U.S. patent application number 16/462892 was filed with the patent office on 2021-10-14 for inhibitors of cyclin-dependent kinase 12 (cdk12) and uses thereof.
This patent application is currently assigned to Dana-Farber Cancer Institute, Inc.. The applicant listed for this patent is Dana-Farber Cancer Institute, Inc.. Invention is credited to Nathanael S. Gray, Baishan Jiang, Nicholas Paul Kwiatkowski, Tinghu Zhang.
Application Number | 20210317105 16/462892 |
Document ID | / |
Family ID | 1000005866144 |
Filed Date | 2021-10-14 |
United States Patent
Application |
20210317105 |
Kind Code |
A9 |
Gray; Nathanael S. ; et
al. |
October 14, 2021 |
INHIBITORS OF CYCLIN-DEPENDENT KINASE 12 (CDK12) AND USES
THEREOF
Abstract
The present invention provides novel compounds of Formulae (I')
and (II), and pharmaceutically acceptable salts, solvates,
hydrates, polymorphs, co-crystals, tautomers, stereoisomers,
isotopically labeled derivatives, prodrugs, and compositions
thereof. Also provided are methods and kits involving the inventive
compounds or compositions for treating and/or preventing
proliferative diseases (e.g., cancers (e.g., leukemia, acute
lymphoblastic leukemia, lymphoma, Burkitt's lymphoma, melanoma,
multiple myeloma, breast cancer, Ewing's sarcoma, osteosarcoma,
brain cancer, ovarian cancer, neuroblastoma, lung cancer,
colorectal cancer), benign neoplasms, diseases associated with
angiogenesis, inflammatory diseases, autoinflammatory diseases, and
autoimmune diseases) in a subject. Treatment of a subject with a
proliferative disease using a compound or composition of the
invention may inhibit the aberrant activity of a kinase, such as a
cyclin-dependent kinase (CDK) (e.g., CDK12), and therefore, induce
cellular apoptosis and/or inhibit transcription in the subject.
##STR00001##
Inventors: |
Gray; Nathanael S.; (Boston,
MA) ; Zhang; Tinghu; (Brookline, MA) ; Jiang;
Baishan; (Brookline, MA) ; Kwiatkowski; Nicholas
Paul; (Brookline, MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Dana-Farber Cancer Institute, Inc. |
Boston |
MA |
US |
|
|
Assignee: |
Dana-Farber Cancer Institute,
Inc.
Boston
MA
|
Prior
Publication: |
|
Document Identifier |
Publication Date |
|
US 20200361906 A1 |
November 19, 2020 |
|
|
Family ID: |
1000005866144 |
Appl. No.: |
16/462892 |
Filed: |
November 22, 2017 |
PCT Filed: |
November 22, 2017 |
PCT NO: |
PCT/US2017/063132 PCKC 00 |
371 Date: |
May 21, 2019 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
62425519 |
Nov 22, 2016 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07D 403/04 20130101;
C07D 401/14 20130101 |
International
Class: |
C07D 403/04 20060101
C07D403/04; C07D 401/14 20060101 C07D401/14 |
Claims
1. A compound of Formula (I'): ##STR00264## or a pharmaceutically
acceptable salt, solvate, hydrate, tautomer, or stereoisomer
thereof, wherein: Ring A is an optionally substituted heteroaryl
ring of any one of the Formulae (ii-1)-(ii-5): ##STR00265## or an
optionally substituted 6-membered aryl or heteroaryl ring; each
instance of V.sup.1, V.sup.2, V.sup.3, V.sup.4, V.sup.5, V.sup.6,
V.sup.7, V.sup.8, V.sup.9, V.sup.10, V.sup.11, V.sup.12, V.sup.13,
and V.sup.14 is independently O, S, N, N(R.sup.A1), C, or
C(R.sup.A2); Z is --CH-- or --N--; each instance of R.sup.A1 is
independently selected from hydrogen, optionally substituted acyl,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
and optionally substituted heteroaryl; each instance of R.sup.A2 is
independently selected from hydrogen, halogen, --CN, optionally
substituted acyl, optionally substituted alkyl, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, optionally substituted heteroaryl,
--OR.sup.A2a, --N(R.sup.A2b).sub.2, and --SR.sup.A2a, wherein
R.sup.A2a is independently selected from hydrogen, optionally
substituted acyl, optionally substituted alkyl, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, and optionally substituted heteroaryl,
