Gly Trp Leu Leu Val Ala 595 600 605Leu Asp Tyr Ser Gln
Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly 610 615 620Asp Glu Asn
Leu Ile Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr625 630 635
640Glu Thr Ala Ser Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp Pro
645 650 655Leu Met Arg Arg Ala Ala Lys Thr Ile Asn Phe Gly Val Leu
Tyr Gly 660 665 670Met Ser Ala His Arg Leu Ser Gln Glu Leu Ala Ile
Pro Tyr Glu Glu 675 680 685Ala Gln Ala Phe Ile Glu Arg Tyr Phe Gln
Ser Phe Pro Lys Val Arg 690 695 700Ala Trp Ile Glu Lys Thr Leu Glu
Glu Gly Arg Arg Arg Gly Tyr Val705 710 715 720Glu Thr Leu Phe Gly
Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg 725 730 735Val Lys Ser
Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro 740 745 750Val
Gln Gly Thr Ala Ala Asp Leu Met Lys Leu Ala Met Val Lys Leu 755 760
765Phe Pro Arg Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln Val His
770 775 780Asp Glu Leu Val Leu Glu Ala Pro Lys Glu Arg Ala Glu Ala
Val Ala785 790 795 800Arg Leu Ala Lys Glu Val Met Glu Gly Val Tyr
Pro Leu Ala Val Pro 805 810 815Leu Glu Val Glu Val Gly Ile Gly Glu
Asp Trp Leu Ser Ala Lys Glu 820 825 83022626DNAArtificial
SequenceTAQ DNA POLYMERASE DNA SEQUENCE 2aagctcagat ctacctgcct
gagggcgtcc ggttccagct ggcccttccc gagggggaga 60gggaggcgtt tctaaaagcc
cttcaggacg ctacccgggg gcgggtggtg gaagggtaac 120atgaggggga
tgctgcccct ctttgagccc aagggccggg tcctcctggt ggacggccac
180cacctggcct accgcacctt ccacgccctg aagggcctca ccaccagccg
gggggagccg 240gtgcaggcgg tctacggctt cgccaagagc ctcctcaagg
ccctcaagga ggacggggac 300gcggtgatcg tggtctttga cgccaaggcc
ccctccttcc gccacgaggc ctacgggggg 360tacaaggcgg gccgggcccc
cacgccggag gactttcccc ggcaactcgc cctcatcaag 420gagctggtgg
acctcctggg gctggcgcgc ctcgaggtcc cgggctacga ggcggacgac
480gtcctggcca gcctggccaa gaaggcggaa aaggagggct acgaggtccg
catcctcacc 540gccgacaaag acctttacca gctcctttcc gaccgcatcc
acgtcctcca ccccgagggg 600tacctcatca ccccggcctg gctttgggaa
aagtacggcc tgaggcccga ccagtgggcc 660gactaccggg ccctgaccgg
ggacgagtcc gacaaccttc ccggggtcaa gggcatcggg 720gagaagacgg
cgaggaagct tctggaggag tgggggagcc tggaagccct cctcaagaac
780ctggaccggc tgaagcccgc catccgggag aagatcctgg cccacatgga
cgatctgaag 840ctctcctggg acctggccaa ggtgcgcacc gacctgcccc
tggaggtgga cttcgccaaa 900aggcgggagc ccgaccggga gaggcttagg
gcctttctgg agaggcttga gtttggcagc 960ctcctccacg agttcggcct
tctggaaagc cccaaggccc tggaggaggc cccctggccc 1020ccgccggaag
gggccttcgt gggctttgtg ctttcccgca aggagcccat gtgggccgat
1080cttctggccc tggccgccgc cagggggggc cgggtccacc gggcccccga
gccttataaa 1140gccctcaggg acctgaagga ggcgcggggg cttctcgcca
aagacctgag cgttctggcc 1200ctgagggaag gccttggcct cccgcccggc
gacgacccca tgctcctcgc ctacctcctg 1260gacccttcca acaccacccc
cgagggggtg gcccggcgct acggcgggga gtggacggag 1320gaggcggggg
agcgggccgc cctttccgag aggctcttcg ccaacctgtg ggggaggctt
1380gagggggagg agaggctcct ttggctttac cgggaggtgg agaggcccct
ttccgctgtc 1440ctggcccaca tggaggccac gggggtgcgc ctggacgtgg
cctatctcag ggccttgtcc 1500ctggaggtgg ccgaggagat cgcccgcctc
gaggccgagg tcttccgcct ggccggccac 1560cccttcaacc tcaactcccg
ggaccagctg gaaagggtcc tctttgacga gctagggctt 1620cccgccatcg
gcaagacgga gaagaccggc aagcgctcca ccagcgccgc cgtcctggag
1680gccctccgcg aggcccaccc catcgtggag aagatcctgc agtaccggga
gctcaccaag 1740ctgaagagca cctacattga ccccttgccg gacctcatcc
accccaggac gggccgcctc 1800cacacccgct tcaaccagac ggccacggcc
acgggcaggc taagtagctc cgatcccaac 1860ctccagaaca tccccgtccg
caccccgctt gggcagagga tccgccgggc cttcatcgcc 1920gaggaggggt
ggctattggt ggccctggac tatagccaga tagagctcag ggtgctggcc
1980cacctctccg gcgacgagaa cctgatccgg gtcttccagg aggggcggga
catccacacg 2040gagaccgcca gctggatgtt cggcgtcccc cgggaggccg
tggaccccct gatgcgccgg 2100gcggccaaga ccatcaactt cggggtcctc
tacggcatgt cggcccaccg cctctcccag 2160gagctagcca tcccttacga
ggaggcccag gccttcattg agcgctactt tcagagcttc 2220cccaaggtgc
gggcctggat tgagaagacc ctggaggagg gcaggaggcg ggggtacgtg
2280gagaccctct tcggccgccg ccgctacgtg ccagacctag aggcccgggt
gaagagcgtg 2340cgggaggcgg ccgagcgcat ggccttcaac atgcccgtcc
agggcaccgc cgccgacctc 2400atgaagctgg ctatggtgaa gctcttcccc
aggctggagg aaatgggggc caggatgctc 2460cttcaggtcc acgacgagct
ggtcctcgag gccccaaaag agagggcgga ggccgtggcc 2520cggctggcca
aggaggtcat ggagggggtg tatcccctgg ccgtgcccct ggaggtggag
2580gtggggatag gggaggactg gctctccgcc aaggagtgat accacc
26263865DNAArtificial SequenceTAQ DNA POLYMERASE CODON-OPTIMIZED
SUB-FRAGMENT 1 3catatgcgtg gtatgctgcc gttgttcgag cctaaaggcc
gcgtactgtt agtcgatggt 60catcacttgg cctatcggac gttccatgca ctcaaaggtc
tgacgaccag tcgtggcgaa 120ccggtccagg ctgtttatgg tttcgctaag
tctttgctca aagcactgaa agaagacggg 180gacgcggtaa ttgttgtatt
tgatgccaaa gcaccgagct tccgccacga agcttatggt 240ggctacaagg
caggacgcgc ccctacccca gaagatttcc cccgtcagct ggcattaatt
300aaggagttag tagaccttct cggcttagcg cgtctggaag ttccgggtta
tgaggcggac 360gatgtccttg catccttggc taaaaaggcc gaaaaagagg
gctacgaagt ccgcatcttg 420acggcagaca aagatctgta ccagcttctg
tctgaccgta ttcatgtttt gcaccctgaa 480ggctacttaa tcactccggc
ctggctctgg gaaaagtacg gtctgcgtcc cgatcagtgg 540gcggattatc
gggctttgac gggagatgag agcgacaacc tgccaggagt taagggcatt
600ggtgaaaaaa ccgcacgtaa gctgcttgaa gagtggggtt ccctggaagc
cttgttaaaa 660aatctggatc gtctcaagcc cgcaattcgt gaaaagatcc
tggctcatat ggacgatctt 720aaattaagtt gggacctggc caaggtgcgc
accgatttac cgcttgaagt ggattttgca 780aaacgccgtg agccggaccg
ggaacgttta cgcgctttct tagagcgtct ggaattcggt 840tcactgcttc
atgaattcgg tctgt 8654880DNAArtificial SequenceTAQ DNA POLYMERASE
CODON-OPTIMIZED SUB-FRAGMENT 2 4tcggttcact gcttcatgaa ttcggtctgt
tagagtctcc taaagcactc gaagaggcac 60cgtggccgcc cccagaaggt gcttttgttg
gcttcgtact ttcccgtaag gagcctatgt 120gggcagatct tctggcttta
gcggctgcac gcggtggccg tgttcaccgg gcccctgagc 180catacaaagc
gttacgtgat ctgaaggaag cacgtggctt gctggcaaaa gacctttctg
240ttttggccct gcgcgagggt cttggactgc cgccaggcga cgatcccatg
ttattggcct 300atctgttaga ccctagcaat accacacctg aaggggtcgc
tcgtcggtat ggcggtgaat 360ggactgagga agccggagag cgcgccgcat
tgtccgaacg gctctttgca aacttatggg 420gtcgtctgga aggggaggaa
cgtctgttat ggttgtatcg ggaagtcgaa cgtcctcttt 480cggccgtatt
agcgcatatg gaggcaacag gtgtgcgttt agatgtcgcg taccttcggg
540ccttatcact ggaagttgca gaggaaatcg cccgtctcga ggctgaagtg
ttccggttgg 600ccggtcaccc gtttaacctc aactcccgtg accagctgga
acgcgtttta ttcgatgagc 660ttgggcttcc cgcaattggc aaaaccgaaa
agactggcaa acgcagtacg agcgctgccg 720tccttgaggc actccgcgag
gctcacccta ttgtagaaaa gatcctgcaa taccgtgagt 780tgacgaagct
taaaagcact tatattgatc ctctcccgga tctgatccat cctcgtaccg
840gccgcttgca cacacgtttc aaccagacgg cgactgcaac 8805822DNAArtificial
SequenceTAQ DNA POLYMERASE CODON-OPTIMIZED SUB-FRAGMENT 3
5cacacgtttc aaccagacgg cgactgcaac cggccgtctg tctagctcgg atccaaatct
60ccagaacatt ccggtccgta cacccttggg ccaacgtatc cgccgggcgt ttatcgctga
120ggaaggatgg ttactggtcg cattggacta ctcgcagatt gagctgcgcg
tcctcgcaca 180tctctctggt gacgaaaatt taatccgcgt gtttcaagag
gggcgtgata ttcacacaga 240aactgcctca tggatgttcg gtgtcccacg
tgaagcagtg gatcctttga tgcgccgtgc 300agctaaaaca attaattttg
gagtgctgta cggaatgagc gctcatcgct tgagtcagga 360actggcaatc
ccctacgagg aagcgcaggc attcatcgaa cgttactttc aatcgtttcc
420gaaagttcgc gcatggatcg agaagacgct cgaggaaggt cgtcgtcggg
gctatgtcga 480aactctgttt ggtcgccgtc ggtacgtacc agatcttgaa
gcccgcgtca aatcggtacg 540ggaggctgcg gagcgtatgg catttaatat
gcctgtacag ggtactgcag ctgacctcat 600gaaactggca atggtcaagc
ttttcccgcg cttggaggaa atgggcgcac gtatgcttct 660gcaggtccat
gacgagctgg tgttagaagc ccctaaggag cgcgccgaag ctgtcgcgcg
720cctcgctaaa gaagtgatgg agggcgttta cccattggcc gtacccctcg
aagtggaggt 780cggtattgga gaagattggt tatctgcaaa ggaagcggcc gc
82262507DNAArtificial SequenceComplete codon-optimized Taq DNA
polymerase DNA Sequence ("OptiTaq") 6catatgcgtg gtatgctgcc
gttgttcgag cctaaaggcc gcgtactgtt agtcgatggt 60catcacttgg cctatcggac
gttccatgca ctcaaaggtc tgacgaccag tcgtggcgaa 120ccggtccagg
ctgtttatgg tttcgctaag tctttgctca aagcactgaa agaagacggg
180gacgcggtaa ttgttgtatt tgatgccaaa gcaccgagct tccgccacga
agcttatggt 240ggctacaagg caggacgcgc ccctacccca gaagatttcc
cccgtcagct ggcattaatt 300aaggagttag tagaccttct cggcttagcg
cgtctggaag ttccgggtta tgaggcggac 360gatgtccttg catccttggc
taaaaaggcc gaaaaagagg gctacgaagt ccgcatcttg 420acggcagaca
aagatctgta ccagcttctg tctgaccgta ttcatgtttt gcaccctgaa
480ggctacttaa tcactccggc ctggctctgg gaaaagtacg gtctgcgtcc
cgatcagtgg 540gcggattatc gggctttgac gggagatgag agcgacaacc
tgccaggagt taagggcatt 600ggtgaaaaaa ccgcacgtaa gctgcttgaa
gagtggggtt ccctggaagc cttgttaaaa 660aatctggatc gtctcaagcc
cgcaattcgt gaaaagatcc tggctcatat ggacgatctt 720aaattaagtt
gggacctggc caaggtgcgc accgatttac cgcttgaagt ggattttgca
780aaacgccgtg agccggaccg ggaacgttta cgcgctttct tagagcgtct
ggaattcggt 840tcactgcttc atgaattcgg tctgttagag tctcctaaag
cactcgaaga ggcaccgtgg 900ccgcccccag aaggtgcttt tgttggcttc
gtactttccc gtaaggagcc tatgtgggca 960gatcttctgg ctttagcggc
tgcacgcggt ggccgtgttc accgggcccc tgagccatac 1020aaagcgttac
gtgatctgaa ggaagcacgt ggcttgctgg caaaagacct ttctgttttg
1080gccctgcgcg agggtcttgg actgccgcca ggcgacgatc ccatgttatt
ggcctatctg 1140ttagacccta gcaataccac acctgaaggg gtcgctcgtc
ggtatggcgg tgaatggact 1200gaggaagccg gagagcgcgc cgcattgtcc
gaacggctct ttgcaaactt atggggtcgt 1260ctggaagggg aggaacgtct
gttatggttg tatcgggaag tcgaacgtcc tctttcggcc 1320gtattagcgc
atatggaggc aacaggtgtg cgtttagatg tcgcgtacct tcgggcctta
1380tcactggaag ttgcagagga aatcgcccgt ctcgaggctg aagtgttccg
gttggccggt 1440cacccgttta acctcaactc ccgtgaccag ctggaacgcg
ttttattcga tgagcttggg 1500cttcccgcaa ttggcaaaac cgaaaagact
ggcaaacgca gtacgagcgc tgccgtcctt 1560gaggcactcc gcgaggctca
ccctattgta gaaaagatcc tgcaataccg tgagttgacg 1620aagcttaaaa
gcacttatat tgatcctctc ccggatctga tccatcctcg taccggccgc
1680ttgcacacac gtttcaacca gacggcgact gcaaccggcc gtctgtctag
ctcggatcca 1740aatctccaga acattccggt ccgtacaccc ttgggccaac
gtatccgccg ggcgtttatc 1800gctgaggaag gatggttact ggtcgcattg
gactactcgc agattgagct gcgcgtcctc 1860gcacatctct ctggtgacga
aaatttaatc cgcgtgtttc aagaggggcg tgatattcac 1920acagaaactg
cctcatggat gttcggtgtc ccacgtgaag cagtggatcc tttgatgcgc
1980cgtgcagcta aaacaattaa ttttggagtg ctgtacggaa tgagcgctca
tcgcttgagt 2040caggaactgg caatccccta cgaggaagcg caggcattca
tcgaacgtta ctttcaatcg 2100tttccgaaag ttcgcgcatg gatcgagaag
acgctcgagg aaggtcgtcg tcggggctat 2160gtcgaaactc tgtttggtcg
ccgtcggtac gtaccagatc ttgaagcccg cgtcaaatcg 2220gtacgggagg
ctgcggagcg tatggcattt aatatgcctg tacagggtac tgcagctgac
2280ctcatgaaac tggcaatggt caagcttttc ccgcgcttgg aggaaatggg
cgcacgtatg 2340cttctgcagg tccatgacga gctggtgtta gaagccccta
aggagcgcgc cgaagctgtc 2400gcgcgcctcg ctaaagaagt gatggagggc
gtttacccat tggccgtacc cctcgaagtg 2460gaggtcggta ttggagaaga
ttggttatct gcaaaggaag cggccgc 2507753DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 7aatgggcgca cgtatgcttc
tgcagattca tgacgagctg gtgttagaag ccc 53853DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 8gggcttctaa caccagctcg
tcatgaatct gcagaagcat acgtgcgccc att 53953DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 9aatgggcgca cgtatgcttc
tgcagttcca tgacgagctg gtgttagaag ccc 531053DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 10gggcttctaa caccagctcg
tcatggaact gcagaagcat acgtgcgccc att 531153DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 11gggcgcacgt atgcttctgc
aggtccagga cgagctggtg ttagaagccc cta 531253DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 12taggggcttc taacaccagc
tcgtcctgga cctgcagaag catacgtgcg ccc 531353DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 13caaccagacg gcgactgcaa
ccggccatct gtctagctcg gatccaaatc tcc 531453DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 14ggagatttgg atccgagcta
gacagatggc cggttgcagt cgccgtctgg ttg 531553DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 15tctgtctagc tcggatccaa
atctcaaaaa cattccggtc cgtacaccct tgg 531653DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 16ccaagggtgt acggaccgga
atgtttttga gatttggatc cgagctagac aga 531753DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 17gcgccgtgca gctaaaacaa
ttaattgggg agtgctgtac ggaatgagcg ctc 531853DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 18gagcgctcat tccgtacagc
actccccaat taattgtttt agctgcacgg cgc 531953DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 19cgtgtttcaa gaggggcgtg
atatttggac agaaactgcc tcatggatgt tcg 532053DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 20cgaacatcca tgaggcagtt
tctgtccaaa tatcacgccc ctcttgaaac acg 532153DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 21cgcattggac tactcgcaga
ttgagatgcg cgtcctcgca catctctctg gtg
532253DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
22caccagagag atgtgcgagg acgcgcatct caatctgcga gtagtccaat gcg
532356DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
23ggtcgcattg gactactcgc agattctgga gcgcgtcctc gcacatctct ctggtg
562456DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
24caccagagag atgtgcgagg acgcgctcca gaatctgcga gtagtccaat gcgacc
562581DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
25cgtgaagcag tggatccttt gatgcgccgt gaagctaaaa catggaattt gggagtgctg
60tacggaatga gcgctcatcg c 812681DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 26gcgatgagcg ctcattccgt acagcactcc caaattccat
gttttagctt cacggcgcat 60caaaggatcc actgcttcac g 812759DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 27ggaaatgggc gcacgtatgc
ttctgatcgt cttcgacgag ctggtgttag aagccccta 592859DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 28taggggcttc taacaccagc
tcgtcgaaga cgatcagaag catacgtgcg cccatttcc 592959DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 29ggaaatgggc gcacgtatgc
ttctgatttt gctggacgag ctggtgttag aagccccta 593059DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 30taggggcttc taacaccagc
tcgtccagca aaatcagaag catacgtgcg cccatttcc 593159DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 31ggaaatgggc gcacgtatgc
ttctgtcctt caacgacgag ctggtgttag aagccccta 593259DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 32taggggcttc taacaccagc
tcgtcgttga aggacagaag catacgtgcg cccatttcc 593359DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 33ggaaatgggc gcacgtatgc
ttctgccgtt acaggacgag ctggtgttag aagccccta 593459DNAArtificial
Sequence
ggaaatgggcgcacgtatgcttctgCCGTTACAGgacgagctggtgttagaagccccta
34taggggcttc taacaccagc tcgtcctgta acggcagaag catacgtgcg cccatttcc
593553DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
35gcgtatggca tttaatatgc ctgtagcggg tactgcagct gacctcatga aac
533653DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
36gtttcatgag gtcagctgca gtacccgcta caggcatatt aaatgccata cgc
533753DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
37acgtgaagca gtggatcctt tgatgcaccg tgcagctaaa acaattaatt ttg
533853DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
38caaaattaat tgttttagct gcacggtgca tcaaaggatc cactgcttca cgt
533951DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
39aatgggcgca cgtatgcttc tgcagttcca ggacgagctg gtgttagaag c
514051DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
40gcttctaaca ccagctcgtc ctggaactgc agaagcatac gtgcgcccat t
514153DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
41aatgggcgca cgtatgcttc tgcagctgca ggacgagctg gtgttagaag ccc
534253DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
42gggcttctaa caccagctcg tcctgcagct gcagaagcat acgtgcgccc att
534321DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
43gactttgctt tccttggtca g 214422DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 44ggcttatatc caacacttcg tg 224526DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(1)..(1)5'-FAM
(6-carboxyfluorescein)misc_feature(9)..(10)ZEN INTERNAL
FLUORESCENCE QUENCHER BETWEEN RESIDUES 9 AND
10.misc_feature(26)..(26)3'-IBFQ ( Iowa Black FQ (fluorescence
quencher)) 45atggtcaagg tcgcaagctt gctggt 264696DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 46gactttgctt tccttggtca
ggcagtataa tccaaagatg gtcaaggtcg caagcttgct 60ggtgaaaagg accccacgaa
gtgttggata taagcc 964718DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(18)..(18)RNA RESIDUE 47tgtgcagaag
gatggagu 184820DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(20)..(20)RNA RESIDUE 48ctggtgcttc
tctcaggata 204925DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(1)..(1)5'-hexachlorofluoresceinmisc_feature(9-
)..(10)ZEN INTERNAL FLUORESCENCE QUENCHER BETWEEN RESIDUES 9 AND
10.misc_feature(25)..(25)3'-IBFQ (Iowa Black FQ (fluorescence
quencher)) 49tggaatatgc cctgcgtaaa ctgga 2550144DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 50tgtgcagaag gatggagtgg
ggatggtcga gtatctcaga aaagaagaca tggaatatgc 60cctgcgtaaa ctggatgaca
ccaaattccg ctctcatgag ggtgaaactt cctacatccg 120agtttatcct
gagagaagca ccag 14451103DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 51agctctgccc aaagattacc ctgacagcta agtggcagtg
gaagttggcc tcagaagtag 60tggccagctg tgtgtcgggg aacagtaaag gcatgaagct
cag 10352103DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
52agctctgccc aaagattacc ctgacagcta agtggcagtg gaagttggcc tcagaagtag
60tggccagctg tgtgtcgggg cacagtaaag gcatgaagct cag
10353103DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
53agctctgccc aaagattacc ctgacagcta agtggcagtg gaagttggcc tcagaagtag
60tggccagctg tgtgtcgggg gacagtaaag gcatgaagct cag
10354103DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
54agctctgccc aaagattacc ctgacagcta agtggcagtg gaagttggcc tcagaagtag
60tggccagctg tgtgtcgggg tacagtaaag gcatgaagct cag
1035523DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
55ctgagcttca tgcctttact gtt 235623DNAArtificial SequenceSYNTHETIC
DNA OLIGONUCLEOTIDE 56ctgagcttca tgcctttact gtc 235723DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 57ctgagcttca tgcctttact gta
235823DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
58ctgagcttca tgcctttact gtg 235922DNAArtificial SequenceSYNTHETIC
DNA OLIGONUCLEOTIDE 59ctgagcttca tgcctttact gt 226023DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDE 60agctctgccc aaagattacc ctg
236128DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(1)..(1)5'-FAM
(6-carboxyfluorescein)misc_feature(9)..(10)ZEN INTERNAL
FLUORESCENCE QUENCHER BETWEEN RESIDUES 9 AND
10.misc_feature(28)..(28)3'-IBFQ (Iowa Black FQ fluorescence
quencher)) 61ttctgaggcc aacttccact gccactta 286223DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUE 62ctgagcttca tgcctttact gtu 236323DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUE 63ctgagcttca tgcctttact gtc 236423DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUE 64ctgagcttca tgcctttact gta 236523DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUE 65ctgagcttca tgcctttact gtg 236627DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUEmisc_feature(27)..(27)3'-C3 SPACER (propanediol)
66ctgagcttca tgcctttact gtucccc 276727DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUEmisc_feature(27)..(27)3'-C3 SPACER (PROPANEDIOL)
67ctgagcttca tgcctttact gtccccc 276827DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUEmisc_feature(27)..(27)3'-C3 SPACER (PROPANEDIOL)
68ctgagcttca tgcctttact gtacccc 276927DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUEmisc_feature(27)..(27)3'-C3 SPACER (PROPANEDIOL)
69ctgagcttca tgcctttact gtgcccc 277025DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUEmisc_feature(24)..(25)TWO INTERNAL C3 SPACERS (PROPANEDIOL)
BETWEEN RESIDUES 24 AND 25. 70ctgagcttca tgcctttact gtucc
257125DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUEmisc_feature(24)..(25)TWO INTERNAL C3 SPACERS (PROPANEDIOL)
BETWEEN RESIDUES 24 AND 25. 71ctgagcttca tgcctttact gtccc
257225DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUEmisc_feature(24)..(25)TWO INTERNAL C3 SPACERS (PROPANEDIOL)
BETWEEN RESIDUES 24 AND 25. 72ctgagcttca tgcctttact gtacc
257325DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUEmisc_feature(24)..(25)TWO INTERNAL C3 SPACERS (PROPANEDIOL)
BETWEEN RESIDUES 24 AND 25. 73ctgagcttca tgcctttact gtgcc
257421DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
74ctcactctaa accccagcat t 217522DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 75cagcctcatc caaaagagga aa 227627DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUEmisc_feature(27)..(27)3'-C3 SPACER (PROPANEDIOL)
76cagcctcatc caaaagagga aacagga 277727DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUEmisc_feature(27)..(27)3'-C3 SPACER (PROPANEDIOL)
77cagcctcatc caaaagagga aauagga 277825DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUEmisc_feature(24)..(25)TWO INTERNAL C3 SPACERS (PROPANEDIOL)
BETWEEN RESIDUES 24 AND 25. 78cagcctcatc caaaagagga aacaa
257925DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(23)..(23)RNA
RESIDUEmisc_feature(24)..(25)TWO INTERNAL C3 SPACERS (PROPANEDIOL)
BETWEEN RESIDUES 24 AND 25. 79cagcctcatc caaaagagga aauaa
258022DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(1)..(1)5'-FAM
(6-carboxyfluorescein)misc_feature(22)..(22)3'-IBFQ (Iowa Black FQ
(fluorescence quencher)) 80cccagagctc cctcagactc ct
228185DNAArtificial SequenceSYNTHETIC DNA OLIGONUCLEOTIDE
81cagcctcatc caaaagagga aataggaccc cagagctccc tcagactcct caggaaacac
60agacaatgct ggggtttaga gtgag 85822507DNAArtificial
SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 2 (V783F) 82catatgcgtg
gtatgctgcc gttgttcgag cctaaaggcc gcgtactgtt agtcgatggt 60catcacttgg
cctatcggac gttccatgca ctcaaaggtc tgacgaccag tcgtggcgaa
120ccggtccagg ctgtttatgg tttcgctaag tctttgctca aagcactgaa
agaagacggg 180gacgcggtaa ttgttgtatt tgatgccaaa gcaccgagct
tccgccacga agcttatggt 240ggctacaagg caggacgcgc ccctacccca
gaagatttcc cccgtcagct ggcattaatt 300aaggagttag tagaccttct
cggcttagcg cgtctggaag ttccgggtta tgaggcggac 360gatgtccttg
catccttggc taaaaaggcc gaaaaagagg gctacgaagt ccgcatcttg
420acggcagaca aagatctgta ccagcttctg tctgaccgta ttcatgtttt
gcaccctgaa 480ggctacttaa tcactccggc ctggctctgg gaaaagtacg
gtctgcgtcc cgatcagtgg 540gcggattatc gggctttgac gggagatgag
agcgacaacc tgccaggagt taagggcatt 600ggtgaaaaaa ccgcacgtaa
gctgcttgaa gagtggggtt ccctggaagc cttgttaaaa 660aatctggatc
gtctcaagcc cgcaattcgt gaaaagatcc tggctcatat ggacgatctt
720aaattaagtt gggacctggc caaggtgcgc accgatttac cgcttgaagt
ggattttgca 780aaacgccgtg agccggaccg ggaacgttta cgcgctttct
tagagcgtct ggaattcggt 840tcactgcttc atgaattcgg tctgttagag
tctcctaaag cactcgaaga ggcaccgtgg 900ccgcccccag aaggtgcttt
tgttggcttc gtactttccc gtaaggagcc tatgtgggca 960gatcttctgg
ctttagcggc tgcacgcggt ggccgtgttc accgggcccc tgagccatac
1020aaagcgttac gtgatctgaa ggaagcacgt ggcttgctgg caaaagacct
ttctgttttg 1080gccctgcgcg agggtcttgg actgccgcca ggcgacgatc
ccatgttatt ggcctatctg 1140ttagacccta gcaataccac acctgaaggg
gtcgctcgtc ggtatggcgg tgaatggact 1200gaggaagccg gagagcgcgc
cgcattgtcc gaacggctct ttgcaaactt atggggtcgt 1260ctggaagggg
aggaacgtct gttatggttg tatcgggaag tcgaacgtcc tctttcggcc
1320gtattagcgc atatggaggc aacaggtgtg cgtttagatg tcgcgtacct
tcgggcctta 1380tcactggaag ttgcagagga aatcgcccgt ctcgaggctg
aagtgttccg gttggccggt 1440cacccgttta acctcaactc ccgtgaccag
ctggaacgcg ttttattcga tgagcttggg 1500cttcccgcaa ttggcaaaac
cgaaaagact ggcaaacgca gtacgagcgc tgccgtcctt 1560gaggcactcc
gcgaggctca ccctattgta gaaaagatcc tgcaataccg tgagttgacg
1620aagcttaaaa gcacttatat tgatcctctc ccggatctga tccatcctcg
taccggccgc 1680ttgcacacac gtttcaacca gacggcgact gcaaccggcc
gtctgtctag ctcggatcca 1740aatctccaga acattccggt ccgtacaccc
ttgggccaac gtatccgccg ggcgtttatc 1800gctgaggaag gatggttact
ggtcgcattg gactactcgc agattgagct gcgcgtcctc 1860gcacatctct
ctggtgacga aaatttaatc cgcgtgtttc aagaggggcg tgatattcac
1920acagaaactg cctcatggat gttcggtgtc ccacgtgaag cagtggatcc
tttgatgcgc 1980cgtgcagcta aaacaattaa ttttggagtg ctgtacggaa
tgagcgctca tcgcttgagt 2040caggaactgg caatccccta cgaggaagcg
caggcattca tcgaacgtta ctttcaatcg 2100tttccgaaag ttcgcgcatg
gatcgagaag acgctcgagg aaggtcgtcg tcggggctat 2160gtcgaaactc
tgtttggtcg ccgtcggtac gtaccagatc ttgaagcccg cgtcaaatcg
2220gtacgggagg ctgcggagcg tatggcattt aatatgcctg tacagggtac
tgcagctgac 2280ctcatgaaac tggcaatggt caagcttttc ccgcgcttgg
aggaaatggg cgcacgtatg 2340cttctgcagt tccatgacga gctggtgtta
gaagccccta aggagcgcgc cgaagctgtc 2400gcgcgcctcg ctaaagaagt
gatggagggc gtttacccat tggccgtacc cctcgaagtg 2460gaggtcggta
ttggagaaga ttggttatct gcaaaggaag cggccgc 250783834PRTArtificial
SequenceAMINO ACID SEQUENCE OF MUTANT ID 2 (V783F) 83Met Arg Gly
Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val Leu Leu1 5 10 15Val Asp
Gly His His Leu Ala Tyr Arg Thr Phe His Ala Leu Lys Gly 20 25 30Leu
Thr Thr Ser Arg Gly Glu Pro Val Gln Ala Val Tyr Gly Phe Ala 35 40
45Lys Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala Val Ile Val
50 55 60Val Phe Asp Ala Lys Ala Pro Ser Phe Arg His Glu Ala Tyr Gly
Gly65 70 75 80Tyr Lys Ala Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro
Arg Gln Leu 85 90 95Ala Leu Ile Lys Glu Leu Val Asp Leu Leu Gly Leu
Ala Arg Leu Glu 100 105 110Val Pro Gly Tyr Glu Ala Asp Asp Val Leu
Ala Ser Leu Ala Lys Lys 115 120 125Ala Glu Lys Glu Gly Tyr Glu Val
Arg Ile Leu Thr Ala Asp Lys Asp 130 135 140Leu Tyr Gln Leu Leu Ser
Asp Arg Ile His Val Leu His Pro Glu Gly145 150 155 160Tyr Leu Ile
Thr Pro Ala Trp Leu Trp Glu Lys Tyr Gly Leu Arg Pro 165 170 175Asp
Gln Trp Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu Ser Asp Asn 180 185
190Leu Pro Gly Val Lys Gly Ile Gly Glu Lys Thr Ala Arg Lys Leu Leu
195 200 205Glu Glu Trp Gly Ser Leu Glu Ala Leu Leu Lys Asn Leu Asp
Arg Leu 210 215 220Lys Pro Ala Ile Arg Glu Lys Ile Leu Ala His Met
Asp Asp Leu Lys225 230 235 240Leu Ser Trp Asp Leu Ala Lys Val Arg
Thr Asp Leu Pro Leu Glu Val 245 250 255Asp Phe Ala Lys Arg Arg Glu
Pro Asp Arg Glu Arg Leu Arg Ala Phe 260 265 270Leu Glu Arg Leu Glu
Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu 275 280 285Glu Ser Pro
Lys Ala Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly 290 295 300Ala
Phe Val Gly Phe Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp305 310
315 320Leu Leu Ala Leu Ala Ala Ala Arg Gly Gly Arg Val His Arg Ala
Pro 325 330 335Glu Pro Tyr Lys Ala Leu Arg Asp Leu Lys Glu Ala Arg
Gly Leu Leu 340 345 350Ala Lys Asp Leu Ser Val Leu Ala Leu Arg Glu
Gly Leu Gly Leu Pro 355
360 365Pro Gly Asp Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser
Asn 370 375 380Thr Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu
Trp Thr Glu385 390 395 400Glu Ala Gly Glu Arg Ala Ala Leu Ser Glu
Arg Leu Phe Ala Asn Leu 405 410 415Trp Gly Arg Leu Glu Gly Glu Glu
Arg Leu Leu Trp Leu Tyr Arg Glu 420 425 430Val Glu Arg Pro Leu Ser
Ala Val Leu Ala His Met Glu Ala Thr Gly 435 440 445Val Arg Leu Asp
Val Ala Tyr Leu Arg Ala Leu Ser Leu Glu Val Ala 450 455 460Glu Glu
Ile Ala Arg Leu Glu Ala Glu Val Phe Arg Leu Ala Gly His465 470 475
480Pro Phe Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp
485 490 495Glu Leu Gly Leu Pro Ala Ile Gly Lys Thr Glu Lys Thr Gly
Lys Arg 500 505 510Ser Thr Ser Ala Ala Val Leu Glu Ala Leu Arg Glu
Ala His Pro Ile 515 520 525Val Glu Lys Ile Leu Gln Tyr Arg Glu Leu
Thr Lys Leu Lys Ser Thr 530 535 540Tyr Ile Asp Pro Leu Pro Asp Leu
Ile His Pro Arg Thr Gly Arg Leu545 550 555 560His Thr Arg Phe Asn
Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser 565 570 575Ser Asp Pro
Asn Leu Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln 580 585 590Arg
Ile Arg Arg Ala Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala 595 600
605Leu Asp Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly
610 615 620Asp Glu Asn Leu Ile Arg Val Phe Gln Glu Gly Arg Asp Ile
His Thr625 630 635 640Glu Thr Ala Ser Trp Met Phe Gly Val Pro Arg
Glu Ala Val Asp Pro 645 650 655Leu Met Arg Arg Ala Ala Lys Thr Ile
Asn Phe Gly Val Leu Tyr Gly 660 665 670Met Ser Ala His Arg Leu Ser
Gln Glu Leu Ala Ile Pro Tyr Glu Glu 675 680 685Ala Gln Ala Phe Ile
Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg 690 695 700Ala Trp Ile
Glu Lys Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr Val705 710 715
720Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg
725 730 735Val Lys Ser Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn
Met Pro 740 745 750Val Gln Gly Thr Ala Ala Asp Leu Met Lys Leu Ala
Met Val Lys Leu 755 760 765Phe Pro Arg Leu Glu Glu Met Gly Ala Arg
Met Leu Leu Gln Phe His 770 775 780Asp Glu Leu Val Leu Glu Ala Pro
Lys Glu Arg Ala Glu Ala Val Ala785 790 795 800Arg Leu Ala Lys Glu