an oxygen protecting group when attached to an oxygen atom, and a
sulfur protecting group when attached to a sulfur atom; wherein
each occurrence of R.sup.A2b is independently selected from
hydrogen, optionally substituted acyl, optionally substituted
alkyl, optionally substituted alkenyl, optionally substituted
alkynyl, optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, optionally substituted
heteroaryl, and a nitrogen protecting group, or optionally two
instances of R.sup.A2b are taken together with their intervening
atoms to form a substituted or unsubstituted heterocyclic or
substituted or unsubstituted heteroaryl ring; or any two R.sup.A1,
any two R.sup.A2, or one R.sup.A1 and one R.sup.A2 are joined to
form an optionally substituted carbocyclic, optionally substituted
heterocyclic, optionally substituted aryl, or optionally
substituted heteroaryl ring; each of R.sup.1b is independently
selected from hydrogen, halogen, optionally substituted acyl,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
optionally substituted heteroaryl, --CN, --OR.sup.B1a,
--N(R.sup.B1b).sub.2, and --SR.sup.B1a, wherein each occurrence of
R.sup.B1a is independently selected from hydrogen, optionally
substituted acyl, optionally substituted alkyl, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, and optionally substituted heteroaryl,
an oxygen protecting group when attached to an oxygen atom, and a
sulfur protecting group when attached to a sulfur atom, wherein
each occurrence of R.sup.B1b is independently selected from
hydrogen, optionally substituted acyl, optionally substituted
alkyl, optionally substituted alkenyl, optionally substituted
alkynyl, optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, optionally substituted
heteroaryl, and a nitrogen protecting group, or optionally two
instances of R.sup.B1b are taken together with their intervening
atoms to form a substituted or unsubstituted heterocyclic or
substituted or unsubstituted heteroaryl ring; R.sup.2 is --O--,
--S--, --N(R.sup.6)--, or an optionally substituted C.sub.1-C.sub.4
alkylene, wherein one or more methylene units of the alkylene are
optionally and independently replaced with --O--, --S--, or
--N(R.sup.6)--; each instance of R.sup.3, if present, is
independently selected from halogen, optionally substituted acyl,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
optionally substituted heteroaryl, --OR.sup.C1,
--N(R.sup.C1a).sub.2, and --SR.sup.C1, wherein each occurrence of
R.sup.C1 is independently selected from hydrogen, optionally
substituted acyl, optionally substituted alkyl, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, optionally substituted heteroaryl, an
oxygen protecting group when attached to an oxygen atom, and a
sulfur protecting group when attached to a sulfur atom; wherein
each occurrence of R.sup.C1a is independently selected from
hydrogen, optionally substituted acyl, optionally substituted
alkyl, optionally substituted alkenyl, optionally substituted
alkynyl, optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, optionally substituted
heteroaryl, and a nitrogen protecting group, or optionally two
instances of R.sup.C1a are taken together with their intervening
atoms to form a substituted or unsubstituted heterocyclic or
substituted or unsubstituted heteroaryl ring; or two R.sup.3 groups
bound to the same ring carbon atom are taken together to form
.dbd.O, or two R.sup.3 groups bound to the same or different ring
carbon atoms are joined to form an optionally substituted
carbocyclyl, optionally substituted heterocyclyl, optionally
substituted aryl, or optionally substituted heteroaryl ring;
R.sup.4 is selected from a bond, --C(.dbd.O)--, --O--, --S--,
--N(R.sup.6)--, --S(.dbd.O).sub.2--, or an optionally substituted
C.sub.1-C.sub.4 alkylene, wherein: one or more methylene units of
the alkylene other than a methylene unit bound to a nitrogen atom
is optionally and independently replaced with --C(.dbd.O), --O--,