Val Met Glu Gly Val Tyr Pro Leu Ala Val Pro 805 810 815Leu Glu Val
Glu Val Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu 820 825 830Ala
Ala842507DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 3
(H784Q) 84catatgcgtg gtatgctgcc gttgttcgag cctaaaggcc gcgtactgtt
agtcgatggt 60catcacttgg cctatcggac gttccatgca ctcaaaggtc tgacgaccag
tcgtggcgaa 120ccggtccagg ctgtttatgg tttcgctaag tctttgctca
aagcactgaa agaagacggg 180gacgcggtaa ttgttgtatt tgatgccaaa
gcaccgagct tccgccacga agcttatggt 240ggctacaagg caggacgcgc
ccctacccca gaagatttcc cccgtcagct ggcattaatt 300aaggagttag
tagaccttct cggcttagcg cgtctggaag ttccgggtta tgaggcggac
360gatgtccttg catccttggc taaaaaggcc gaaaaagagg gctacgaagt
ccgcatcttg 420acggcagaca aagatctgta ccagcttctg tctgaccgta
ttcatgtttt gcaccctgaa 480ggctacttaa tcactccggc ctggctctgg
gaaaagtacg gtctgcgtcc cgatcagtgg 540gcggattatc gggctttgac
gggagatgag agcgacaacc tgccaggagt taagggcatt 600ggtgaaaaaa
ccgcacgtaa gctgcttgaa gagtggggtt ccctggaagc cttgttaaaa
660aatctggatc gtctcaagcc cgcaattcgt gaaaagatcc tggctcatat
ggacgatctt 720aaattaagtt gggacctggc caaggtgcgc accgatttac
cgcttgaagt ggattttgca 780aaacgccgtg agccggaccg ggaacgttta
cgcgctttct tagagcgtct ggaattcggt 840tcactgcttc atgaattcgg
tctgttagag tctcctaaag cactcgaaga ggcaccgtgg 900ccgcccccag
aaggtgcttt tgttggcttc gtactttccc gtaaggagcc tatgtgggca
960gatcttctgg ctttagcggc tgcacgcggt ggccgtgttc accgggcccc
tgagccatac 1020aaagcgttac gtgatctgaa ggaagcacgt ggcttgctgg
caaaagacct ttctgttttg 1080gccctgcgcg agggtcttgg actgccgcca
ggcgacgatc ccatgttatt ggcctatctg 1140ttagacccta gcaataccac
acctgaaggg gtcgctcgtc ggtatggcgg tgaatggact 1200gaggaagccg
gagagcgcgc cgcattgtcc gaacggctct ttgcaaactt atggggtcgt
1260ctggaagggg aggaacgtct gttatggttg tatcgggaag tcgaacgtcc
tctttcggcc 1320gtattagcgc atatggaggc aacaggtgtg cgtttagatg
tcgcgtacct tcgggcctta 1380tcactggaag ttgcagagga aatcgcccgt
ctcgaggctg aagtgttccg gttggccggt 1440cacccgttta acctcaactc
ccgtgaccag ctggaacgcg ttttattcga tgagcttggg 1500cttcccgcaa
ttggcaaaac cgaaaagact ggcaaacgca gtacgagcgc tgccgtcctt
1560gaggcactcc gcgaggctca ccctattgta gaaaagatcc tgcaataccg
tgagttgacg 1620aagcttaaaa gcacttatat tgatcctctc ccggatctga
tccatcctcg taccggccgc 1680ttgcacacac gtttcaacca gacggcgact
gcaaccggcc gtctgtctag ctcggatcca 1740aatctccaga acattccggt
ccgtacaccc ttgggccaac gtatccgccg ggcgtttatc 1800gctgaggaag
gatggttact ggtcgcattg gactactcgc agattgagct gcgcgtcctc
1860gcacatctct ctggtgacga aaatttaatc cgcgtgtttc aagaggggcg
tgatattcac 1920acagaaactg cctcatggat gttcggtgtc ccacgtgaag
cagtggatcc tttgatgcgc 1980cgtgcagcta aaacaattaa ttttggagtg
ctgtacggaa tgagcgctca tcgcttgagt 2040caggaactgg caatccccta
cgaggaagcg caggcattca tcgaacgtta ctttcaatcg 2100tttccgaaag
ttcgcgcatg gatcgagaag acgctcgagg aaggtcgtcg tcggggctat
2160gtcgaaactc tgtttggtcg ccgtcggtac gtaccagatc ttgaagcccg
cgtcaaatcg 2220gtacgggagg ctgcggagcg tatggcattt aatatgcctg
tacagggtac tgcagctgac 2280ctcatgaaac tggcaatggt caagcttttc
ccgcgcttgg aggaaatggg cgcacgtatg 2340cttctgcagg tccaggacga
gctggtgtta gaagccccta aggagcgcgc cgaagctgtc 2400gcgcgcctcg
ctaaagaagt gatggagggc gtttacccat tggccgtacc cctcgaagtg
2460gaggtcggta ttggagaaga ttggttatct gcaaaggaag cggccgc
250785834PRTArtificial SequenceAMINO ACID SEQUENCE OF MUTANT ID 3
(H784Q) 85Met Arg Gly Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val
Leu Leu1 5 10 15Val Asp Gly His His Leu Ala Tyr Arg Thr Phe His Ala
Leu Lys Gly 20 25 30Leu Thr Thr Ser Arg Gly Glu Pro Val Gln Ala Val
Tyr Gly Phe Ala 35 40 45Lys Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly
Asp Ala Val Ile Val 50 55 60Val Phe Asp Ala Lys Ala Pro Ser Phe Arg
His Glu Ala Tyr Gly Gly65 70 75 80Tyr Lys Ala Gly Arg Ala Pro Thr
Pro Glu Asp Phe Pro Arg Gln Leu 85 90 95Ala Leu Ile Lys Glu Leu Val
Asp Leu Leu Gly Leu Ala Arg Leu Glu 100 105 110Val Pro Gly Tyr Glu
Ala Asp Asp Val Leu Ala Ser Leu Ala Lys Lys 115 120 125Ala Glu Lys
Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp 130 135 140Leu
Tyr Gln Leu Leu Ser Asp Arg Ile His Val Leu His Pro Glu Gly145 150
155 160Tyr Leu Ile Thr Pro Ala Trp Leu Trp Glu Lys Tyr Gly Leu Arg
Pro 165 170 175Asp Gln Trp Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu
Ser Asp Asn 180 185 190Leu Pro Gly Val Lys Gly Ile Gly Glu Lys Thr
Ala Arg Lys Leu Leu 195 200 205Glu Glu Trp Gly Ser Leu Glu Ala Leu
Leu Lys Asn Leu Asp Arg Leu 210 215 220Lys Pro Ala Ile Arg Glu Lys
Ile Leu Ala His Met Asp Asp Leu Lys225 230 235 240Leu Ser Trp Asp
Leu Ala Lys Val Arg Thr Asp Leu Pro Leu Glu Val 245 250 255Asp Phe
Ala Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe 260 265
270Leu Glu Arg Leu Glu Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu
275 280 285Glu Ser Pro Lys Ala Leu Glu Glu Ala Pro Trp Pro Pro Pro
Glu Gly 290 295 300Ala Phe Val Gly Phe Val Leu Ser Arg Lys Glu Pro
Met Trp Ala Asp305 310 315 320Leu Leu Ala Leu Ala Ala Ala Arg Gly
Gly Arg Val His Arg Ala Pro 325 330 335Glu Pro Tyr Lys Ala Leu Arg
Asp Leu Lys Glu Ala Arg Gly Leu Leu 340 345 350Ala Lys Asp Leu Ser
Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro 355 360 365Pro Gly Asp
Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn 370 375 380Thr
Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu385 390
395 400Glu Ala Gly Glu Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn
Leu 405 410 415Trp Gly Arg Leu Glu Gly Glu Glu Arg Leu Leu Trp Leu
Tyr Arg Glu 420 425 430Val Glu Arg Pro Leu Ser Ala Val Leu Ala His
Met Glu Ala Thr Gly 435 440 445Val Arg Leu Asp Val Ala Tyr Leu Arg
Ala Leu Ser Leu Glu Val Ala 450 455 460Glu Glu Ile Ala Arg Leu Glu
Ala Glu Val Phe Arg Leu Ala Gly His465 470 475 480Pro Phe Asn Leu
Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp 485 490 495Glu Leu
Gly Leu Pro Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg 500 505
510Ser Thr Ser Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile
515 520 525Val Glu Lys Ile Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys
Ser Thr 530 535 540Tyr Ile Asp Pro Leu Pro Asp Leu Ile His Pro Arg
Thr Gly Arg Leu545 550 555 560His Thr Arg Phe Asn Gln Thr Ala Thr
Ala Thr Gly Arg Leu Ser Ser 565 570 575Ser Asp Pro Asn Leu Gln Asn
Ile Pro Val Arg Thr Pro Leu Gly Gln 580 585 590Arg Ile Arg Arg Ala
Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala 595 600 605Leu Asp Tyr
Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly 610 615 620Asp
Glu Asn Leu Ile Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr625 630
635 640Glu Thr Ala Ser Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp
Pro 645 650 655Leu Met Arg Arg Ala Ala Lys Thr Ile Asn Phe Gly Val
Leu Tyr Gly 660 665 670Met Ser Ala His Arg Leu Ser Gln Glu Leu Ala
Ile Pro Tyr Glu Glu 675 680 685Ala Gln Ala Phe Ile Glu Arg Tyr Phe
Gln Ser Phe Pro Lys Val Arg 690 695 700Ala Trp Ile Glu Lys Thr Leu
Glu Glu Gly Arg Arg Arg Gly Tyr Val705 710 715 720Glu Thr Leu Phe
Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg 725 730 735Val Lys
Ser Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro 740 745
750Val Gln Gly Thr Ala Ala Asp Leu Met Lys Leu Ala Met Val Lys Leu
755 760 765Phe Pro Arg Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln
Val Gln 770 775 780Asp Glu Leu Val Leu Glu Ala Pro Lys Glu Arg Ala
Glu Ala Val Ala785 790 795 800Arg Leu Ala Lys Glu Val Met Glu Gly
Val Tyr Pro Leu Ala Val Pro 805 810 815Leu Glu Val Glu Val Gly Ile
Gly Glu Asp Trp Leu Ser Ala Lys Glu 820 825 830Ala
Ala862507DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 10
(A661E, I665W, F667L) 86catatgcgtg gtatgctgcc gttgttcgag cctaaaggcc
gcgtactgtt agtcgatggt 60catcacttgg cctatcggac gttccatgca ctcaaaggtc
tgacgaccag tcgtggcgaa 120ccggtccagg ctgtttatgg tttcgctaag
tctttgctca aagcactgaa agaagacggg 180gacgcggtaa ttgttgtatt
tgatgccaaa gcaccgagct tccgccacga agcttatggt 240ggctacaagg
caggacgcgc ccctacccca gaagatttcc cccgtcagct ggcattaatt
300aaggagttag tagaccttct cggcttagcg cgtctggaag ttccgggtta
tgaggcggac 360gatgtccttg catccttggc taaaaaggcc gaaaaagagg
gctacgaagt ccgcatcttg 420acggcagaca aagatctgta ccagcttctg
tctgaccgta ttcatgtttt gcaccctgaa 480ggctacttaa tcactccggc
ctggctctgg gaaaagtacg gtctgcgtcc cgatcagtgg 540gcggattatc
gggctttgac gggagatgag agcgacaacc tgccaggagt taagggcatt
600ggtgaaaaaa ccgcacgtaa gctgcttgaa gagtggggtt ccctggaagc
cttgttaaaa 660aatctggatc gtctcaagcc cgcaattcgt gaaaagatcc
tggctcatat ggacgatctt 720aaattaagtt gggacctggc caaggtgcgc
accgatttac cgcttgaagt ggattttgca 780aaacgccgtg agccggaccg
ggaacgttta cgcgctttct tagagcgtct ggaattcggt 840tcactgcttc
atgaattcgg tctgttagag tctcctaaag cactcgaaga ggcaccgtgg
900ccgcccccag aaggtgcttt tgttggcttc gtactttccc gtaaggagcc
tatgtgggca 960gatcttctgg ctttagcggc tgcacgcggt ggccgtgttc
accgggcccc tgagccatac 1020aaagcgttac gtgatctgaa ggaagcacgt
ggcttgctgg caaaagacct ttctgttttg 1080gccctgcgcg agggtcttgg
actgccgcca ggcgacgatc ccatgttatt ggcctatctg 1140ttagacccta
gcaataccac acctgaaggg gtcgctcgtc ggtatggcgg tgaatggact
1200gaggaagccg gagagcgcgc cgcattgtcc gaacggctct ttgcaaactt
atggggtcgt 1260ctggaagggg aggaacgtct gttatggttg tatcgggaag
tcgaacgtcc tctttcggcc 1320gtattagcgc atatggaggc aacaggtgtg
cgtttagatg tcgcgtacct tcgggcctta 1380tcactggaag ttgcagagga
aatcgcccgt ctcgaggctg aagtgttccg gttggccggt 1440cacccgttta
acctcaactc ccgtgaccag ctggaacgcg ttttattcga tgagcttggg
1500cttcccgcaa ttggcaaaac cgaaaagact ggcaaacgca gtacgagcgc
tgccgtcctt 1560gaggcactcc gcgaggctca ccctattgta gaaaagatcc
tgcaataccg tgagttgacg 1620aagcttaaaa gcacttatat tgatcctctc
ccggatctga tccatcctcg taccggccgc 1680ttgcacacac gtttcaacca
gacggcgact gcaaccggcc gtctgtctag ctcggatcca 1740aatctccaga
acattccggt ccgtacaccc ttgggccaac gtatccgccg ggcgtttatc
1800gctgaggaag gatggttact ggtcgcattg gactactcgc agattgagct
gcgcgtcctc 1860gcacatctct ctggtgacga aaatttaatc cgcgtgtttc
aagaggggcg tgatattcac 1920acagaaactg cctcatggat gttcggtgtc
ccacgtgaag cagtggatcc tttgatgcgc 1980cgtgaagcta aaacatggaa
tttgggagtg ctgtacggaa tgagcgctca tcgcttgagt 2040caggaactgg
caatccccta cgaggaagcg caggcattca tcgaacgtta ctttcaatcg
2100tttccgaaag ttcgcgcatg gatcgagaag acgctcgagg aaggtcgtcg
tcggggctat 2160gtcgaaactc tgtttggtcg ccgtcggtac gtaccagatc
ttgaagcccg cgtcaaatcg 2220gtacgggagg ctgcggagcg tatggcattt
aatatgcctg tacagggtac tgcagctgac 2280ctcatgaaac tggcaatggt
caagcttttc ccgcgcttgg aggaaatggg cgcacgtatg 2340cttctgcagg
tccatgacga gctggtgtta gaagccccta aggagcgcgc cgaagctgtc
2400gcgcgcctcg ctaaagaagt gatggagggc gtttacccat tggccgtacc
cctcgaagtg 2460gaggtcggta ttggagaaga ttggttatct gcaaaggaag cggccgc
250787834PRTArtificial SequenceAMINO ACID SEQUENCE OF MUTANT ID 10
(A661E, I665W, F667L) 87Met Arg Gly Met Leu Pro Leu Phe Glu Pro Lys
Gly Arg Val Leu Leu1 5 10 15Val Asp Gly His His Leu Ala Tyr Arg Thr
Phe His Ala Leu Lys Gly 20 25 30Leu Thr Thr Ser Arg Gly Glu Pro Val
Gln Ala Val Tyr Gly Phe Ala 35 40 45Lys Ser Leu Leu Lys Ala Leu Lys
Glu Asp Gly Asp Ala Val Ile Val 50 55 60Val Phe Asp Ala Lys Ala Pro
Ser Phe Arg His Glu Ala Tyr Gly Gly65 70 75 80Tyr Lys Ala Gly Arg
Ala Pro Thr Pro Glu Asp Phe Pro Arg Gln Leu 85 90 95Ala Leu Ile Lys
Glu Leu Val Asp Leu Leu Gly Leu Ala Arg Leu Glu 100 105 110Val Pro
Gly Tyr Glu Ala Asp Asp Val Leu Ala Ser Leu Ala Lys Lys 115 120
125Ala Glu Lys Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp
130 135 140Leu Tyr Gln Leu Leu Ser Asp Arg Ile His Val Leu His Pro
Glu Gly145 150 155 160Tyr Leu Ile Thr Pro Ala Trp Leu Trp Glu Lys
Tyr Gly Leu Arg Pro 165 170 175Asp Gln Trp Ala Asp Tyr Arg Ala Leu
Thr Gly Asp Glu Ser Asp Asn 180 185 190Leu Pro Gly Val Lys Gly Ile
Gly Glu Lys Thr Ala Arg Lys Leu Leu 195 200 205Glu Glu Trp Gly Ser
Leu Glu Ala Leu Leu Lys Asn Leu Asp Arg Leu 210 215 220Lys Pro Ala
Ile Arg Glu Lys Ile Leu Ala His Met Asp Asp Leu Lys225 230 235
240Leu Ser Trp Asp Leu Ala Lys Val Arg Thr Asp Leu Pro Leu Glu Val
245 250 255Asp Phe Ala Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg
Ala Phe 260 265 270Leu Glu Arg Leu Glu Phe Gly Ser Leu Leu His Glu
Phe Gly Leu Leu 275 280 285Glu Ser Pro Lys Ala Leu Glu Glu Ala
Pro Trp Pro Pro Pro Glu Gly 290 295 300Ala Phe Val Gly Phe Val Leu
Ser Arg Lys Glu Pro Met Trp Ala Asp305 310 315 320Leu Leu Ala Leu
Ala Ala Ala Arg Gly Gly Arg Val His Arg Ala Pro 325 330 335Glu Pro
Tyr Lys Ala Leu Arg Asp Leu Lys Glu Ala Arg Gly Leu Leu 340 345
350Ala Lys Asp Leu Ser Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro
355 360 365Pro Gly Asp Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro
Ser Asn 370 375 380Thr Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly
Glu Trp Thr Glu385 390 395 400Glu Ala Gly Glu Arg Ala Ala Leu Ser
Glu Arg Leu Phe Ala Asn Leu 405 410 415Trp Gly Arg Leu Glu Gly Glu
Glu Arg Leu Leu Trp Leu Tyr Arg Glu 420 425 430Val Glu Arg Pro Leu
Ser Ala Val Leu Ala His Met Glu Ala Thr Gly 435 440 445Val Arg Leu
Asp Val Ala Tyr Leu Arg Ala Leu Ser Leu Glu Val Ala 450 455 460Glu
Glu Ile Ala Arg Leu Glu Ala Glu Val Phe Arg Leu Ala Gly His465 470
475 480Pro Phe Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe
Asp 485 490 495Glu Leu Gly Leu Pro Ala Ile Gly Lys Thr Glu Lys Thr
Gly Lys Arg 500 505 510Ser Thr Ser Ala Ala Val Leu Glu Ala Leu Arg
Glu Ala His Pro Ile 515 520 525Val Glu Lys Ile Leu Gln Tyr Arg Glu
Leu Thr Lys Leu Lys Ser Thr 530 535 540Tyr Ile Asp Pro Leu Pro Asp
Leu Ile His Pro Arg Thr Gly Arg Leu545 550 555 560His Thr Arg Phe
Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser 565 570 575Ser Asp
Pro Asn Leu Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln 580 585
590Arg Ile Arg Arg Ala Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala
595 600 605Leu Asp Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu
Ser Gly 610 615 620Asp Glu Asn Leu Ile Arg Val Phe Gln Glu Gly Arg
Asp Ile His Thr625 630 635 640Glu Thr Ala Ser Trp Met Phe Gly Val
Pro Arg Glu Ala Val Asp Pro 645 650 655Leu Met Arg Arg Glu Ala Lys
Thr Trp Asn Leu Gly Val Leu Tyr Gly 660 665 670Met Ser Ala His Arg
Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu 675 680 685Ala Gln Ala
Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg 690 695 700Ala
Trp Ile Glu Lys Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr Val705 710
715 720Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala
Arg 725 730 735Val Lys Ser Val Arg Glu Ala Ala Glu Arg Met Ala Phe
Asn Met Pro 740 745 750Val Gln Gly Thr Ala Ala Asp Leu Met Lys Leu
Ala Met Val Lys Leu 755 760 765Phe Pro Arg Leu Glu Glu Met Gly Ala
Arg Met Leu Leu Gln Val His 770 775 780Asp Glu Leu Val Leu Glu Ala
Pro Lys Glu Arg Ala Glu Ala Val Ala785 790 795 800Arg Leu Ala Lys
Glu Val Met Glu Gly Val Tyr Pro Leu Ala Val Pro 805 810 815Leu Glu
Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu 820 825
830Ala Ala882507DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT
ID 18 (V783L, H784Q) 88catatgcgtg gtatgctgcc gttgttcgag cctaaaggcc
gcgtactgtt agtcgatggt 60catcacttgg cctatcggac gttccatgca ctcaaaggtc
tgacgaccag tcgtggcgaa 120ccggtccagg ctgtttatgg tttcgctaag
tctttgctca aagcactgaa agaagacggg 180gacgcggtaa ttgttgtatt
tgatgccaaa gcaccgagct tccgccacga agcttatggt 240ggctacaagg
caggacgcgc ccctacccca gaagatttcc cccgtcagct ggcattaatt
300aaggagttag tagaccttct cggcttagcg cgtctggaag ttccgggtta
tgaggcggac 360gatgtccttg catccttggc taaaaaggcc gaaaaagagg
gctacgaagt ccgcatcttg 420acggcagaca aagatctgta ccagcttctg
tctgaccgta ttcatgtttt gcaccctgaa 480ggctacttaa tcactccggc
ctggctctgg gaaaagtacg gtctgcgtcc cgatcagtgg 540gcggattatc
gggctttgac gggagatgag agcgacaacc tgccaggagt taagggcatt
600ggtgaaaaaa ccgcacgtaa gctgcttgaa gagtggggtt ccctggaagc
cttgttaaaa 660aatctggatc gtctcaagcc cgcaattcgt gaaaagatcc
tggctcatat ggacgatctt 720aaattaagtt gggacctggc caaggtgcgc
accgatttac cgcttgaagt ggattttgca 780aaacgccgtg agccggaccg
ggaacgttta cgcgctttct tagagcgtct ggaattcggt 840tcactgcttc
atgaattcgg tctgttagag tctcctaaag cactcgaaga ggcaccgtgg
900ccgcccccag aaggtgcttt tgttggcttc gtactttccc gtaaggagcc
tatgtgggca 960gatcttctgg ctttagcggc tgcacgcggt ggccgtgttc
accgggcccc tgagccatac 1020aaagcgttac gtgatctgaa ggaagcacgt
ggcttgctgg caaaagacct ttctgttttg 1080gccctgcgcg agggtcttgg
actgccgcca ggcgacgatc ccatgttatt ggcctatctg 1140ttagacccta
gcaataccac acctgaaggg gtcgctcgtc ggtatggcgg tgaatggact
1200gaggaagccg gagagcgcgc cgcattgtcc gaacggctct ttgcaaactt
atggggtcgt 1260ctggaagggg aggaacgtct gttatggttg tatcgggaag
tcgaacgtcc tctttcggcc 1320gtattagcgc atatggaggc aacaggtgtg
cgtttagatg tcgcgtacct tcgggcctta 1380tcactggaag ttgcagagga
aatcgcccgt ctcgaggctg aagtgttccg gttggccggt 1440cacccgttta
acctcaactc ccgtgaccag ctggaacgcg ttttattcga tgagcttggg
1500cttcccgcaa ttggcaaaac cgaaaagact ggcaaacgca gtacgagcgc
tgccgtcctt 1560gaggcactcc gcgaggctca ccctattgta gaaaagatcc
tgcaataccg tgagttgacg 1620aagcttaaaa gcacttatat tgatcctctc
ccggatctga tccatcctcg taccggccgc 1680ttgcacacac gtttcaacca
gacggcgact gcaaccggcc gtctgtctag ctcggatcca 1740aatctccaga
acattccggt ccgtacaccc ttgggccaac gtatccgccg ggcgtttatc
1800gctgaggaag gatggttact ggtcgcattg gactactcgc agattgagct
gcgcgtcctc 1860gcacatctct ctggtgacga aaatttaatc cgcgtgtttc
aagaggggcg tgatattcac 1920acagaaactg cctcatggat gttcggtgtc
ccacgtgaag cagtggatcc tttgatgcgc 1980cgtgcagcta aaacaattaa
ttttggagtg ctgtacggaa tgagcgctca tcgcttgagt 2040caggaactgg
caatccccta cgaggaagcg caggcattca tcgaacgtta ctttcaatcg
2100tttccgaaag ttcgcgcatg gatcgagaag acgctcgagg aaggtcgtcg
tcggggctat 2160gtcgaaactc tgtttggtcg ccgtcggtac gtaccagatc
ttgaagcccg cgtcaaatcg 2220gtacgggagg ctgcggagcg tatggcattt
aatatgcctg tacagggtac tgcagctgac 2280ctcatgaaac tggcaatggt
caagcttttc ccgcgcttgg aggaaatggg cgcacgtatg 2340cttctgcagc
tgcaggacga gctggtgtta gaagccccta aggagcgcgc cgaagctgtc
2400gcgcgcctcg ctaaagaagt gatggagggc gtttacccat tggccgtacc
cctcgaagtg 2460gaggtcggta ttggagaaga ttggttatct gcaaaggaag cggccgc
250789834PRTArtificial SequenceAMINO ACID SEQUENCE OF MUTANT ID 18
(V783L, H784Q). 89Met Arg Gly Met Leu Pro Leu Phe Glu Pro Lys Gly
Arg Val Leu Leu1 5 10 15Val Asp Gly His His Leu Ala Tyr Arg Thr Phe
His Ala Leu Lys Gly 20 25 30Leu Thr Thr Ser Arg Gly Glu Pro Val Gln
Ala Val Tyr Gly Phe Ala 35 40 45Lys Ser Leu Leu Lys Ala Leu Lys Glu
Asp Gly Asp Ala Val Ile Val 50 55 60Val Phe Asp Ala Lys Ala Pro Ser
Phe Arg His Glu Ala Tyr Gly Gly65 70 75 80Tyr Lys Ala Gly Arg Ala
Pro Thr Pro Glu Asp Phe Pro Arg Gln Leu 85 90 95Ala Leu Ile Lys Glu
Leu Val Asp Leu Leu Gly Leu Ala Arg Leu Glu 100 105 110Val Pro Gly
Tyr Glu Ala Asp Asp Val Leu Ala Ser Leu Ala Lys Lys 115 120 125Ala
Glu Lys Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp 130 135
140Leu Tyr Gln Leu Leu Ser Asp Arg Ile His Val Leu His Pro Glu
Gly145 150 155 160Tyr Leu Ile Thr Pro Ala Trp Leu Trp Glu Lys Tyr
Gly Leu Arg Pro 165 170 175Asp Gln Trp Ala Asp Tyr Arg Ala Leu Thr
Gly Asp Glu Ser Asp Asn 180 185 190Leu Pro Gly Val Lys Gly Ile Gly
Glu Lys Thr Ala Arg Lys Leu Leu 195 200 205Glu Glu Trp Gly Ser Leu
Glu Ala Leu Leu Lys Asn Leu Asp Arg Leu 210 215 220Lys Pro Ala Ile
Arg Glu Lys Ile Leu Ala His Met Asp Asp Leu Lys225 230 235 240Leu
Ser Trp Asp Leu Ala Lys Val Arg Thr Asp Leu Pro Leu Glu Val 245 250
255Asp Phe Ala Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe
260 265 270Leu Glu Arg Leu Glu Phe Gly Ser Leu Leu His Glu Phe Gly
Leu Leu 275 280 285Glu Ser Pro Lys Ala Leu Glu Glu Ala Pro Trp Pro
Pro Pro Glu Gly 290 295 300Ala Phe Val Gly Phe Val Leu Ser Arg Lys
Glu Pro Met Trp Ala Asp305 310 315 320Leu Leu Ala Leu Ala Ala Ala
Arg Gly Gly Arg Val His Arg Ala Pro 325 330 335Glu Pro Tyr Lys Ala
Leu Arg Asp Leu Lys Glu Ala Arg Gly Leu Leu 340 345 350Ala Lys Asp
Leu Ser Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro 355 360 365Pro
Gly Asp Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn 370 375
380Thr Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr
Glu385 390 395 400Glu Ala Gly Glu Arg Ala Ala Leu Ser Glu Arg Leu
Phe Ala Asn Leu 405 410 415Trp Gly Arg Leu Glu Gly Glu Glu Arg Leu
Leu Trp Leu Tyr Arg Glu 420 425 430Val Glu Arg Pro Leu Ser Ala Val
Leu Ala His Met Glu Ala Thr Gly 435 440 445Val Arg Leu Asp Val Ala
Tyr Leu Arg Ala Leu Ser Leu Glu Val Ala 450 455 460Glu Glu Ile Ala
Arg Leu Glu Ala Glu Val Phe Arg Leu Ala Gly His465 470 475 480Pro
Phe Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp 485 490
495Glu Leu Gly Leu Pro Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg
500 505 510Ser Thr Ser Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His
Pro Ile 515 520 525Val Glu Lys Ile Leu Gln Tyr Arg Glu Leu Thr Lys
Leu Lys Ser Thr 530 535 540Tyr Ile Asp Pro Leu Pro Asp Leu Ile His
Pro Arg Thr Gly Arg Leu545 550 555 560His Thr Arg Phe Asn Gln Thr
Ala Thr Ala Thr Gly Arg Leu Ser Ser 565 570 575Ser Asp Pro Asn Leu
Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln 580 585 590Arg Ile Arg
Arg Ala Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala 595 600 605Leu
Asp Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly 610 615
620Asp Glu Asn Leu Ile Arg Val Phe Gln Glu Gly Arg Asp Ile His
Thr625 630 635 640Glu Thr Ala Ser Trp Met Phe Gly Val Pro Arg Glu
Ala Val Asp Pro 645 650 655Leu Met Arg Arg Ala Ala Lys Thr Ile Asn
Phe Gly Val Leu Tyr Gly 660 665 670Met Ser Ala His Arg Leu Ser Gln
Glu Leu Ala Ile Pro Tyr Glu Glu 675 680 685Ala Gln Ala Phe Ile Glu
Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg 690 695 700Ala Trp Ile Glu
Lys Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr Val705 710 715 720Glu
Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg 725 730
735Val Lys Ser Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro
740 745 750Val Gln Gly Thr Ala Ala Asp Leu Met Lys Leu Ala Met Val
Lys Leu 755 760 765Phe Pro Arg Leu Glu Glu Met Gly Ala Arg Met Leu
Leu Gln Leu Gln 770 775 780Asp Glu Leu Val Leu Glu Ala Pro Lys Glu
Arg Ala Glu Ala Val Ala785 790 795 800Arg Leu Ala Lys Glu Val Met
Glu Gly Val Tyr Pro Leu Ala Val Pro 805 810 815Leu Glu Val Glu Val
Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu 820 825 830Ala
Ala9058PRTArtificial SequenceAMINO ACID SEQUENCE OF RESIDUES
755-812 OF TAQ DNA POLYMERASE 90Gly Thr Ala Ala Asp Leu Met Lys Leu
Ala Met Val Lys Leu Phe Pro1 5 10 15Arg Leu Glu Glu Met Gly Ala Arg
Met Leu Leu Gln Val His Asp Glu 20 25 30Leu Val Leu Glu Ala Pro Lys
Glu Arg Ala Glu Ala Val Ala Arg Leu 35 40 45Ala Lys Glu Val Met Glu
Gly Val Tyr Pro 50 5591829PRTArtificial SequenceAMINO ACID SEQUENCE
OF DNA polymerase I [Thermus igniterrae] 91Met Leu Pro Leu Phe Glu
Pro Lys Gly Arg Val Leu Leu Val Asp Gly1 5 10 15His His Leu Ala Tyr
Arg Thr Phe Phe Ala Leu Lys Gly Leu Thr Thr 20 25 30Ser Arg Gly Glu
Pro Val Gln Ala Val Tyr Gly Phe Ala Lys Ser Leu 35 40 45Leu Lys Ala
Leu Lys Glu Asp Gly Asp Val Val Val Val Val Phe Asp 50 55 60Ala Lys
Ala Pro Ser Phe Arg His Glu Ala Tyr Glu Ala Tyr Lys Ala65 70 75
80Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg Gln Leu Ala Leu Ile
85 90 95Lys Glu Leu Val Asp Leu Leu Gly Leu Val Arg Leu Glu Val Pro
Gly 100 105 110Phe Glu Ala Asp Asp Val Leu Ala Thr Leu Ala Lys Arg
Ala Glu Lys 115 120 125Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp
Arg Asp Leu Tyr Gln 130 135 140Leu Leu Ser Glu Arg Ile Ala Ile Leu
His Pro Glu Gly Tyr Leu Ile145 150 155 160Thr Pro Ala Trp Leu Tyr
Glu Lys Tyr Gly Leu Arg Pro Glu Gln Trp 165 170 175Val Asp Tyr Arg
Ala Leu Ala Gly Asp Pro Ser Asp Asn Ile Pro Gly 180 185 190Val Lys
Gly Ile Gly Glu Lys Thr Ala Gln Arg Leu Ile Arg Glu Trp 195 200
205Gly Ser Leu Glu Asn Leu Phe Gln His Leu Asp Gln Val Lys Pro Ser
210 215 220Leu Arg Glu Lys Leu Gln Ala Gly Met Glu Ala Leu Ala Leu
Ser Arg225 230 235 240Lys Leu Ser Gln Val His Thr Asp Leu Pro Leu
Glu Val Asp Phe Gly 245 250 255Arg Arg Arg Thr Pro Asn Leu Glu Gly
Leu Arg Ala Phe Leu Glu Arg 260 265 270Leu Glu Phe Gly Ser Leu Leu
His Glu Phe Gly Leu Leu Glu Gly Pro 275 280 285Lys Ala Ala Glu Glu
Ala Pro Trp Pro Pro Pro Glu Gly Ala Phe Leu 290 295 300Gly Phe Ser
Phe Ser Arg Pro Glu Pro Met Trp Ala Glu Leu Leu Ala305 310 315
320Leu Ala Gly Ala Trp Glu Gly Arg Leu His Arg Ala Gln Asp Pro Leu
325 330 335Arg Gly Leu Arg Asp Leu Lys Gly Val Arg Gly Ile Leu Ala
Lys Asp 340 345 350Leu Ala Val Leu Ala Leu Arg Glu Gly Leu Asp Leu
Phe Pro Glu Asp 355 360 365Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp
Pro Ser Asn Thr Thr Pro 370 375 380Glu Gly Val Ala Arg Arg Tyr Gly
Gly Glu Trp Thr Glu Asp Ala Gly385 390 395 400Glu Arg Ala Leu Leu
Ala Glu Arg Leu Phe Gln Thr Leu Lys Glu Arg 405 410 415Leu Lys Gly
Glu Glu Arg Leu Leu Trp Leu Tyr Glu Glu Val Glu Lys 420 425 430Pro
Leu Ser Arg Val Leu Ala Arg Met Glu Ala Thr Gly Val Arg Leu 435 440
445Asp Val Ala Tyr Leu Gln Ala Leu Ser Leu Glu Val Glu Ala Glu Val
450 455 460Arg Gln Leu Glu Glu Glu Val Phe Arg Leu Ala Gly His Pro
Phe Asn465 470 475 480Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu
Phe Asp Glu Leu Gly 485 490 495Leu Pro Ala Ile Gly Lys Thr Glu Lys
Thr Gly Lys Arg Ser Thr Ser 500 505 510Ala Ala Val Leu Glu Ala Leu
Arg Glu Ala His Pro Ile Val Asp Arg 515 520 525Ile Leu Gln Tyr Arg
Glu Leu Thr Lys Leu Lys Asn Thr Tyr Ile Asp 530 535 540Pro Leu Pro
Ala Leu Val His Pro Lys Thr Gly Arg Leu His Thr Arg545 550 555
560Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser Ser Asp Pro
565 570
575Asn Leu Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln Arg Ile Arg
580 585 590Arg Ala Phe Val Ala Glu Glu Gly Trp Val Leu Val Val Leu
Asp Tyr 595 600 605Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser
Gly Asp Glu Asn 610 615 620Leu Ile Arg Val Phe Gln Glu Gly Arg Asp
Ile His Thr Gln Thr Ala625 630 635 640Ser Trp Met Phe Gly Val Ser
Pro Glu Gly Val Asp Pro Leu Met Arg 645 650 655Arg Ala Ala Lys Thr
Ile Asn Phe Gly Val Leu Tyr Gly Met Ser Ala 660 665 670His Arg Leu
Ser Gly Glu Leu Ser Ile Pro Tyr Glu Glu Ala Val Ala 675 680 685Phe
Ile Glu Arg Tyr Phe Gln Ser Tyr Pro Lys Val Arg Ala Trp Ile 690 695
700Glu Gly Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr Val Glu Thr
Leu705 710 715 720Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Asn Ala
Arg Val Lys Ser 725 730 735Val Arg Glu Ala Ala Glu Arg Met Ala Phe
Asn Met Pro Val Gln Gly 740 745 750Thr Ala Ala Asp Leu Met Lys Leu
Ala Met Val Arg Leu Phe Pro Arg 755 760 765Leu Gln Glu Leu Gly Ala
Arg Met Leu Leu Gln Val His Asp Glu Leu 770 775 780Val Leu Glu Ala
Pro Lys Asp Arg Ala Glu Arg Val Ala Ala Leu Ala785 790 795 800Lys
Glu Val Met Glu Gly Val Trp Pro Leu Arg Val Pro Leu Glu Val 805 810
815Glu Val Gly Leu Gly Glu Asp Trp Leu Ser Ala Lys Glu 820
82592829PRTArtificial SequenceAMINO ACID SEQUENCE OF DNA polymerase
I [Thermus islandicus] 92Met Leu Pro Leu Phe Ala Pro Lys Gly Arg
Val Leu Leu Val Asp Gly1 5 10 15His His Leu Ala Tyr Arg Thr Phe Phe
Ala Leu Lys Gly Leu Thr Thr 20 25 30Ser Arg Gly Glu Pro Val Gln Ala
Val Tyr Gly Phe Ala Lys Ser Leu 35 40 45Leu Lys Ala Leu Lys Glu Asp
Gly Asp Ala Val Val Val Val Phe Asp 50 55 60Ala Lys Ala Pro Ser Phe
Arg His Glu Ala Tyr Glu Gly Tyr Lys Ala65 70 75 80Gly Arg Ala Pro
Thr Pro Glu Asp Phe Pro Arg Gln Leu Ala Leu Ile 85 90 95Lys Glu Phe
Val Asp Leu Leu Gly Leu Thr Arg Leu Glu Val Pro Gly 100 105 110Tyr
Glu Ala Asp Asp Val Leu Ala Thr Leu Ala Lys Lys Ala Glu Arg 115 120
125Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Arg Asp Leu Tyr Gln
130 135 140Leu Val Ser Asp Arg Ile Ala Ile Leu His Pro Glu Gly Tyr
Leu Ile145 150 155 160Thr Pro Glu Trp Leu Met Glu Arg Tyr Gly Leu
Arg Pro Glu Gln Trp 165 170 175Val Asp Tyr Arg Ala Leu Ala Gly Asp
Pro Ser Asp Asn Ile Pro Gly 180 185 190Val Lys Gly Ile Gly Glu Lys
Arg Ala Ala Gly Leu Ile Arg Glu Trp 195 200 205Gly Ser Leu Glu Asn
Leu Leu Lys His Leu Asp Gln Val Lys Pro Ser 210 215 220Leu Arg Glu
Ala Ile Leu Ala His Met Glu Asp Leu Arg Leu Ser Gln225 230 235
240Asp Leu Ser Arg Val Arg Thr Asp Leu Pro Leu Glu Val Asp Phe Ala
245 250 255Arg Arg Gln Glu Pro Asp Arg Glu Ala Leu Lys Ala Phe Leu
Glu Arg 260 265 270Leu Glu Phe Gly Ser Leu Leu His Glu Phe Gly Leu
Leu Glu Gly Pro 275 280 285Lys Ala Leu Glu Glu Ala Pro Trp Pro Pro
Pro Glu Gly Ala Phe Val 290 295 300Gly Tyr Leu Leu Ser Arg Pro Glu
Pro Met Trp Ala Glu Leu Glu Ala305 310 315 320Leu Ala Ala Ser Lys
Glu Gly Arg Val His Arg Ala Leu Asp Pro Leu 325 330 335Ala Gly Leu
Arg Asp Leu Lys Glu Ile Gln Ala Leu Leu Ala Lys Asp 340 345 350Leu