--S--, --N(R.sup.6)--, or --S(.dbd.O).sub.2--; each R.sup.6 is
independently selected from hydrogen and --C.sub.1-C.sub.6 alkyl;
R.sup.7 is a warhead of formula: ##STR00266## ##STR00267## wherein:
L.sup.3 is a bond or an optionally substituted C.sub.1-4
hydrocarbon chain, optionally wherein one or more carbon units of
the hydrocarbon chain are independently replaced with --C.dbd.O--,
--O--, --S--, --NR.sup.L3a--, --NR.sup.L3aC(.dbd.O)--,
--C(.dbd.O)NR.sup.L3a--, --SC(.dbd.O)--, --C(.dbd.O)S--,
--OC(.dbd.O)--, --C(.dbd.O)O--, --NR.sup.L3aC(.dbd.S)--,
--C(.dbd.S)NR.sup.L3a--, trans-CR.sup.L3b.dbd.CR.sup.L3b--,
cis-CR.sup.L3b.dbd.CR.sup.L3b--, --C.ident.C--, --S(.dbd.O)--,
--S(.dbd.O)O--, --OS(.dbd.O)--, --S(.dbd.O)NR.sup.L3a--,
--NR.sup.L3aS(.dbd.O)--, --S(.dbd.O).sub.2--, --S(.dbd.O).sub.2O--,
--OS(.dbd.O).sub.2--, --S(.dbd.O).sub.2NR.sup.L3a--, or
--NR.sup.L3aS(.dbd.O).sub.2--, wherein R.sup.L3a is hydrogen,
substituted or unsubstituted C.sub.1-6 alkyl, or a nitrogen
protecting group, and wherein each occurrence of R.sup.L3b is
independently hydrogen, halogen, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, or optionally
substituted heteroaryl, or two R.sup.L3b groups are joined to form
an optionally substituted carbocyclic or optionally substituted
heterocyclic ring; L.sup.4 is a bond or an optionally substituted,
branched or unbranched C.sub.1-6 hydrocarbon chain; each of
R.sup.E1, R.sup.E2, and R.sup.E3 is independently hydrogen,
halogen, optionally substituted alkyl, optionally substituted
alkenyl, optionally substituted alkynyl, optionally substituted
carbocyclyl, optionally substituted heterocyclyl, optionally
substituted aryl, optionally substituted heteroaryl, --CN,
--CH.sub.2OR.sup.EE, --CH.sub.2N(R.sup.EE).sub.2,
--CH.sub.2SR.sup.EE, --OR.sup.EE, --N(R.sup.EE).sub.2,
--Si(R.sup.EE).sub.3, or --SR.sup.EE, wherein each instance of
R.sup.EE is independently hydrogen, optionally substituted alkyl,
optionally substituted alkoxy, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
or optionally substituted heteroaryl, or two R.sup.EE groups are
joined to form an optionally substituted heterocyclic ring; or
R.sup.E1 and R.sup.E3, or R.sup.E2 and R.sup.E3, or R.sup.E1 and
R.sup.E2 are joined to form an optionally substituted carbocyclic
or optionally substituted heterocyclic ring; R.sup.E4 is a leaving
group; R.sup.E5 is halogen; R.sup.E6 is hydrogen, substituted or
unsubstituted C.sub.1-6 alkyl, or a nitrogen protecting group; each
instance of Y is independently O, S, or NR.sup.E7, wherein R.sup.E7
is hydrogen, substituted or unsubstituted C.sub.1-6 alkyl, or a
nitrogen protecting group; a is 1 or 2; each instance of z is
independently 0, 1, 2, 3, 4, 5, or 6, as valency permits; and W is
--CR.sup.D1-- or --N.dbd.; each instance of R.sup.8, if present, is
independently selected from hydrogen, halogen, optionally
substituted acyl, optionally substituted alkyl, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, optionally substituted heteroaryl,
--OR.sup.D, --N(R.sup.D1a).sub.2, and --SR.sup.D1, wherein each
occurrence of R.sup.D1 is independently selected from hydrogen,
optionally substituted acyl, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, and optionally
substituted heteroaryl, an oxygen protecting group when attached to
an oxygen atom, or a sulfur protecting group when attached to a
sulfur atom, wherein each occurrence of R.sup.D1a is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, and a nitrogen protecting group, or
optionally two instances of R.sup.D1a are taken together with their
intervening atoms to form a substituted or unsubstituted
heterocyclic or substituted or unsubstituted heteroaryl ring; or
two R.sup.8 groups are joined to form an optionally substituted
carbocyclyl, optionally substituted heterocyclyl, optionally
substituted aryl, or optionally substituted heteroaryl ring; m is
0, 1, 2, 3 or 4; and n is 0, 1, 2, 3, 4, 5 or 6.