Ala Val Leu Ala Leu Arg Glu Gly Leu Asp Leu Ser Pro Ser His 355 360
365Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro Ala Asn Thr Thr Pro
370 375 380Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Ala Glu
Ala Gly385 390 395 400Glu Arg Ala Ala Leu Ala Glu Arg Leu Tyr Gly
Arg Leu Arg Glu Arg 405 410 415Leu Glu Gly Glu Glu Lys Leu Leu Trp
Leu Tyr Glu Glu Leu Glu Arg 420 425 430Pro Leu Ser Arg Val Leu Ala
His Met Glu Ala Thr Gly Val Arg Leu 435 440 445Asp Val Pro Tyr Leu
Lys Ala Leu Ser Leu Glu Val Glu Ala Glu Val 450 455 460Arg Arg Val
Glu Glu Glu Ala Phe Arg Leu Ala Gly His Pro Phe Asn465 470 475
480Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp Glu Leu Lys
485 490 495Leu Pro Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser
Thr Ser 500 505 510Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His Pro
Ile Val Gly Lys 515 520 525Ile Leu Glu Tyr Arg Glu Leu Thr Lys Leu
Lys Ser Thr Tyr Ile Asp 530 535 540Pro Leu Pro Gly Leu Val His Pro
Lys Thr Gly Arg Leu His Thr Arg545 550 555 560Phe Asn Gln Thr Ala
Thr Ala Thr Gly Arg Leu Ser Ser Ser Asp Pro 565 570 575Asn Leu Gln
Asn Ile Pro Val Arg Thr Pro Leu Gly Gln Arg Ile Arg 580 585 590Arg
Ala Phe Val Ala Glu Glu Arg Trp Leu Leu Leu Ala Leu Asp Tyr 595 600
605Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly Asp Glu Asn
610 615 620Leu Ile Arg Val Phe Gln Glu Gly Gln Asp Ile His Thr Glu
Thr Ala625 630 635 640Ser Trp Met Phe Ala Val Pro Lys Glu Ala Val
Asp Ser Leu Met Arg 645 650 655Arg Ala Ala Lys Thr Val Asn Phe Gly
Val Leu Tyr Gly Met Ser Ala 660 665 670His Arg Leu Ser Gln Glu Leu
Ser Ile Pro Tyr Glu Glu Ala Ala Ala 675 680 685Phe Ile Glu Arg Tyr
Phe Gln Thr Phe Pro Lys Val Arg Ala Trp Ile 690 695 700Glu Arg Thr
Leu Glu Glu Gly Arg Lys Arg Gly Tyr Val Glu Thr Leu705 710 715
720Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Thr Ala Arg Val Lys Ser
725 730 735Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro Val
Gln Gly 740 745 750Thr Ala Ala Asp Leu Met Lys Leu Ala Met Val Lys
Leu Phe Pro Arg 755 760 765Leu Arg Glu Ala Gly Ala Arg Met Leu Leu
Gln Val His Asp Glu Leu 770 775 780Leu Leu Glu Ala Pro Lys Asp Arg
Ala Glu Glu Val Ala Ala Leu Ala785 790 795 800Lys Glu Val Met Glu
Gly Val Tyr Pro Leu Ala Val Pro Leu Val Val 805 810 815Glu Val Gly
Met Gly Glu Asp Trp Leu Ser Ala Lys Gly 820 82593833PRTArtificial
SequenceAMINO ACID SEQUENCE OF DNA polymerase I, thermostable
[Thermus sp. CCB_US3_UF1] 93Met Leu Pro Leu Phe Ala Pro Lys Gly Arg
Ile Leu Leu Val Asp Gly1 5 10 15His His Leu Ala Tyr Arg Thr Phe Phe
Ala Leu Lys Gly Leu Thr Thr 20 25 30Ser Arg Gly Glu Pro Val Gln Gly
Val Tyr Gly Phe Ala Lys Ala Leu 35 40 45Leu Lys Ala Leu Lys Glu Val
Lys Gly Asp Gly Asp Gly Val Ile Val 50 55 60Val Phe Asp Ala Lys Ala
Pro Ser Phe Arg His Gln Ala Tyr Gly Ala65 70 75 80Tyr Lys Ala Gly
Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg Gln Leu 85 90 95Ser Leu Ile
Lys Glu Leu Val Asp Leu Leu Gly Leu Val Arg Leu Glu 100 105 110Val
Pro Gly Tyr Glu Ala Asp Asp Val Leu Ala Thr Leu Ala Arg Arg 115 120
125Ala Glu Gly Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Arg Asp
130 135 140Leu Tyr Gln Leu Leu Ser Glu Arg Val Ser Ile Leu His Pro
Glu Gly145 150 155 160His Thr Ile Thr Pro Gln Trp Leu Trp Glu Lys
Tyr Gly Leu Arg Pro 165 170 175Glu Gln Trp Val Asp Tyr Arg Ala Leu
Ser Gly Asp Pro Ser Asp Asn 180 185 190Leu Pro Gly Val Lys Gly Ile
Gly Glu Lys Thr Ala Ala Lys Leu Leu 195 200 205Gln Glu Trp Gly Ser
Leu Glu Asn Leu Leu Lys Asn Leu Asp Arg Val 210 215 220Lys Pro Pro
Ser Ile Arg Glu Lys Ile Gln Ala His Leu Glu Asp Leu225 230 235
240Arg Leu Ser Gln Asp Leu Ala Arg Val Arg Thr Asp Leu Pro Leu Glu
245 250 255Val Asp Phe Ala Gly Arg Arg Glu Pro Asp Arg Glu Gly Leu
Arg Ala 260 265 270Phe Leu Glu Arg Leu Glu Phe Gly Ser Leu Leu His
Glu Phe Gly Leu 275 280 285Leu Glu Gly Pro Lys Ala Ala Glu Glu Ala
Pro Trp Pro Pro Pro Pro 290 295 300Gly Ala Phe Val Gly Tyr Val Leu
Ser Arg Pro Glu Pro Met Trp Ala305 310 315 320Asp Leu Leu Ala Leu
Ala Ala Ala Gln Glu Gly Arg Val His Arg Ala 325 330 335Pro Glu Ala
Leu Ala Gly Leu Arg Ala Leu Gly Glu Val Arg Gly Leu 340 345 350Leu
Ala Lys Asp Leu Ala Val Leu Ala Leu Arg Glu Gly Leu Glu Ile 355 360
365Pro Pro Gly Asp Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser
370 375 380Asn Thr Ser Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu
Trp Ala385 390 395 400Glu Glu Ala Gly Glu Arg Ala Leu Leu Ala Glu
Arg Leu Gln Ala Ala 405 410 415Leu Trp Ala Arg Leu Glu Gly Glu Glu
Arg Leu Arg Trp Leu Tyr Glu 420 425 430Glu Val Glu Lys Pro Leu Ser
Arg Val Leu Ala Arg Met Glu Ala Thr 435 440 445Gly Val Arg Leu Asp
Val Ala Tyr Leu Gln Ala Leu Ala Leu Glu Val 450 455 460Glu Gly Glu
Val Arg Arg Leu Glu Glu Glu Val Phe Arg Leu Ala Gly465 470 475
480His Pro Phe Asn Leu Asn Ser Arg Asp Gln Leu Glu Lys Val Leu Phe
485 490 495Asp Glu Leu Gly Leu Pro Ala Ile Gly Lys Thr Glu Lys Thr
Gly Lys 500 505 510Arg Ser Thr Ser Ala Gln Val Leu Glu Leu Leu Arg
Glu Ala His Pro 515 520 525Ile Val Ala Arg Ile Leu Glu Tyr Arg Glu
Leu Thr Lys Leu Lys Ser 530 535 540Thr Tyr Ile Asp Pro Leu Pro Ala
Leu Val His Pro Arg Thr Gly Arg545 550 555 560Leu His Thr Arg Phe
Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser 565 570 575Ser Ser Asp
Pro Asn Leu Gln Asn Ile Pro Val Arg Thr Pro Leu Gly 580 585 590Gln
Arg Ile Arg Arg Ala Phe Val Ala Glu Glu Gly Trp Val Leu Val 595 600
605Ala Leu Asp Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser
610 615 620Gly Asp Glu Asn Leu Ile Arg Val Phe Gln Glu Gly Arg Asp
Ile His625 630 635 640Thr Gln Thr Ala Ser Trp Met Phe Gly Val Pro
Pro Glu Ala Val Asp 645 650 655Pro Leu Met Arg Arg Ala Ala Lys Thr
Ile Asn Phe Gly Val Leu Tyr 660 665 670Gly Met Ser Ala His Arg Leu
Ser Gly Glu Leu Ala Ile Pro Tyr Glu 675 680 685Glu Ala Val Ala Phe
Ile Glu Arg Tyr Phe Gln Ser Tyr Pro Lys Val 690 695 700Arg Ala Trp
Ile Glu Lys Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr705 710 715
720Val Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Asn Ala
725 730 735Arg Val Lys Ser Val Arg Glu Ala Ala Glu Arg Met Ala Phe
Asn Met 740 745 750Pro Val Gln Gly Thr Ala Ala Asp Leu Met Lys Leu
Ala Met Val Arg 755 760 765Leu Phe Pro Leu Leu Pro Gly Val Gly Ala
Arg Met Leu Leu Gln Val 770 775 780His Asp Glu Leu Leu Leu Glu Ala
Pro Lys Glu Arg Ala Glu Glu Val785 790 795 800Ala Arg Leu Ala Arg
Glu Val Met Glu Gly Val Trp Pro Leu Ala Val 805 810 815Pro Leu Glu
Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ala Ala Lys 820 825
830Gly94830PRTArtificial SequenceAMINO ACID SEQUENCE OF DNA
polymerase I [Thermus oshimai] 94Met Leu Pro Leu Phe Glu Pro Lys
Gly Arg Val Leu Leu Val Asp Gly1 5 10 15His His Leu Ala Tyr Arg Thr
Phe Phe Ala Leu Lys Gly Leu Thr Thr 20 25 30Ser Arg Gly Glu Pro Val
Gln Ala Val Tyr Gly Phe Ala Lys Ser Leu 35 40 45Leu Lys Ala Leu Lys
Glu Asp Gly Glu Val Ala Ile Val Val Phe Asp 50 55 60Ala Lys Ala Pro
Ser Phe Arg His Glu Ala Tyr Glu Ala Tyr Lys Ala65 70 75 80Gly Arg
Ala Pro Thr Pro Glu Asp Phe Pro Arg Gln Leu Ala Leu Ile 85 90 95Lys
Glu Leu Val Asp Leu Leu Gly Leu Val Arg Leu Glu Val Pro Gly 100 105
110Phe Glu Ala Asp Asp Val Leu Ala Thr Leu Ala Lys Lys Ala Glu Arg
115 120 125Glu Gly Tyr Glu Val Arg Ile Leu Ser Ala Asp Arg Asp Leu
Tyr Gln 130 135 140Leu Leu Ser Asp Arg Ile His Leu Leu His Pro Glu
Gly Glu Val Leu145 150 155 160Thr Pro Gly Trp Leu Gln Glu Arg Tyr
Gly Leu Ser Pro Glu Arg Trp 165 170 175Val Glu Tyr Arg Ala Leu Val
Gly Asp Pro Ser Asp Asn Leu Pro Gly 180 185 190Val Pro Gly Ile Gly
Glu Lys Thr Ala Leu Lys Leu Leu Lys Glu Trp 195 200 205Gly Ser Leu
Glu Ala Ile Leu Lys Asn Leu Asp Gln Val Lys Pro Glu 210 215 220Arg
Val Arg Glu Ala Ile Arg Asn Asn Leu Asp Lys Leu Gln Met Ser225 230
235 240Leu Glu Leu Ser Arg Leu Arg Thr Asp Leu Pro Leu Glu Val Asp
Phe 245 250 255Ala Lys Arg Arg Glu Pro Asp Trp Glu Gly Leu Lys Ala
Phe Leu Glu 260 265 270Arg Leu Glu Phe Gly Ser Leu Leu His Glu Phe
Gly Leu Leu Glu Ala 275 280 285Pro Lys Glu Ala Glu Glu Ala Pro Trp
Pro Pro Pro Gly Gly Ala Phe 290 295 300Leu Gly Phe Leu Leu Ser Arg
Pro Glu Pro Met Trp Ala Glu Leu Leu305 310 315 320Ala Leu Ala Gly
Ala Lys Glu Gly Arg Val His Arg Ala Glu Asp Pro 325 330 335Val Gly
Ala Leu Lys Asp Leu Lys Glu Ile Arg Gly Leu Leu Ala Lys 340 345
350Asp Leu Ser Val Leu Ala Leu Arg Glu Gly Arg Glu Ile Pro Pro Gly
355 360 365Asp Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro Gly Asn
Thr Asn 370 375 380Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp
Lys Glu Asp Ala385 390 395 400Ala Ala Arg Ala Leu Leu Ser Glu Arg
Leu Trp Gln Ala Leu Tyr Pro 405 410 415Arg Val Ala Glu Glu Glu Arg
Leu Leu Trp Leu Tyr Arg Glu Val Glu 420 425 430Arg Pro Leu Ala Gln
Val Leu Ala His Met Glu Ala Thr Gly Val Arg 435 440 445Leu Asp Val
Pro Tyr Leu Glu Ala Leu Ser Gln Glu Val Ala Phe Glu 450 455 460Leu
Glu Arg Leu Glu Ala Glu Val His Arg Leu Ala Gly His Pro Phe465 470
475 480Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp Glu
Leu 485 490 495Gly Leu Pro Pro Ile Gly Lys Thr Glu Lys Thr Gly Lys
Arg Ser Thr 500 505 510Ser Ala Ala Val Leu Glu Leu Leu Arg Glu Ala
His
Pro Ile Val Gly 515 520 525Arg Ile Leu Glu Tyr Arg Glu Leu Met Lys
Leu Lys Ser Thr Tyr Ile 530 535 540Asp Pro Leu Pro Arg Leu Val His
Pro Lys Thr Gly Arg Leu His Thr545 550 555 560Arg Phe Asn Gln Thr
Ala Thr Ala Thr Gly Arg Leu Ser Ser Ser Asp 565 570 575Pro Asn Leu
Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln Arg Ile 580 585 590Arg
Lys Ala Phe Ile Ala Glu Glu Gly His Leu Leu Val Ala Leu Asp 595 600
605Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly Asp Glu
610 615 620Asn Leu Ile Arg Val Phe Arg Glu Gly Lys Asp Ile His Thr
Glu Thr625 630 635 640Ala Ala Trp Met Phe Gly Val Pro Pro Glu Gly
Val Asp Gly Ala Met 645 650 655Arg Arg Ala Ala Lys Thr Val Asn Phe
Gly Val Leu Tyr Gly Met Ser 660 665 670Ala His Arg Leu Ser Gln Glu
Leu Ser Ile Pro Tyr Glu Glu Ala Ala 675 680 685Ala Phe Ile Glu Arg
Tyr Phe Gln Ser Phe Pro Lys Val Arg Ala Trp 690 695 700Ile Ala Lys
Thr Leu Glu Glu Gly Arg Lys Lys Gly Tyr Val Glu Thr705 710 715
720Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Asn Ala Arg Val Lys
725 730 735Ser Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro
Val Gln 740 745 750Gly Thr Ala Ala Asp Leu Met Lys Leu Ala Met Val
Lys Leu Phe Pro 755 760 765Arg Leu Arg Pro Leu Gly Val Arg Ile Leu
Leu Gln Val His Asp Glu 770 775 780Leu Val Leu Glu Ala Pro Lys Ala
Arg Ala Glu Glu Ala Ala Gln Leu785 790 795 800Ala Lys Glu Thr Met
Glu Gly Val Tyr Pro Leu Ser Val Pro Leu Glu 805 810 815Val Glu Val
Gly Met Gly Glu Asp Trp Leu Ser Ala Lys Ala 820 825
83095831PRTArtificial SequenceAMINO ACID SEQUENCE OF DNA polymerase
I [Thermus sp. RL] 95Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val
Leu Leu Val Asp Gly1 5 10 15His His Leu Ala Tyr Arg Thr Phe Phe Ala
Leu Lys Gly Leu Thr Thr 20 25 30Ser Arg Gly Glu Pro Val Gln Ala Val
Tyr Gly Phe Ala Lys Ser Leu 35 40 45Leu Lys Ala Leu Lys Glu Asp Gly
Tyr Lys Ala Val Phe Val Val Phe 50 55 60Asp Ala Lys Ala Pro Ser Phe
Arg His Glu Ala Tyr Glu Ala Tyr Lys65 70 75 80Ala Gly Arg Ala Pro
Thr Pro Glu Asp Phe Pro Arg Gln Leu Ala Leu 85 90 95Ile Lys Glu Leu
Val Asp Leu Leu Gly Phe Thr Arg Leu Glu Val Gln 100 105 110Gly Tyr
Glu Ala Asp Asp Val Leu Ala Thr Leu Ala Lys Lys Ala Glu 115 120
125Lys Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Arg Asp Leu Tyr
130 135 140Gln Leu Val Ser Asp Arg Val Ala Val Leu His Pro Glu Gly
His Leu145 150 155 160Ile Thr Pro Glu Trp Leu Trp Glu Lys Tyr Gly
Leu Arg Pro Glu Gln 165 170 175Trp Val Asp Phe Arg Ala Leu Val Gly
Asp Pro Ser Asp Asn Leu Pro 180 185 190Gly Val Lys Gly Ile Gly Glu
Lys Thr Ala Leu Lys Leu Leu Lys Glu 195 200 205Trp Gly Ser Leu Glu
Asn Ile Leu Lys Asn Leu Asp Arg Val Lys Pro 210 215 220Glu Ser Val
Arg Glu Arg Ile Lys Ala His Leu Glu Asp Leu Lys Leu225 230 235
240Ser Leu Glu Leu Ser Arg Val Arg Ala Asp Leu Pro Leu Glu Val Asp
245 250 255Phe Ala Arg Arg Arg Glu Pro Asp Arg Glu Gly Leu Arg Ala
Phe Leu 260 265 270Glu Arg Leu Glu Phe Gly Ser Leu Leu His Glu Phe
Gly Leu Leu Glu 275 280 285Ala Pro Ala Pro Leu Glu Glu Ala Pro Trp
Pro Pro Pro Glu Gly Ala 290 295 300Phe Val Gly Phe Val Leu Ser Arg
Pro Glu Pro Met Trp Ala Glu Leu305 310 315 320Lys Ala Leu Ala Ala
Cys Lys Glu Gly Arg Val His Arg Ala Lys Asp 325 330 335Pro Leu Ala
Gly Leu Lys Asp Leu Lys Glu Val Arg Gly Leu Leu Ala 340 345 350Lys
Asp Leu Ala Val Leu Ala Leu Arg Glu Gly Leu Asp Leu Ala Pro 355 360
365Ser Asp Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn Thr
370 375 380Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr
Glu Asp385 390 395 400Ala Ala His Arg Ala Leu Leu Ala Glu Arg Leu
Gln Gln Asn Leu Leu 405 410 415Glu Arg Leu Lys Gly Glu Glu Lys Leu
Leu Trp Leu Tyr Gln Glu Val 420 425 430Glu Lys Pro Leu Ser Arg Val
Leu Ala His Met Glu Ala Thr Gly Val 435 440 445Arg Leu Asp Val Ala
Tyr Leu Lys Ala Leu Ser Leu Glu Leu Ala Glu 450 455 460Glu Ile Arg
Arg Leu Glu Glu Glu Val Phe Arg Leu Ala Gly His Pro465 470 475
480Phe Asn Leu Asn Ser Arg Asp Gln Leu Glu Lys Val Leu Phe Asp Glu
485 490 495Leu Arg Leu Pro Ala Leu Gly Lys Thr Gln Lys Thr Gly Lys
Arg Ser 500 505 510Thr Ser Ala Ala Val Leu Glu Ala Leu Arg Glu Ala
His Pro Ile Val 515 520 525Glu Lys Ile Leu Gln His Arg Glu Leu Thr
Lys Leu Lys Asn Thr Tyr 530 535 540Val Asp Pro Leu Pro Gly Leu Val
His Pro Arg Thr Gly Arg Leu His545 550 555 560Thr Arg Phe Asn Gln
Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser Ser 565 570 575Asp Pro Asn
Leu Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln Arg 580 585 590Ile
Arg Arg Ala Phe Val Ala Glu Ala Gly Trp Ala Leu Val Ala Leu 595 600
605Asp Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly Asp
610 615 620Glu Asn Leu Ile Arg Val Phe Gln Glu Gly Lys Asp Ile His
Thr Gln625 630 635 640Thr Ala Ser Trp Met Phe Gly Val Pro Pro Glu
Ala Val Asp Pro Leu 645 650 655Met Arg Arg Ala Ala Lys Thr Val Asn
Phe Gly Val Leu Tyr Gly Met 660 665 670Ser Ala His Arg Leu Ser Gln
Glu Leu Ser Ile Pro Tyr Glu Glu Ala 675 680 685Val Ala Phe Ile Asp
Arg Tyr Phe Lys Ser Phe Pro Lys Val Lys Ala 690 695 700Trp Ile Glu
Arg Thr Leu Glu Glu Gly Arg Gln Arg Gly Tyr Val Glu705 710 715
720Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Asn Ala Arg Val
725 730 735Lys Ser Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met
Pro Val 740 745 750Gln Gly Thr Ala Ala Asp Leu Met Lys Leu Ala Met
Val Lys Leu Phe 755 760 765Pro Arg Leu Arg Glu Met Gly Ala Arg Met
Leu Leu Gln Val His Asp 770 775 780Glu Leu Leu Leu Glu Ala Pro Gln
Ala Arg Ala Glu Glu Val Ala Ala785 790 795 800Leu Ala Lys Glu Ala
Met Glu Lys Ala Tyr Pro Leu Ala Val Pro Leu 805 810 815Glu Val Glu
Val Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Gly 820 825
83096831PRTArtificial SequenceAMINO ACID SEQUENCE OF DNA polymerase
I [Thermus thermophilus SG0.5JP17-16] 96Met Leu Pro Leu Phe Glu Pro
Lys Gly Arg Val Leu Leu Val Asp Gly1 5 10 15His His Leu Ala Tyr Arg
Thr Phe Phe Ala Leu Lys Gly Leu Thr Thr 20 25 30Ser Arg Gly Glu Pro
Val Gln Ala Val Tyr Gly Phe Ala Lys Ser Leu 35 40 45Leu Lys Ala Leu
Lys Glu Asp Gly Tyr Lys Ala Val Phe Val Val Phe 50 55 60Asp Ala Lys
Ala Pro Ser Phe Arg His Glu Ala Tyr Glu Ala Tyr Lys65 70 75 80Ala
Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg Gln Leu Ala Leu 85 90
95Ile Lys Glu Leu Val Asp Leu Leu Gly Phe Thr Arg Leu Glu Val Gln
100 105 110Gly Tyr Glu Ala Asp Asp Val Leu Ala Thr Leu Ala Lys Lys
Ala Glu 115 120 125Lys Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp
Arg Asp Leu Tyr 130 135 140Gln Leu Val Ser Asp Arg Val Ala Val Leu
His Pro Glu Gly His Leu145 150 155 160Ile Thr Pro Glu Trp Leu Trp
Glu Lys Tyr Gly Leu Arg Pro Glu Gln 165 170 175Trp Val Asp Phe Arg
Ala Leu Val Gly Asp Pro Ser Asp Asn Leu Pro 180 185 190Gly Val Lys
Gly Ile Gly Glu Lys Thr Ala Leu Lys Leu Leu Lys Glu 195 200 205Trp
Gly Ser Leu Glu Asn Leu Leu Lys Asn Leu Asp Arg Val Lys Pro 210 215
220Glu Asn Val Arg Glu Lys Ile Lys Ala His Leu Glu Asp Leu Arg
Leu225 230 235 240Ser Met Glu Leu Ser Arg Val Arg Thr Asp Leu Pro
Leu Glu Val Asp 245 250 255Leu Ala Gln Gly Arg Glu Pro Asp Arg Glu
Gly Leu Arg Ala Phe Leu 260 265 270Glu Arg Leu Glu Phe Gly Ser Leu
Leu His Glu Phe Gly Leu Leu Glu 275 280 285Ala Pro Ala Pro Leu Glu
Glu Ala Pro Trp Pro Pro Pro Glu Gly Ala 290 295 300Phe Val Gly Phe
Val Leu Ser Arg Pro Glu Pro Met Trp Ala Glu Leu305 310 315 320Lys
Ala Leu Ala Ala Cys Arg Asp Gly Arg Val His Arg Ala Ala Asp 325 330
335Pro Leu Ala Gly Leu Lys Asp Leu Lys Glu Val Arg Gly Leu Leu Ala
340 345 350Lys Asp Leu Ala Val Leu Ala Ser Arg Glu Gly Leu Asp Leu
Val Pro 355 360 365Gly Asp Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp
Pro Ser Asn Thr 370 375 380Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly
Gly Glu Trp Thr Glu Asp385 390 395 400Ala Ala His Arg Ala Leu Leu
Ser Glu Arg Leu His Arg Asn Leu Leu 405 410 415Lys Arg Leu Glu Gly
Glu Glu Lys Leu Leu Trp Leu Tyr His Glu Val 420 425 430Glu Lys Pro
Leu Ser Arg Val Leu Ala His Met Glu Ala Thr Gly Val 435 440 445Arg
Leu Asp Val Ala Tyr Leu Lys Ala Leu Ser Leu Glu Leu Ala Glu 450 455
460Glu Ile Arg Arg Leu Glu Glu Glu Val Phe Arg Leu Ala Gly His
Pro465 470 475 480Phe Asn Leu Asn Ser Arg Asp Gln Leu Glu Lys Val
Leu Phe Asp Glu 485 490 495Leu Arg Leu Pro Ala Leu Gly Lys Thr Gln
Lys Thr Gly Lys Arg Ser 500 505 510Thr Ser Ala Ala Val Leu Glu Ala
Leu Arg Glu Ala His Pro Ile Val 515 520 525Glu Lys Ile Leu Gln His
Arg Glu Leu Thr Lys Leu Lys Asn Thr Tyr 530 535 540Val Asp Pro Leu
Pro Gly Leu Val His Pro Arg Thr Gly Arg Leu His545 550 555 560Thr
Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser Ser 565 570
575Asp Pro Asn Leu Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln Arg
580 585 590Ile Arg Arg Ala Phe Val Ala Glu Ala Gly Trp Ala Leu Val
Ala Leu 595 600 605Asp Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His
Leu Ser Gly Asp 610 615 620Glu Asn Leu Ile Arg Val Phe Gln Glu Gly
Lys Asp Ile His Thr Gln625 630 635 640Thr Ala Ser Trp Met Phe Gly
Val Pro Pro Glu Ala Val Asp Pro Leu 645 650 655Met Arg Arg Ala Ala
Lys Thr Val Asn Phe Gly Val Leu Tyr Gly Met 660 665 670Ser Ala His
Arg Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu Ala 675 680 685Ser
Ala Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg Ala 690 695
700Trp Ile Glu Lys Thr Leu Glu Glu Gly Arg Lys Arg Gly Tyr Val
Glu705 710 715 720Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu
Asn Ala Arg Val 725 730 735Lys Ser Val Arg Glu Ala Ala Glu Arg Met
Ala Phe Asn Met Pro Val 740 745 750Gln Gly Thr Ala Ala Asp Leu Met
Lys Leu Ala Met Val Lys Leu Phe 755 760 765Pro Arg Leu Arg Glu Met
Gly Ala Arg Met Leu Leu Gln Val His Asp 770 775 780Glu Leu Leu Leu
Glu Ala Pro Gln Ala Arg Ala Glu Glu Val Ala Ala785 790 795 800Leu
Ala Lys Glu Ala Met Glu Lys Ala Tyr Pro Leu Ala Val Pro Leu 805 810
815Glu Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Gly 820
825 83097830PRTArtificial SequenceAMINO ACID SEQUENCE OF DNA
polymerase I [Thermus scotoductus] 97Met Leu Pro Leu Phe Glu Pro
Lys Gly Arg Val Leu Leu Val Asp Gly1 5 10 15His His Leu Ala Tyr Arg
Thr Phe Phe Ala Leu Lys Gly Leu Thr Thr 20 25 30Ser Arg Gly Glu Pro
Val Gln Ala Val Tyr Gly Phe Ala Lys Ser Leu 35 40 45Leu Lys Ala Leu
Arg Glu Asp Gly Asp Val Val Ile Val Val Phe Asp 50 55 60Ala Lys Ala
Pro Ser Phe Arg His Gln Thr Tyr Glu Ala Tyr Lys Ala65 70 75 80Gly
Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg Gln Leu Ala Leu Ile 85 90
95Lys Glu Met Val Asp Leu Leu Gly Leu Glu Arg Leu Glu Val Pro Gly
100 105 110Phe Glu Ala Asp Asp Val Leu Ala Thr Leu Ala Lys Lys Ala
Glu Lys 115 120 125Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Arg
Asp Leu Tyr Gln 130 135 140Leu Leu Ser Glu Arg Ile Ser Ile Leu His
Pro Glu Gly Tyr Leu Ile145 150 155 160Thr Pro Glu Trp Leu Trp Glu
Lys Tyr Gly Leu Lys Pro Ser Gln Trp 165 170 175Val Asp Tyr Arg Ala
Leu Ala Gly Asp Pro Ser Asp Asn Ile Pro Gly 180 185 190Val Lys Gly
Ile Gly Glu Lys Thr Ala Ala Lys Leu Ile Arg Glu Trp 195 200 205Gly
Ser Leu Glu Asn Leu Leu Lys His Leu Glu Gln Val Lys Pro Ala 210 215
220Ser Val Arg Glu Lys Ile Leu Ser His Met Glu Asp Leu Lys Leu
Ser225 230 235 240Leu Glu Leu Ser Arg Val His Thr Asp Leu Leu Leu
Gln Val Asp Phe 245 250 255Ala Arg Arg Arg Glu Pro Asp Arg Glu Gly
Leu Lys Ala Phe Leu Glu 260 265 270Arg Leu Glu Phe Gly Ser Leu Leu
His Glu Phe Gly Leu Leu Glu Ser 275 280 285Pro Val Ala Ala Glu Glu
Ala Pro Trp Pro Pro Pro Glu Gly Ala Phe 290 295 300Val Gly Tyr Val
Leu Ser Arg Pro Glu Pro Met Trp Ala Glu Leu Asn305 310 315 320Ala
Leu Ala Ala Ala Trp Glu Gly Arg Val Tyr Arg Ala Glu Asp Pro 325 330
335Leu Glu Ala Leu Arg Gly Leu Gly Glu Val Arg Gly Leu Leu Ala Lys
340 345 350Asp Leu Ala Val Leu Ala Leu Arg Glu Gly Ile Ala Leu Ala
Pro Gly 355 360 365Asp Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro
Ser Asn Thr Ala 370 375 380Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly
Glu Trp Thr Glu Glu Ala385 390 395 400Gly Glu Arg Ala Leu Leu Ser
Glu Arg Leu Tyr Ala Ala Leu Leu Glu 405 410 415Arg Leu Lys Gly Glu
Glu Arg Leu Leu Trp Leu Tyr Glu Glu Val Glu 420 425 430Lys Pro Leu
Ser Arg Val Leu Ala His Met Glu Ala Thr Gly Val Arg 435 440 445Leu
Asp Val Ala Tyr Leu Lys Ala Leu Ser Leu Glu Val Glu Ala Glu 450
455 460Leu Arg Arg Leu Glu Glu Glu Val His Arg Leu Ala Gly His Pro
Phe465 470 475 480Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu
Phe Asp Glu Leu 485 490 495Gly Leu Pro Ala Ile Gly Lys Thr Glu Lys
Thr Gly Lys Arg Ser Thr 500 505 510Ser Ala Ala Val Leu Glu Ala Leu
Arg Glu Ala His Pro Ile Val Asp 515 520 525Arg Ile Leu Gln Tyr Arg
Glu Leu Ser Lys Leu Lys Gly Thr Tyr Ile 530 535 540Asp Pro Leu Pro
Ala Leu Val His Pro Lys Thr Asn Arg Leu His Thr545 550 555 560Arg
Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser Ser Asp 565 570
575Pro Asn Leu Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln Arg Ile
580 585 590Arg Arg Ala Phe Val Ala Glu Glu Gly Trp Arg Leu Val Val
Leu Asp 595 600 605Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu
Ser Gly Asp Glu 610 615 620Asn Leu Ile Arg Val Phe Gln Glu Gly Gln
Asp Ile His Thr Gln Thr625 630 635 640Ala Ser Trp Met Phe Gly Val
Pro Pro Glu Ala Val Asp Ser Leu Met 645 650 655Arg Arg Ala Ala Lys
Thr Ile Asn Phe Gly Val Leu Tyr Gly Met Ser 660 665 670Ala His Arg
Leu Ser Gly Glu Leu Ala Ile Pro Tyr Glu Glu Ala Val 675 680 685Ala
Phe Ile Glu Arg Tyr Phe Gln Ser Tyr Pro Lys Val Arg Ala Trp 690 695
700Ile Glu Lys Thr Leu Ala Glu Gly Arg Glu Arg Gly Tyr Val Glu
Thr705 710 715 720Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Ala
Ser Arg Val Lys 725 730 735Ser Ile Arg Glu Ala Ala Glu Arg Met Ala
Phe Asn Met Pro Val Gln 740 745 750Gly Thr Ala Ala Asp Leu Met Lys
Leu Ala Met Val Lys Leu Phe Pro 755 760 765Arg Leu Gln Glu Leu Gly
Ala Arg Met Leu Leu Gln Val His Asp Glu 770 775 780Leu Val Leu Glu
Ala Pro Lys Glu Gln Ala Glu Glu Val Ala Gln Glu785 790 795 800Ala
Lys Arg Thr Met Glu Glu Val Trp Pro Leu Lys Val Pro Leu Glu 805 810
815Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Ala 820 825
83098834PRTArtificial SequenceAMINO ACID SEQUENCE OF Thermostable
DNA Polymerase [Thermus caldophilus] 98Met Glu Ala Met Leu Pro Leu
Phe Glu Pro Lys Gly Arg Val Leu Leu1 5 10 15Val Asp Gly His His Leu
Ala Tyr Arg Thr Phe Phe Ala Leu Lys Gly 20 25 30Leu Thr Thr Ser Arg
Gly Glu Pro Val Gln Ala Val Tyr Gly Phe Ala 35 40 45Lys Ser Leu Leu
Lys Ala Leu Lys Glu Asp Gly Tyr Lys Ala Val Phe 50 55 60Val Val Phe
Asp Ala Lys Ala Pro Ser Phe Arg His Glu Ala Tyr Glu65 70 75 80Ala
Tyr Lys Ala Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg Gln 85 90
95Leu Ala Leu Ile Lys Glu Leu Val Asp Leu Leu Gly Phe Thr Arg Leu
100 105 110Glu Val Pro Gly Tyr Glu Ala Asp Asp Val Leu Ala Thr Leu
Ala Lys 115 120 125Asn Pro Glu Lys Glu Gly Tyr Glu Val Arg Ile Leu
Thr Ala Asp Arg 130 135 140Asp Leu Asp Gln Leu Val Ser Asp Arg Val
Ala Val Leu His Pro Glu145 150 155 160Gly His Leu Ile Thr Pro Glu
Trp Leu Trp Gln Lys Tyr Gly Leu Lys 165 170 175Pro Glu Gln Trp Val
Asp Phe Arg Ala Leu Val Gly Asp Pro Ser Asp 180 185 190Asn Leu Pro
Gly Val Lys Gly Ile Gly Glu Lys Thr Ala Leu Lys Leu 195 200 205Leu
Lys Glu Trp Gly Ser Leu Glu Asn Leu Leu Lys Asn Leu Asp Arg 210 215
220Val Lys Pro Glu Asn Val Arg Glu Lys Ile Lys Ala His Leu Glu
Asp225 230 235 240Leu Arg Leu Ser Leu Glu Leu Ser Arg Val Arg Thr
Asp Leu Pro Leu 245 250 255Glu Val Asp Leu Ala Gln Gly Arg Glu Pro
Asp Arg Glu Gly Leu Arg 260 265 270Ala Phe Leu Glu Arg Leu Glu Phe
Gly Ser Leu Leu His Glu Phe Gly 275 280 285Leu Leu Glu Ala Pro Ala
Pro Leu Glu Glu Ala Pro Trp Pro Pro Pro 290 295 300Glu Gly Ala Phe
Val Gly Phe Val Leu Ser Arg Pro Glu Pro Met Trp305 310 315 320Ala
Glu Leu Lys Ala Leu Ala Ala Cys Arg Asp Gly Arg Val His Arg 325 330
335Ala Ala Asp Pro Leu Ala Gly Leu Lys Asp Leu Lys Glu Val Arg Gly
340 345 350Leu Leu Ala Lys Asp Leu Ala Val Leu Ala Ser Arg Glu Gly
Leu Asp 355 360 365Leu Val Pro Gly Asp Asp Pro Met Leu Leu Ala Tyr
Leu Leu Asp Pro 370 375 380Ser Asn Thr Thr Pro Glu Gly Val Ala Arg
Arg Tyr Gly Gly Glu Trp385 390 395 400Thr Glu Asp Ala Ala His Arg
Ala Leu Leu Ser Glu Arg Leu His Arg 405 410 415Asn Leu Leu Lys Arg
Leu Gln Gly Glu Glu Lys Leu Leu Trp Leu Tyr 420 425 430His Glu Val
Glu Lys Pro Leu Ser Arg Val Leu Ala His Met Glu Ala 435 440 445Thr
Gly Val Arg Leu Asp Val Ala Tyr Leu Gln Ala Leu Ser Leu Glu 450 455
460Leu Ala Glu Glu Ile Arg Arg Leu Glu Glu Glu Val Phe Arg Leu
Ala465 470 475 480Gly His Pro Phe Asn Leu Asn Ser Arg Asp Gln Leu
Glu Arg Val Leu 485 490 495Phe Asp Glu Leu Arg Leu Pro Ala Leu Gly
Lys Thr Gln Lys Thr Gly 500 505 510Lys Arg Ser Thr Ser Ala Ala Val
Leu Glu Ala Leu Arg Glu Ala His 515 520 525Pro Ile Val Glu Lys Ile
Leu Gln His Arg Glu Leu Thr Lys Leu Lys 530 535 540Asn Thr Tyr Val
Asp Pro Leu Pro Ser Leu Val His Pro Asn Thr Gly545 550 555 560Arg
Leu His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu 565 570
575Ser Ser Ser Asp Pro Asn Leu Gln Asn Ile Pro Val Arg Thr Pro Leu
580 585 590Gly Gln Arg Ile Arg Arg Ala Phe Val Ala Glu Ala Gly Trp
Ala Leu 595 600 605Val Ala Leu Asp Tyr Ser Gln Ile Glu Leu Arg Val
Leu Ala His Leu 610 615 620Ser Gly Asp Glu Asn Leu Ile Arg Val Phe
Gln Glu Gly Lys Asp Ile625 630 635 640His Thr Gln Thr Ala Ser Trp
Met Phe Gly Val Pro Pro Glu Ala Val 645 650 655Asp Pro Leu Met Arg
Arg Ala Ala Lys Thr Val Asn Phe Gly Val Leu 660 665 670Tyr Gly Met
Ser Ala His Arg Leu Ser Gln Glu Leu Ala Ile Pro Tyr 675 680 685Glu
Glu Ala Val Ala Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys 690 695
700Val Arg Ala Trp Ile Glu Lys Thr Leu Glu Glu Gly Arg Lys Arg
Gly705 710 715 720Tyr Val Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val
Pro Asp Leu Asn 725 730 735Ala Arg Val Lys Ser Val Arg Glu Ala Ala
Glu Arg Met Ala Phe Asn 740 745 750Met Pro Val Gln Gly Thr Ala Ala
Asp Leu Met Lys Leu Ala Met Val 755 760 765Lys Leu Phe Pro Arg Leu
Arg Glu Met Gly Ala Arg Met Leu Leu Gln 770 775 780Val His Asp Glu
Leu Leu Leu Glu Ala Pro Gln Ala Gly Ala Glu Glu785 790 795 800Val
Ala Ala Leu Ala Lys Glu Ala Met Glu Lys Ala Tyr Pro Leu Ala 805 810
815Val Pro Leu Glu Val Glu Val Gly Met Gly Glu Asp Trp Leu Ser Ala
820 825 830Lys Gly99834PRTArtificial SequenceAMINO ACID SEQUENCE OF
DNA polymerase I [Marinithermus hydrothermalis DSM 14884] 99Met Gln
Gln Pro Ser Leu Phe Asp His Arg Pro Glu Arg Ile Leu Ile1 5 10 15Val
Asp Gly His His Leu Ala Tyr Arg Asn Tyr Phe Ala Leu Gly Glu 20 25
30Leu Thr Thr Ser Arg Gly Glu Pro Val Gln Ala Val Tyr Gly Phe Ala
35 40 45Arg Thr Leu Leu Lys Leu Leu Lys Glu Asp Gly Asp Cys Val Ile
Val 50 55 60Val Phe Asp Ala Pro Gln Pro Ser Phe Arg His Glu Gln Phe
Ala Ala65 70 75 80Tyr Lys Ala Gln Arg Ala Pro Thr Pro Glu Asp Phe
Lys Pro Gln Leu 85 90 95Glu Lys Ile Lys Gln Leu Val Asp Leu Leu Gly
Leu Ala Arg Phe Glu 100 105 110Leu Ala Gly Tyr Glu Ala Asp Asp Val
Ile Gly Ser Leu Ala Lys Lys 115 120 125Ala Glu Ala Glu Gly Tyr Glu
Val Arg Ile Val Thr Ser Asp Arg Asp 130 135 140Ser Tyr Gln Leu Leu
Ser Asp Lys Val Arg Val Leu Lys Pro Asp Gly145 150 155 160Glu Glu
Val Thr Pro Glu Thr Val Arg Glu Lys Tyr Gly Val Thr Val 165 170
175Ala Gln Trp Val Asp Phe Arg Ala Leu Thr Gly Asp Ala Ser Asp Asn
180 185 190Ile Pro Gly Val Arg Gly Ile Gly Ala Lys Thr Ala Ala Lys
Leu Leu 195 200 205Ala Glu Trp Gly Ser Leu Glu Asn Leu Tyr Ala His
Leu Ala Glu Val 210 215 220Thr Pro Pro Ser Val Arg Lys Lys Leu Glu
Ala Gly Arg Glu Lys Ala225 230 235 240Ala Leu Ser Arg Ala Leu Ser
Glu Ile His Thr Asp Leu Ala Ile Glu 245 250 255Val Asp Phe Ala Ala
Cys His Arg Arg Pro Val Asp Arg Glu Ala Leu 260 265 270Arg Ala Phe
Leu Glu Ala Leu Glu Phe Gly Ser Ile Leu Arg Glu Leu 275 280 285Gly
Leu Ile Glu Ala Arg Ser Ala Glu Glu Ala Pro Trp Pro Pro Pro 290 295
300Pro Glu Ala Phe Leu Gly Tyr Val Leu Asp Arg Pro Gln Pro Met
Trp305 310 315 320Ala Glu Leu Lys Gly Leu Ala Gly Ala Trp Glu Gly
Arg Val Ala Arg 325 330 335Gly Pro Ala Arg Ala Lys Glu Leu Ala Arg
Phe Glu Ala Val His Ala 340 345 350Leu Gln Ala Lys Asp Leu Thr Val
Trp Ala Arg Arg Glu Gly Val Arg 355 360 365Val Gln Pro Gly Glu Asp
Pro Leu Leu Leu Ala Tyr Leu Tyr Asp Pro 370 375 380Thr Asn Ser Asp
Pro Ala Ala Thr Val Arg Arg Tyr Gly Ala Gly Asp385 390 395 400Trp
Ser Glu Asp Pro Ala Ala Arg Ala Leu Ala Ala Ala Glu Leu Trp 405 410
415Arg Ile Leu Gly Glu Arg Leu Ala Gly Glu Glu Ala Leu Trp Trp Leu
420 425 430Tyr Arg Glu Val Glu Arg Pro Leu Ala Gly Val Leu Ala Glu
Met Glu 435 440 445His Ala Gly Val Arg Val Asp Val Ala Tyr Leu Glu
Ala Leu Ser Ala 450 455 460Glu Leu Gly Arg Glu Ile Ala Ala Ile Glu
Ala Glu Val His Arg Leu465 470 475 480Ala Gly Arg Ala Phe Asn Leu
Asn Ser Arg Asp Gln Leu Glu Val Ile 485 490 495Leu Tyr Asp Glu Leu
Gly Leu Thr Pro Thr Arg Arg Thr Gln Lys Thr 500 505 510Gly Arg Arg
Ser Thr Ser Ala Ala Ala Leu Glu Ala Leu Val Gly Ala 515 520 525His
Pro Ile Val Glu Arg Ile Leu Ala Tyr Arg Glu Leu Ser Lys Leu 530 535
540Lys Gly Thr Tyr Leu Asp Pro Leu Pro Arg Leu Val His Pro Ala
Thr545 550 555 560Gly Arg Ile His Thr Arg Tyr His Gln Thr Gly Thr
Ala Thr Gly Arg 565 570 575Leu Ser Ser Ser Asp Pro Asn Leu Gln Asn
Ile Pro Val Arg Thr Glu 580 585 590Val Gly Arg Arg Ile Arg Arg Ala
Phe Val Ala Glu Pro Gly Tyr Val 595 600 605Leu Val Ala Ala Asp Tyr
Ser Gln Ile Glu Leu Arg Val Leu Ala His 610 615 620Leu Ser Gly Asp
Glu Asn Leu Lys Arg Val Phe Gln Glu Arg Arg Asp625 630 635 640Ile
His Thr Gln Thr Ala Ser Trp Met Phe Gly Val Pro Pro Glu Ala 645 650
655Val Asp Pro Phe Arg Arg Arg Ala Ala Lys Thr Val Asn Phe Gly Val
660 665 670Leu Tyr Gly Met Ser Pro His Arg Leu Ser Arg Glu Leu Gly
Ile Glu 675 680 685Tyr Ala Glu Ala Glu Arg Phe Ile Gln Arg Tyr Phe
Glu Ser Tyr Pro 690 695 700Arg Val Gln Ala Tyr Ile Glu Arg Thr Leu
Glu Gln Ala Arg Glu Lys705 710 715 720Gly Tyr Val Glu Thr Leu Phe
Gly Arg Arg Arg Tyr Ile Pro Asp Ile 725 730 735Arg Ser Arg Asn Arg
Asn Val Arg Glu Ala Ala Glu Arg Met Ala Phe 740 745 750Asn Met Pro
Val Gln Gly Thr Ala Ala Asp Leu Met Lys Leu Ala Met 755 760 765Val
Lys Leu Ala Pro Glu Ile Arg Ser Leu Gly Ala Arg Leu Ile Leu 770 775
780Gln Val His Asp Glu Leu Val Leu Glu Ala Pro Gln Glu Arg Ala
Glu785 790 795 800Ala Val Ala Arg Val Val Arg Glu Val Met Glu Gly
Ala Trp Ala Leu 805 810 815Asp Val Pro Leu Glu Val Glu Val Gly Ile
Gly Glu Asn Trp Leu Glu 820 825 830Ala Lys100833PRTArtificial
SequenceAMINO ACID SEQUENCE OF DNA polymerase I [Thermus
filiformis] 100Met Thr Pro Leu Phe Asp Leu Glu Glu Pro Pro Lys Arg
Val Leu Leu1 5 10 15Val Asp Gly His His Leu Ala Tyr Arg Thr Phe Tyr
Ala Leu Ser Leu 20 25 30Thr Thr Ser Arg Gly Glu Pro Val Gln Met Val
Tyr Gly Phe Ala Arg 35 40 45Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly
Gln Ala Val Val Val Val 50 55 60Phe Asp Ala Lys Ala Pro Ser Phe Arg
His Glu Ala Tyr Glu Ala Tyr65 70 75 80Lys Ala Gly Arg Ala Pro Thr
Pro Glu Asp Phe Pro Arg Gln Leu Ala 85 90 95Leu Val Lys Arg Leu Val
Asp Leu Leu Gly Leu Val Arg Leu Glu Ala 100 105 110Pro Gly Tyr Glu
Ala Asp Asp Val Leu Gly Thr Leu Ala Lys Lys Ala 115 120 125Glu Arg
Glu Gly Met Glu Val Arg Ile Leu Thr Gly Asp Arg Asp Phe 130 135
140Phe Gln Leu Leu Ser Glu Lys Val Ser Val Leu Leu Pro Asp Gly
Thr145 150 155 160Leu Val Thr Pro Lys Asp Val Gln Glu Lys Tyr Gly
Val Pro Pro Glu 165 170 175Arg Trp Val Asp Phe Arg Ala Leu Thr Gly
Asp Arg Ser Asp Asn Ile 180 185 190Pro Gly Val Ala Gly Ile Gly Glu
Lys Thr Ala Leu Arg Leu Leu Ala 195 200 205Glu Trp Gly Ser Val Glu
Asn Leu Leu Lys Asn Leu Asp Arg Val Lys 210 215 220Pro Asp Ser Val
Arg Arg Lys Ile Glu Ala His Leu Glu Asp Leu Arg225 230 235 240Leu
Ser Leu Asp Leu Ala Arg Ile Arg Thr Asp Leu Pro Leu Glu Val 245 250
255Asp Phe Lys Ala Leu Arg Arg Arg Thr Pro Asp Leu Glu Gly Leu Arg
260 265 270Ala Phe Leu Glu Glu Leu Glu Phe Gly Ser Leu Leu His Glu
Phe Gly 275 280 285Leu Leu Gly Gly Glu Lys Pro Arg Glu Glu Ala Pro
Trp Pro Pro Pro 290 295 300Glu Gly Ala Phe Val Gly Phe Leu Leu Ser
Arg Lys Glu Pro Met Trp305 310 315 320Ala Glu Leu Leu Ala Leu Ala
Ala Ala Ala Glu Gly Arg Val His Arg 325 330 335Ala Thr Ser Pro Val
Glu Ala Leu Ala Asp Leu Lys Glu Ala Arg Gly 340 345 350Phe Leu Ala
Lys Asp Leu Ala Val Leu Ala Leu Arg Glu Gly Val Ala 355 360 365Leu
Asp Pro Thr Asp Asp Pro Leu Leu Val Ala Tyr Leu Leu Asp Pro 370 375
380Ala Asn Thr Asn Pro Glu Gly Val Ala Arg Arg Tyr
Gly Gly Glu Phe385 390 395 400Thr Glu Asp Ala Ala Glu Arg Ala Leu
Leu Ser Glu Arg Leu Phe Gln 405 410 415Asn Leu Phe Pro Arg Leu Ser
Glu Lys Leu Leu Trp Leu Tyr Gln Glu 420 425 430Val Glu Arg Pro Leu
Ser Arg Val Leu Ala His Met Glu Ala Arg Gly 435 440 445Val Arg Leu
Asp Val Pro Leu Leu Glu Ala Leu Ser Phe Glu Leu Glu 450 455 460Lys
Glu Met Glu Arg Leu Glu Gly Glu Val Phe Arg Leu Ala Gly His465 470
475 480Pro Phe Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe
Asp 485 490 495Glu Leu Gly Leu Thr Pro Val Gly Arg Thr Glu Lys Thr
Gly Lys Arg 500 505 510Ser Thr Ala Gln Gly Ala Leu Glu Ala Leu Arg
Gly Ala His Pro Ile 515 520 525Val Glu Leu Ile Leu Gln Tyr Arg Glu
Leu Ser Lys Leu Lys Ser Thr 530 535 540Tyr Leu Asp Pro Leu Pro Arg
Leu Val His Pro Arg Thr Gly Arg Leu545 550 555 560His Thr Arg Phe
Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser 565 570 575Ser Asp
Pro Asn Leu Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln 580 585
590Arg Ile Arg Lys Ala Phe Val Ala Glu Glu Gly Trp Leu Leu Leu Ala
595 600 605Ala Asp Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu
Ser Gly 610 615 620Asp Glu Asn Leu Lys Arg Val Phe Arg Glu Gly Lys
Asp Ile His Thr625 630 635 640Glu Thr Ala Ala Trp Met Phe Gly Leu
Asp Pro Ala Leu Val Asp Pro 645 650 655Lys Met Arg Arg Ala Ala Lys
Thr Val Asn Phe Gly Val Leu Tyr Gly 660 665 670Met Ser Ala His Arg
Leu Ser Gln Glu Leu Gly Ile Asp Tyr Lys Glu 675 680 685Ala Glu Ala
Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg 690 695 700Ala
Trp Ile Glu Arg Thr Leu Glu Glu Gly Arg Thr Arg Gly Tyr Val705 710
715 720Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Ala Ser
Arg 725 730 735Val Arg Ser Val Arg Glu Ala Ala Glu Arg Met Ala Phe
Asn Met Pro 740 745 750Val Gln Gly Thr Ala Ala Asp Leu Met Lys Ile
Ala Met Val Lys Leu 755 760 765Phe Pro Arg Leu Lys Pro Leu Gly Ala
His Leu Leu Leu Gln Val His 770 775 780Asp Glu Leu Val Leu Glu Val
Pro Glu Asp Arg Ala Glu Glu Ala Lys785 790 795 800Ala Leu Val Lys
Glu Val Met Glu Asn Thr Tyr Pro Leu Asp Val Pro 805 810 815Leu Glu
Val Glu Val Gly Val Gly Arg Asp Trp Leu Glu Ala Lys Gly 820 825
830Asp101850PRTArtificial SequenceAMINO ACID SEQUENCE OF DNA
polymerase I [Meiothermus timidus] 101Met Gln Gln Arg Ser Leu Phe
Asp Pro Glu Pro Glu Thr Gln Pro Lys1 5 10 15Pro Ala Pro Ala Pro Arg
Ala Glu Arg Val Ile Leu Ile Asp Gly His 20 25 30His Leu Ala Tyr Arg
Thr Tyr Phe Ala Phe Glu Lys Leu Thr Thr Ser 35 40 45Thr Gly Glu Pro
Val Gln Ala Ile Phe Gly Phe Leu Arg Thr Leu Leu 50 55 60Lys Tyr Leu
Lys Glu Asn Ser Ser Cys Val Ile Val Val Phe Asp Ala65 70 75 80Pro
Ala Arg Thr Phe Arg His Asp Asn Phe Glu Ala Tyr Lys Ala Gly 85 90
95Arg Ala Pro Thr Pro Glu Asp Leu Pro Glu Gln Ile Arg Lys Ile Lys
100 105 110Gln Leu Val Glu Leu Leu Gly Leu Val Cys Leu Glu Val Pro
Gly Tyr 115 120 125Glu Ala Asp Asp Val Ile Gly Thr Leu Ala Lys Lys
Ala Glu Ala Glu 130 135 140Gly Tyr Gln Val Arg Ile Leu Thr Gly Asp
Arg Asp Ala Tyr Gln Leu145 150 155 160Leu Ser Glu Asn Ile Trp Ile
Phe His Pro Asp Gly Ser Ile Ile Gly 165 170 175Pro Ser Gln Val Arg
Glu Lys Tyr Gly Val Ser Val Glu Gln Trp Val 180 185 190Asp Tyr Arg
Ala Leu Thr Gly Asp Ala Ser Asp Asn Ile Pro Gly Ala 195 200 205Lys
Gly Ile Gly Pro Lys Gly Ala Ser Lys Leu Leu Glu Glu Trp Lys 210 215
220Ser Leu Asp Asn Leu Leu Thr His Leu Glu Glu Val Arg Pro Glu
Arg225 230 235 240Thr Arg Glu Leu Ile Arg Ala Ser Leu Glu Asp Ile
Lys Leu Ser Arg 245 250 255Glu Leu Ser Gln Ile His Thr Asp Val Pro
Leu Glu Pro Glu Leu Cys 260 265 270Asp Phe Ser Lys Ala His Arg Arg
Glu Pro Lys Thr Ala Glu Leu Arg 275 280 285Glu Met Leu Glu Arg Leu
Glu Phe Gly Ser Ile Leu Arg Asp Leu Gly 290 295 300Leu Leu Glu Ala
His Arg Pro Thr Thr Glu Ala Pro Trp Pro Pro Pro305 310 315 320Pro
Gly Ala Phe Leu Gly Phe Thr Leu Asp Arg Ala Gln Pro Met Trp 325 330
335Ala Glu Leu Thr Gly Leu Ala Ala Ala Lys Gly Asp Thr Leu Tyr Arg
340 345 350Gly Pro Thr Asp Leu Ala Asp Leu Lys Thr Leu Gly Arg Leu
Asn Ser 355 360 365Leu Glu Ala Lys Asp Leu Ser Val Leu Leu Leu Arg
Glu Gly Tyr Trp 370 375 380Val Pro Pro Gly Asp Asp Pro Met Leu Leu
Ala Tyr Leu Tyr Asp Pro385 390 395 400Ala Asn Ser Glu Pro Ala Gly
Thr Val Arg Arg Tyr Gly Ala Gly Asp 405 410 415Trp Thr Thr Asp Pro
Ala Gln Arg Ala Leu Ala Ala Gln Thr Leu Trp 420 425 430Glu Thr Leu
Gly Arg Arg Thr Glu Lys Asp Glu Arg Leu Trp Trp Leu 435 440 445Tyr
Arg Glu Val Glu Gln Pro Leu Ser Gly Ile Leu Ala Arg Met Glu 450 455
460Val Gln Gly Val Ala Leu Asp Val Pro Tyr Leu Arg Glu Leu Ser
Glu465 470 475 480Glu Leu Gly Lys Glu Leu Gly Tyr Leu Glu Ala Glu
Ile His Arg Leu 485 490 495Ala Gly Arg Pro Phe Asn Val Asn Ser Arg
Asp Gln Leu Glu Ala Ile 500 505 510Leu Tyr Asp Glu Leu Lys Leu Gln
Ala Gly Gly Lys Lys Thr Ala Thr 515 520 525Gly Lys Arg Ser Thr Ala
Ala Ser Val Leu Glu Glu Met Arg Ser Leu 530 535 540His Pro Ile Val
Asp Lys Ile Leu Asp Tyr Arg Glu Leu Ser Lys Leu545 550 555 560Lys
Ser Thr Tyr Leu Asp Pro Leu Pro Lys Leu Ile His Pro Lys Thr 565 570
575Gly Arg Leu His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg
580 585 590Leu Ser Ser Ser Asp Pro Asn Leu Gln Asn Ile Pro Val Arg
Thr Glu 595 600 605Val Gly Arg Lys Ile Arg Lys Ala Phe Val Ala Arg
Pro Gly Tyr Cys 610 615 620Leu Val Ala Ala Asp Tyr Ser Gln Ile Glu
Leu Arg Leu Leu Ala His625 630 635 640Leu Ser Gly Asp Glu Asn Leu
Lys Gln Val Phe Leu Glu Gly Arg Asp 645 650 655Ile His Thr Gln Thr
Ala Ala Trp Met Phe Gly Ile Ala Pro Glu Thr 660 665 670Val Asp Ser
Tyr Arg Arg Arg Ala Ala Lys Thr Val Val Phe Gly Val 675 680 685Leu
Tyr Gly Met Ser Ala His Arg Leu Ser Ser Glu Leu Ser Ile Pro 690 695
700Tyr Ala Glu Ala Glu Gly Phe Ile Glu Arg Tyr Phe Ala Thr Tyr
Pro705 710 715 720Lys Val Arg Ser Trp Ile Asp Arg Thr Leu Ala Glu
Ala Arg Glu Arg 725 730 735Gly Tyr Val Glu Thr Leu Phe Gly Arg Lys
Arg Phe Val Ser Glu Leu 740 745 750Ser Ala Lys Val Ser Ser Val Arg
Gln Ala Ala Glu Arg Met Ala Phe 755 760 765Asn Met Pro Val Gln Gly
Thr Ala Ala Asp Leu Met Lys Leu Ala Met 770 775 780Val Lys Leu Gly
Pro Lys Leu Glu Pro Leu Asp Ala His Leu Val Leu785 790 795 800Gln
Val His Asp Glu Leu Val Ile Glu Ala Pro Arg Glu Arg Ala Glu 805 810
815Glu Val Ala Glu Leu Ala Arg Glu Thr Met Arg Thr Ala Trp Glu Phe
820 825 830Glu Val Pro Leu Glu Val Gly Thr Gly Val Gly Glu Asn Trp
Leu Glu 835 840 845Ala Lys 850102838PRTArtificial SequenceAMINO
ACID SEQUENCE OF DNA polymerase I [Desulfurobacterium
thermolithotrophum] 102Met Ser Lys Lys Thr Ile Tyr Leu Phe Asp Gly
Thr Ser Leu Ala Tyr1 5 10 15Arg Ala Tyr Tyr Ala Ile Lys Asp Leu Thr
Thr Ser Lys Gly Phe Pro 20 25 30Thr Asn Ala Ile Tyr Gly Phe Ile Arg
Met Phe Leu Lys Leu Tyr Lys 35 40 45Asp Phe Lys Pro Asn Tyr Ile Ala
Val Ala Phe Asp Val Gly Lys Lys 50 55 60Thr Phe Arg Ser Lys Leu Leu
Lys Glu Tyr Lys Ala Asn Arg Lys Pro65 70 75 80Thr Pro Asp Ser Phe
Lys Leu Gln Leu Pro Tyr Ile Lys Lys Phe Leu 85 90 95Glu Cys Leu Gly
Ile Thr Ile Leu Glu Lys Glu Gly Phe Glu Ala Asp 100 105 110Asp Ile
Leu Gly Thr Ala Ala Lys Lys Phe Ala Ser Glu Gly Tyr Arg 115 120
125Val Phe Val Val Thr Pro Asp Lys Asp Met Arg Gln Leu Ile Asp Gly
130 135 140Lys Ile Ser Val Ile Ala Ile Asn Lys Thr Gly Gln Lys Glu
Ile Tyr145 150 155 160Asp Leu Val Ser Phe Lys Glu Lys Tyr Gly Ile
Glu Pro Glu Gln Ile 165 170 175Pro Asp Phe Phe Gly Leu Val Gly Asp
Ser Val Asp Asn Ile Pro Gly 180 185 190Val Pro Ser Ile Gly Glu Lys
Thr Ala Gln Lys Leu Ile Ala Glu Phe 195 200 205Gly Asn Leu Glu Asn
Leu Tyr Lys Asn Leu Ser Lys Leu Thr Ser Lys 210 215 220Arg Arg Glu
Val Leu Glu Lys Phe Lys Glu Gln Ala Phe Leu Ser Arg225 230 235
240Glu Leu Ala Lys Ile Lys Lys Asn Val Pro Ile Glu Ile Ser Leu Glu
245 250 255Asn Leu Lys Val Lys Glu Pro Gln Gly Lys Cys Leu Gly Glu
Phe Leu 260 265 270Lys Glu Leu Glu Met Arg Ser Ile Val Ser Glu Leu
Lys Lys Leu Phe 275 280 285Pro Ser Ile Asp Phe Gly Glu Phe Asp Lys
Phe Lys Lys Ser Lys Lys 290 295 300Leu Ser Lys Glu Glu Phe Lys Arg
Lys Ile Gln Pro Ala Asp Leu Phe305 310 315 320Ser Thr Pro Glu Val
Ala Val Ile His Asp Phe Glu Arg Val Ile Ala 325 330 335Ile Asn Glu
Gly Tyr Val Glu Val Asp Phe Lys Glu Ile Glu Glu Phe 340 345 350Leu
Pro Glu Lys Gly Lys Ile Tyr Thr Phe Asp Leu Lys Ser Leu Tyr 355 360
365His Lys Val Gly Glu Lys Leu Arg Asn Phe Ser Phe Ile Asp Leu Ser
370 375 380Val Cys Glu Tyr Leu Leu Asn Pro Leu Gln Lys Asp Tyr Ser
Ser Lys385 390 395 400Asp Ile Leu Lys Lys Arg Leu Gly Val Val Ser
Leu Glu Glu Val Lys 405 410 415Asp Tyr Val His Tyr Thr Leu Asp Ile
Gly Lys Glu Ile Leu Asn Glu 420 425 430Leu Lys Lys Glu Gly Leu Glu
Asn Leu Tyr Glu Ser Ile Glu His Pro 435 440 445Leu Thr Phe Val Leu
Tyr Lys Met Glu Lys Arg Gly Val Leu Phe Asp 450 455 460Lys Glu Tyr
Leu Glu Asn Phe Gly Lys Glu Leu Asp Arg Lys Ser Lys465 470 475
480Glu Ile Glu Lys Lys Ile Phe Glu Ile Ala Gly Glu Lys Phe Asn Leu
485 490 495Asn Ser Pro Lys Gln Leu Ser Lys Ile Leu Phe Glu Lys Leu
Lys Leu 500 505 510Lys Pro Leu Lys Lys Thr Lys Ser Gly Tyr Ser Thr
Asp Val Glu Thr 515 520 525Leu Thr Ala Leu Ala Leu Lys Gly His Lys
Ile Ala Glu Leu Leu Leu 530 535 540Glu Tyr Arg Lys Leu Thr Lys Leu
Asn Ser Thr Phe Val Lys Gly Ile545 550 555 560Leu Lys His Met Asp
Glu Asp Gly Arg Val Arg Thr Thr Phe Ile Gln 565 570 575Thr Gly Thr
Ala Thr Gly Arg Leu Ser Ser Ala Glu Pro Asn Leu Gln 580 585 590Asn
Leu Pro Val Ser Asp Glu Ile Ser Lys Lys Ile Arg Tyr Ala Val 595 600
605Thr Ala Pro Ala Gly Tyr Asn Leu Val Trp Ala Asp Tyr Ser Gln Ile
610 615 620Glu Leu Arg Ile Leu Ala His Leu Ser Gln Asp Glu Lys Leu
Leu Glu625 630 635 640Ala Tyr Arg Lys Gly Arg Asp Ile His Thr Glu
Thr Ala Ser Tyr Leu 645 650 655Phe Gly Ile Ser Ala Glu Glu Val Asp
Glu Arg Leu Arg Arg Ile Ala 660 665 670Lys Thr Val Asn Phe Gly Ile
Ile Tyr Gly Met Ser Pro His Gly Leu 675 680 685Ser Glu Arg Leu Gly
Ile Ser Val Glu Glu Ala Glu Lys Tyr Ile Asp 690 695 700Arg Tyr Phe
Glu Lys Phe Pro Lys Val Lys Glu Tyr Ile Glu Asn Thr705 710 715
720Leu Arg Glu Ala Tyr Glu Lys Gly Tyr Val Lys Thr Ile Phe Gly Arg
725 730 735Lys Arg Pro Leu Pro Glu Leu Lys Ser Ser Asn Lys Asn Ile
Arg Ser 740 745 750Phe Gly Glu Arg Ala Ala Val Asn Ala Thr Ile Gln
Gly Thr Ala Ala 755 760 765Asp Ile Met Lys Leu Ala Met Val Lys Leu
Tyr Lys Lys Leu Glu Lys 770 775 780Leu Gly Ala Tyr Met Val Leu Gln
Val His Asp Glu Ile Val Ile Glu785 790 795 800Ala Leu Glu Glu Lys
Thr Glu Glu Ile Met Lys Ile Val Lys Glu Thr 805 810 815Met Glu Asn
Val Val Glu Phe Ser Val Pro Leu Thr Val Asp Val Lys 820 825 830Val
Gly Lys His Trp Ser 835103955PRTArtificial SequenceAMINO ACID
SEQUENCE OF DNA polymerase I [Caldilinea aerophila DSM 14535 = NBRC
104270] 103Met Pro Gly Arg Val Val Ser Ala Ser Ile Val Ala Pro Pro
Arg Asn1 5 10 15Gly Ala Ser Thr Met Ala Leu Leu Leu Leu Ile Asp Gly
His Ser Gln 20 25 30Ala Tyr Arg Ala Tyr Phe Gly Ile Lys Thr Pro Leu
Ser Thr Arg Ala 35 40 45Gly Glu Pro Thr Ser Ala Val Tyr Gly Phe Thr
Arg Lys Leu Leu Ala 50 55 60Ala Leu Arg Asp Tyr His Pro Asp Cys Ile
Ala Val Ala Phe Asp Ala65 70 75 80Gly Asp Thr Trp Arg His Ala Glu
Phe Pro Asp Tyr Lys Ala Thr Arg 85 90 95Asp Val Met Pro Asp Asp Met
Arg Thr Gln Met Glu Arg Ile Glu Ser 100 105 110Leu Leu Arg Ala Phe
Asn Ile Pro Ile Ile Thr Tyr Pro Asn Phe Glu 115 120 125Ala Asp Asp
Val Leu Gly Thr Leu Ala Arg Lys Ala Ala Ala Gln Gly 130 135 140His
Asp Val Leu Val Met Thr Gly Asp Arg Asp Met Phe Gln Leu Val145 150
155 160Asp Glu Arg Val Lys Ile Leu Tyr Thr Ser Gly Gly Pro Asn Pro
Val 165 170 175Thr Ser Val Tyr Gly Ile Glu Gln Ile Gln Glu Arg Tyr
Gly Leu Thr 180 185 190Pro Gln Gln Phe Ile Asp Phe Lys Ala Leu Thr
Gly Asp Ser Ser Asp 195 200 205Asn Ile Pro Gly Val Pro Gly Val Gly
Glu Lys Thr Ala Ile Lys Leu 210 215 220Leu Gln Gln Tyr Gly Ser Ile
Glu Gly Ile Tyr Glu His Leu Asp Glu225 230 235 240Ile Gly Gly Pro
Lys Leu Arg Gln Ala Leu Ser Asp Ala Arg Glu Gln 245 250 255Val Met
Arg Asn Arg Arg Leu Val Thr Ile His Thr Asp Leu Asp Ile 260 265
270Ser Phe Asp Leu Ala Gln Cys Ala Val His Asp Tyr Asn Pro Asp Ala
275 280 285Val Leu Glu Leu Phe Asn Glu Leu Glu Phe Arg Ser Leu Leu
Lys Glu 290
295 300Leu Pro Ala Ser Thr Arg Asn Ala Ala Glu Ala Leu Ala Thr Glu
Pro305 310 315 320Gln Gln Ala Gly Gln Met Thr Leu Phe Ser Ala Ala
Pro Thr Pro Leu 325 330 335Thr Ser Leu Thr Ile Asp Gly Glu Arg Thr
Val Leu Ile Val Gln Asp 340 345 350Arg Thr Thr Leu Ala Gln Leu Val
Glu Ser Leu Arg Ala Ala Glu Arg 355 360 365Leu Ser Phe Asp Val Glu
Thr Thr Ala Thr Asp Ala Met Gln Ala Ala 370 375 380Leu Val Gly Leu
Gly Ile Ala Trp Ala Pro Gly Gln Thr Ala Tyr Ile385 390 395 400Pro
Val Thr His Thr Ile Gly Glu Gln Leu Asp Trp Ser His Ala Met 405 410
415Glu Ala Ile Arg Pro Phe Phe Ala Asp Ala Ala Leu Pro Lys Val Ala
420 425 430His Asn Ala Lys Tyr Asp Leu Ile Val Leu Arg Arg His Gly
Leu Asp 435 440 445Val Met Gly Val Leu Asp Asp Thr Leu Leu Met Ala
Trp Leu Leu Asp 450 455 460Pro Ala Ser Arg Ser Leu Gly Leu Lys Ala
Leu Ala Glu Thr Glu Leu465 470 475 480Gly Trp Lys Met Thr Glu Leu
Ser Glu Leu Ile Gly Ser Gly Arg Lys 485 490 495Gln Ile Thr Ile Asp
Gln Val Pro Leu Glu Gln Ala Ala Ala Tyr Cys 500 505 510Gly Ala Asp
Val Asp Ala Thr Ile Arg Leu Tyr Ala Thr Leu Glu Pro 515 520 525Arg
Leu Arg Glu Ala Gly Leu Glu Glu Leu Tyr Arg Thr Ile Glu Arg 530 535
540Pro Leu Leu Pro Val Leu Thr Ala Met Glu Met Ala Gly Val Leu
Leu545 550 555 560Asp Val Glu Phe Leu Lys Gln Met Ser Ala Glu Leu
Ser Lys Arg Leu 565 570 575Tyr Glu Leu Glu Gln Ser Leu Tyr Glu Val
Val Gly His Ala Phe Asn 580 585 590Leu Arg Ser Thr Gln Gln Leu Ser
Gln Val Leu Phe Asp Glu Met Gly 595 600 605Phe Pro Ser Lys Gly Leu
Lys Lys Thr Ala Ser Gly His Tyr Ser Thr 610 615 620Ala Ala Asp Val
Leu Glu Thr Leu Ala Ala Tyr Gly Asp Val Leu Ser625 630 635 640Pro
Thr Gln Gln Arg Leu Ile Glu Leu Ile Leu Glu His Arg Gln Leu 645 650
655Glu Lys Leu Arg Ser Thr Tyr Val Asp Ala Leu Pro Ala Leu Val Asn
660 665 670Pro Gln Thr Gly Arg Val His Thr Ser Phe Ser Gln Thr Gly
Ala Val 675 680 685Thr Gly Arg Leu Ser Ser Ser Asn Pro Asn Leu Gln
Asn Ile Pro Ile 690 695 700Arg Thr Glu Ile Gly Arg Glu Ile Arg Arg
Ala Ile Val Ala Pro Pro705 710 715 720Gly Trp Gln Leu Ile Ser Ala
Asp Tyr Ser Gln Val Glu Leu Arg Val 725 730 735Leu Ala His Met Ala
Asn Glu Pro Leu Leu Ile Glu Ala Phe Gln Ala 740 745 750Asp Gln Asp
Ile His Ala Val Thr Ala Ser Lys Leu Phe Gly Val Pro 755 760 765Val
Glu Ala Val Thr Arg Asp Gln Arg Ser Leu Gly Lys Thr Ile Asn 770 775
780Phe Ala Thr Ile Tyr Gly Val Ser Glu Phe Gly Leu Ser Ser Arg
Thr785 790 795 800Glu Leu Thr Arg Glu Gln Ala Arg Gln Phe Leu Glu
Gln Tyr Phe Gln 805 810 815Thr Tyr Pro Arg Ile Arg Ala Phe Leu Asp
His Ile Leu Glu Glu Ala 820 825 830Arg Glu Lys Gly Tyr Val Gln Thr
Leu Leu Gly Arg Lys Arg Phe Phe 835 840 845Pro Glu Leu Lys Ser Gly
Lys Leu Pro Pro Asn Gln Arg Ala Ala Val 850 855 860Glu Arg Ala Ala
Ile Asn Ala Pro Ile Gln Gly Thr Ala Ala Asp Ile865 870 875 880Met
Lys Ile Ala Met Ile Arg Leu Tyr Glu Arg Leu Gln Asn Asp Gly 885 890
895Tyr Arg Thr Arg Leu Leu Ile Gln Val His Asp Glu Leu Val Leu Glu
900 905 910Ala Pro Pro Glu Glu Leu Glu Ser Ala Thr His Leu Val Arg
Glu Thr 915 920 925Met Ala Asn Ala Tyr Gln Leu Thr Val Pro Leu Lys
Val Asp Val Glu 930 935 940Ile Gly Pro Asn Trp Arg Asp Met Thr Lys
Ala945 950 955104829PRTArtificial SequenceAMINO ACID SEQUENCE OF
DNA polymerase I [[Eubacterium] siraeum] 104Met Gly Phe Leu Ile Ile
Asp Gly Asn Ser Ile Leu Asn Arg Ala Phe1 5 10 15Tyr Gly Ile Arg Val
Leu Thr Asn Ser Arg Gly Val Ala Thr Asn Ala 20 25 30Val Thr Gly Phe
Met Asn Thr Leu Leu Met Leu Glu Lys Asp Val Asp 35 40 45Pro Asp Met
Ile Ala Val Ala Phe Asp Leu Lys Ala Pro Thr Phe Arg 50 55 60His Lys
Met Tyr Asp Gly Tyr Lys Ala Asn Arg Lys Gly Met Pro Glu65 70 75
80Asp Leu Ala Gln Gln Leu Pro Tyr Met Lys Lys Ile Ile Thr Ala Met
85 90 95Gly Ile Thr Ile Ile Glu Lys Glu Gly Phe Glu Ala Asp Asp Ile
Ile 100 105 110Gly Thr Val Ser Ala Ala Cys Ala Asp Lys Lys Ile Pro
Cys Thr Val 115 120 125Ser Thr Gly Asp Arg Asp Ser Phe Gln Leu Val
Asn Asp Tyr Val Thr 130 135 140Val Arg Leu Ala Lys Thr Lys Gly Asp
Ile Tyr Tyr Thr Pro Asp Val145 150 155 160Ile Met Glu Glu Tyr Gly
Val Thr Pro Lys Gln Met Ile Glu Val Lys 165 170 175Ala Leu Met Gly
Asp Ser Ser Asp Asn Ile Pro Gly Val Pro Gly Ile 180 185 190Gly Glu
Lys Thr Ala Leu Ser Leu Ile Lys Glu Phe Ala Ser Val Asp 195 200
205Gly Val Tyr Glu Asn Ile Gly Ser Thr Leu Ile Thr Lys Gly Val Arg
210 215 220Thr Lys Leu Glu Asn Gly Lys Glu Ser Cys Tyr Met Ser Arg
Gln Leu225 230 235 240Ala Glu Ile Cys Leu Thr Ala Pro Ile Asp Thr
Glu Leu Ser His Tyr 245 250 255Val Pro Lys Glu Arg Asp Asp Thr Glu
Leu Ala Arg Leu Leu Ser Glu 260 265 270Leu Glu Met Tyr Lys Met Leu
Gln Lys Leu Lys Leu His Pro Thr Ser 275 280 285Ala Pro Ala Gly Ser
Lys Glu Ala Leu Glu Glu Ser Ala Ala Lys Gln 290 295 300Ile Pro Ala
Met Pro Ala Gly Asp Ile Val Leu Thr Gln Glu Gly Ser305 310 315
320Val Tyr Ala Gly Thr Val Gly Ala Pro Val Glu Leu Ser Asp Gly Glu
325 330 335Leu Lys Ala Tyr Ala Asp Ser Asp Ser Thr Lys Tyr Thr Phe
Asp Ile 340 345 350Lys Glu Thr Leu Thr Val Thr Gly Cys Glu Arg Leu
Lys Asn Asn Arg 355 360 365Phe Asp Thr Thr Leu Ala Ala Tyr Leu Ala
Asp Pro Asp Ser Asn Asp 370 375 380Tyr Ser Leu Ser Arg Leu Cys Ala
Gln Tyr Gly Val Pro Glu Gly Asn385 390 395 400Ser Ile Gln Glu Lys
Ser Ile Thr Val Ala Ala Leu Asn Asp Ile Leu 405 410 415Asn Cys Lys
Ile Ser Glu Thr Gly Ser Ala Ala Val Leu Thr Asp Ile 420 425 430Glu
Ile Pro Leu Ala Thr Val Leu Val Ala Met Glu Arg Glu Gly Val 435 440
445Ser Ile Asp Ala Asp Gly Ile Lys Ala Phe Gly Lys Glu Val Cys Glu
450 455 460Lys Ala Glu Lys Ile Ser Arg Glu Ile Tyr Glu Tyr Ala Gly
Tyr Glu465 470 475 480Phe Asn Ile Gly Ser Pro Lys Gln Leu Gly Ser
Val Leu Phe Glu Lys 485 490 495Leu Ala Leu Pro Ser Ala Lys Lys Thr
Lys Thr Gly Tyr Ser Thr Asn 500 505 510Ala Asp Val Leu Glu Ser Leu
Met Asp Lys His Pro Ile Val Pro Leu 515 520 525Ile Thr Glu Tyr Arg
Ala Leu Thr Lys Leu Gln Asn Thr Tyr Val Thr 530 535 540Gly Leu Leu
Lys Val Val Gly Glu Asp Gly Arg Ile His Ser Thr Phe545 550 555
560Lys Gln Thr Glu Thr Arg Thr Gly Arg Ile Ser Ser Ala Glu Pro Asn
565 570 575Ile Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Arg Glu Met
Arg Arg 580 585 590Phe Phe Thr Ala Lys Asp Gly Tyr Leu Leu Val Asp
Ala Asp Tyr Ser 595 600 605Gln Ile Glu Leu Arg Val Leu Ala His Ile
Ser Gly Asp Glu Ile Met 610 615 620Lys Lys Ala Phe Leu Asp Gly Val
Asp Ile His Thr Val Thr Ala Ser625 630 635 640Gln Val Phe Asn Gln
Pro Ile Glu Trp Val Thr Pro Asp Leu Arg Ser 645 650 655Lys Ala Lys
Ala Val Asn Phe Gly Ile Val Tyr Gly Ile Gly Ala Phe 660 665 670Ser
Leu Ser Lys Asp Ile Gly Val Ser Val Pro Lys Ala Ser Glu Tyr 675 680
685Ile Arg Ser Tyr Leu Ser Lys Tyr Ser Gly Ile Ala His Tyr Met Glu
690 695 700Gln Thr Val Ala Lys Ala Lys Arg Asp Gly Tyr Val Glu Thr
Met Phe705 710 715 720Gly Arg Arg Arg Tyr Ile Lys Glu Leu Ala Ala
Lys Asn Lys Asn Leu 725 730 735Gln Ala Phe Gly Glu Arg Val Ala Lys
Asn Thr Pro Ile Gln Gly Thr 740 745 750Ala Ala Asp Ile Ile Lys Ile
Ala Met Ile Lys Val Tyr Asn Arg Leu 755 760 765Glu Glu Ser Gly Leu
Asp Ala Arg Leu Ile Leu Gln Val His Asp Glu 770 775 780Leu Ile Val
Glu Ala Lys Glu Asp Cys Ala Glu Lys Val Ala Leu Leu785 790 795
800Leu Lys Glu Glu Met Glu Asn Ala Val Lys Leu Thr Val Pro Met Thr
805 810 815Val Asp Val Asn Ile Gly Lys Thr Trp Tyr Asp Thr His 820
825105399PRTArtificial SequenceAMINO ACID SEQUENCE OF DNA
polymerase [Clostridium leptum CAG27] 105Met Glu Ile Pro Leu Ala
Gln Val Leu Ala Arg Met Glu Asn Ile Gly1 5 10 15Phe Leu Val Asp Gly
Glu Ser Ile Arg Val Tyr Gly Glu Arg Leu Glu 20 25 30Thr Glu Ile Glu
Ala Leu Gln Lys Gln Ile Tyr Glu Glu Val Gly Tyr 35 40 45Glu Phe Asn
Ile Asn Ser Pro Lys Gln Leu Gly Asp Ala Leu Phe Val 50 55 60Lys Leu
Gly Leu Pro Ser Gly Lys Lys Thr Lys Thr Gly Tyr Ser Thr65 70 75
80Asn Ala Glu Ile Leu Glu Lys Leu Arg Tyr Asp His Pro Ala Val Glu
85 90 95Leu Val Leu His Tyr Arg Thr Leu Thr Lys Leu Lys Ser Thr Tyr
Cys 100 105 110Glu Gly Met Leu Lys Val Ile Gly Pro Asp Gly Arg Ile
His Ser Asn 115 120 125Phe Asn Gln Thr Glu Thr Arg Thr Gly Arg Ile
Ser Ser Thr Glu Pro 130 135 140Asn Leu Gln Asn Ile Pro Val Arg Thr
Glu Leu Gly Arg Glu Leu Arg145 150 155 160Lys Phe Phe Leu Ala Lys
Glu Gly Trp Val Leu Val Asp Ala Asp Tyr 165 170 175Ser Gln Ile Glu
Leu Arg Val Leu Ala His Ile Ala His Asp Glu Asn 180 185 190Met Ile
Lys Ala Phe Gln Asp Lys Glu Asp Ile His Thr Ile Thr Ala 195 200
205Ser Gln Val Phe Gly Met Pro Pro Glu Met Val Thr Pro Leu Met Arg
210 215 220Ser Arg Ala Lys Ala Val Asn Phe Gly Ile Val Tyr Gly Ile
Gly Ala225 230 235 240Phe Ser Leu Ser Lys Asp Ile Asn Val Ser Arg
Lys Glu Ala Gln Arg 245 250 255Tyr Ile Asp Asp Tyr Leu Thr Leu Tyr
Ser Gly Val Asp Arg Tyr Met 260 265 270Lys Glu Val Val Glu Lys Ala
Lys Glu Asp Gly Tyr Val Glu Thr Leu 275 280 285Phe His Arg Arg Arg
Tyr Leu Pro Glu Leu Thr Ala Ser Asn Phe Asn 290 295 300Leu Arg Ala
Phe Gly Glu Arg Val Ala Arg Asn Met Pro Ile Gln Gly305 310 315
320Thr Ala Ala Asp Ile Ile Lys Ile Ala Met Val Arg Val Asp Arg Arg
325 330 335Leu Lys Arg Glu Asn Met Arg Ala Arg Leu Ile Leu Gln Val
His Asp 340 345 350Glu Leu Ile Val Glu Ala Pro Glu Asp Glu Ala Glu
Gln Ala Ala Arg 355 360 365Ile Leu Thr Glu Glu Met Glu Gly Ala Val
Ser Leu Thr Val Pro Met 370 375 380Val Ala Glu Ala Ser Val Gly Lys
Thr Trp Tyr Asp Ala Lys Gly385 390 395106881PRTArtificial
SequenceAMINO ACID SEQUENCE OF DNA polymerase I [Enterococcus
faecium] 106Met Thr Lys Asn Lys Leu Leu Leu Val Asp Gly Asn Ser Val
Ala Phe1 5 10 15Arg Ala Phe Phe Ala Leu His Asn Ser Leu Glu Arg Phe
Lys Asn Arg 20 25 30Asn Gly Leu His Thr Asn Ala Ile Tyr Ala Phe Asn
Thr Met Phe Glu 35 40 45Asn Val Met Gln Lys Glu Gln Pro Thr His Val
Leu Val Ala Phe Asp 50 55 60Ala Gly Lys Thr Thr Phe Arg Thr Glu Met
Tyr Ala Glu Tyr Lys Gly65 70 75 80Gly Arg Ser Lys Thr Pro Gly Glu
Phe Lys Glu Gln Met Pro Tyr Ile 85 90 95Arg Asp Leu Leu Thr Gly Leu
Gly Val Gln Tyr Tyr Glu Leu Pro Asn 100 105 110Tyr Glu Ala Asp Asp
Ile Ile Gly Thr Leu Ala Glu Lys Val Asp Lys 115 120 125Asp Gln Phe
Asp Val Val Val Leu Ser Gly Asp Arg Asp Leu Thr Gln 130 135 140Leu
Ala Ser Lys Glu Val Lys Val Asp Ile Thr Val Lys Gly Val Ser145 150
155 160Asp Ile Glu Ser Tyr Thr Pro Glu His Val Ala Glu Lys Tyr Asp
Gly 165 170 175Leu Thr Pro Lys Gln Ile Ile Asp Met Lys Gly Leu Ala
Gly Asp Ala 180 185 190Ser Asp Asn Ile Pro Gly Val Thr Lys Ile Gly
Glu Lys Thr Ala Ile 195 200 205Lys Leu Leu Lys Gln Tyr Gly Ser Val
Glu Gly Ile Tyr Glu His Ile 210 215 220Asp Glu Met Lys Gln Ser Lys
Met Lys Glu Asn Leu Ile Asn Asp Lys225 230 235 240Glu Gln Ala Phe
Leu Ser Lys Lys Leu Ala Thr Ile Asn Thr Ser Ala 245 250 255Pro Val
Asp Val Ser Ile Asp Ser Leu Lys Tyr Glu Gly Lys Asn Leu 260 265
270Asp Lys Leu Val Pro Phe Tyr Lys Glu Met Asp Phe Asn Gln Phe Leu
275 280 285Ser Lys Leu Asn Ile Val Glu Glu Glu Val Lys Met Asp Asp
Ile Leu 290 295 300Phe Glu Val Val His Glu Phe Lys Glu Glu Met Phe
Thr Thr Asp Met305 310 315 320Ala Leu Tyr Val Glu Met Met Gly Asp
Asn Tyr His Thr Glu Glu Ile 325 330 335Val Gly Val Ala Trp Gly Thr
Glu Lys Lys Ile Tyr Val Thr Asn Asp 340 345 350Leu Ser Val Phe Glu
Asn Arg Ala Phe His Ser Trp Ile Thr Asp Pro 355 360 365Thr Arg Leu
Lys Lys Val Tyr Asp Ala Lys Arg Thr Tyr Val Ala Leu 370 375 380Asn
Arg Tyr Thr Gly Lys Thr Lys Gly Ile Asp Phe Asp Val Leu Leu385 390
395 400Gly Ala Tyr Leu Leu Asp Thr Asn Glu Lys Ser Thr Asp Ile Glu
Gly 405 410 415Ile Ala Ala His Tyr Gly Tyr Asn Asp Ile Gln Ser Asp
Glu Ala Val 420 425 430Tyr Gly Lys Gly Ala Lys Lys Gly Leu Pro Glu
Glu Glu Glu Leu Phe 435 440 445Phe Ala His Leu Ala Arg Lys Val Ala
Ala Ile Asn Ala Leu Thr Pro 450 455 460Lys Leu Ser Gln Glu Leu Ala
Asp Lys Asn Gln Glu Asp Leu Phe Arg465 470 475 480Lys Met Glu Leu
Pro Leu Ser Ile Ile Leu Ala Glu Met Glu Ile Ser 485 490 495Gly Ile
Lys Val Asp Ala Thr Arg Leu Gln Glu Met Lys Gly Glu Phe 500 505
510Ser Ala Arg Leu Arg Glu Ile Glu Gln Lys Ile Tyr Glu Glu Ala Gly
515 520 525Glu Glu Phe Asn Leu Asn Ser Pro Lys Gln Leu Gly Val Ile
Leu Phe 530 535 540Glu Lys Met Gly Leu Pro Val Ile Lys Lys Thr
Lys Thr Gly Tyr Ser545 550 555 560Thr Ala Val Asp Val Leu Glu Gln
Leu Arg Glu Gln Ala Pro Ile Val 565 570 575Glu Asp Ile Leu Thr Tyr
Arg Gln Ile Ala Lys Ile Gln Ser Thr Tyr 580 585 590Val Glu Gly Leu
Leu Lys Val Ile Gln Ser Asp Gly Lys Val His Thr 595 600 605Arg Tyr
Val Gln Thr Leu Thr Gln Thr Gly Arg Leu Ser Ser Val Asp 610 615
620Pro Asn Leu Gln Asn Ile Pro Ile Arg Leu Asp Glu Gly Arg Lys
Ile625 630 635 640Arg Gln Ala Phe Val Pro Arg Glu Lys Asp Trp Leu
Ile Tyr Ser Ser 645 650 655Asp Tyr Ser Gln Ile Glu Leu Arg Val Leu
Ala His Ile Ser Asn Asp 660 665 670Glu His Leu Lys Ala Ala Phe Leu
Glu Gly Gln Asp Ile His Ala Ser 675 680 685Thr Ala Met Arg Val Phe
Gly Ile Glu Lys Ala Glu Asp Val Thr Pro 690 695 700Asn Met Arg Arg
Gln Ala Lys Ala Val Asn Phe Gly Ile Val Tyr Gly705 710 715 720Ile
Ser Asp Tyr Gly Leu Ser Gln Asn Leu Gly Ile Ser Arg Lys Ala 725 730
735Ala Gln Gln Tyr Ile Asp Thr Tyr Phe Glu Lys Tyr Pro Gly Val Lys
740 745 750Glu Tyr Met Glu Arg Ile Val Arg Glu Ala Lys Asp Gln Gly
Tyr Val 755 760 765Glu Thr Leu Tyr His Arg Arg Arg Tyr Leu Pro Asp
Ile Asn Ser Arg 770 775 780Asn Tyr Asn Ile Arg Ser Phe Ala Glu Arg
Thr Ala Ile Asn Thr Pro785 790 795 800Ile Gln Gly Ser Ala Ala Asp
Ile Leu Lys Ile Ala Met Ile Glu Leu 805 810 815Asp Lys Arg Leu Lys
Glu Thr Gly Leu Gln Ala Thr Met Leu Leu Gln 820 825 830Val His Asp
Glu Leu Val Phe Glu Val Pro Lys Lys Glu Leu Glu Ser 835 840 845Leu
Asp Lys Leu Val Lys Glu Val Met Glu Gln Ala Val Ser Leu His 850 855
860Val Pro Leu Ile Thr Asp Ser Ser Trp Gly Lys Thr Trp Tyr Glu
Ala865 870 875 880Lys107881PRTArtificial SequenceAMINO ACID
SEQUENCE OF DNA polymerase I [Facklamia hominis] 107Met Leu Ile Asp
Gly Ser Ser Leu Ala Phe Arg Ala Phe Tyr Ser Ile1 5 10 15Leu Asp Ile
Asp Arg Phe Thr Asn Arg Gln Gly Leu His Thr Asn Ala 20 25 30Ile Tyr
Ser Phe Lys Arg Met Leu Asp Asn Val Leu Ala Glu Phe Glu 35 40 45Pro
Ser His Val Leu Val Val Phe Asp Lys Ser Pro Asn Thr Ile Arg 50 55
60Lys Glu Lys Phe Asp Gln Tyr Lys Gly Gly Arg Ser Lys Thr Pro Ala65
70 75 80Glu Phe Thr Glu Gln Met Pro Tyr Phe Ala Pro Leu Leu Glu Gly
Tyr 85 90 95Gly Ile Arg His Tyr Ala Met Asp Tyr Tyr Glu Ala Asp Asp
Ile Ile 100 105 110Gly Thr Leu Ser Arg Leu Ala Asp Pro Lys Asp Gln
Val Val Val Leu 115 120 125Ser Gly Asp Lys Asp Leu Thr Gln Leu Ala
Ser Asp Gln Val Thr Val 130 135 140Tyr Ile Thr Arg Lys Gly Val Ser
Asp Leu Val Val Tyr Ser Pro Thr145 150 155 160Thr Ile Gln Glu Lys
Trp Gly Ile Arg Pro Glu Gln Ile Ile Asp Met 165 170 175Lys Gly Leu
Met Gly Asp Ser Ser Asp Asn Tyr Pro Gly Ile Thr Arg 180 185 190Val
Gly Glu Lys Thr Ala Leu Lys Leu Leu His Gln Phe Gly Ser Val 195 200
205Glu Gly Leu Tyr Gln Ser Leu Asp Gln Leu Lys Ala Ser Lys Leu Lys
210 215 220Glu Asn Ile Ile Lys Asp Lys Asp Gln Ala Phe Leu Ser Lys
Asp Leu225 230 235 240Ala Arg Ile Leu Leu Asp Val Pro Leu Glu Ile
Asp Leu Ala Asp Ile 245 250 255Glu Arg Gly Glu Met Asp Thr Gln Ala
Leu Asn Asp Leu Tyr Arg Gln 260 265 270Leu Asp Phe Gln Ser Phe Leu
Gln Glu Leu Asp Ala Lys Ser Val Leu 275 280 285Asp Asp Pro Ser Ala
Ser Leu Ala Asp Phe Asp Leu Leu Val Leu Glu 290 295 300Asp Gln Ala
Asp Phe Asp Gly Leu Ala Trp Pro Asp Arg Gly Ile Tyr305 310 315
320His Thr Glu Gln Leu Asp Glu Asn Tyr His Phe Ala Lys Val Glu Ala
325 330 335Val Cys Trp Ala Asp Pro Glu Thr Lys Lys Ala Tyr Val Thr
Ser Ala 340 345 350Asp Leu Ala Phe Thr Asn Pro Ala Phe Lys Ala Trp
Leu Glu Asp Ser 355 360 365Ser Lys Leu Lys Asp Cys Leu Asp Phe Lys
Lys Glu Ala Val Ile Ala 370 375 380Ala Arg Tyr Gly Leu Asp Leu Ala
Gly Met Gly Glu Asp Val Ser Ile385 390 395 400Met Ala Tyr Leu Val
Asp Thr Leu Gln Thr His Glu Leu Ala Asp Leu 405 410 415Ser Gln Ser
Phe Gly Leu Gly Gln Val Ile Pro Tyr Asp Val Glu Val 420 425 430Tyr
Gly Lys Gly Val Lys Lys Gly Val Pro Glu Asp Glu Ala Val Phe 435 440
445Gln Gly His Leu Val Leu Lys Leu Gln Cys Leu His Ala Leu Met Glu
450 455 460Pro Leu Leu Ala Lys Leu Glu Glu Leu Asp Met Val Gly Leu
Tyr Arg465 470 475 480Glu Met Glu Gln Pro Leu Ala Arg Cys Leu Ala
Lys Met Glu Ile Thr 485 490 495Gly Ile Lys Val Asn Gln Glu Val Leu
Glu Ala Lys Asn Gln Glu Val 500 505 510Leu Ala Arg Leu Ala Gln Met
Glu Lys Ser Ile Tyr Asp Leu Ala Gly 515 520 525His Ser Phe Asn Val
Asn Ser Pro Lys Gln Leu Gly Gln Val Leu Phe 530 535 540Glu Glu Leu
Lys Leu Pro Val Ile Lys Lys Thr Lys Thr Gly Tyr Ser545 550 555
560Thr Ala Ala Asp Val Leu Asp Lys Leu Val Gln Val His Pro Ile Ile
565 570 575Gln Ala Ile Leu Asp Tyr Arg Gln Ile Ala Lys Leu Gln Ser
Thr Tyr 580 585 590Leu Ala Gly Leu Gln Pro Phe Ile Lys Glu Asp Gly
Lys Ile His Thr 595 600 605Arg Tyr Thr Gln Thr Leu Thr Gln Thr Gly
Arg Leu Ser Ser Thr Asp 610 615 620Pro Asn Leu Gln Asn Ile Pro Ile
Arg Ile Glu Glu Gly Arg Leu Val625 630 635 640Arg Ala Ala Phe Val
Pro Ser Gln Pro Gly Trp Gln Met Leu Gly Ala 645 650 655Asp Tyr Ser
Gln Ile Glu Leu Arg Val Leu Ala His Ile Ser Gly Asp 660 665 670Glu
His Met Lys Arg Ala Phe Gln Asn Gly Glu Asp Ile His Ser Ala 675 680
685Thr Ala Arg Arg Val Phe Gln Leu Asp Glu Asp Gln Glu Val Asp Ala
690 695 700Asp His Arg Arg Gln Ala Lys Ala Val Asn Phe Gly Ile Val
Tyr Gly705 710 715 720Ile Ser Asp Tyr Gly Leu Ser Gln Asn Leu Asn
Ile Ser Arg Gln Ala 725 730 735Ala Lys Thr Phe Ile Asp Arg Tyr Phe
Glu Glu Phe Pro Lys Ile Arg 740 745 750Gln Tyr Met Asp Glu Ile Val
Glu Gln Ala Lys Ser Asp Gly Tyr Val 755 760 765Ser Thr Leu Phe His
Arg Arg Arg Tyr Leu Pro Asp Ile His Ala Lys 770 775 780Asn Phe Asn
Leu Arg Ser Phe Ala Glu Arg Thr Ala Met Asn Ser Pro785 790 795
800Ile Gln Gly Thr Ala Ala Asp Ile Ile Lys Leu Ala Met Val Arg Leu
805 810 815Gln Ala Arg Leu Glu Glu Ala Gly Leu Ser Ser Arg Leu Leu
Leu Gln 820 825 830Ile His Asp Glu Leu Ile Leu Glu Gly Pro Lys Glu
Glu Met Pro Gln 835 840 845Leu Gln Lys Leu Val Val Glu Val Met Glu
Ser Ala Ala Asp Leu Ser 850 855 860Val Pro Leu Lys Val Asp Asp His
Ile Gly Asp Asn Trp Tyr Asp Leu865 870 875
880Lys108877PRTArtificial SequenceAMINO ACID SEQUENCE OF DNA
polymerase I [Bacillus anthracis] 108Met Glu Lys Lys Val Val Leu
Val Asp Gly Asn Asn Ile Ala Tyr Arg1 5 10 15Ala Phe Phe Ala Leu Pro
Leu Leu Asn Asn Asp Lys Gly Ile His Thr 20 25 30Asn Ala Ile Tyr Gly
Phe Thr Met Met Leu Met Arg Ile Leu Glu Glu 35 40 45Glu Lys Pro Thr
His Met Leu Val Ala Phe Asp Ala Gly Lys Thr Thr 50 55 60Phe Arg His
Lys Ala Tyr Ser Glu Tyr Lys Gly Gly Arg Gln Lys Thr65 70 75 80Pro
Pro Glu Leu Ser Glu Gln Phe Pro Phe Ile Arg Glu Met Leu Asp 85 90
95Ala Phe Asn Val Pro Arg Tyr Glu Leu Glu Asn Tyr Glu Ala Asp Asp
100 105 110Ile Met Gly Thr Leu Ala Lys Glu Ala Ser Glu Gln Gly Ala
Ser Val 115 120 125Lys Val Ile Ser Gly Asp Lys Asp Leu Leu Gln Leu
Val Ser Asp Asn 130 135 140Thr Leu Val Cys Ile Pro Arg Lys Gly Ile
Thr Glu Val Asp Glu Tyr145 150 155 160Thr Lys Glu Ala Leu Phe Glu
Lys Tyr Ser Leu Ser Pro Lys Gln Ile 165 170 175Ile Asp Met Lys Gly
Leu Met Gly Asp Gln Ser Asp Asn Ile Pro Gly 180 185 190Val Pro Gly
Val Gly Glu Lys Thr Ala Ile Lys Leu Leu Thr Gln Phe 195 200 205Gly
Thr Val Glu Glu Val Tyr Glu Asn Ile Asp Gln Val Ser Gly Lys 210 215
220Lys Leu Lys Glu Lys Leu Glu Ala Asn Lys Asp Gln Ala Leu Met
Ser225 230 235 240Lys Asp Leu Ala Thr Ile Ile Thr Asp Ala Pro Ile
Thr Val Asn Val 245 250 255Asp Asp Met Glu Tyr Lys Gly Tyr Glu Ala
Ser Asp Val Ile Pro Met 260 265 270Phe Glu Asn Leu Gly Phe Thr Ser
Leu Leu Asn Lys Leu Gly Val Thr 275 280 285Pro Glu Glu Thr Ala Pro
Ala Glu Leu Asp Asp Ile Thr Phe Asp Ile 290 295 300Val Glu Glu Val
Thr Glu Glu Met Leu Gln Gln Asp Ser Ala Leu Ile305 310 315 320Val
Glu Val Gln Glu Asp Asn Tyr His Lys Ala Asp Ile Gln Gly Phe 325 330
335Gly Ile Gln Asn Glu Asn Gly Cys Tyr Phe Ile Gln Thr Asp Ile Ala
340 345 350Leu Lys Ser Asp Ala Phe Lys Glu Trp Leu Ala Asp Gly Glu
Met Arg 355 360 365Lys Tyr Thr Phe Asp Ala Lys Arg Ala Ile Val Ala
Leu Lys Trp Asn 370 375 380Gly Ile Asp Met Gln Gly Ile Asp Phe Asp
Leu Leu Ile Ala Ala Tyr385 390 395 400Leu Leu Asp Pro Ala Asp Thr
Asp Lys Asp Phe Arg Thr Val Ala Lys 405 410 415Met Lys Glu Thr His
Ala Val Lys Ser Asp Glu Glu Val Tyr Gly Lys 420 425 430Gly Ala Lys
Arg Ala Val Pro Glu Leu Glu Ile Val Ala Glu His Val 435 440 445Ala
Arg Lys Val His Val Leu Tyr Asp Val Lys Gln Thr Phe Val Glu 450 455
460Glu Leu Glu Lys Asn Glu Gln Tyr Glu Leu Phe Thr Glu Leu Glu
Leu465 470 475 480Pro Leu Ala Arg Val Leu Ala Asp Met Glu Val Lys
Gly Val Lys Val 485 490 495Asp Thr Glu Arg Leu Arg Asn Met Gly Glu
Glu Leu Ala Gly Arg Leu 500 505 510Lys Glu Met Glu Gln Glu Ile Tyr
Lys Leu Ala Gly Thr Glu Phe Asn 515 520 525Ile Asn Ser Pro Lys Gln
Leu Gly Val Ile Leu Phe Glu Asn Leu Asn 530 535 540Leu Pro Val Ile
Lys Lys Thr Lys Thr Gly Tyr Ser Thr Ser Ala Asp545 550 555 560Val
Leu Asp Lys Leu Met Asp His His Glu Ile Ile Pro Asn Ile Leu 565 570
575His Tyr Arg Gln Leu Gly Lys Leu Asn Ser Thr Tyr Ile Glu Gly Leu
580 585 590Leu Lys Val Val His Glu Asp Ser Ser Lys Ile His Thr Arg
Phe Asn 595 600 605Gln Val Leu Thr Gln Thr Gly Arg Leu Ser Ser Thr
Asp Pro Asn Leu 610 615 620Gln Asn Ile Pro Ile Arg Leu Glu Glu Gly
Arg Lys Ile Arg Gln Ala625 630 635 640Phe Val Pro Ser Glu Glu Gly
Trp Ile Met Tyr Ala Ala Asp Tyr Ser 645 650 655Gln Ile Glu Leu Arg
Val Leu Ala His Ile Ala Asn Asp Lys Gly Leu 660 665 670Val Glu Ala
Phe Gln His Asp Met Asp Ile His Thr Lys Thr Ala Met 675 680 685Asp
Val Phe Gly Val Glu Lys Asp Glu Val Thr Ser Asn Met Arg Arg 690 695
700Gln Ala Lys Ala Val Asn Phe Gly Ile Val Tyr Gly Ile Ser Asp
Tyr705 710 715 720Gly Leu Ser Gln Asn Leu Gly Ile Thr Arg Lys Ala
Ala Ala Glu Phe 725 730 735Ile Glu Lys Tyr Leu Glu Ser Phe Pro Gly
Val Gln Glu Tyr Met Asp 740 745 750Asp Ile Val Lys Asp Ala Lys Gln
Lys Gly Tyr Val Ala Thr Leu Leu 755 760 765Asn Arg Arg Arg Tyr Ile
Pro Glu Ile Thr Ser Arg Asn Phe Asn Leu 770 775 780Arg Ser Phe Ala
Glu Arg Thr Ala Met Asn Thr Pro Ile Gln Gly Thr785 790 795 800Ala
Ala Asp Ile Ile Lys Lys Ala Met Ile Ile Met Ala Asp Arg Leu 805 810
815Glu Glu Glu Gly Leu Gln Ala Arg Leu Leu Leu Gln Val His Asp Glu
820 825 830Leu Ile Phe Glu Ala Pro Lys Glu Glu Val Glu Lys Leu Glu
Lys Leu 835 840 845Val Pro Glu Val Met Glu His Ala Ile Glu Leu Ala
Val Pro Leu Lys 850 855 860Val Asp Tyr Ser Tyr Gly Pro Thr Trp Tyr
Asp Ala Lys865 870 875109877PRTArtificial SequenceAMINO ACID
SEQUENCE OF DNA polymerase I [Bacillus cereus ATCC 10987] 109Met
Glu Lys Lys Val Val Leu Val Asp Gly Asn Asn Ile Ala Tyr Arg1 5 10
15Ala Phe Phe Ala Leu Pro Leu Leu Asn Asn Asp Lys Gly Ile His Thr
20 25 30Asn Ala Ile Tyr Gly Phe Thr Met Met Leu Met Arg Ile Leu Glu
Glu 35 40 45Glu Lys Pro Thr His Met Leu Val Ala Phe Asp Ala Gly Lys
Thr Thr 50 55 60Phe Arg His Lys Thr Tyr Ser Glu Tyr Lys Gly Gly Arg
Gln Lys Thr65 70 75 80Pro Pro Glu Leu Ser Glu Gln Phe Pro Phe Ile
Arg Glu Met Leu Asp 85 90 95Ala Phe Asn Val Pro Arg Tyr Glu Leu Glu
Asn Tyr Glu Ala Asp Asp 100 105 110Ile Met Gly Thr Leu Ala Lys Glu
Ala Ser Glu Gln Gly Ala Ser Val 115 120 125Lys Val Ile Ser Gly Asp
Lys Asp Leu Leu Gln Leu Val Ser Asp Asn 130 135 140Thr Leu Val Cys
Ile Pro Arg Lys Gly Ile Thr Glu Val Asp Glu Tyr145 150 155 160Thr
Lys Glu Ala Leu Phe Glu Lys Tyr Ser Leu Ser Pro Lys Gln Ile 165 170
175Ile Asp Met Lys Gly Leu Met Gly Asp Gln Ser Asp Asn Ile Pro Gly
180 185 190Val Pro Gly Val Gly Glu Lys Thr Ala Ile Lys Leu Leu Thr
Gln Phe 195 200 205Gly Thr Val Glu Glu Val Tyr Glu Asn Ile Asp Gln
Val Ser Gly Lys 210 215 220Lys Leu Lys Glu Lys Leu Glu Ala Asn Lys
Glu Gln Ala Leu Met Ser225 230 235 240Lys Asp Leu Ala Thr Ile Ile
Thr Asp Ala Pro Ile Thr Val His Val 245 250 255Asp Asp Met Glu Tyr
Lys Gly Tyr Glu Ala Ser Asp Val Ile Pro Met 260 265 270Phe Glu Asn
Leu Gly Phe Thr Ser Leu Leu Asn Lys Leu Gly Val Thr 275 280 285Pro
Glu Glu Thr Ala Pro Ala Glu Leu Asp Asp Ile Thr Phe Asp Ile 290 295
300Val Glu Glu Val Thr Glu Glu Met Leu Gln Gln Asp Ser Ala Leu
Ile305 310 315 320Val Glu Val Gln Glu Asp Asn Tyr His Lys Ala Asp
Ile Gln Gly Phe 325 330 335Gly Ile Gln Asn Glu Asn Gly Cys Tyr Phe
Ile Gln Thr Asp Ile Ala 340
345 350Leu Lys Ser Asp Ala Phe Lys Glu Trp Leu Ala Asp Gly Glu Met
Arg 355 360 365Lys Tyr Thr Phe Asp Ala Lys Arg Ala Ile Val Ala Leu
Lys Trp Asn 370 375 380Gly Ile Asp Met Gln Gly Ile Asp Phe Asp Leu
Leu Ile Ala Ala Tyr385 390 395 400Leu Leu Asp Pro Ala Asp Thr Asp
Lys Asp Phe Arg Thr Val Ala Lys 405 410 415Met Lys Glu Thr His Ala
Val Lys Ser Asp Glu Glu Val Tyr Gly Lys 420 425 430Gly Ala Lys Arg
Ala Val Pro Glu Leu Glu Ile Val Ala Glu His Val 435 440 445Ala Arg
Lys Val His Val Leu Tyr Asp Val Lys Gln Thr Phe Val Glu 450 455
460Glu Leu Glu Lys Asn Glu Gln Tyr Glu Leu Phe Thr Glu Leu Glu
Leu465 470 475 480Pro Leu Ala Arg Val Leu Ala Asp Met Glu Val Lys
Gly Val Lys Val 485 490 495Asp Thr Glu Arg Leu Arg Asn Met Gly Glu
Glu Leu Ala Gly Arg Leu 500 505 510Lys Glu Met Glu Gln Glu Ile Tyr
Lys Leu Ala Gly Arg Glu Phe Asn 515 520 525Ile Asn Ser Pro Lys Gln
Leu Gly Val Ile Leu Phe Glu Asn Leu Asn 530 535 540Leu Pro Val Ile
Lys Lys Thr Lys Thr Gly Tyr Ser Thr Ser Ala Asp545 550 555 560Val
Leu Asp Lys Leu Met Asp His His Glu Ile Ile Pro Asn Ile Leu 565 570
575His Tyr Arg Gln Leu Gly Lys Leu Asn Ser Thr Tyr Ile Glu Gly Leu
580 585 590Leu Lys Val Val His Glu Asp Ser Ser Lys Ile His Thr Arg
Phe Asn 595 600 605Gln Val Leu Thr Gln Thr Gly Arg Leu Ser Ser Thr
Asp Pro Asn Leu 610 615 620Gln Asn Ile Pro Ile Arg Leu Glu Glu Gly
Arg Lys Ile Arg Gln Ala625 630 635 640Phe Val Pro Ser Glu Glu Gly
Trp Ile Met Tyr Ala Ala Asp Tyr Ser 645 650 655Gln Ile Glu Leu Arg
Val Leu Ala His Ile Ala Asn Asp Lys Gly Leu 660 665 670Val Glu Ala
Phe Gln His Asp Met Asp Ile His Thr Lys Thr Ala Met 675 680 685Asp
Val Phe Gly Val Glu Lys Asp Glu Val Thr Ser Asn Met Arg Arg 690 695
700Gln Ala Lys Ala Val Asn Phe Gly Ile Val Tyr Gly Ile Ser Asp
Tyr705 710 715 720Gly Leu Ser Gln Asn Leu Gly Ile Thr Arg Lys Ala
Ala Ala Glu Phe 725 730 735Ile Glu Lys Tyr Leu Glu Ser Phe Pro Gly
Val Gln Glu Tyr Met Asp 740 745 750Asp Ile Val Lys Asp Ala Lys Gln
Lys Gly Tyr Val Ala Thr Leu Leu 755 760 765Asn Arg Arg Arg Tyr Ile
Pro Glu Ile Thr Ser Arg Asn Phe Asn Leu 770 775 780Arg Ser Phe Ala
Glu Arg Thr Ala Met Asn Thr Pro Ile Gln Gly Thr785 790 795 800Ala
Ala Asp Ile Ile Lys Lys Ala Met Ile Ile Met Ala Asp Arg Leu 805 810
815Glu Glu Glu Gly Leu Gln Ala Arg Leu Leu Leu Gln Val His Asp Glu
820 825 830Leu Ile Phe Glu Ala Pro Lys Glu Glu Ile Glu Lys Leu Glu
Lys Leu 835 840 845Val Pro Glu Val Met Glu His Ala Ile Glu Leu Ala
Val Pro Leu Lys 850 855 860Val Asp Tyr Ser Tyr Gly Pro Thr Trp Tyr
Asp Ala Lys865 870 87511053DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 110gggcgcacgt atgcttctgc aggtcggtga cgagctggtg
ttagaagccc cta 5311153DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 111taggggcttc taacaccagc tcgtcaccga cctgcagaag
catacgtgcg ccc 5311253DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 112gggcgcacgt atgcttctgc aggtcgcgga cgagctggtg
ttagaagccc cta 5311353DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 113taggggcttc taacaccagc tcgtccgcga cctgcagaag
catacgtgcg ccc 5311453DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 114gggcgcacgt atgcttctgc aggtcagcga cgagctggtg
ttagaagccc cta 5311553DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 115taggggcttc taacaccagc tcgtcgctga cctgcagaag
catacgtgcg ccc 5311653DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 116gggcgcacgt atgcttctgc aggtcacgga cgagctggtg
ttagaagccc cta 5311753DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 117taggggcttc taacaccagc tcgtccgtga cctgcagaag
catacgtgcg ccc 5311853DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 118gggcgcacgt atgcttctgc aggtctgcga cgagctggtg
ttagaagccc cta 5311953DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 119taggggcttc taacaccagc tcgtcgcaga cctgcagaag
catacgtgcg ccc 5312053DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 120gggcgcacgt atgcttctgc aggtcgtaga cgagctggtg
ttagaagccc cta 5312153DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 121taggggcttc taacaccagc tcgtctacga cctgcagaag
catacgtgcg ccc 5312253DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 122gggcgcacgt atgcttctgc aggtcttgga cgagctggtg
ttagaagccc cta 5312353DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 123taggggcttc taacaccagc tcgtccaaga cctgcagaag
catacgtgcg ccc 5312453DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 124gggcgcacgt atgcttctgc aggtcattga cgagctggtg
ttagaagccc cta 5312553DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 125taggggcttc taacaccagc tcgtcaatga cctgcagaag
catacgtgcg ccc 5312653DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 126gggcgcacgt atgcttctgc aggtcatgga cgagctggtg
ttagaagccc cta 5312753DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 127taggggcttc taacaccagc tcgtccatga cctgcagaag
catacgtgcg ccc 5312853DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 128gggcgcacgt atgcttctgc aggtcccaga cgagctggtg
ttagaagccc cta 5312953DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 129taggggcttc taacaccagc tcgtctggga cctgcagaag
catacgtgcg ccc 5313053DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 130gggcgcacgt atgcttctgc aggtctttga cgagctggtg
ttagaagccc cta 5313153DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 131taggggcttc taacaccagc tcgtcaaaga cctgcagaag
catacgtgcg ccc 5313253DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 132gggcgcacgt atgcttctgc aggtctatga cgagctggtg
ttagaagccc cta 5313353DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 133taggggcttc taacaccagc tcgtcataga cctgcagaag
catacgtgcg ccc 5313453DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 134gggcgcacgt atgcttctgc aggtctggga cgagctggtg
ttagaagccc cta 5313553DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 135taggggcttc taacaccagc tcgtcccaga cctgcagaag
catacgtgcg ccc 5313653DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 136gggcgcacgt atgcttctgc aggtcgatga cgagctggtg
ttagaagccc cta 5313753DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 137taggggcttc taacaccagc tcgtcatcga cctgcagaag
catacgtgcg ccc 5313853DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 138gggcgcacgt atgcttctgc aggtcgaaga cgagctggtg
ttagaagccc cta 5313953DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 139taggggcttc taacaccagc tcgtcttcga cctgcagaag
catacgtgcg ccc 5314053DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 140gggcgcacgt atgcttctgc aggtcaacga cgagctggtg
ttagaagccc cta 5314153DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 141taggggcttc taacaccagc tcgtcgttga cctgcagaag
catacgtgcg ccc 5314253DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 142gggcgcacgt atgcttctgc aggtcaaaga cgagctggtg
ttagaagccc cta 5314353DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 143taggggcttc taacaccagc tcgtctttga cctgcagaag
catacgtgcg ccc 5314453DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 144gggcgcacgt atgcttctgc aggtccggga cgagctggtg
ttagaagccc cta 5314553DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDE 145taggggcttc taacaccagc tcgtcccgga cctgcagaag
catacgtgcg ccc 531462507DNAArtificial SequenceNUCLEOTIDE SEQUENCE
OF MUTANT ID 20 (H784A) 146catatgcgtg gtatgctgcc gttgttcgag
cctaaaggcc gcgtactgtt agtcgatggt 60catcacttgg cctatcggac gttccatgca
ctcaaaggtc tgacgaccag tcgtggcgaa 120ccggtccagg ctgtttatgg
tttcgctaag tctttgctca aagcactgaa agaagacggg 180gacgcggtaa
ttgttgtatt tgatgccaaa gcaccgagct tccgccacga agcttatggt
240ggctacaagg caggacgcgc ccctacccca gaagatttcc cccgtcagct
ggcattaatt 300aaggagttag tagaccttct cggcttagcg cgtctggaag
ttccgggtta tgaggcggac 360gatgtccttg catccttggc taaaaaggcc
gaaaaagagg gctacgaagt ccgcatcttg 420acggcagaca aagatctgta
ccagcttctg tctgaccgta ttcatgtttt gcaccctgaa 480ggctacttaa
tcactccggc ctggctctgg gaaaagtacg gtctgcgtcc cgatcagtgg
540gcggattatc gggctttgac gggagatgag agcgacaacc tgccaggagt
taagggcatt 600ggtgaaaaaa ccgcacgtaa gctgcttgaa gagtggggtt
ccctggaagc cttgttaaaa 660aatctggatc gtctcaagcc cgcaattcgt
gaaaagatcc tggctcatat ggacgatctt 720aaattaagtt gggacctggc
caaggtgcgc accgatttac cgcttgaagt ggattttgca 780aaacgccgtg
agccggaccg ggaacgttta cgcgctttct tagagcgtct ggaattcggt
840tcactgcttc atgaattcgg tctgttagag tctcctaaag cactcgaaga
ggcaccgtgg 900ccgcccccag aaggtgcttt tgttggcttc gtactttccc
gtaaggagcc tatgtgggca 960gatcttctgg ctttagcggc tgcacgcggt
ggccgtgttc accgggcccc tgagccatac 1020aaagcgttac gtgatctgaa
ggaagcacgt ggcttgctgg caaaagacct ttctgttttg 1080gccctgcgcg
agggtcttgg actgccgcca ggcgacgatc ccatgttatt ggcctatctg
1140ttagacccta gcaataccac acctgaaggg gtcgctcgtc ggtatggcgg
tgaatggact 1200gaggaagccg gagagcgcgc cgcattgtcc gaacggctct
ttgcaaactt atggggtcgt 1260ctggaagggg aggaacgtct gttatggttg
tatcgggaag tcgaacgtcc tctttcggcc 1320gtattagcgc atatggaggc
aacaggtgtg cgtttagatg tcgcgtacct tcgggcctta 1380tcactggaag
ttgcagagga aatcgcccgt ctcgaggctg aagtgttccg gttggccggt
1440cacccgttta acctcaactc ccgtgaccag ctggaacgcg ttttattcga
tgagcttggg 1500cttcccgcaa ttggcaaaac cgaaaagact ggcaaacgca
gtacgagcgc tgccgtcctt 1560gaggcactcc gcgaggctca ccctattgta
gaaaagatcc tgcaataccg tgagttgacg 1620aagcttaaaa gcacttatat
tgatcctctc ccggatctga tccatcctcg taccggccgc 1680ttgcacacac
gtttcaacca gacggcgact gcaaccggcc gtctgtctag ctcggatcca
1740aatctccaga acattccggt ccgtacaccc ttgggccaac gtatccgccg
ggcgtttatc 1800gctgaggaag gatggttact ggtcgcattg gactactcgc
agattgagct gcgcgtcctc 1860gcacatctct ctggtgacga aaatttaatc
cgcgtgtttc aagaggggcg tgatattcac 1920acagaaactg cctcatggat
gttcggtgtc ccacgtgaag cagtggatcc tttgatgcgc 1980cgtgcagcta
aaacaattaa ttttggagtg ctgtacggaa tgagcgctca tcgcttgagt
2040caggaactgg caatccccta cgaggaagcg caggcattca tcgaacgtta
ctttcaatcg 2100tttccgaaag ttcgcgcatg gatcgagaag acgctcgagg
aaggtcgtcg tcggggctat 2160gtcgaaactc tgtttggtcg ccgtcggtac
gtaccagatc ttgaagcccg cgtcaaatcg 2220gtacgggagg ctgcggagcg
tatggcattt aatatgcctg tacagggtac tgcagctgac 2280ctcatgaaac
tggcaatggt caagcttttc ccgcgcttgg aggaaatggg cgcacgtatg
2340cttctgcagg tcgcggacga gctggtgtta gaagccccta aggagcgcgc
cgaagctgtc 2400gcgcgcctcg ctaaagaagt gatggagggc gtttacccat
tggccgtacc cctcgaagtg 2460gaggtcggta ttggagaaga ttggttatct
gcaaaggaag cggccgc 2507147834PRTArtificial SequenceAMINO ACID
SEQUENCE OF MUTANT ID 20 (H784A) 147Met Arg Gly Met Leu Pro Leu Phe
Glu Pro Lys Gly Arg Val Leu Leu1 5 10 15Val Asp Gly His His Leu Ala
Tyr Arg Thr Phe His Ala Leu Lys Gly 20 25 30Leu Thr Thr Ser Arg Gly
Glu Pro Val Gln Ala Val Tyr Gly Phe Ala 35 40 45Lys Ser Leu Leu Lys
Ala Leu Lys Glu Asp Gly Asp Ala Val Ile Val 50 55 60Val Phe Asp Ala
Lys Ala Pro Ser Phe Arg His Glu Ala Tyr Gly Gly65 70 75 80Tyr Lys
Ala Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg Gln Leu 85 90 95Ala
Leu Ile Lys Glu Leu Val Asp Leu Leu Gly Leu Ala Arg Leu Glu 100 105
110Val Pro Gly Tyr Glu Ala Asp Asp Val Leu Ala Ser Leu Ala Lys Lys
115 120 125Ala Glu Lys Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp
Lys Asp 130 135 140Leu Tyr Gln Leu Leu Ser Asp Arg Ile His Val Leu
His Pro Glu Gly145 150 155 160Tyr Leu Ile Thr Pro Ala Trp Leu Trp
Glu Lys Tyr Gly Leu Arg Pro 165 170 175Asp Gln Trp Ala Asp Tyr Arg
Ala Leu Thr Gly Asp Glu Ser Asp Asn 180 185 190Leu Pro Gly Val Lys
Gly Ile Gly Glu Lys Thr Ala Arg Lys Leu Leu 195 200 205Glu Glu Trp
Gly Ser Leu Glu Ala Leu Leu Lys Asn Leu Asp Arg Leu 210 215 220Lys
Pro Ala Ile Arg Glu Lys Ile Leu Ala His Met Asp Asp Leu Lys225 230
235 240Leu Ser Trp Asp Leu Ala Lys Val Arg Thr Asp Leu Pro Leu Glu
Val 245 250 255Asp Phe Ala Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu
Arg Ala Phe 260 265 270Leu Glu Arg Leu Glu Phe Gly Ser Leu Leu His
Glu Phe Gly Leu Leu 275 280 285Glu Ser Pro Lys Ala Leu Glu Glu Ala
Pro Trp Pro Pro Pro Glu Gly 290 295 300Ala Phe Val Gly Phe Val Leu
Ser Arg Lys Glu Pro Met Trp Ala Asp305 310 315 320Leu Leu Ala Leu
Ala Ala Ala Arg Gly Gly Arg Val His Arg Ala Pro 325 330 335Glu Pro
Tyr Lys Ala Leu Arg Asp Leu Lys Glu Ala Arg Gly Leu Leu 340 345
350Ala Lys Asp Leu Ser Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro
355 360 365Pro Gly Asp Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro
Ser Asn 370 375 380Thr Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly
Glu Trp Thr Glu385 390 395 400Glu Ala Gly Glu Arg Ala Ala Leu Ser
Glu Arg Leu Phe Ala Asn Leu 405 410 415Trp Gly Arg Leu Glu Gly Glu
Glu Arg Leu Leu Trp Leu Tyr Arg Glu 420 425 430Val Glu Arg Pro Leu
Ser Ala Val Leu Ala His Met Glu Ala Thr Gly 435 440 445Val Arg Leu
Asp Val Ala Tyr Leu Arg Ala Leu Ser Leu Glu Val Ala 450 455 460Glu
Glu Ile Ala Arg Leu Glu Ala Glu Val Phe Arg Leu Ala Gly His465 470
475 480Pro Phe Asn Leu Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe
Asp 485 490 495Glu Leu Gly Leu Pro Ala Ile Gly Lys Thr Glu Lys Thr
Gly Lys Arg 500 505 510Ser Thr Ser Ala Ala Val Leu Glu Ala Leu Arg
Glu Ala His Pro Ile 515 520 525Val Glu Lys Ile Leu Gln Tyr Arg Glu
Leu Thr Lys Leu Lys Ser Thr 530 535 540Tyr Ile Asp Pro Leu Pro Asp
Leu Ile His Pro Arg Thr Gly Arg Leu545 550 555 560His Thr Arg Phe
Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser 565 570 575Ser Asp
Pro Asn Leu Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln 580 585
590Arg Ile Arg Arg Ala Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala
595 600 605Leu Asp Tyr Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu
Ser Gly 610 615 620Asp Glu Asn Leu Ile Arg Val Phe Gln Glu Gly Arg
Asp Ile His Thr625 630 635 640Glu Thr Ala Ser Trp Met Phe Gly Val
Pro Arg Glu Ala Val Asp Pro 645 650 655Leu Met Arg Arg Ala Ala Lys
Thr Ile Asn Phe Gly Val Leu Tyr Gly 660 665 670Met Ser Ala His Arg
Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu 675 680 685Ala Gln Ala
Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg 690 695 700Ala
Trp Ile Glu Lys Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr Val705 710
715 720Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala
Arg 725 730 735Val Lys Ser Val Arg Glu Ala Ala Glu Arg Met Ala Phe
Asn Met Pro 740 745 750Val Gln Gly Thr Ala Ala Asp Leu Met Lys Leu
Ala Met Val Lys Leu 755 760 765Phe Pro Arg Leu Glu Glu Met Gly Ala
Arg Met Leu Leu Gln Val Ala 770 775 780Asp Glu Leu Val Leu Glu Ala
Pro Lys Glu Arg Ala Glu Ala Val Ala785 790
795 800Arg Leu Ala Lys Glu Val Met Glu Gly Val Tyr Pro Leu Ala Val
Pro 805 810 815Leu Glu Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ser
Ala Lys Glu 820 825 830Ala Ala1482507DNAArtificial
SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 21 (H784S) 148catatgcgtg
gtatgctgcc gttgttcgag cctaaaggcc gcgtactgtt agtcgatggt 60catcacttgg
cctatcggac gttccatgca ctcaaaggtc tgacgaccag tcgtggcgaa
120ccggtccagg ctgtttatgg tttcgctaag tctttgctca aagcactgaa
agaagacggg 180gacgcggtaa ttgttgtatt tgatgccaaa gcaccgagct
tccgccacga agcttatggt 240ggctacaagg caggacgcgc ccctacccca
gaagatttcc cccgtcagct ggcattaatt 300aaggagttag tagaccttct
cggcttagcg cgtctggaag ttccgggtta tgaggcggac 360gatgtccttg
catccttggc taaaaaggcc gaaaaagagg gctacgaagt ccgcatcttg
420acggcagaca aagatctgta ccagcttctg tctgaccgta ttcatgtttt
gcaccctgaa 480ggctacttaa tcactccggc ctggctctgg gaaaagtacg
gtctgcgtcc cgatcagtgg 540gcggattatc gggctttgac gggagatgag
agcgacaacc tgccaggagt taagggcatt 600ggtgaaaaaa ccgcacgtaa
gctgcttgaa gagtggggtt ccctggaagc cttgttaaaa 660aatctggatc
gtctcaagcc cgcaattcgt gaaaagatcc tggctcatat ggacgatctt
720aaattaagtt gggacctggc caaggtgcgc accgatttac cgcttgaagt
ggattttgca 780aaacgccgtg agccggaccg ggaacgttta cgcgctttct
tagagcgtct ggaattcggt 840tcactgcttc atgaattcgg tctgttagag
tctcctaaag cactcgaaga ggcaccgtgg 900ccgcccccag aaggtgcttt
tgttggcttc gtactttccc gtaaggagcc tatgtgggca 960gatcttctgg
ctttagcggc tgcacgcggt ggccgtgttc accgggcccc tgagccatac
1020aaagcgttac gtgatctgaa ggaagcacgt ggcttgctgg caaaagacct
ttctgttttg 1080gccctgcgcg agggtcttgg actgccgcca ggcgacgatc
ccatgttatt ggcctatctg 1140ttagacccta gcaataccac acctgaaggg
gtcgctcgtc ggtatggcgg tgaatggact 1200gaggaagccg gagagcgcgc
cgcattgtcc gaacggctct ttgcaaactt atggggtcgt 1260ctggaagggg
aggaacgtct gttatggttg tatcgggaag tcgaacgtcc tctttcggcc
1320gtattagcgc atatggaggc aacaggtgtg cgtttagatg tcgcgtacct
tcgggcctta 1380tcactggaag ttgcagagga aatcgcccgt ctcgaggctg
aagtgttccg gttggccggt 1440cacccgttta acctcaactc ccgtgaccag
ctggaacgcg ttttattcga tgagcttggg 1500cttcccgcaa ttggcaaaac
cgaaaagact ggcaaacgca gtacgagcgc tgccgtcctt 1560gaggcactcc
gcgaggctca ccctattgta gaaaagatcc tgcaataccg tgagttgacg
1620aagcttaaaa gcacttatat tgatcctctc ccggatctga tccatcctcg
taccggccgc 1680ttgcacacac gtttcaacca gacggcgact gcaaccggcc
gtctgtctag ctcggatcca 1740aatctccaga acattccggt ccgtacaccc
ttgggccaac gtatccgccg ggcgtttatc 1800gctgaggaag gatggttact
ggtcgcattg gactactcgc agattgagct gcgcgtcctc 1860gcacatctct
ctggtgacga aaatttaatc cgcgtgtttc aagaggggcg tgatattcac
1920acagaaactg cctcatggat gttcggtgtc ccacgtgaag cagtggatcc
tttgatgcgc 1980cgtgcagcta aaacaattaa ttttggagtg ctgtacggaa
tgagcgctca tcgcttgagt 2040caggaactgg caatccccta cgaggaagcg
caggcattca tcgaacgtta ctttcaatcg 2100tttccgaaag ttcgcgcatg
gatcgagaag acgctcgagg aaggtcgtcg tcggggctat 2160gtcgaaactc
tgtttggtcg ccgtcggtac gtaccagatc ttgaagcccg cgtcaaatcg
2220gtacgggagg ctgcggagcg tatggcattt aatatgcctg tacagggtac
tgcagctgac 2280ctcatgaaac tggcaatggt caagcttttc ccgcgcttgg
aggaaatggg cgcacgtatg 2340cttctgcagg tcagcgacga gctggtgtta
gaagccccta aggagcgcgc cgaagctgtc 2400gcgcgcctcg ctaaagaagt
gatggagggc gtttacccat tggccgtacc cctcgaagtg 2460gaggtcggta
ttggagaaga ttggttatct gcaaaggaag cggccgc 2507149834PRTArtificial
SequenceAMINO ACID SEQUENCE OF MUTANT ID 21 (H784S) 149Met Arg Gly
Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val Leu Leu1 5 10 15Val Asp
Gly His His Leu Ala Tyr Arg Thr Phe His Ala Leu Lys Gly 20 25 30Leu
Thr Thr Ser Arg Gly Glu Pro Val Gln Ala Val Tyr Gly Phe Ala 35 40
45Lys Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala Val Ile Val
50 55 60Val Phe Asp Ala Lys Ala Pro Ser Phe Arg His Glu Ala Tyr Gly
Gly65 70 75 80Tyr Lys Ala Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro
Arg Gln Leu 85 90 95Ala Leu Ile Lys Glu Leu Val Asp Leu Leu Gly Leu
Ala Arg Leu Glu 100 105 110Val Pro Gly Tyr Glu Ala Asp Asp Val Leu
Ala Ser Leu Ala Lys Lys 115 120 125Ala Glu Lys Glu Gly Tyr Glu Val
Arg Ile Leu Thr Ala Asp Lys Asp 130 135 140Leu Tyr Gln Leu Leu Ser
Asp Arg Ile His Val Leu His Pro Glu Gly145 150 155 160Tyr Leu Ile
Thr Pro Ala Trp Leu Trp Glu Lys Tyr Gly Leu Arg Pro 165 170 175Asp
Gln Trp Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu Ser Asp Asn 180 185
190Leu Pro Gly Val Lys Gly Ile Gly Glu Lys Thr Ala Arg Lys Leu Leu
195 200 205Glu Glu Trp Gly Ser Leu Glu Ala Leu Leu Lys Asn Leu Asp
Arg Leu 210 215 220Lys Pro Ala Ile Arg Glu Lys Ile Leu Ala His Met
Asp Asp Leu Lys225 230 235 240Leu Ser Trp Asp Leu Ala Lys Val Arg
Thr Asp Leu Pro Leu Glu Val 245 250 255Asp Phe Ala Lys Arg Arg Glu
Pro Asp Arg Glu Arg Leu Arg Ala Phe 260 265 270Leu Glu Arg Leu Glu
Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu 275 280 285Glu Ser Pro
Lys Ala Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly 290 295 300Ala
Phe Val Gly Phe Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp305 310
315 320Leu Leu Ala Leu Ala Ala Ala Arg Gly Gly Arg Val His Arg Ala
Pro 325 330 335Glu Pro Tyr Lys Ala Leu Arg Asp Leu Lys Glu Ala Arg
Gly Leu Leu 340 345 350Ala Lys Asp Leu Ser Val Leu Ala Leu Arg Glu
Gly Leu Gly Leu Pro 355 360 365Pro Gly Asp Asp Pro Met Leu Leu Ala
Tyr Leu Leu Asp Pro Ser Asn 370 375 380Thr Thr Pro Glu Gly Val Ala
Arg Arg Tyr Gly Gly Glu Trp Thr Glu385 390 395 400Glu Ala Gly Glu
Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu 405 410 415Trp Gly
Arg Leu Glu Gly Glu Glu Arg Leu Leu Trp Leu Tyr Arg Glu 420 425
430Val Glu Arg Pro Leu Ser Ala Val Leu Ala His Met Glu Ala Thr Gly
435 440 445Val Arg Leu Asp Val Ala Tyr Leu Arg Ala Leu Ser Leu Glu
Val Ala 450 455 460Glu Glu Ile Ala Arg Leu Glu Ala Glu Val Phe Arg
Leu Ala Gly His465 470 475 480Pro Phe Asn Leu Asn Ser Arg Asp Gln
Leu Glu Arg Val Leu Phe Asp 485 490 495Glu Leu Gly Leu Pro Ala Ile
Gly Lys Thr Glu Lys Thr Gly Lys Arg 500 505 510Ser Thr Ser Ala Ala
Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile 515 520 525Val Glu Lys
Ile Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser Thr 530 535 540Tyr
Ile Asp Pro Leu Pro Asp Leu Ile His Pro Arg Thr Gly Arg Leu545 550
555 560His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser
Ser 565 570 575Ser Asp Pro Asn Leu Gln Asn Ile Pro Val Arg Thr Pro
Leu Gly Gln 580 585 590Arg Ile Arg Arg Ala Phe Ile Ala Glu Glu Gly
Trp Leu Leu Val Ala 595 600 605Leu Asp Tyr Ser Gln Ile Glu Leu Arg
Val Leu Ala His Leu Ser Gly 610 615 620Asp Glu Asn Leu Ile Arg Val
Phe Gln Glu Gly Arg Asp Ile His Thr625 630 635 640Glu Thr Ala Ser
Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp Pro 645 650 655Leu Met
Arg Arg Ala Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr Gly 660 665
670Met Ser Ala His Arg Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu
675 680 685Ala Gln Ala Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys
Val Arg 690 695 700Ala Trp Ile Glu Lys Thr Leu Glu Glu Gly Arg Arg
Arg Gly Tyr Val705 710 715 720Glu Thr Leu Phe Gly Arg Arg Arg Tyr
Val Pro Asp Leu Glu Ala Arg 725 730 735Val Lys Ser Val Arg Glu Ala
Ala Glu Arg Met Ala Phe Asn Met Pro 740 745 750Val Gln Gly Thr Ala
Ala Asp Leu Met Lys Leu Ala Met Val Lys Leu 755 760 765Phe Pro Arg
Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln Val Ser 770 775 780Asp
Glu Leu Val Leu Glu Ala Pro Lys Glu Arg Ala Glu Ala Val Ala785 790
795 800Arg Leu Ala Lys Glu Val Met Glu Gly Val Tyr Pro Leu Ala Val
Pro 805 810 815Leu Glu Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ser
Ala Lys Glu 820 825 830Ala Ala1502507DNAArtificial
SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 22 (H784T) 150catatgcgtg
gtatgctgcc gttgttcgag cctaaaggcc gcgtactgtt agtcgatggt 60catcacttgg
cctatcggac gttccatgca ctcaaaggtc tgacgaccag tcgtggcgaa
120ccggtccagg ctgtttatgg tttcgctaag tctttgctca aagcactgaa
agaagacggg 180gacgcggtaa ttgttgtatt tgatgccaaa gcaccgagct
tccgccacga agcttatggt 240ggctacaagg caggacgcgc ccctacccca
gaagatttcc cccgtcagct ggcattaatt 300aaggagttag tagaccttct
cggcttagcg cgtctggaag ttccgggtta tgaggcggac 360gatgtccttg
catccttggc taaaaaggcc gaaaaagagg gctacgaagt ccgcatcttg
420acggcagaca aagatctgta ccagcttctg tctgaccgta ttcatgtttt
gcaccctgaa 480ggctacttaa tcactccggc ctggctctgg gaaaagtacg
gtctgcgtcc cgatcagtgg 540gcggattatc gggctttgac gggagatgag
agcgacaacc tgccaggagt taagggcatt 600ggtgaaaaaa ccgcacgtaa
gctgcttgaa gagtggggtt ccctggaagc cttgttaaaa 660aatctggatc
gtctcaagcc cgcaattcgt gaaaagatcc tggctcatat ggacgatctt
720aaattaagtt gggacctggc caaggtgcgc accgatttac cgcttgaagt
ggattttgca 780aaacgccgtg agccggaccg ggaacgttta cgcgctttct
tagagcgtct ggaattcggt 840tcactgcttc atgaattcgg tctgttagag
tctcctaaag cactcgaaga ggcaccgtgg 900ccgcccccag aaggtgcttt
tgttggcttc gtactttccc gtaaggagcc tatgtgggca 960gatcttctgg
ctttagcggc tgcacgcggt ggccgtgttc accgggcccc tgagccatac
1020aaagcgttac gtgatctgaa ggaagcacgt ggcttgctgg caaaagacct
ttctgttttg 1080gccctgcgcg agggtcttgg actgccgcca ggcgacgatc
ccatgttatt ggcctatctg 1140ttagacccta gcaataccac acctgaaggg
gtcgctcgtc ggtatggcgg tgaatggact 1200gaggaagccg gagagcgcgc
cgcattgtcc gaacggctct ttgcaaactt atggggtcgt 1260ctggaagggg
aggaacgtct gttatggttg tatcgggaag tcgaacgtcc tctttcggcc
1320gtattagcgc atatggaggc aacaggtgtg cgtttagatg tcgcgtacct
tcgggcctta 1380tcactggaag ttgcagagga aatcgcccgt ctcgaggctg
aagtgttccg gttggccggt 1440cacccgttta acctcaactc ccgtgaccag
ctggaacgcg ttttattcga tgagcttggg 1500cttcccgcaa ttggcaaaac
cgaaaagact ggcaaacgca gtacgagcgc tgccgtcctt 1560gaggcactcc
gcgaggctca ccctattgta gaaaagatcc tgcaataccg tgagttgacg
1620aagcttaaaa gcacttatat tgatcctctc ccggatctga tccatcctcg
taccggccgc 1680ttgcacacac gtttcaacca gacggcgact gcaaccggcc
gtctgtctag ctcggatcca 1740aatctccaga acattccggt ccgtacaccc
ttgggccaac gtatccgccg ggcgtttatc 1800gctgaggaag gatggttact
ggtcgcattg gactactcgc agattgagct gcgcgtcctc 1860gcacatctct
ctggtgacga aaatttaatc cgcgtgtttc aagaggggcg tgatattcac
1920acagaaactg cctcatggat gttcggtgtc ccacgtgaag cagtggatcc
tttgatgcgc 1980cgtgcagcta aaacaattaa ttttggagtg ctgtacggaa
tgagcgctca tcgcttgagt 2040caggaactgg caatccccta cgaggaagcg
caggcattca tcgaacgtta ctttcaatcg 2100tttccgaaag ttcgcgcatg
gatcgagaag acgctcgagg aaggtcgtcg tcggggctat 2160gtcgaaactc
tgtttggtcg ccgtcggtac gtaccagatc ttgaagcccg cgtcaaatcg
2220gtacgggagg ctgcggagcg tatggcattt aatatgcctg tacagggtac
tgcagctgac 2280ctcatgaaac tggcaatggt caagcttttc ccgcgcttgg
aggaaatggg cgcacgtatg 2340cttctgcagg tcacggacga gctggtgtta
gaagccccta aggagcgcgc cgaagctgtc 2400gcgcgcctcg ctaaagaagt
gatggagggc gtttacccat tggccgtacc cctcgaagtg 2460gaggtcggta
ttggagaaga ttggttatct gcaaaggaag cggccgc 2507151834PRTArtificial
SequenceAMINO ACID SEQUENCE OF MUTANT ID 22 (H784T) 151Met Arg Gly
Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val Leu Leu1 5 10 15Val Asp
Gly His His Leu Ala Tyr Arg Thr Phe His Ala Leu Lys Gly 20 25 30Leu
Thr Thr Ser Arg Gly Glu Pro Val Gln Ala Val Tyr Gly Phe Ala 35 40
45Lys Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala Val Ile Val
50 55 60Val Phe Asp Ala Lys Ala Pro Ser Phe Arg His Glu Ala Tyr Gly
Gly65 70 75 80Tyr Lys Ala Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro
Arg Gln Leu 85 90 95Ala Leu Ile Lys Glu Leu Val Asp Leu Leu Gly Leu
Ala Arg Leu Glu 100 105 110Val Pro Gly Tyr Glu Ala Asp Asp Val Leu
Ala Ser Leu Ala Lys Lys 115 120 125Ala Glu Lys Glu Gly Tyr Glu Val
Arg Ile Leu Thr Ala Asp Lys Asp 130 135 140Leu Tyr Gln Leu Leu Ser
Asp Arg Ile His Val Leu His Pro Glu Gly145 150 155 160Tyr Leu Ile
Thr Pro Ala Trp Leu Trp Glu Lys Tyr Gly Leu Arg Pro 165 170 175Asp
Gln Trp Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu Ser Asp Asn 180 185
190Leu Pro Gly Val Lys Gly Ile Gly Glu Lys Thr Ala Arg Lys Leu Leu
195 200 205Glu Glu Trp Gly Ser Leu Glu Ala Leu Leu Lys Asn Leu Asp
Arg Leu 210 215 220Lys Pro Ala Ile Arg Glu Lys Ile Leu Ala His Met
Asp Asp Leu Lys225 230 235 240Leu Ser Trp Asp Leu Ala Lys Val Arg
Thr Asp Leu Pro Leu Glu Val 245 250 255Asp Phe Ala Lys Arg Arg Glu
Pro Asp Arg Glu Arg Leu Arg Ala Phe 260 265 270Leu Glu Arg Leu Glu
Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu 275 280 285Glu Ser Pro
Lys Ala Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly 290 295 300Ala
Phe Val Gly Phe Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp305 310
315 320Leu Leu Ala Leu Ala Ala Ala Arg Gly Gly Arg Val His Arg Ala
Pro 325 330 335Glu Pro Tyr Lys Ala Leu Arg Asp Leu Lys Glu Ala Arg
Gly Leu Leu 340 345 350Ala Lys Asp Leu Ser Val Leu Ala Leu Arg Glu
Gly Leu Gly Leu Pro 355 360 365Pro Gly Asp Asp Pro Met Leu Leu Ala
Tyr Leu Leu Asp Pro Ser Asn 370 375 380Thr Thr Pro Glu Gly Val Ala
Arg Arg Tyr Gly Gly Glu Trp Thr Glu385 390 395 400Glu Ala Gly Glu
Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu 405 410 415Trp Gly
Arg Leu Glu Gly Glu Glu Arg Leu Leu Trp Leu Tyr Arg Glu 420 425
430Val Glu Arg Pro Leu Ser Ala Val Leu Ala His Met Glu Ala Thr Gly
435 440 445Val Arg Leu Asp Val Ala Tyr Leu Arg Ala Leu Ser Leu Glu
Val Ala 450 455 460Glu Glu Ile Ala Arg Leu Glu Ala Glu Val Phe Arg
Leu Ala Gly His465 470 475 480Pro Phe Asn Leu Asn Ser Arg Asp Gln
Leu Glu Arg Val Leu Phe Asp 485 490 495Glu Leu Gly Leu Pro Ala Ile
Gly Lys Thr Glu Lys Thr Gly Lys Arg 500 505 510Ser Thr Ser Ala Ala
Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile 515 520 525Val Glu Lys
Ile Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser Thr 530 535 540Tyr
Ile Asp Pro Leu Pro Asp Leu Ile His Pro Arg Thr Gly Arg Leu545 550
555 560His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser
Ser 565 570 575Ser Asp Pro Asn Leu Gln Asn Ile Pro Val Arg Thr Pro
Leu Gly Gln 580 585 590Arg Ile Arg Arg Ala Phe Ile Ala Glu Glu Gly
Trp Leu Leu Val Ala 595 600 605Leu Asp Tyr Ser Gln Ile Glu Leu Arg
Val Leu Ala His Leu Ser Gly 610 615 620Asp Glu Asn Leu Ile Arg Val
Phe Gln Glu Gly Arg Asp Ile His Thr625 630 635 640Glu Thr Ala Ser
Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp Pro 645 650 655Leu Met
Arg Arg Ala Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr Gly 660 665
670Met Ser Ala His Arg Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu
675 680 685Ala Gln Ala Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys
Val Arg 690 695 700Ala Trp Ile Glu Lys Thr Leu Glu Glu Gly Arg Arg
Arg Gly Tyr Val705 710 715 720Glu Thr Leu Phe Gly Arg Arg Arg Tyr
Val Pro Asp Leu Glu Ala
Arg 725 730 735Val Lys Ser Val Arg Glu Ala Ala Glu Arg Met Ala Phe
Asn Met Pro 740 745 750Val Gln Gly Thr Ala Ala Asp Leu Met Lys Leu
Ala Met Val Lys Leu 755 760 765Phe Pro Arg Leu Glu Glu Met Gly Ala
Arg Met Leu Leu Gln Val Thr 770 775 780Asp Glu Leu Val Leu Glu Ala
Pro Lys Glu Arg Ala Glu Ala Val Ala785 790 795 800Arg Leu Ala Lys
Glu Val Met Glu Gly Val Tyr Pro Leu Ala Val Pro 805 810 815Leu Glu
Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu 820 825
830Ala Ala1521964DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF
MUTANT ID 24 (H784V). 152gattatcggg ctttgacggg agatgagagc
gacaacctgc caggagttaa gggcattggt 60gaaaaaaccg cacgtaagct gcttgaagag
tggggttccc tggaagcctt gttaaaaaat 120ctggatcgtc tcaagcccgc
aattcgtgaa aagatcctgg ctcatatgga cgatcttaaa 180ttaagttggg
acctggccaa ggtgcgcacc gatttaccgc ttgaagtgga ttttgcaaaa
240cgccgtgagc cggaccggga acgtttacgc gctttcttag agcgtctgga
attcggttca 300ctgcttcatg aattcggtct gttagagtct cctaaagcac
tcgaagaggc accgtggccg 360cccccagaag gtgcttttgt tggcttcgta
ctttcccgta aggagcctat gtgggcagat 420cttctggctt tagcggctgc
acgcggtggc cgtgttcacc gggcccctga gccatacaaa 480gcgttacgtg
atctgaagga agcacgtggc ttgctggcaa aagacctttc tgttttggcc
540ctgcgcgagg gtcttggact gccgccaggc gacgatccca tgttattggc
ctatctgtta 600gaccctagca ataccacacc tgaaggggtc gctcgtcggt
atggcggtga atggactgag 660gaagccggag agcgcgccgc attgtccgaa
cggctctttg caaacttatg gggtcgtctg 720gaaggggagg aacgtctgtt
atggttgtat cgggaagtcg aacgtcctct ttcggccgta 780ttagcgcata
tggaggcaac aggtgtgcgt ttagatgtcg cgtaccttcg ggccttatca
840ctggaagttg cagaggaaat cgcccgtctc gaggctgaag tgttccggtt
ggccggtcac 900ccgtttaacc tcaactcccg tgaccagctg gaacgcgttt
tattcgatga gcttgggctt 960cccgcaattg gcaaaaccga aaagactggc
aaacgcagta cgagcgctgc cgtccttgag 1020gcactccgcg aggctcaccc
tattgtagaa aagatcctgc aataccgtga gttgacgaag 1080cttaaaagca
cttatattga tcctctcccg gatctgatcc atcctcgtac cggccgcttg
1140cacacacgtt tcaaccagac ggcgactgca accggccgtc tgtctagctc
ggatccaaat 1200ctccagaaca ttccggtccg tacacccttg ggccaacgta
tccgccgggc gtttatcgct 1260gaggaaggat ggttactggt cgcattggac
tactcgcaga ttgagctgcg cgtcctcgca 1320catctctctg gtgacgaaaa
tttaatccgc gtgtttcaag aggggcgtga tattcacaca 1380gaaactgcct
catggatgtt cggtgtccca cgtgaagcag tggatccttt gatgcgccgt
1440gcagctaaaa caattaattt tggagtgctg tacggaatga gcgctcatcg
cttgagtcag 1500gaactggcaa tcccctacga ggaagcgcag gcattcatcg
aacgttactt tcaatcgttt 1560ccgaaagttc gcgcatggat cgagaagacg
ctcgaggaag gtcgtcgtcg gggctatgtc 1620gaaactctgt ttggtcgccg
tcggtacgta ccagatcttg aagcccgcgt caaatcggta 1680cgggaggctg
cggagcgtat ggcatttaat atgcctgtac agggtactgc agctgacctc
1740atgaaactgg caatggtcaa gcttttcccg cgcttggagg aaatgggcgc
acgtatgctt 1800ctgcaggtcg tagacgagct ggtgttagaa gcccctaagg
agcgcgccga agctgtcgcg 1860cgcctcgcta aagaagtgat ggagggcgtt
tacccattgg ccgtacccct cgaagtggag 1920gtcggtattg gagaagattg
gttatctgca aaggaagcgg ccgc 1964153834PRTArtificial SequenceAMINO
ACID SEQUENCE OF MUTANT ID 24 (H784V). 153Met Arg Gly Met Leu Pro
Leu Phe Glu Pro Lys Gly Arg Val Leu Leu1 5 10 15Val Asp Gly His His
Leu Ala Tyr Arg Thr Phe His Ala Leu Lys Gly 20 25 30Leu Thr Thr Ser
Arg Gly Glu Pro Val Gln Ala Val Tyr Gly Phe Ala 35 40 45Lys Ser Leu
Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala Val Ile Val 50 55 60Val Phe
Asp Ala Lys Ala Pro Ser Phe Arg His Glu Ala Tyr Gly Gly65 70 75
80Tyr Lys Ala Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg Gln Leu
85 90 95Ala Leu Ile Lys Glu Leu Val Asp Leu Leu Gly Leu Ala Arg Leu
Glu 100 105 110Val Pro Gly Tyr Glu Ala Asp Asp Val Leu Ala Ser Leu
Ala Lys Lys 115 120 125Ala Glu Lys Glu Gly Tyr Glu Val Arg Ile Leu
Thr Ala Asp Lys Asp 130 135 140Leu Tyr Gln Leu Leu Ser Asp Arg Ile
His Val Leu His Pro Glu Gly145 150 155 160Tyr Leu Ile Thr Pro Ala
Trp Leu Trp Glu Lys Tyr Gly Leu Arg Pro 165 170 175Asp Gln Trp Ala
Asp Tyr Arg Ala Leu Thr Gly Asp Glu Ser Asp Asn 180 185 190Leu Pro
Gly Val Lys Gly Ile Gly Glu Lys Thr Ala Arg Lys Leu Leu 195 200
205Glu Glu Trp Gly Ser Leu Glu Ala Leu Leu Lys Asn Leu Asp Arg Leu
210 215 220Lys Pro Ala Ile Arg Glu Lys Ile Leu Ala His Met Asp Asp
Leu Lys225 230 235 240Leu Ser Trp Asp Leu Ala Lys Val Arg Thr Asp
Leu Pro Leu Glu Val 245 250 255Asp Phe Ala Lys Arg Arg Glu Pro Asp
Arg Glu Arg Leu Arg Ala Phe 260 265 270Leu Glu Arg Leu Glu Phe Gly
Ser Leu Leu His Glu Phe Gly Leu Leu 275 280 285Glu Ser Pro Lys Ala
Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly 290 295 300Ala Phe Val
Gly Phe Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp305 310 315
320Leu Leu Ala Leu Ala Ala Ala Arg Gly Gly Arg Val His Arg Ala Pro
325 330 335Glu Pro Tyr Lys Ala Leu Arg Asp Leu Lys Glu Ala Arg Gly
Leu Leu 340 345 350Ala Lys Asp Leu Ser Val Leu Ala Leu Arg Glu Gly
Leu Gly Leu Pro 355 360 365Pro Gly Asp Asp Pro Met Leu Leu Ala Tyr
Leu Leu Asp Pro Ser Asn 370 375 380Thr Thr Pro Glu Gly Val Ala Arg
Arg Tyr Gly Gly Glu Trp Thr Glu385 390 395 400Glu Ala Gly Glu Arg
Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu 405 410 415Trp Gly Arg
Leu Glu Gly Glu Glu Arg Leu Leu Trp Leu Tyr Arg Glu 420 425 430Val
Glu Arg Pro Leu Ser Ala Val Leu Ala His Met Glu Ala Thr Gly 435 440
445Val Arg Leu Asp Val Ala Tyr Leu Arg Ala Leu Ser Leu Glu Val Ala
450 455 460Glu Glu Ile Ala Arg Leu Glu Ala Glu Val Phe Arg Leu Ala
Gly His465 470 475 480Pro Phe Asn Leu Asn Ser Arg Asp Gln Leu Glu
Arg Val Leu Phe Asp 485 490 495Glu Leu Gly Leu Pro Ala Ile Gly Lys
Thr Glu Lys Thr Gly Lys Arg 500 505 510Ser Thr Ser Ala Ala Val Leu
Glu Ala Leu Arg Glu Ala His Pro Ile 515 520 525Val Glu Lys Ile Leu
Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser Thr 530 535 540Tyr Ile Asp
Pro Leu Pro Asp Leu Ile His Pro Arg Thr Gly Arg Leu545 550 555
560His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser
565 570 575Ser Asp Pro Asn Leu Gln Asn Ile Pro Val Arg Thr Pro Leu
Gly Gln 580 585 590Arg Ile Arg Arg Ala Phe Ile Ala Glu Glu Gly Trp
Leu Leu Val Ala 595 600 605Leu Asp Tyr Ser Gln Ile Glu Leu Arg Val
Leu Ala His Leu Ser Gly 610 615 620Asp Glu Asn Leu Ile Arg Val Phe
Gln Glu Gly Arg Asp Ile His Thr625 630 635 640Glu Thr Ala Ser Trp
Met Phe Gly Val Pro Arg Glu Ala Val Asp Pro 645 650 655Leu Met Arg
Arg Ala Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr Gly 660 665 670Met
Ser Ala His Arg Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu 675 680
685Ala Gln Ala Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg
690 695 700Ala Trp Ile Glu Lys Thr Leu Glu Glu Gly Arg Arg Arg Gly
Tyr Val705 710 715 720Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro
Asp Leu Glu Ala Arg 725 730 735Val Lys Ser Val Arg Glu Ala Ala Glu
Arg Met Ala Phe Asn Met Pro 740 745 750Val Gln Gly Thr Ala Ala Asp
Leu Met Lys Leu Ala Met Val Lys Leu 755 760 765Phe Pro Arg Leu Glu
Glu Met Gly Ala Arg Met Leu Leu Gln Val Val 770 775 780Asp Glu Leu
Val Leu Glu Ala Pro Lys Glu Arg Ala Glu Ala Val Ala785 790 795
800Arg Leu Ala Lys Glu Val Met Glu Gly Val Tyr Pro Leu Ala Val Pro
805 810 815Leu Glu Val Glu Val Gly Ile Gly Glu Asp Trp Leu Ser Ala
Lys Glu 820 825 830Ala Ala1542507DNAArtificial SequenceNUCLEOTIDE
SEQUENCE OF MUTANT ID 26 (H784I) 154catatgcgtg gtatgctgcc
gttgttcgag cctaaaggcc gcgtactgtt agtcgatggt 60catcacttgg cctatcggac
gttccatgca ctcaaaggtc tgacgaccag tcgtggcgaa 120ccggtccagg
ctgtttatgg tttcgctaag tctttgctca aagcactgaa agaagacggg
180gacgcggtaa ttgttgtatt tgatgccaaa gcaccgagct tccgccacga
agcttatggt 240ggctacaagg caggacgcgc ccctacccca gaagatttcc
cccgtcagct ggcattaatt 300aaggagttag tagaccttct cggcttagcg
cgtctggaag ttccgggtta tgaggcggac 360gatgtccttg catccttggc
taaaaaggcc gaaaaagagg gctacgaagt ccgcatcttg 420acggcagaca
aagatctgta ccagcttctg tctgaccgta ttcatgtttt gcaccctgaa
480ggctacttaa tcactccggc ctggctctgg gaaaagtacg gtctgcgtcc
cgatcagtgg 540gcggattatc gggctttgac gggagatgag agcgacaacc
tgccaggagt taagggcatt 600ggtgaaaaaa ccgcacgtaa gctgcttgaa
gagtggggtt ccctggaagc cttgttaaaa 660aatctggatc gtctcaagcc
cgcaattcgt gaaaagatcc tggctcatat ggacgatctt 720aaattaagtt
gggacctggc caaggtgcgc accgatttac cgcttgaagt ggattttgca
780aaacgccgtg agccggaccg ggaacgttta cgcgctttct tagagcgtct
ggaattcggt 840tcactgcttc atgaattcgg tctgttagag tctcctaaag
cactcgaaga ggcaccgtgg 900ccgcccccag aaggtgcttt tgttggcttc
gtactttccc gtaaggagcc tatgtgggca 960gatcttctgg ctttagcggc
tgcacgcggt ggccgtgttc accgggcccc tgagccatac 1020aaagcgttac
gtgatctgaa ggaagcacgt ggcttgctgg caaaagacct ttctgttttg
1080gccctgcgcg agggtcttgg actgccgcca ggcgacgatc ccatgttatt
ggcctatctg 1140ttagacccta gcaataccac acctgaaggg gtcgctcgtc
ggtatggcgg tgaatggact 1200gaggaagccg gagagcgcgc cgcattgtcc
gaacggctct ttgcaaactt atggggtcgt 1260ctggaagggg aggaacgtct
gttatggttg tatcgggaag tcgaacgtcc tctttcggcc 1320gtattagcgc
atatggaggc aacaggtgtg cgtttagatg tcgcgtacct tcgggcctta
1380tcactggaag ttgcagagga aatcgcccgt ctcgaggctg aagtgttccg
gttggccggt 1440cacccgttta acctcaactc ccgtgaccag ctggaacgcg
ttttattcga tgagcttggg 1500cttcccgcaa ttggcaaaac cgaaaagact
ggcaaacgca gtacgagcgc tgccgtcctt 1560gaggcactcc gcgaggctca
ccctattgta gaaaagatcc tgcaataccg tgagttgacg 1620aagcttaaaa
gcacttatat tgatcctctc ccggatctga tccatcctcg taccggccgc
1680ttgcacacac gtttcaacca gacggcgact gcaaccggcc gtctgtctag
ctcggatcca 1740aatctccaga acattccggt ccgtacaccc ttgggccaac
gtatccgccg ggcgtttatc 1800gctgaggaag gatggttact ggtcgcattg
gactactcgc agattgagct gcgcgtcctc 1860gcacatctct ctggtgacga
aaatttaatc cgcgtgtttc aagaggggcg tgatattcac 1920acagaaactg
cctcatggat gttcggtgtc ccacgtgaag cagtggatcc tttgatgcgc
1980cgtgcagcta aaacaattaa ttttggagtg ctgtacggaa tgagcgctca
tcgcttgagt 2040caggaactgg caatccccta cgaggaagcg caggcattca
tcgaacgtta ctttcaatcg 2100tttccgaaag ttcgcgcatg gatcgagaag
acgctcgagg aaggtcgtcg tcggggctat 2160gtcgaaactc tgtttggtcg
ccgtcggtac gtaccagatc ttgaagcccg cgtcaaatcg 2220gtacgggagg
ctgcggagcg tatggcattt aatatgcctg tacagggtac tgcagctgac
2280ctcatgaaac tggcaatggt caagcttttc ccgcgcttgg aggaaatggg
cgcacgtatg 2340cttctgcagg tcattgacga gctggtgtta gaagccccta
aggagcgcgc cgaagctgtc 2400gcgcgcctcg ctaaagaagt gatggagggc
gtttacccat tggccgtacc cctcgaagtg 2460gaggtcggta ttggagaaga
ttggttatct gcaaaggaag cggccgc 2507155834PRTArtificial SequenceAMINO
ACID SEQUENCE OF MUTANT ID 26 (H784I) 155Met Arg Gly Met Leu Pro
Leu Phe Glu Pro Lys Gly Arg Val Leu Leu1 5 10 15Val Asp Gly His His
Leu Ala Tyr Arg Thr Phe His Ala Leu Lys Gly 20 25 30Leu Thr Thr Ser
Arg Gly Glu Pro Val Gln Ala Val Tyr Gly Phe Ala 35 40 45Lys Ser Leu
Leu Lys Ala Leu Lys Glu Asp Gly Asp Ala Val Ile Val 50 55 60Val Phe
Asp Ala Lys Ala Pro Ser Phe Arg His Glu Ala Tyr Gly Gly65 70 75
80Tyr Lys Ala Gly Arg Ala Pro Thr Pro Glu Asp Phe Pro Arg Gln Leu
85 90 95Ala Leu Ile Lys Glu Leu Val Asp Leu Leu Gly Leu Ala Arg Leu
Glu 100 105 110Val Pro Gly Tyr Glu Ala Asp Asp Val Leu Ala Ser Leu
Ala Lys Lys 115 120 125Ala Glu Lys Glu Gly Tyr Glu Val Arg Ile Leu
Thr Ala Asp Lys Asp 130 135 140Leu Tyr Gln Leu Leu Ser Asp Arg Ile
His Val Leu His Pro Glu Gly145 150 155 160Tyr Leu Ile Thr Pro Ala
Trp Leu Trp Glu Lys Tyr Gly Leu Arg Pro 165 170 175Asp Gln Trp Ala
Asp Tyr Arg Ala Leu Thr Gly Asp Glu Ser Asp Asn 180 185 190Leu Pro
Gly Val Lys Gly Ile Gly Glu Lys Thr Ala Arg Lys Leu Leu 195 200
205Glu Glu Trp Gly Ser Leu Glu Ala Leu Leu Lys Asn Leu Asp Arg Leu
210 215 220Lys Pro Ala Ile Arg Glu Lys Ile Leu Ala His Met Asp Asp
Leu Lys225 230 235 240Leu Ser Trp Asp Leu Ala Lys Val Arg Thr Asp
Leu Pro Leu Glu Val 245 250 255Asp Phe Ala Lys Arg Arg Glu Pro Asp
Arg Glu Arg Leu Arg Ala Phe 260 265 270Leu Glu Arg Leu Glu Phe Gly
Ser Leu Leu His Glu Phe Gly Leu Leu 275 280 285Glu Ser Pro Lys Ala
Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly 290 295 300Ala Phe Val
Gly Phe Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp305 310 315
320Leu Leu Ala Leu Ala Ala Ala Arg Gly Gly Arg Val His Arg Ala Pro
325 330 335Glu Pro Tyr Lys Ala Leu Arg Asp Leu Lys Glu Ala Arg Gly
Leu Leu 340 345 350Ala Lys Asp Leu Ser Val Leu Ala Leu Arg Glu Gly
Leu Gly Leu Pro 355 360 365Pro Gly Asp Asp Pro Met Leu Leu Ala Tyr
Leu Leu Asp Pro Ser Asn 370 375 380Thr Thr Pro Glu Gly Val Ala Arg
Arg Tyr Gly Gly Glu Trp Thr Glu385 390 395 400Glu Ala Gly Glu Arg
Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu 405 410 415Trp Gly Arg
Leu Glu Gly Glu Glu Arg Leu Leu Trp Leu Tyr Arg Glu 420 425 430Val
Glu Arg Pro Leu Ser Ala Val Leu Ala His Met Glu Ala Thr Gly 435 440
445Val Arg Leu Asp Val Ala Tyr Leu Arg Ala Leu Ser Leu Glu Val Ala
450 455 460Glu Glu Ile Ala Arg Leu Glu Ala Glu Val Phe Arg Leu Ala
Gly His465 470 475 480Pro Phe Asn Leu Asn Ser Arg Asp Gln Leu Glu
Arg Val Leu Phe Asp 485 490 495Glu Leu Gly Leu Pro Ala Ile Gly Lys
Thr Glu Lys Thr Gly Lys Arg 500 505 510Ser Thr Ser Ala Ala Val Leu
Glu Ala Leu Arg Glu Ala His Pro Ile 515 520 525Val Glu Lys Ile Leu
Gln Tyr Arg Glu Leu Thr Lys Leu Lys Ser Thr 530 535 540Tyr Ile Asp
Pro Leu Pro Asp Leu Ile His Pro Arg Thr Gly Arg Leu545 550 555
560His Thr Arg Phe Asn Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser
565 570 575Ser Asp Pro Asn Leu Gln Asn Ile Pro Val Arg Thr Pro Leu
Gly Gln 580 585 590Arg Ile Arg Arg Ala Phe Ile Ala Glu Glu Gly Trp
Leu Leu Val Ala 595 600 605Leu Asp Tyr Ser Gln Ile Glu Leu Arg Val
Leu Ala His Leu Ser Gly 610 615 620Asp Glu Asn Leu Ile Arg Val Phe
Gln Glu Gly Arg Asp Ile His Thr625 630 635 640Glu Thr Ala Ser Trp
Met Phe Gly Val Pro Arg Glu Ala Val Asp Pro 645 650 655Leu Met Arg
Arg Ala Ala Lys Thr Ile Asn Phe Gly Val Leu Tyr Gly 660 665 670Met
Ser Ala His Arg Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu 675 680
685Ala Gln Ala Phe Ile Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg
690 695 700Ala Trp Ile Glu Lys Thr Leu Glu Glu Gly Arg Arg Arg Gly
Tyr Val705 710 715 720Glu Thr Leu Phe Gly Arg Arg Arg Tyr Val Pro
Asp Leu Glu Ala Arg 725 730 735Val Lys Ser Val Arg Glu Ala Ala Glu
Arg Met Ala Phe Asn Met Pro 740
745 750Val Gln Gly Thr Ala Ala Asp Leu Met Lys Leu Ala Met Val Lys
Leu 755 760 765Phe Pro Arg Leu Glu Glu Met Gly Ala Arg Met Leu Leu
Gln Val Val 770 775 780Asp Glu Leu Val Leu Glu Ala Pro Lys Glu Arg
Ala Glu Ala Val Ala785 790 795 800Arg Leu Ala Lys Glu Val Met Glu
Gly Val Tyr Pro Leu Ala Val Pro 805 810 815Leu Glu Val Glu Val Gly
Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu 820 825 830Ala
Ala1562507DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 27
(H784M) 156catatgcgtg gtatgctgcc gttgttcgag cctaaaggcc gcgtactgtt
agtcgatggt 60catcacttgg cctatcggac gttccatgca ctcaaaggtc tgacgaccag
tcgtggcgaa 120ccggtccagg ctgtttatgg tttcgctaag tctttgctca
aagcactgaa agaagacggg 180gacgcggtaa ttgttgtatt tgatgccaaa
gcaccgagct tccgccacga agcttatggt 240ggctacaagg caggacgcgc
ccctacccca gaagatttcc cccgtcagct ggcattaatt 300aaggagttag
tagaccttct cggcttagcg cgtctggaag ttccgggtta tgaggcggac
360gatgtccttg catccttggc taaaaaggcc gaaaaagagg gctacgaagt
ccgcatcttg 420acggcagaca aagatctgta ccagcttctg tctgaccgta
ttcatgtttt gcaccctgaa 480ggctacttaa tcactccggc ctggctctgg
gaaaagtacg gtctgcgtcc cgatcagtgg 540gcggattatc gggctttgac
gggagatgag agcgacaacc tgccaggagt taagggcatt 600ggtgaaaaaa
ccgcacgtaa gctgcttgaa gagtggggtt ccctggaagc cttgttaaaa
660aatctggatc gtctcaagcc cgcaattcgt gaaaagatcc tggctcatat
ggacgatctt 720aaattaagtt gggacctggc caaggtgcgc accgatttac
cgcttgaagt ggattttgca 780aaacgccgtg agccggaccg ggaacgttta
cgcgctttct tagagcgtct ggaattcggt 840tcactgcttc atgaattcgg
tctgttagag tctcctaaag cactcgaaga ggcaccgtgg 900ccgcccccag
aaggtgcttt tgttggcttc gtactttccc gtaaggagcc tatgtgggca
960gatcttctgg ctttagcggc tgcacgcggt ggccgtgttc accgggcccc
tgagccatac 1020aaagcgttac gtgatctgaa ggaagcacgt ggcttgctgg
caaaagacct ttctgttttg 1080gccctgcgcg agggtcttgg actgccgcca
ggcgacgatc ccatgttatt ggcctatctg 1140ttagacccta gcaataccac
acctgaaggg gtcgctcgtc ggtatggcgg tgaatggact 1200gaggaagccg
gagagcgcgc cgcattgtcc gaacggctct ttgcaaactt atggggtcgt
1260ctggaagggg aggaacgtct gttatggttg tatcgggaag tcgaacgtcc
tctttcggcc 1320gtattagcgc atatggaggc aacaggtgtg cgtttagatg
tcgcgtacct tcgggcctta 1380tcactggaag ttgcagagga aatcgcccgt
ctcgaggctg aagtgttccg gttggccggt 1440cacccgttta acctcaactc
ccgtgaccag ctggaacgcg ttttattcga tgagcttggg 1500cttcccgcaa
ttggcaaaac cgaaaagact ggcaaacgca gtacgagcgc tgccgtcctt
1560gaggcactcc gcgaggctca ccctattgta gaaaagatcc tgcaataccg
tgagttgacg 1620aagcttaaaa gcacttatat tgatcctctc ccggatctga
tccatcctcg taccggccgc 1680ttgcacacac gtttcaacca gacggcgact
gcaaccggcc gtctgtctag ctcggatcca 1740aatctccaga acattccggt
ccgtacaccc ttgggccaac gtatccgccg ggcgtttatc 1800gctgaggaag
gatggttact ggtcgcattg gactactcgc agattgagct gcgcgtcctc
1860gcacatctct ctggtgacga aaatttaatc cgcgtgtttc aagaggggcg
tgatattcac 1920acagaaactg cctcatggat gttcggtgtc ccacgtgaag
cagtggatcc tttgatgcgc 1980cgtgcagcta aaacaattaa ttttggagtg
ctgtacggaa tgagcgctca tcgcttgagt 2040caggaactgg caatccccta
cgaggaagcg caggcattca tcgaacgtta ctttcaatcg 2100tttccgaaag
ttcgcgcatg gatcgagaag acgctcgagg aaggtcgtcg tcggggctat
2160gtcgaaactc tgtttggtcg ccgtcggtac gtaccagatc ttgaagcccg
cgtcaaatcg 2220gtacgggagg ctgcggagcg tatggcattt aatatgcctg
tacagggtac tgcagctgac 2280ctcatgaaac tggcaatggt caagcttttc
ccgcgcttgg aggaaatggg cgcacgtatg 2340cttctgcagg tcatggacga
gctggtgtta gaagccccta aggagcgcgc cgaagctgtc 2400gcgcgcctcg
ctaaagaagt gatggagggc gtttacccat tggccgtacc cctcgaagtg
2460gaggtcggta ttggagaaga ttggttatct gcaaaggaag cggccgc
2507157834PRTArtificial SequenceAMINO ACID SEQUENCE OF MUTANT ID 27
(H784M) 157Met Arg Gly Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val
Leu Leu1 5 10 15Val Asp Gly His His Leu Ala Tyr Arg Thr Phe His Ala
Leu Lys Gly 20 25 30Leu Thr Thr Ser Arg Gly Glu Pro Val Gln Ala Val
Tyr Gly Phe Ala 35 40 45Lys Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly
Asp Ala Val Ile Val 50 55 60Val Phe Asp Ala Lys Ala Pro Ser Phe Arg
His Glu Ala Tyr Gly Gly65 70 75 80Tyr Lys Ala Gly Arg Ala Pro Thr
Pro Glu Asp Phe Pro Arg Gln Leu 85 90 95Ala Leu Ile Lys Glu Leu Val
Asp Leu Leu Gly Leu Ala Arg Leu Glu 100 105 110Val Pro Gly Tyr Glu
Ala Asp Asp Val Leu Ala Ser Leu Ala Lys Lys 115 120 125Ala Glu Lys
Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp 130 135 140Leu
Tyr Gln Leu Leu Ser Asp Arg Ile His Val Leu His Pro Glu Gly145 150
155 160Tyr Leu Ile Thr Pro Ala Trp Leu Trp Glu Lys Tyr Gly Leu Arg
Pro 165 170 175Asp Gln Trp Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu
Ser Asp Asn 180 185 190Leu Pro Gly Val Lys Gly Ile Gly Glu Lys Thr
Ala Arg Lys Leu Leu 195 200 205Glu Glu Trp Gly Ser Leu Glu Ala Leu
Leu Lys Asn Leu Asp Arg Leu 210 215 220Lys Pro Ala Ile Arg Glu Lys
Ile Leu Ala His Met Asp Asp Leu Lys225 230 235 240Leu Ser Trp Asp
Leu Ala Lys Val Arg Thr Asp Leu Pro Leu Glu Val 245 250 255Asp Phe
Ala Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe 260 265
270Leu Glu Arg Leu Glu Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu
275 280 285Glu Ser Pro Lys Ala Leu Glu Glu Ala Pro Trp Pro Pro Pro
Glu Gly 290 295 300Ala Phe Val Gly Phe Val Leu Ser Arg Lys Glu Pro
Met Trp Ala Asp305 310 315 320Leu Leu Ala Leu Ala Ala Ala Arg Gly
Gly Arg Val His Arg Ala Pro 325 330 335Glu Pro Tyr Lys Ala Leu Arg
Asp Leu Lys Glu Ala Arg Gly Leu Leu 340 345 350Ala Lys Asp Leu Ser
Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro 355 360 365Pro Gly Asp
Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn 370 375 380Thr
Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu385 390
395 400Glu Ala Gly Glu Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn
Leu 405 410 415Trp Gly Arg Leu Glu Gly Glu Glu Arg Leu Leu Trp Leu
Tyr Arg Glu 420 425 430Val Glu Arg Pro Leu Ser Ala Val Leu Ala His
Met Glu Ala Thr Gly 435 440 445Val Arg Leu Asp Val Ala Tyr Leu Arg
Ala Leu Ser Leu Glu Val Ala 450 455 460Glu Glu Ile Ala Arg Leu Glu
Ala Glu Val Phe Arg Leu Ala Gly His465 470 475 480Pro Phe Asn Leu
Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp 485 490 495Glu Leu
Gly Leu Pro Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg 500 505
510Ser Thr Ser Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile
515 520 525Val Glu Lys Ile Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys
Ser Thr 530 535 540Tyr Ile Asp Pro Leu Pro Asp Leu Ile His Pro Arg
Thr Gly Arg Leu545 550 555 560His Thr Arg Phe Asn Gln Thr Ala Thr
Ala Thr Gly Arg Leu Ser Ser 565 570 575Ser Asp Pro Asn Leu Gln Asn
Ile Pro Val Arg Thr Pro Leu Gly Gln 580 585 590Arg Ile Arg Arg Ala
Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala 595 600 605Leu Asp Tyr
Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly 610 615 620Asp
Glu Asn Leu Ile Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr625 630
635 640Glu Thr Ala Ser Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp
Pro 645 650 655Leu Met Arg Arg Ala Ala Lys Thr Ile Asn Phe Gly Val
Leu Tyr Gly 660 665 670Met Ser Ala His Arg Leu Ser Gln Glu Leu Ala
Ile Pro Tyr Glu Glu 675 680 685Ala Gln Ala Phe Ile Glu Arg Tyr Phe
Gln Ser Phe Pro Lys Val Arg 690 695 700Ala Trp Ile Glu Lys Thr Leu
Glu Glu Gly Arg Arg Arg Gly Tyr Val705 710 715 720Glu Thr Leu Phe
Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg 725 730 735Val Lys
Ser Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro 740 745
750Val Gln Gly Thr Ala Ala Asp Leu Met Lys Leu Ala Met Val Lys Leu
755 760 765Phe Pro Arg Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln
Val Met 770 775 780Asp Glu Leu Val Leu Glu Ala Pro Lys Glu Arg Ala
Glu Ala Val Ala785 790 795 800Arg Leu Ala Lys Glu Val Met Glu Gly
Val Tyr Pro Leu Ala Val Pro 805 810 815Leu Glu Val Glu Val Gly Ile
Gly Glu Asp Trp Leu Ser Ala Lys Glu 820 825 830Ala
Ala1582507DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 29
(H784F) 158catatgcgtg gtatgctgcc gttgttcgag cctaaaggcc gcgtactgtt
agtcgatggt 60catcacttgg cctatcggac gttccatgca ctcaaaggtc tgacgaccag
tcgtggcgaa 120ccggtccagg ctgtttatgg tttcgctaag tctttgctca
aagcactgaa agaagacggg 180gacgcggtaa ttgttgtatt tgatgccaaa
gcaccgagct tccgccacga agcttatggt 240ggctacaagg caggacgcgc
ccctacccca gaagatttcc cccgtcagct ggcattaatt 300aaggagttag
tagaccttct cggcttagcg cgtctggaag ttccgggtta tgaggcggac
360gatgtccttg catccttggc taaaaaggcc gaaaaagagg gctacgaagt
ccgcatcttg 420acggcagaca aagatctgta ccagcttctg tctgaccgta
ttcatgtttt gcaccctgaa 480ggctacttaa tcactccggc ctggctctgg
gaaaagtacg gtctgcgtcc cgatcagtgg 540gcggattatc gggctttgac
gggagatgag agcgacaacc tgccaggagt taagggcatt 600ggtgaaaaaa
ccgcacgtaa gctgcttgaa gagtggggtt ccctggaagc cttgttaaaa
660aatctggatc gtctcaagcc cgcaattcgt gaaaagatcc tggctcatat
ggacgatctt 720aaattaagtt gggacctggc caaggtgcgc accgatttac
cgcttgaagt ggattttgca 780aaacgccgtg agccggaccg ggaacgttta
cgcgctttct tagagcgtct ggaattcggt 840tcactgcttc atgaattcgg
tctgttagag tctcctaaag cactcgaaga ggcaccgtgg 900ccgcccccag
aaggtgcttt tgttggcttc gtactttccc gtaaggagcc tatgtgggca
960gatcttctgg ctttagcggc tgcacgcggt ggccgtgttc accgggcccc
tgagccatac 1020aaagcgttac gtgatctgaa ggaagcacgt ggcttgctgg
caaaagacct ttctgttttg 1080gccctgcgcg agggtcttgg actgccgcca
ggcgacgatc ccatgttatt ggcctatctg 1140ttagacccta gcaataccac
acctgaaggg gtcgctcgtc ggtatggcgg tgaatggact 1200gaggaagccg
gagagcgcgc cgcattgtcc gaacggctct ttgcaaactt atggggtcgt
1260ctggaagggg aggaacgtct gttatggttg tatcgggaag tcgaacgtcc
tctttcggcc 1320gtattagcgc atatggaggc aacaggtgtg cgtttagatg
tcgcgtacct tcgggcctta 1380tcactggaag ttgcagagga aatcgcccgt
ctcgaggctg aagtgttccg gttggccggt 1440cacccgttta acctcaactc
ccgtgaccag ctggaacgcg ttttattcga tgagcttggg 1500cttcccgcaa
ttggcaaaac cgaaaagact ggcaaacgca gtacgagcgc tgccgtcctt
1560gaggcactcc gcgaggctca ccctattgta gaaaagatcc tgcaataccg
tgagttgacg 1620aagcttaaaa gcacttatat tgatcctctc ccggatctga
tccatcctcg taccggccgc 1680ttgcacacac gtttcaacca gacggcgact
gcaaccggcc gtctgtctag ctcggatcca 1740aatctccaga acattccggt
ccgtacaccc ttgggccaac gtatccgccg ggcgtttatc 1800gctgaggaag
gatggttact ggtcgcattg gactactcgc agattgagct gcgcgtcctc
1860gcacatctct ctggtgacga aaatttaatc cgcgtgtttc aagaggggcg
tgatattcac 1920acagaaactg cctcatggat gttcggtgtc ccacgtgaag
cagtggatcc tttgatgcgc 1980cgtgcagcta aaacaattaa ttttggagtg
ctgtacggaa tgagcgctca tcgcttgagt 2040caggaactgg caatccccta
cgaggaagcg caggcattca tcgaacgtta ctttcaatcg 2100tttccgaaag
ttcgcgcatg gatcgagaag acgctcgagg aaggtcgtcg tcggggctat
2160gtcgaaactc tgtttggtcg ccgtcggtac gtaccagatc ttgaagcccg
cgtcaaatcg 2220gtacgggagg ctgcggagcg tatggcattt aatatgcctg
tacagggtac tgcagctgac 2280ctcatgaaac tggcaatggt caagcttttc
ccgcgcttgg aggaaatggg cgcacgtatg 2340cttctgcagg tctttgacga
gctggtgtta gaagccccta aggagcgcgc cgaagctgtc 2400gcgcgcctcg
ctaaagaagt gatggagggc gtttacccat tggccgtacc cctcgaagtg
2460gaggtcggta ttggagaaga ttggttatct gcaaaggaag cggccgc
2507159834PRTArtificial SequenceAMINO ACID SEQUENCE OF MUTANT ID 29
(H784F) 159Met Arg Gly Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val
Leu Leu1 5 10 15Val Asp Gly His His Leu Ala Tyr Arg Thr Phe His Ala
Leu Lys Gly 20 25 30Leu Thr Thr Ser Arg Gly Glu Pro Val Gln Ala Val
Tyr Gly Phe Ala 35 40 45Lys Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly
Asp Ala Val Ile Val 50 55 60Val Phe Asp Ala Lys Ala Pro Ser Phe Arg
His Glu Ala Tyr Gly Gly65 70 75 80Tyr Lys Ala Gly Arg Ala Pro Thr
Pro Glu Asp Phe Pro Arg Gln Leu 85 90 95Ala Leu Ile Lys Glu Leu Val
Asp Leu Leu Gly Leu Ala Arg Leu Glu 100 105 110Val Pro Gly Tyr Glu
Ala Asp Asp Val Leu Ala Ser Leu Ala Lys Lys 115 120 125Ala Glu Lys
Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp 130 135 140Leu
Tyr Gln Leu Leu Ser Asp Arg Ile His Val Leu His Pro Glu Gly145 150
155 160Tyr Leu Ile Thr Pro Ala Trp Leu Trp Glu Lys Tyr Gly Leu Arg
Pro 165 170 175Asp Gln Trp Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu
Ser Asp Asn 180 185 190Leu Pro Gly Val Lys Gly Ile Gly Glu Lys Thr
Ala Arg Lys Leu Leu 195 200 205Glu Glu Trp Gly Ser Leu Glu Ala Leu
Leu Lys Asn Leu Asp Arg Leu 210 215 220Lys Pro Ala Ile Arg Glu Lys
Ile Leu Ala His Met Asp Asp Leu Lys225 230 235 240Leu Ser Trp Asp
Leu Ala Lys Val Arg Thr Asp Leu Pro Leu Glu Val 245 250 255Asp Phe
Ala Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe 260 265
270Leu Glu Arg Leu Glu Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu
275 280 285Glu Ser Pro Lys Ala Leu Glu Glu Ala Pro Trp Pro Pro Pro
Glu Gly 290 295 300Ala Phe Val Gly Phe Val Leu Ser Arg Lys Glu Pro
Met Trp Ala Asp305 310 315 320Leu Leu Ala Leu Ala Ala Ala Arg Gly
Gly Arg Val His Arg Ala Pro 325 330 335Glu Pro Tyr Lys Ala Leu Arg
Asp Leu Lys Glu Ala Arg Gly Leu Leu 340 345 350Ala Lys Asp Leu Ser
Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro 355 360 365Pro Gly Asp
Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn 370 375 380Thr
Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu385 390
395 400Glu Ala Gly Glu Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn
Leu 405 410 415Trp Gly Arg Leu Glu Gly Glu Glu Arg Leu Leu Trp Leu
Tyr Arg Glu 420 425 430Val Glu Arg Pro Leu Ser Ala Val Leu Ala His
Met Glu Ala Thr Gly 435 440 445Val Arg Leu Asp Val Ala Tyr Leu Arg
Ala Leu Ser Leu Glu Val Ala 450 455 460Glu Glu Ile Ala Arg Leu Glu
Ala Glu Val Phe Arg Leu Ala Gly His465 470 475 480Pro Phe Asn Leu
Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp 485 490 495Glu Leu
Gly Leu Pro Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg 500 505
510Ser Thr Ser Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile
515 520 525Val Glu Lys Ile Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys
Ser Thr 530 535 540Tyr Ile Asp Pro Leu Pro Asp Leu Ile His Pro Arg
Thr Gly Arg Leu545 550 555 560His Thr Arg Phe Asn Gln Thr Ala Thr
Ala Thr Gly Arg Leu Ser Ser 565 570 575Ser Asp Pro Asn Leu Gln Asn
Ile Pro Val Arg Thr Pro Leu Gly Gln 580 585 590Arg Ile Arg Arg Ala
Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala 595 600 605Leu Asp Tyr
Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly 610 615 620Asp
Glu Asn Leu Ile Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr625 630
635 640Glu Thr Ala Ser Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp
Pro 645 650 655Leu Met Arg Arg Ala Ala Lys Thr Ile Asn Phe Gly Val
Leu Tyr Gly 660 665 670Met Ser Ala His Arg Leu Ser Gln Glu Leu
Ala
Ile Pro Tyr Glu Glu 675 680 685Ala Gln Ala Phe Ile Glu Arg Tyr Phe
Gln Ser Phe Pro Lys Val Arg 690 695 700Ala Trp Ile Glu Lys Thr Leu
Glu Glu Gly Arg Arg Arg Gly Tyr Val705 710 715 720Glu Thr Leu Phe
Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg 725 730 735Val Lys
Ser Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro 740 745
750Val Gln Gly Thr Ala Ala Asp Leu Met Lys Leu Ala Met Val Lys Leu
755 760 765Phe Pro Arg Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln
Val Phe 770 775 780Asp Glu Leu Val Leu Glu Ala Pro Lys Glu Arg Ala
Glu Ala Val Ala785 790 795 800Arg Leu Ala Lys Glu Val Met Glu Gly
Val Tyr Pro Leu Ala Val Pro 805 810 815Leu Glu Val Glu Val Gly Ile
Gly Glu Asp Trp Leu Ser Ala Lys Glu 820 825 830Ala
Ala1602507DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 30
(H784Y) 160catatgcgtg gtatgctgcc gttgttcgag cctaaaggcc gcgtactgtt
agtcgatggt 60catcacttgg cctatcggac gttccatgca ctcaaaggtc tgacgaccag
tcgtggcgaa 120ccggtccagg ctgtttatgg tttcgctaag tctttgctca
aagcactgaa agaagacggg 180gacgcggtaa ttgttgtatt tgatgccaaa
gcaccgagct tccgccacga agcttatggt 240ggctacaagg caggacgcgc
ccctacccca gaagatttcc cccgtcagct ggcattaatt 300aaggagttag
tagaccttct cggcttagcg cgtctggaag ttccgggtta tgaggcggac
360gatgtccttg catccttggc taaaaaggcc gaaaaagagg gctacgaagt
ccgcatcttg 420acggcagaca aagatctgta ccagcttctg tctgaccgta
ttcatgtttt gcaccctgaa 480ggctacttaa tcactccggc ctggctctgg
gaaaagtacg gtctgcgtcc cgatcagtgg 540gcggattatc gggctttgac
gggagatgag agcgacaacc tgccaggagt taagggcatt 600ggtgaaaaaa
ccgcacgtaa gctgcttgaa gagtggggtt ccctggaagc cttgttaaaa
660aatctggatc gtctcaagcc cgcaattcgt gaaaagatcc tggctcatat
ggacgatctt 720aaattaagtt gggacctggc caaggtgcgc accgatttac
cgcttgaagt ggattttgca 780aaacgccgtg agccggaccg ggaacgttta
cgcgctttct tagagcgtct ggaattcggt 840tcactgcttc atgaattcgg
tctgttagag tctcctaaag cactcgaaga ggcaccgtgg 900ccgcccccag
aaggtgcttt tgttggcttc gtactttccc gtaaggagcc tatgtgggca
960gatcttctgg ctttagcggc tgcacgcggt ggccgtgttc accgggcccc
tgagccatac 1020aaagcgttac gtgatctgaa ggaagcacgt ggcttgctgg
caaaagacct ttctgttttg 1080gccctgcgcg agggtcttgg actgccgcca
ggcgacgatc ccatgttatt ggcctatctg 1140ttagacccta gcaataccac
acctgaaggg gtcgctcgtc ggtatggcgg tgaatggact 1200gaggaagccg
gagagcgcgc cgcattgtcc gaacggctct ttgcaaactt atggggtcgt
1260ctggaagggg aggaacgtct gttatggttg tatcgggaag tcgaacgtcc
tctttcggcc 1320gtattagcgc atatggaggc aacaggtgtg cgtttagatg
tcgcgtacct tcgggcctta 1380tcactggaag ttgcagagga aatcgcccgt
ctcgaggctg aagtgttccg gttggccggt 1440cacccgttta acctcaactc
ccgtgaccag ctggaacgcg ttttattcga tgagcttggg 1500cttcccgcaa
ttggcaaaac cgaaaagact ggcaaacgca gtacgagcgc tgccgtcctt
1560gaggcactcc gcgaggctca ccctattgta gaaaagatcc tgcaataccg
tgagttgacg 1620aagcttaaaa gcacttatat tgatcctctc ccggatctga
tccatcctcg taccggccgc 1680ttgcacacac gtttcaacca gacggcgact
gcaaccggcc gtctgtctag ctcggatcca 1740aatctccaga acattccggt
ccgtacaccc ttgggccaac gtatccgccg ggcgtttatc 1800gctgaggaag
gatggttact ggtcgcattg gactactcgc agattgagct gcgcgtcctc
1860gcacatctct ctggtgacga aaatttaatc cgcgtgtttc aagaggggcg
tgatattcac 1920acagaaactg cctcatggat gttcggtgtc ccacgtgaag
cagtggatcc tttgatgcgc 1980cgtgcagcta aaacaattaa ttttggagtg
ctgtacggaa tgagcgctca tcgcttgagt 2040caggaactgg caatccccta
cgaggaagcg caggcattca tcgaacgtta ctttcaatcg 2100tttccgaaag
ttcgcgcatg gatcgagaag acgctcgagg aaggtcgtcg tcggggctat
2160gtcgaaactc tgtttggtcg ccgtcggtac gtaccagatc ttgaagcccg
cgtcaaatcg 2220gtacgggagg ctgcggagcg tatggcattt aatatgcctg
tacagggtac tgcagctgac 2280ctcatgaaac tggcaatggt caagcttttc
ccgcgcttgg aggaaatggg cgcacgtatg 2340cttctgcagg tctatgacga
gctggtgtta gaagccccta aggagcgcgc cgaagctgtc 2400gcgcgcctcg
ctaaagaagt gatggagggc gtttacccat tggccgtacc cctcgaagtg
2460gaggtcggta ttggagaaga ttggttatct gcaaaggaag cggccgc
2507161834PRTArtificial SequenceAMINO ACID SEQUENCE OF MUTANT ID 30
(H784Y) 161Met Arg Gly Met Leu Pro Leu Phe Glu Pro Lys Gly Arg Val
Leu Leu1 5 10 15Val Asp Gly His His Leu Ala Tyr Arg Thr Phe His Ala
Leu Lys Gly 20 25 30Leu Thr Thr Ser Arg Gly Glu Pro Val Gln Ala Val
Tyr Gly Phe Ala 35 40 45Lys Ser Leu Leu Lys Ala Leu Lys Glu Asp Gly
Asp Ala Val Ile Val 50 55 60Val Phe Asp Ala Lys Ala Pro Ser Phe Arg
His Glu Ala Tyr Gly Gly65 70 75 80Tyr Lys Ala Gly Arg Ala Pro Thr
Pro Glu Asp Phe Pro Arg Gln Leu 85 90 95Ala Leu Ile Lys Glu Leu Val
Asp Leu Leu Gly Leu Ala Arg Leu Glu 100 105 110Val Pro Gly Tyr Glu
Ala Asp Asp Val Leu Ala Ser Leu Ala Lys Lys 115 120 125Ala Glu Lys
Glu Gly Tyr Glu Val Arg Ile Leu Thr Ala Asp Lys Asp 130 135 140Leu
Tyr Gln Leu Leu Ser Asp Arg Ile His Val Leu His Pro Glu Gly145 150
155 160Tyr Leu Ile Thr Pro Ala Trp Leu Trp Glu Lys Tyr Gly Leu Arg
Pro 165 170 175Asp Gln Trp Ala Asp Tyr Arg Ala Leu Thr Gly Asp Glu
Ser Asp Asn 180 185 190Leu Pro Gly Val Lys Gly Ile Gly Glu Lys Thr
Ala Arg Lys Leu Leu 195 200 205Glu Glu Trp Gly Ser Leu Glu Ala Leu
Leu Lys Asn Leu Asp Arg Leu 210 215 220Lys Pro Ala Ile Arg Glu Lys
Ile Leu Ala His Met Asp Asp Leu Lys225 230 235 240Leu Ser Trp Asp
Leu Ala Lys Val Arg Thr Asp Leu Pro Leu Glu Val 245 250 255Asp Phe
Ala Lys Arg Arg Glu Pro Asp Arg Glu Arg Leu Arg Ala Phe 260 265
270Leu Glu Arg Leu Glu Phe Gly Ser Leu Leu His Glu Phe Gly Leu Leu
275 280 285Glu Ser Pro Lys Ala Leu Glu Glu Ala Pro Trp Pro Pro Pro
Glu Gly 290 295 300Ala Phe Val Gly Phe Val Leu Ser Arg Lys Glu Pro
Met Trp Ala Asp305 310 315 320Leu Leu Ala Leu Ala Ala Ala Arg Gly
Gly Arg Val His Arg Ala Pro 325 330 335Glu Pro Tyr Lys Ala Leu Arg
Asp Leu Lys Glu Ala Arg Gly Leu Leu 340 345 350Ala Lys Asp Leu Ser
Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro 355 360 365Pro Gly Asp
Asp Pro Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn 370 375 380Thr
Thr Pro Glu Gly Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu385 390
395 400Glu Ala Gly Glu Arg Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn
Leu 405 410 415Trp Gly Arg Leu Glu Gly Glu Glu Arg Leu Leu Trp Leu
Tyr Arg Glu 420 425 430Val Glu Arg Pro Leu Ser Ala Val Leu Ala His
Met Glu Ala Thr Gly 435 440 445Val Arg Leu Asp Val Ala Tyr Leu Arg
Ala Leu Ser Leu Glu Val Ala 450 455 460Glu Glu Ile Ala Arg Leu Glu
Ala Glu Val Phe Arg Leu Ala Gly His465 470 475 480Pro Phe Asn Leu
Asn Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp 485 490 495Glu Leu
Gly Leu Pro Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg 500 505
510Ser Thr Ser Ala Ala Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile
515 520 525Val Glu Lys Ile Leu Gln Tyr Arg Glu Leu Thr Lys Leu Lys
Ser Thr 530 535 540Tyr Ile Asp Pro Leu Pro Asp Leu Ile His Pro Arg
Thr Gly Arg Leu545 550 555 560His Thr Arg Phe Asn Gln Thr Ala Thr
Ala Thr Gly Arg Leu Ser Ser 565 570 575Ser Asp Pro Asn Leu Gln Asn
Ile Pro Val Arg Thr Pro Leu Gly Gln 580 585 590Arg Ile Arg Arg Ala
Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala 595 600 605Leu Asp Tyr
Ser Gln Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly 610 615 620Asp
Glu Asn Leu Ile Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr625 630
635 640Glu Thr Ala Ser Trp Met Phe Gly Val Pro Arg Glu Ala Val Asp
Pro 645 650 655Leu Met Arg Arg Ala Ala Lys Thr Ile Asn Phe Gly Val
Leu Tyr Gly 660 665 670Met Ser Ala His Arg Leu Ser Gln Glu Leu Ala
Ile Pro Tyr Glu Glu 675 680 685Ala Gln Ala Phe Ile Glu Arg Tyr Phe
Gln Ser Phe Pro Lys Val Arg 690 695 700Ala Trp Ile Glu Lys Thr Leu
Glu Glu Gly Arg Arg Arg Gly Tyr Val705 710 715 720Glu Thr Leu Phe
Gly Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg 725 730 735Val Lys
Ser Val Arg Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro 740 745
750Val Gln Gly Thr Ala Ala Asp Leu Met Lys Leu Ala Met Val Lys Leu
755 760 765Phe Pro Arg Leu Glu Glu Met Gly Ala Arg Met Leu Leu Gln
Val Tyr 770 775 780Asp Glu Leu Val Leu Glu Ala Pro Lys Glu Arg Ala
Glu Ala Val Ala785 790 795 800Arg Leu Ala Lys Glu Val Met Glu Gly
Val Tyr Pro Leu Ala Val Pro 805 810 815Leu Glu Val Glu Val Gly Ile
Gly Glu Asp Trp Leu Ser Ala Lys Glu 820 825 830Ala
Ala16225DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(1)..(1)5'-PHOSPHATE 162ggttcactgc
ttcatgaatt cggtc 2516332DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(1)..(1)5'-PHOSPHATE 163catatgtatt
ctccttctta aagttaaaca aa 3216426DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(1)..(1)5'-FAM
(6-carboxyfluorescein)misc_feature(26)..(26)3'-IBFQ (Iowa Black FQ
(fluorescence quencher)) 164atggtcaagg tcgcaagctt gctggt
2616527DNAArtificial SequenceSYNTHETIC DNA
OLIGONUCLEOTIDEmisc_feature(1)..(1)5'-FAM
(6-carboxyfluorescein)misc_feature(14)..(14)RNA
RESIDUEmisc_feature(27)..(27)3'-IBFQ (Iowa BlacK FQ (fluorescence
quencher) 165ttctgaggcc aacuccactg ccactta 2716622DNAArtificial
SequenceSYNTHETIC DNA OLIGONUCLEOTIDEmisc_feature(1)..(1)5'-FAM
(6-carboxyfluorescein)misc_feature(11)..(11)RNA
RESIDUEmisc_feature(22)..(22)3'-IBFQ (Iowa Black FQ (fluorescence
quencher)) 166cccagagctc cctcagactc ct 221671676DNAArtificial
SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 37 (OptiTaq KlenTaq)
167catatgggtt cactgcttca tgaattcggt ctgttagagt ctcctaaagc
actcgaagag 60gcaccgtggc cgcccccaga aggtgctttt gttggcttcg tactttcccg
taaggagcct 120atgtgggcag atcttctggc tttagcggct gcacgcggtg
gccgtgttca ccgggcccct 180gagccataca aagcgttacg tgatctgaag
gaagcacgtg gcttgctggc aaaagacctt 240tctgttttgg ccctgcgcga
gggtcttgga ctgccgccag gcgacgatcc catgttattg 300gcctatctgt
tagaccctag caataccaca cctgaagggg tcgctcgtcg gtatggcggt
360gaatggactg aggaagccgg agagcgcgcc gcattgtccg aacggctctt
tgcaaactta 420tggggtcgtc tggaagggga ggaacgtctg ttatggttgt
atcgggaagt cgaacgtcct 480ctttcggccg tattagcgca tatggaggca
acaggtgtgc gtttagatgt cgcgtacctt 540cgggccttat cactggaagt
tgcagaggaa atcgcccgtc tcgaggctga agtgttccgg 600ttggccggtc
acccgtttaa cctcaactcc cgtgaccagc tggaacgcgt tttattcgat
660gagcttgggc ttcccgcaat tggcaaaacc gaaaagactg gcaaacgcag
tacgagcgct 720gccgtccttg aggcactccg cgaggctcac cctattgtag
aaaagatcct gcaataccgt 780gagttgacga agcttaaaag cacttatatt
gatcctctcc cggatctgat ccatcctcgt 840accggccgct tgcacacacg
tttcaaccag acggcgactg caaccggccg tctgtctagc 900tcggatccaa
atctccagaa cattccggtc cgtacaccct tgggccaacg tatccgccgg
960gcgtttatcg ctgaggaagg atggttactg gtcgcattgg actactcgca
gattgagctg 1020cgcgtcctcg cacatctctc tggtgacgaa aatttaatcc
gcgtgtttca agaggggcgt 1080gatattcaca cagaaactgc ctcatggatg
ttcggtgtcc cacgtgaagc agtggatcct 1140ttgatgcgcc gtgcagctaa
aacaattaat tttggagtgc tgtacggaat gagcgctcat 1200cgcttgagtc
aggaactggc aatcccctac gaggaagcgc aggcattcat cgaacgttac
1260tttcaatcgt ttccgaaagt tcgcgcatgg atcgagaaga cgctcgagga
aggtcgtcgt 1320cggggctatg tcgaaactct gtttggtcgc cgtcggtacg
taccagatct tgaagcccgc 1380gtcaaatcgg tacgggaggc tgcggagcgt
atggcattta atatgcctgt acagggtact 1440gcagctgacc tcatgaaact
ggcaatggtc aagcttttcc cgcgcttgga ggaaatgggc 1500gcacgtatgc
ttctgcaggt ccatgacgag ctggtgttag aagcccctaa ggagcgcgcc
1560gaagctgtcg cgcgcctcgc taaagaagtg atggagggcg tttacccatt
ggccgtaccc 1620ctcgaagtgg aggtcggtat tggagaagat tggttatctg
caaaggaagc ggccgc 1676168557PRTArtificial SequenceAMINO ACID
SEQUENCE OF MUTANT ID 37 (OptiTaq KlenTaq) 168Met Gly Ser Leu Leu
His Glu Phe Gly Leu Leu Glu Ser Pro Lys Ala1 5 10 15Leu Glu Glu Ala
Pro Trp Pro Pro Pro Glu Gly Ala Phe Val Gly Phe 20 25 30Val Leu Ser
Arg Lys Glu Pro Met Trp Ala Asp Leu Leu Ala Leu Ala 35 40 45Ala Ala
Arg Gly Gly Arg Val His Arg Ala Pro Glu Pro Tyr Lys Ala 50 55 60Leu
Arg Asp Leu Lys Glu Ala Arg Gly Leu Leu Ala Lys Asp Leu Ser65 70 75
80Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro Pro Gly Asp Asp Pro
85 90 95Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn Thr Thr Pro Glu
Gly 100 105 110Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu Glu Ala
Gly Glu Arg 115 120 125Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn Leu
Trp Gly Arg Leu Glu 130 135 140Gly Glu Glu Arg Leu Leu Trp Leu Tyr
Arg Glu Val Glu Arg Pro Leu145 150 155 160Ser Ala Val Leu Ala His
Met Glu Ala Thr Gly Val Arg Leu Asp Val 165 170 175Ala Tyr Leu Arg
Ala Leu Ser Leu Glu Val Ala Glu Glu Ile Ala Arg 180 185 190Leu Glu
Ala Glu Val Phe Arg Leu Ala Gly His Pro Phe Asn Leu Asn 195 200
205Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp Glu Leu Gly Leu Pro
210 215 220Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser Thr Ser
Ala Ala225 230 235 240Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile
Val Glu Lys Ile Leu 245 250 255Gln Tyr Arg Glu Leu Thr Lys Leu Lys
Ser Thr Tyr Ile Asp Pro Leu 260 265 270Pro Asp Leu Ile His Pro Arg
Thr Gly Arg Leu His Thr Arg Phe Asn 275 280 285Gln Thr Ala Thr Ala
Thr Gly Arg Leu Ser Ser Ser Asp Pro Asn Leu 290 295 300Gln Asn Ile
Pro Val Arg Thr Pro Leu Gly Gln Arg Ile Arg Arg Ala305 310 315
320Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala Leu Asp Tyr Ser Gln
325 330 335Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly Asp Glu Asn
Leu Ile 340 345 350Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr Glu
Thr Ala Ser Trp 355 360 365Met Phe Gly Val Pro Arg Glu Ala Val Asp
Pro Leu Met Arg Arg Ala 370 375 380Ala Lys Thr Ile Asn Phe Gly Val
Leu Tyr Gly Met Ser Ala His Arg385 390 395 400Leu Ser Gln Glu Leu
Ala Ile Pro Tyr Glu Glu Ala Gln Ala Phe Ile 405 410 415Glu Arg Tyr
Phe Gln Ser Phe Pro Lys Val Arg Ala Trp Ile Glu Lys 420 425 430Thr
Leu Glu Glu Gly Arg Arg Arg Gly Tyr Val Glu Thr Leu Phe Gly 435 440
445Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg Val Lys Ser Val Arg
450 455 460Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro Val Gln Gly
Thr Ala465 470 475 480Ala Asp Leu Met Lys Leu Ala Met Val Lys Leu
Phe Pro Arg Leu Glu 485 490 495Glu Met Gly Ala Arg Met Leu Leu Gln
Val His Asp Glu Leu Val Leu 500 505 510Glu Ala Pro Lys Glu Arg Ala
Glu Ala Val Ala Arg Leu Ala Lys Glu 515 520 525Val Met Glu Gly Val
Tyr Pro Leu Ala Val Pro Leu Glu Val Glu Val 530 535 540Gly Ile Gly
Glu Asp Trp Leu Ser Ala Lys Glu Ala Ala545 550
5551691676DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID
38
(A661E, I665W, F667L KlenTaq) 169catatgggtt cactgcttca tgaattcggt
ctgttagagt ctcctaaagc actcgaagag 60gcaccgtggc cgcccccaga aggtgctttt
gttggcttcg tactttcccg taaggagcct 120atgtgggcag atcttctggc
tttagcggct gcacgcggtg gccgtgttca ccgggcccct 180gagccataca
aagcgttacg tgatctgaag gaagcacgtg gcttgctggc aaaagacctt
240tctgttttgg ccctgcgcga gggtcttgga ctgccgccag gcgacgatcc
catgttattg 300gcctatctgt tagaccctag caataccaca cctgaagggg
tcgctcgtcg gtatggcggt 360gaatggactg aggaagccgg agagcgcgcc
gcattgtccg aacggctctt tgcaaactta 420tggggtcgtc tggaagggga
ggaacgtctg ttatggttgt atcgggaagt cgaacgtcct 480ctttcggccg
tattagcgca tatggaggca acaggtgtgc gtttagatgt cgcgtacctt
540cgggccttat cactggaagt tgcagaggaa atcgcccgtc tcgaggctga
agtgttccgg 600ttggccggtc acccgtttaa cctcaactcc cgtgaccagc
tggaacgcgt tttattcgat 660gagcttgggc ttcccgcaat tggcaaaacc
gaaaagactg gcaaacgcag tacgagcgct 720gccgtccttg aggcactccg
cgaggctcac cctattgtag aaaagatcct gcaataccgt 780gagttgacga
agcttaaaag cacttatatt gatcctctcc cggatctgat ccatcctcgt
840accggccgct tgcacacacg tttcaaccag acggcgactg caaccggccg
tctgtctagc 900tcggatccaa atctccagaa cattccggtc cgtacaccct
tgggccaacg tatccgccgg 960gcgtttatcg ctgaggaagg atggttactg
gtcgcattgg actactcgca gattgagctg 1020cgcgtcctcg cacatctctc
tggtgacgaa aatttaatcc gcgtgtttca agaggggcgt 1080gatattcaca
cagaaactgc ctcatggatg ttcggtgtcc cacgtgaagc agtggatcct
1140ttgatgcgcc gtgaagctaa aacatggaat ttgggagtgc tgtacggaat
gagcgctcat 1200cgcttgagtc aggaactggc aatcccctac gaggaagcgc
aggcattcat cgaacgttac 1260tttcaatcgt ttccgaaagt tcgcgcatgg
atcgagaaga cgctcgagga aggtcgtcgt 1320cggggctatg tcgaaactct
gtttggtcgc cgtcggtacg taccagatct tgaagcccgc 1380gtcaaatcgg
tacgggaggc tgcggagcgt atggcattta atatgcctgt acagggtact
1440gcagctgacc tcatgaaact ggcaatggtc aagcttttcc cgcgcttgga
ggaaatgggc 1500gcacgtatgc ttctgcaggt ccatgacgag ctggtgttag
aagcccctaa ggagcgcgcc 1560gaagctgtcg cgcgcctcgc taaagaagtg
atggagggcg tttacccatt ggccgtaccc 1620ctcgaagtgg aggtcggtat
tggagaagat tggttatctg caaaggaagc ggccgc 1676170557PRTArtificial
SequenceAMINO ACID SEQUENCE OF MUTANT ID 38 (A661E, I665W, F667L
KlenTaq) 170Met Gly Ser Leu Leu His Glu Phe Gly Leu Leu Glu Ser Pro
Lys Ala1 5 10 15Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly Ala Phe
Val Gly Phe 20 25 30Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp Leu
Leu Ala Leu Ala 35 40 45Ala Ala Arg Gly Gly Arg Val His Arg Ala Pro
Glu Pro Tyr Lys Ala 50 55 60Leu Arg Asp Leu Lys Glu Ala Arg Gly Leu
Leu Ala Lys Asp Leu Ser65 70 75 80Val Leu Ala Leu Arg Glu Gly Leu
Gly Leu Pro Pro Gly Asp Asp Pro 85 90 95Met Leu Leu Ala Tyr Leu Leu
Asp Pro Ser Asn Thr Thr Pro Glu Gly 100 105 110Val Ala Arg Arg Tyr
Gly Gly Glu Trp Thr Glu Glu Ala Gly Glu Arg 115 120 125Ala Ala Leu
Ser Glu Arg Leu Phe Ala Asn Leu Trp Gly Arg Leu Glu 130 135 140Gly
Glu Glu Arg Leu Leu Trp Leu Tyr Arg Glu Val Glu Arg Pro Leu145 150
155 160Ser Ala Val Leu Ala His Met Glu Ala Thr Gly Val Arg Leu Asp
Val 165 170 175Ala Tyr Leu Arg Ala Leu Ser Leu Glu Val Ala Glu Glu
Ile Ala Arg 180 185 190Leu Glu Ala Glu Val Phe Arg Leu Ala Gly His
Pro Phe Asn Leu Asn 195 200 205Ser Arg Asp Gln Leu Glu Arg Val Leu
Phe Asp Glu Leu Gly Leu Pro 210 215 220Ala Ile Gly Lys Thr Glu Lys
Thr Gly Lys Arg Ser Thr Ser Ala Ala225 230 235 240Val Leu Glu Ala
Leu Arg Glu Ala His Pro Ile Val Glu Lys Ile Leu 245 250 255Gln Tyr
Arg Glu Leu Thr Lys Leu Lys Ser Thr Tyr Ile Asp Pro Leu 260 265
270Pro Asp Leu Ile His Pro Arg Thr Gly Arg Leu His Thr Arg Phe Asn
275 280 285Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser Ser Asp Pro
Asn Leu 290 295 300Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln Arg
Ile Arg Arg Ala305 310 315 320Phe Ile Ala Glu Glu Gly Trp Leu Leu
Val Ala Leu Asp Tyr Ser Gln 325 330 335Ile Glu Leu Arg Val Leu Ala
His Leu Ser Gly Asp Glu Asn Leu Ile 340 345 350Arg Val Phe Gln Glu
Gly Arg Asp Ile His Thr Glu Thr Ala Ser Trp 355 360 365Met Phe Gly
Val Pro Arg Glu Ala Val Asp Pro Leu Met Arg Arg Glu 370 375 380Ala
Lys Thr Trp Asn Leu Gly Val Leu Tyr Gly Met Ser Ala His Arg385 390
395 400Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu Ala Gln Ala Phe
Ile 405 410 415Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg Ala Trp
Ile Glu Lys 420 425 430Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr Val
Glu Thr Leu Phe Gly 435 440 445Arg Arg Arg Tyr Val Pro Asp Leu Glu
Ala Arg Val Lys Ser Val Arg 450 455 460Glu Ala Ala Glu Arg Met Ala
Phe Asn Met Pro Val Gln Gly Thr Ala465 470 475 480Ala Asp Leu Met
Lys Leu Ala Met Val Lys Leu Phe Pro Arg Leu Glu 485 490 495Glu Met
Gly Ala Arg Met Leu Leu Gln Val His Asp Glu Leu Val Leu 500 505
510Glu Ala Pro Lys Glu Arg Ala Glu Ala Val Ala Arg Leu Ala Lys Glu
515 520 525Val Met Glu Gly Val Tyr Pro Leu Ala Val Pro Leu Glu Val
Glu Val 530 535 540Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu Ala
Ala545 550 5551711676DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF
MUTANT ID 39 (V783F KlenTaq). 171catatgggtt cactgcttca tgaattcggt
ctgttagagt ctcctaaagc actcgaagag 60gcaccgtggc cgcccccaga aggtgctttt
gttggcttcg tactttcccg taaggagcct 120atgtgggcag atcttctggc
tttagcggct gcacgcggtg gccgtgttca ccgggcccct 180gagccataca
aagcgttacg tgatctgaag gaagcacgtg gcttgctggc aaaagacctt
240tctgttttgg ccctgcgcga gggtcttgga ctgccgccag gcgacgatcc
catgttattg 300gcctatctgt tagaccctag caataccaca cctgaagggg
tcgctcgtcg gtatggcggt 360gaatggactg aggaagccgg agagcgcgcc
gcattgtccg aacggctctt tgcaaactta 420tggggtcgtc tggaagggga
ggaacgtctg ttatggttgt atcgggaagt cgaacgtcct 480ctttcggccg
tattagcgca tatggaggca acaggtgtgc gtttagatgt cgcgtacctt
540cgggccttat cactggaagt tgcagaggaa atcgcccgtc tcgaggctga
agtgttccgg 600ttggccggtc acccgtttaa cctcaactcc cgtgaccagc
tggaacgcgt tttattcgat 660gagcttgggc ttcccgcaat tggcaaaacc
gaaaagactg gcaaacgcag tacgagcgct 720gccgtccttg aggcactccg
cgaggctcac cctattgtag aaaagatcct gcaataccgt 780gagttgacga
agcttaaaag cacttatatt gatcctctcc cggatctgat ccatcctcgt
840accggccgct tgcacacacg tttcaaccag acggcgactg caaccggccg
tctgtctagc 900tcggatccaa atctccagaa cattccggtc cgtacaccct
tgggccaacg tatccgccgg 960gcgtttatcg ctgaggaagg atggttactg
gtcgcattgg actactcgca gattgagctg 1020cgcgtcctcg cacatctctc
tggtgacgaa aatttaatcc gcgtgtttca agaggggcgt 1080gatattcaca
cagaaactgc ctcatggatg ttcggtgtcc cacgtgaagc agtggatcct
1140ttgatgcgcc gtgcagctaa aacaattaat tttggagtgc tgtacggaat
gagcgctcat 1200cgcttgagtc aggaactggc aatcccctac gaggaagcgc
aggcattcat cgaacgttac 1260tttcaatcgt ttccgaaagt tcgcgcatgg
atcgagaaga cgctcgagga aggtcgtcgt 1320cggggctatg tcgaaactct
gtttggtcgc cgtcggtacg taccagatct tgaagcccgc 1380gtcaaatcgg
tacgggaggc tgcggagcgt atggcattta atatgcctgt acagggtact
1440gcagctgacc tcatgaaact ggcaatggtc aagcttttcc cgcgcttgga
ggaaatgggc 1500gcacgtatgc ttctgcagtt ccatgacgag ctggtgttag
aagcccctaa ggagcgcgcc 1560gaagctgtcg cgcgcctcgc taaagaagtg
atggagggcg tttacccatt ggccgtaccc 1620ctcgaagtgg aggtcggtat
tggagaagat tggttatctg caaaggaagc ggccgc 1676172557PRTArtificial
SequenceAMINO ACID SEQUENCE OF MUTANT ID 39 (V783F KlenTaq). 172Met
Gly Ser Leu Leu His Glu Phe Gly Leu Leu Glu Ser Pro Lys Ala1 5 10
15Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly Ala Phe Val Gly Phe
20 25 30Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp Leu Leu Ala Leu
Ala 35 40 45Ala Ala Arg Gly Gly Arg Val His Arg Ala Pro Glu Pro Tyr
Lys Ala 50 55 60Leu Arg Asp Leu Lys Glu Ala Arg Gly Leu Leu Ala Lys
Asp Leu Ser65 70 75 80Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro
Pro Gly Asp Asp Pro 85 90 95Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser
Asn Thr Thr Pro Glu Gly 100 105 110Val Ala Arg Arg Tyr Gly Gly Glu
Trp Thr Glu Glu Ala Gly Glu Arg 115 120 125Ala Ala Leu Ser Glu Arg
Leu Phe Ala Asn Leu Trp Gly Arg Leu Glu 130 135 140Gly Glu Glu Arg
Leu Leu Trp Leu Tyr Arg Glu Val Glu Arg Pro Leu145 150 155 160Ser
Ala Val Leu Ala His Met Glu Ala Thr Gly Val Arg Leu Asp Val 165 170
175Ala Tyr Leu Arg Ala Leu Ser Leu Glu Val Ala Glu Glu Ile Ala Arg
180 185 190Leu Glu Ala Glu Val Phe Arg Leu Ala Gly His Pro Phe Asn
Leu Asn 195 200 205Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp Glu
Leu Gly Leu Pro 210 215 220Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys
Arg Ser Thr Ser Ala Ala225 230 235 240Val Leu Glu Ala Leu Arg Glu
Ala His Pro Ile Val Glu Lys Ile Leu 245 250 255Gln Tyr Arg Glu Leu
Thr Lys Leu Lys Ser Thr Tyr Ile Asp Pro Leu 260 265 270Pro Asp Leu
Ile His Pro Arg Thr Gly Arg Leu His Thr Arg Phe Asn 275 280 285Gln
Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser Ser Asp Pro Asn Leu 290 295
300Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln Arg Ile Arg Arg
Ala305 310 315 320Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala Leu
Asp Tyr Ser Gln 325 330 335Ile Glu Leu Arg Val Leu Ala His Leu Ser
Gly Asp Glu Asn Leu Ile 340 345 350Arg Val Phe Gln Glu Gly Arg Asp
Ile His Thr Glu Thr Ala Ser Trp 355 360 365Met Phe Gly Val Pro Arg
Glu Ala Val Asp Pro Leu Met Arg Arg Ala 370 375 380Ala Lys Thr Ile
Asn Phe Gly Val Leu Tyr Gly Met Ser Ala His Arg385 390 395 400Leu
Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu Ala Gln Ala Phe Ile 405 410
415Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg Ala Trp Ile Glu Lys
420 425 430Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr Val Glu Thr Leu
Phe Gly 435 440 445Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg Val
Lys Ser Val Arg 450 455 460Glu Ala Ala Glu Arg Met Ala Phe Asn Met
Pro Val Gln Gly Thr Ala465 470 475 480Ala Asp Leu Met Lys Leu Ala
Met Val Lys Leu Phe Pro Arg Leu Glu 485 490 495Glu Met Gly Ala Arg
Met Leu Leu Gln Leu His Asp Glu Leu Val Leu 500 505 510Glu Ala Pro
Lys Glu Arg Ala Glu Ala Val Ala Arg Leu Ala Lys Glu 515 520 525Val
Met Glu Gly Val Tyr Pro Leu Ala Val Pro Leu Glu Val Glu Val 530 535
540Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu Ala Ala545 550
5551731676DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 40
(H784Q KlenTaq) 173catatgggtt cactgcttca tgaattcggt ctgttagagt
ctcctaaagc actcgaagag 60gcaccgtggc cgcccccaga aggtgctttt gttggcttcg
tactttcccg taaggagcct 120atgtgggcag atcttctggc tttagcggct
gcacgcggtg gccgtgttca ccgggcccct 180gagccataca aagcgttacg
tgatctgaag gaagcacgtg gcttgctggc aaaagacctt 240tctgttttgg
ccctgcgcga gggtcttgga ctgccgccag gcgacgatcc catgttattg
300gcctatctgt tagaccctag caataccaca cctgaagggg tcgctcgtcg
gtatggcggt 360gaatggactg aggaagccgg agagcgcgcc gcattgtccg
aacggctctt tgcaaactta 420tggggtcgtc tggaagggga ggaacgtctg
ttatggttgt atcgggaagt cgaacgtcct 480ctttcggccg tattagcgca
tatggaggca acaggtgtgc gtttagatgt cgcgtacctt 540cgggccttat
cactggaagt tgcagaggaa atcgcccgtc tcgaggctga agtgttccgg
600ttggccggtc acccgtttaa cctcaactcc cgtgaccagc tggaacgcgt
tttattcgat 660gagcttgggc ttcccgcaat tggcaaaacc gaaaagactg
gcaaacgcag tacgagcgct 720gccgtccttg aggcactccg cgaggctcac
cctattgtag aaaagatcct gcaataccgt 780gagttgacga agcttaaaag
cacttatatt gatcctctcc cggatctgat ccatcctcgt 840accggccgct
tgcacacacg tttcaaccag acggcgactg caaccggccg tctgtctagc
900tcggatccaa atctccagaa cattccggtc cgtacaccct tgggccaacg
tatccgccgg 960gcgtttatcg ctgaggaagg atggttactg gtcgcattgg
actactcgca gattgagctg 1020cgcgtcctcg cacatctctc tggtgacgaa
aatttaatcc gcgtgtttca agaggggcgt 1080gatattcaca cagaaactgc
ctcatggatg ttcggtgtcc cacgtgaagc agtggatcct 1140ttgatgcgcc
gtgcagctaa aacaattaat tttggagtgc tgtacggaat gagcgctcat
1200cgcttgagtc aggaactggc aatcccctac gaggaagcgc aggcattcat
cgaacgttac 1260tttcaatcgt ttccgaaagt tcgcgcatgg atcgagaaga
cgctcgagga aggtcgtcgt 1320cggggctatg tcgaaactct gtttggtcgc
cgtcggtacg taccagatct tgaagcccgc 1380gtcaaatcgg tacgggaggc
tgcggagcgt atggcattta atatgcctgt acagggtact 1440gcagctgacc
tcatgaaact ggcaatggtc aagcttttcc cgcgcttgga ggaaatgggc
1500gcacgtatgc ttctgcaggt ccaggacgag ctggtgttag aagcccctaa
ggagcgcgcc 1560gaagctgtcg cgcgcctcgc taaagaagtg atggagggcg
tttacccatt ggccgtaccc 1620ctcgaagtgg aggtcggtat tggagaagat
tggttatctg caaaggaagc ggccgc 1676174557PRTArtificial SequenceAMINO
ACID SEQUENCE OF MUTANT ID 40 (H784Q KlenTaq) 174Met Gly Ser Leu
Leu His Glu Phe Gly Leu Leu Glu Ser Pro Lys Ala1 5 10 15Leu Glu Glu
Ala Pro Trp Pro Pro Pro Glu Gly Ala Phe Val Gly Phe 20 25 30Val Leu
Ser Arg Lys Glu Pro Met Trp Ala Asp Leu Leu Ala Leu Ala 35 40 45Ala
Ala Arg Gly Gly Arg Val His Arg Ala Pro Glu Pro Tyr Lys Ala 50 55
60Leu Arg Asp Leu Lys Glu Ala Arg Gly Leu Leu Ala Lys Asp Leu Ser65
70 75 80Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro Pro Gly Asp Asp
Pro 85 90 95Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn Thr Thr Pro
Glu Gly 100 105 110Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu Glu
Ala Gly Glu Arg 115 120 125Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn
Leu Trp Gly Arg Leu Glu 130 135 140Gly Glu Glu Arg Leu Leu Trp Leu
Tyr Arg Glu Val Glu Arg Pro Leu145 150 155 160Ser Ala Val Leu Ala
His Met Glu Ala Thr Gly Val Arg Leu Asp Val 165 170 175Ala Tyr Leu
Arg Ala Leu Ser Leu Glu Val Ala Glu Glu Ile Ala Arg 180 185 190Leu
Glu Ala Glu Val Phe Arg Leu Ala Gly His Pro Phe Asn Leu Asn 195 200
205Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp Glu Leu Gly Leu Pro
210 215 220Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser Thr Ser
Ala Ala225 230 235 240Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile
Val Glu Lys Ile Leu 245 250 255Gln Tyr Arg Glu Leu Thr Lys Leu Lys
Ser Thr Tyr Ile Asp Pro Leu 260 265 270Pro Asp Leu Ile His Pro Arg
Thr Gly Arg Leu His Thr Arg Phe Asn 275 280 285Gln Thr Ala Thr Ala
Thr Gly Arg Leu Ser Ser Ser Asp Pro Asn Leu 290 295 300Gln Asn Ile
Pro Val Arg Thr Pro Leu Gly Gln Arg Ile Arg Arg Ala305 310 315
320Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala Leu Asp Tyr Ser Gln
325 330 335Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly Asp Glu Asn
Leu Ile 340 345 350Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr Glu
Thr Ala Ser Trp 355 360 365Met Phe Gly Val Pro Arg Glu Ala Val Asp
Pro Leu Met Arg Arg Ala 370 375 380Ala Lys Thr Ile Asn Phe Gly Val
Leu Tyr Gly Met Ser Ala His Arg385 390 395 400Leu Ser Gln Glu Leu
Ala Ile Pro Tyr Glu Glu Ala Gln Ala Phe Ile 405 410 415Glu Arg Tyr
Phe Gln Ser Phe Pro Lys Val Arg Ala Trp Ile Glu Lys 420 425 430Thr
Leu Glu Glu Gly Arg Arg Arg Gly Tyr Val Glu Thr Leu Phe Gly 435 440
445Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg Val Lys Ser Val Arg
450 455 460Glu Ala Ala Glu Arg Met Ala Phe Asn Met Pro
Val Gln Gly Thr Ala465 470 475 480Ala Asp Leu Met Lys Leu Ala Met
Val Lys Leu Phe Pro Arg Leu Glu 485 490 495Glu Met Gly Ala Arg Met
Leu Leu Gln Val Gln Asp Glu Leu Val Leu 500 505 510Glu Ala Pro Lys
Glu Arg Ala Glu Ala Val Ala Arg Leu Ala Lys Glu 515 520 525Val Met
Glu Gly Val Tyr Pro Leu Ala Val Pro Leu Glu Val Glu Val 530 535
540Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu Ala Ala545 550
5551751676DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 41
(V783L H784Q KlenTaq) 175catatgggtt cactgcttca tgaattcggt
ctgttagagt ctcctaaagc actcgaagag 60gcaccgtggc cgcccccaga aggtgctttt
gttggcttcg tactttcccg taaggagcct 120atgtgggcag atcttctggc
tttagcggct gcacgcggtg gccgtgttca ccgggcccct 180gagccataca
aagcgttacg tgatctgaag gaagcacgtg gcttgctggc aaaagacctt
240tctgttttgg ccctgcgcga gggtcttgga ctgccgccag gcgacgatcc
catgttattg 300gcctatctgt tagaccctag caataccaca cctgaagggg
tcgctcgtcg gtatggcggt 360gaatggactg aggaagccgg agagcgcgcc
gcattgtccg aacggctctt tgcaaactta 420tggggtcgtc tggaagggga
ggaacgtctg ttatggttgt atcgggaagt cgaacgtcct 480ctttcggccg
tattagcgca tatggaggca acaggtgtgc gtttagatgt cgcgtacctt
540cgggccttat cactggaagt tgcagaggaa atcgcccgtc tcgaggctga
agtgttccgg 600ttggccggtc acccgtttaa cctcaactcc cgtgaccagc
tggaacgcgt tttattcgat 660gagcttgggc ttcccgcaat tggcaaaacc
gaaaagactg gcaaacgcag tacgagcgct 720gccgtccttg aggcactccg
cgaggctcac cctattgtag aaaagatcct gcaataccgt 780gagttgacga
agcttaaaag cacttatatt gatcctctcc cggatctgat ccatcctcgt
840accggccgct tgcacacacg tttcaaccag acggcgactg caaccggccg
tctgtctagc 900tcggatccaa atctccagaa cattccggtc cgtacaccct
tgggccaacg tatccgccgg 960gcgtttatcg ctgaggaagg atggttactg
gtcgcattgg actactcgca gattgagctg 1020cgcgtcctcg cacatctctc
tggtgacgaa aatttaatcc gcgtgtttca agaggggcgt 1080gatattcaca
cagaaactgc ctcatggatg ttcggtgtcc cacgtgaagc agtggatcct
1140ttgatgcgcc gtgcagctaa aacaattaat tttggagtgc tgtacggaat
gagcgctcat 1200cgcttgagtc aggaactggc aatcccctac gaggaagcgc
aggcattcat cgaacgttac 1260tttcaatcgt ttccgaaagt tcgcgcatgg
atcgagaaga cgctcgagga aggtcgtcgt 1320cggggctatg tcgaaactct
gtttggtcgc cgtcggtacg taccagatct tgaagcccgc 1380gtcaaatcgg
tacgggaggc tgcggagcgt atggcattta atatgcctgt acagggtact
1440gcagctgacc tcatgaaact ggcaatggtc aagcttttcc cgcgcttgga
ggaaatgggc 1500gcacgtatgc ttctgcagct gcaggacgag ctggtgttag
aagcccctaa ggagcgcgcc 1560gaagctgtcg cgcgcctcgc taaagaagtg
atggagggcg tttacccatt ggccgtaccc 1620ctcgaagtgg aggtcggtat
tggagaagat tggttatctg caaaggaagc ggccgc 1676176557PRTArtificial
SequenceAMINO ACID SEQUENCE OF MUTANT ID 41 (V783L H784Q KlenTaq)
176Met Gly Ser Leu Leu His Glu Phe Gly Leu Leu Glu Ser Pro Lys Ala1
5 10 15Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly Ala Phe Val Gly
Phe 20 25 30Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp Leu Leu Ala
Leu Ala 35 40 45Ala Ala Arg Gly Gly Arg Val His Arg Ala Pro Glu Pro
Tyr Lys Ala 50 55 60Leu Arg Asp Leu Lys Glu Ala Arg Gly Leu Leu Ala
Lys Asp Leu Ser65 70 75 80Val Leu Ala Leu Arg Glu Gly Leu Gly Leu
Pro Pro Gly Asp Asp Pro 85 90 95Met Leu Leu Ala Tyr Leu Leu Asp Pro
Ser Asn Thr Thr Pro Glu Gly 100 105 110Val Ala Arg Arg Tyr Gly Gly
Glu Trp Thr Glu Glu Ala Gly Glu Arg 115 120 125Ala Ala Leu Ser Glu
Arg Leu Phe Ala Asn Leu Trp Gly Arg Leu Glu 130 135 140Gly Glu Glu
Arg Leu Leu Trp Leu Tyr Arg Glu Val Glu Arg Pro Leu145 150 155
160Ser Ala Val Leu Ala His Met Glu Ala Thr Gly Val Arg Leu Asp Val
165 170 175Ala Tyr Leu Arg Ala Leu Ser Leu Glu Val Ala Glu Glu Ile
Ala Arg 180 185 190Leu Glu Ala Glu Val Phe Arg Leu Ala Gly His Pro
Phe Asn Leu Asn 195 200 205Ser Arg Asp Gln Leu Glu Arg Val Leu Phe
Asp Glu Leu Gly Leu Pro 210 215 220Ala Ile Gly Lys Thr Glu Lys Thr
Gly Lys Arg Ser Thr Ser Ala Ala225 230 235 240Val Leu Glu Ala Leu
Arg Glu Ala His Pro Ile Val Glu Lys Ile Leu 245 250 255Gln Tyr Arg
Glu Leu Thr Lys Leu Lys Ser Thr Tyr Ile Asp Pro Leu 260 265 270Pro
Asp Leu Ile His Pro Arg Thr Gly Arg Leu His Thr Arg Phe Asn 275 280
285Gln Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser Ser Asp Pro Asn Leu
290 295 300Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln Arg Ile Arg
Arg Ala305 310 315 320Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala
Leu Asp Tyr Ser Gln 325 330 335Ile Glu Leu Arg Val Leu Ala His Leu
Ser Gly Asp Glu Asn Leu Ile 340 345 350Arg Val Phe Gln Glu Gly Arg
Asp Ile His Thr Glu Thr Ala Ser Trp 355 360 365Met Phe Gly Val Pro
Arg Glu Ala Val Asp Pro Leu Met Arg Arg Ala 370 375 380Ala Lys Thr
Ile Asn Phe Gly Val Leu Tyr Gly Met Ser Ala His Arg385 390 395
400Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu Ala Gln Ala Phe Ile
405 410 415Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg Ala Trp Ile
Glu Lys 420 425 430Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr Val Glu
Thr Leu Phe Gly 435 440 445Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala
Arg Val Lys Ser Val Arg 450 455 460Glu Ala Ala Glu Arg Met Ala Phe
Asn Met Pro Val Gln Gly Thr Ala465 470 475 480Ala Asp Leu Met Lys
Leu Ala Met Val Lys Leu Phe Pro Arg Leu Glu 485 490 495Glu Met Gly
Ala Arg Met Leu Leu Gln Leu His Asp Glu Leu Val Leu 500 505 510Glu
Ala Pro Lys Glu Arg Ala Glu Ala Val Ala Arg Leu Ala Lys Glu 515 520
525Val Met Glu Gly Val Tyr Pro Leu Ala Val Pro Leu Glu Val Glu Val
530 535 540Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu Ala Ala545
550 5551771676DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT
ID 42 (H784S KlenTaq) 177catatgggtt cactgcttca tgaattcggt
ctgttagagt ctcctaaagc actcgaagag 60gcaccgtggc cgcccccaga aggtgctttt
gttggcttcg tactttcccg taaggagcct 120atgtgggcag atcttctggc
tttagcggct gcacgcggtg gccgtgttca ccgggcccct 180gagccataca
aagcgttacg tgatctgaag gaagcacgtg gcttgctggc aaaagacctt
240tctgttttgg ccctgcgcga gggtcttgga ctgccgccag gcgacgatcc
catgttattg 300gcctatctgt tagaccctag caataccaca cctgaagggg
tcgctcgtcg gtatggcggt 360gaatggactg aggaagccgg agagcgcgcc
gcattgtccg aacggctctt tgcaaactta 420tggggtcgtc tggaagggga
ggaacgtctg ttatggttgt atcgggaagt cgaacgtcct 480ctttcggccg
tattagcgca tatggaggca acaggtgtgc gtttagatgt cgcgtacctt
540cgggccttat cactggaagt tgcagaggaa atcgcccgtc tcgaggctga
agtgttccgg 600ttggccggtc acccgtttaa cctcaactcc cgtgaccagc
tggaacgcgt tttattcgat 660gagcttgggc ttcccgcaat tggcaaaacc
gaaaagactg gcaaacgcag tacgagcgct 720gccgtccttg aggcactccg
cgaggctcac cctattgtag aaaagatcct gcaataccgt 780gagttgacga
agcttaaaag cacttatatt gatcctctcc cggatctgat ccatcctcgt
840accggccgct tgcacacacg tttcaaccag acggcgactg caaccggccg
tctgtctagc 900tcggatccaa atctccagaa cattccggtc cgtacaccct
tgggccaacg tatccgccgg 960gcgtttatcg ctgaggaagg atggttactg
gtcgcattgg actactcgca gattgagctg 1020cgcgtcctcg cacatctctc
tggtgacgaa aatttaatcc gcgtgtttca agaggggcgt 1080gatattcaca
cagaaactgc ctcatggatg ttcggtgtcc cacgtgaagc agtggatcct
1140ttgatgcgcc gtgcagctaa aacaattaat tttggagtgc tgtacggaat
gagcgctcat 1200cgcttgagtc aggaactggc aatcccctac gaggaagcgc
aggcattcat cgaacgttac 1260tttcaatcgt ttccgaaagt tcgcgcatgg
atcgagaaga cgctcgagga aggtcgtcgt 1320cggggctatg tcgaaactct
gtttggtcgc cgtcggtacg taccagatct tgaagcccgc 1380gtcaaatcgg
tacgggaggc tgcggagcgt atggcattta atatgcctgt acagggtact
1440gcagctgacc tcatgaaact ggcaatggtc aagcttttcc cgcgcttgga
ggaaatgggc 1500gcacgtatgc ttctgcaggt cagcgacgag ctggtgttag
aagcccctaa ggagcgcgcc 1560gaagctgtcg cgcgcctcgc taaagaagtg
atggagggcg tttacccatt ggccgtaccc 1620ctcgaagtgg aggtcggtat
tggagaagat tggttatctg caaaggaagc ggccgc 1676178557PRTArtificial
SequenceAMINO ACID SEQUENCE OF MUTANT ID 42 (H784S KlenTaq) 178Met
Gly Ser Leu Leu His Glu Phe Gly Leu Leu Glu Ser Pro Lys Ala1 5 10
15Leu Glu Glu Ala Pro Trp Pro Pro Pro Glu Gly Ala Phe Val Gly Phe
20 25 30Val Leu Ser Arg Lys Glu Pro Met Trp Ala Asp Leu Leu Ala Leu
Ala 35 40 45Ala Ala Arg Gly Gly Arg Val His Arg Ala Pro Glu Pro Tyr
Lys Ala 50 55 60Leu Arg Asp Leu Lys Glu Ala Arg Gly Leu Leu Ala Lys
Asp Leu Ser65 70 75 80Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro
Pro Gly Asp Asp Pro 85 90 95Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser
Asn Thr Thr Pro Glu Gly 100 105 110Val Ala Arg Arg Tyr Gly Gly Glu
Trp Thr Glu Glu Ala Gly Glu Arg 115 120 125Ala Ala Leu Ser Glu Arg
Leu Phe Ala Asn Leu Trp Gly Arg Leu Glu 130 135 140Gly Glu Glu Arg
Leu Leu Trp Leu Tyr Arg Glu Val Glu Arg Pro Leu145 150 155 160Ser
Ala Val Leu Ala His Met Glu Ala Thr Gly Val Arg Leu Asp Val 165 170
175Ala Tyr Leu Arg Ala Leu Ser Leu Glu Val Ala Glu Glu Ile Ala Arg
180 185 190Leu Glu Ala Glu Val Phe Arg Leu Ala Gly His Pro Phe Asn
Leu Asn 195 200 205Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp Glu
Leu Gly Leu Pro 210 215 220Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys
Arg Ser Thr Ser Ala Ala225 230 235 240Val Leu Glu Ala Leu Arg Glu
Ala His Pro Ile Val Glu Lys Ile Leu 245 250 255Gln Tyr Arg Glu Leu
Thr Lys Leu Lys Ser Thr Tyr Ile Asp Pro Leu 260 265 270Pro Asp Leu
Ile His Pro Arg Thr Gly Arg Leu His Thr Arg Phe Asn 275 280 285Gln
Thr Ala Thr Ala Thr Gly Arg Leu Ser Ser Ser Asp Pro Asn Leu 290 295
300Gln Asn Ile Pro Val Arg Thr Pro Leu Gly Gln Arg Ile Arg Arg
Ala305 310 315 320Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala Leu
Asp Tyr Ser Gln 325 330 335Ile Glu Leu Arg Val Leu Ala His Leu Ser
Gly Asp Glu Asn Leu Ile 340 345 350Arg Val Phe Gln Glu Gly Arg Asp
Ile His Thr Glu Thr Ala Ser Trp 355 360 365Met Phe Gly Val Pro Arg
Glu Ala Val Asp Pro Leu Met Arg Arg Ala 370 375 380Ala Lys Thr Ile
Asn Phe Gly Val Leu Tyr Gly Met Ser Ala His Arg385 390 395 400Leu
Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu Ala Gln Ala Phe Ile 405 410
415Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg Ala Trp Ile Glu Lys
420 425 430Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr Val Glu Thr Leu
Phe Gly 435 440 445Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala Arg Val
Lys Ser Val Arg 450 455 460Glu Ala Ala Glu Arg Met Ala Phe Asn Met
Pro Val Gln Gly Thr Ala465 470 475 480Ala Asp Leu Met Lys Leu Ala
Met Val Lys Leu Phe Pro Arg Leu Glu 485 490 495Glu Met Gly Ala Arg
Met Leu Leu Gln Val Ser Asp Glu Leu Val Leu 500 505 510Glu Ala Pro
Lys Glu Arg Ala Glu Ala Val Ala Arg Leu Ala Lys Glu 515 520 525Val
Met Glu Gly Val Tyr Pro Leu Ala Val Pro Leu Glu Val Glu Val 530 535
540Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu Ala Ala545 550
5551791676DNAArtificial SequenceNUCLEOTIDE SEQUENCE OF MUTANT ID 43
(H784Y KlenTaq) 179catatgggtt cactgcttca tgaattcggt ctgttagagt
ctcctaaagc actcgaagag 60gcaccgtggc cgcccccaga aggtgctttt gttggcttcg
tactttcccg taaggagcct 120atgtgggcag atcttctggc tttagcggct
gcacgcggtg gccgtgttca ccgggcccct 180gagccataca aagcgttacg
tgatctgaag gaagcacgtg gcttgctggc aaaagacctt 240tctgttttgg
ccctgcgcga gggtcttgga ctgccgccag gcgacgatcc catgttattg
300gcctatctgt tagaccctag caataccaca cctgaagggg tcgctcgtcg
gtatggcggt 360gaatggactg aggaagccgg agagcgcgcc gcattgtccg
aacggctctt tgcaaactta 420tggggtcgtc tggaagggga ggaacgtctg
ttatggttgt atcgggaagt cgaacgtcct 480ctttcggccg tattagcgca
tatggaggca acaggtgtgc gtttagatgt cgcgtacctt 540cgggccttat
cactggaagt tgcagaggaa atcgcccgtc tcgaggctga agtgttccgg
600ttggccggtc acccgtttaa cctcaactcc cgtgaccagc tggaacgcgt
tttattcgat 660gagcttgggc ttcccgcaat tggcaaaacc gaaaagactg
gcaaacgcag tacgagcgct 720gccgtccttg aggcactccg cgaggctcac
cctattgtag aaaagatcct gcaataccgt 780gagttgacga agcttaaaag
cacttatatt gatcctctcc cggatctgat ccatcctcgt 840accggccgct
tgcacacacg tttcaaccag acggcgactg caaccggccg tctgtctagc
900tcggatccaa atctccagaa cattccggtc cgtacaccct tgggccaacg
tatccgccgg 960gcgtttatcg ctgaggaagg atggttactg gtcgcattgg
actactcgca gattgagctg 1020cgcgtcctcg cacatctctc tggtgacgaa
aatttaatcc gcgtgtttca agaggggcgt 1080gatattcaca cagaaactgc
ctcatggatg ttcggtgtcc cacgtgaagc agtggatcct 1140ttgatgcgcc
gtgcagctaa aacaattaat tttggagtgc tgtacggaat gagcgctcat
1200cgcttgagtc aggaactggc aatcccctac gaggaagcgc aggcattcat
cgaacgttac 1260tttcaatcgt ttccgaaagt tcgcgcatgg atcgagaaga
cgctcgagga aggtcgtcgt 1320cggggctatg tcgaaactct gtttggtcgc
cgtcggtacg taccagatct tgaagcccgc 1380gtcaaatcgg tacgggaggc
tgcggagcgt atggcattta atatgcctgt acagggtact 1440gcagctgacc
tcatgaaact ggcaatggtc aagcttttcc cgcgcttgga ggaaatgggc
1500gcacgtatgc ttctgcaggt ctatgacgag ctggtgttag aagcccctaa
ggagcgcgcc 1560gaagctgtcg cgcgcctcgc taaagaagtg atggagggcg
tttacccatt ggccgtaccc 1620ctcgaagtgg aggtcggtat tggagaagat
tggttatctg caaaggaagc ggccgc 1676180557PRTArtificial SequenceAMINO
ACID SEQUENCE OF MUTANT ID 43 (H784Y KlenTaq) 180Met Gly Ser Leu
Leu His Glu Phe Gly Leu Leu Glu Ser Pro Lys Ala1 5 10 15Leu Glu Glu
Ala Pro Trp Pro Pro Pro Glu Gly Ala Phe Val Gly Phe 20 25 30Val Leu
Ser Arg Lys Glu Pro Met Trp Ala Asp Leu Leu Ala Leu Ala 35 40 45Ala
Ala Arg Gly Gly Arg Val His Arg Ala Pro Glu Pro Tyr Lys Ala 50 55
60Leu Arg Asp Leu Lys Glu Ala Arg Gly Leu Leu Ala Lys Asp Leu Ser65
70 75 80Val Leu Ala Leu Arg Glu Gly Leu Gly Leu Pro Pro Gly Asp Asp
Pro 85 90 95Met Leu Leu Ala Tyr Leu Leu Asp Pro Ser Asn Thr Thr Pro
Glu Gly 100 105 110Val Ala Arg Arg Tyr Gly Gly Glu Trp Thr Glu Glu
Ala Gly Glu Arg 115 120 125Ala Ala Leu Ser Glu Arg Leu Phe Ala Asn
Leu Trp Gly Arg Leu Glu 130 135 140Gly Glu Glu Arg Leu Leu Trp Leu
Tyr Arg Glu Val Glu Arg Pro Leu145 150 155 160Ser Ala Val Leu Ala
His Met Glu Ala Thr Gly Val Arg Leu Asp Val 165 170 175Ala Tyr Leu
Arg Ala Leu Ser Leu Glu Val Ala Glu Glu Ile Ala Arg 180 185 190Leu
Glu Ala Glu Val Phe Arg Leu Ala Gly His Pro Phe Asn Leu Asn 195 200
205Ser Arg Asp Gln Leu Glu Arg Val Leu Phe Asp Glu Leu Gly Leu Pro
210 215 220Ala Ile Gly Lys Thr Glu Lys Thr Gly Lys Arg Ser Thr Ser
Ala Ala225 230 235 240Val Leu Glu Ala Leu Arg Glu Ala His Pro Ile
Val Glu Lys Ile Leu 245 250 255Gln Tyr Arg Glu Leu Thr Lys Leu Lys
Ser Thr Tyr Ile Asp Pro Leu 260 265 270Pro Asp Leu Ile His Pro Arg
Thr Gly Arg Leu His Thr Arg Phe Asn 275 280 285Gln Thr Ala Thr Ala
Thr Gly Arg Leu Ser Ser Ser Asp Pro Asn Leu 290 295 300Gln Asn Ile
Pro Val Arg Thr Pro Leu Gly Gln Arg Ile Arg Arg Ala305 310 315
320Phe Ile Ala Glu Glu Gly Trp Leu Leu Val Ala Leu Asp Tyr Ser Gln
325 330 335Ile Glu Leu Arg Val Leu Ala His Leu Ser Gly Asp Glu Asn
Leu Ile 340 345 350Arg Val Phe Gln Glu Gly Arg Asp Ile His Thr Glu
Thr Ala Ser Trp 355 360 365Met Phe Gly Val
Pro Arg Glu Ala Val Asp Pro Leu Met Arg Arg Ala 370 375 380Ala Lys
Thr Ile Asn Phe Gly Val Leu Tyr Gly Met Ser Ala His Arg385 390 395
400Leu Ser Gln Glu Leu Ala Ile Pro Tyr Glu Glu Ala Gln Ala Phe Ile
405 410 415Glu Arg Tyr Phe Gln Ser Phe Pro Lys Val Arg Ala Trp Ile
Glu Lys 420 425 430Thr Leu Glu Glu Gly Arg Arg Arg Gly Tyr Val Glu
Thr Leu Phe Gly 435 440 445Arg Arg Arg Tyr Val Pro Asp Leu Glu Ala
Arg Val Lys Ser Val Arg 450 455 460Glu Ala Ala Glu Arg Met Ala Phe
Asn Met Pro Val Gln Gly Thr Ala465 470 475 480Ala Asp Leu Met Lys
Leu Ala Met Val Lys Leu Phe Pro Arg Leu Glu 485 490 495Glu Met Gly
Ala Arg Met Leu Leu Gln Val Tyr Asp Glu Leu Val Leu 500 505 510Glu
Ala Pro Lys Glu Arg Ala Glu Ala Val Ala Arg Leu Ala Lys Glu 515 520
525Val Met Glu Gly Val Tyr Pro Leu Ala Val Pro Leu Glu Val Glu Val
530 535 540Gly Ile Gly Glu Asp Trp Leu Ser Ala Lys Glu Ala Ala545
550 555
* * * * *
References