2. (canceled)
3. A compound of Formula (II): ##STR00268## or a pharmaceutically
acceptable salt, solvate, hydrate, tautomer, or stereoisomer
thereof, wherein: Ring A is an optionally substituted heteroaryl
ring of any one of the Formulae (ii-1)-(ii-5): ##STR00269## or an
optionally substituted 6-membered aryl or heteroaryl ring; each
instance of V.sup.1, V.sup.2, V.sup.3, V.sup.4, V.sup.5, V.sup.6,
V.sup.7, V.sup.8, V.sup.9, V.sup.10, V.sup.11, V.sup.12, V.sup.13,
and V.sup.14 is independently O, S, N, N(R.sup.A1), C, or
C(R.sup.A2); each instance of R.sup.A1 is independently selected
from hydrogen, optionally substituted acyl, optionally substituted
alkyl, optionally substituted alkenyl, optionally substituted
alkynyl, optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, and optionally
substituted heteroaryl; each instance of R.sup.A2 is independently
selected from hydrogen, halogen, --CN, optionally substituted acyl,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
optionally substituted heteroaryl, --OR.sup.A2a,
N(R.sup.A2b).sub.2, and --SR.sup.A2a, wherein R.sup.A2a is
independently selected from hydrogen, optionally substituted acyl,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
and optionally substituted heteroaryl, an oxygen protecting group
when attached to an oxygen atom, or a sulfur protecting group when
attached to a sulfur atom; wherein each occurrence of R.sup.A2b is
independently selected from hydrogen, optionally substituted acyl,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
and optionally substituted heteroaryl, a nitrogen protecting group,
or optionally two instances of R.sup.A2b are taken together with
their intervening atoms to form a substituted or unsubstituted
heterocyclic or substituted or unsubstituted heteroaryl ring; or
any two R.sup.A1, any two R.sup.A2, or one R.sup.A1 and one
R.sup.A2 are joined to form an optionally substituted carbocyclic,
optionally substituted heterocyclic, optionally substituted aryl,
or optionally substituted heteroaryl ring; each of R.sup.1b is
independently selected from hydrogen, halogen, optionally
substituted acyl, optionally substituted alkyl, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, optionally substituted heteroaryl,
--CN, --OR.sup.B1a, --N(R.sup.B1b).sub.2, and --SR.sup.B1a, wherein
each occurrence of R.sup.B1a is independently selected from
hydrogen, optionally substituted acyl, optionally substituted
alkyl, optionally substituted alkenyl, optionally substituted
alkynyl, optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, and optionally
substituted heteroaryl, an oxygen protecting group when attached to
an oxygen atom, or a sulfur protecting group when attached to a
sulfur atom, wherein each occurrence of R.sup.B1b is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, and
optionally substituted heteroaryl, a nitrogen protecting group, or
optionally two instances of R.sup.B1b are taken together with their
intervening atoms to form a substituted or unsubstituted
heterocyclic or substituted or unsubstituted heteroaryl ring; each
instance of R.sup.3, if present, is independently selected from
halogen, optionally substituted acyl, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, optionally substituted
heteroaryl, --OR.sup.C1, --N(R.sup.C1a).sub.2, and --SR.sup.C1,
wherein each occurrence of R.sup.C1 is independently selected from
hydrogen, optionally substituted acyl, optionally substituted
alkyl, optionally substituted alkenyl, optionally substituted
alkynyl, optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, and optionally
substituted heteroaryl, an oxygen protecting group when attached to
an oxygen atom, or a sulfur protecting group when attached to a
sulfur atom, wherein each occurrence of R.sup.C1a is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, and
optionally substituted heteroaryl, a nitrogen protecting group, or
optionally two instances of R.sup.C1a are taken together with their
intervening atoms to form a substituted or unsubstituted
heterocyclic or substituted or unsubstituted heteroaryl ring; or
two R.sup.3 groups bound to the same ring carbon atom are taken
together to form .dbd.O, or two R.sup.3 groups bound to the same or
different ring carbon atoms are joined to form an optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, or optionally substituted heteroaryl
ring; each R.sup.6 is independently selected from hydrogen and
--C.sub.1-C.sub.6 alkyl; R.sup.7 is a warhead of formula:
##STR00270## ##STR00271## ##STR00272## ##STR00273## ##STR00274##
##STR00275## wherein: L.sup.3 is a bond or an optionally
substituted C.sub.1-4 hydrocarbon chain, optionally wherein one or
more carbon units of the hydrocarbon chain are independently
replaced with --C.dbd.O--, --O--, --S--, --NR.sup.L3a--,
--NR.sup.L3aC(.dbd.O)--, --C(.dbd.O)NR.sup.L3a--, --SC(.dbd.O)--,
--C(O)S--, --OC(.dbd.O)--, --C(.dbd.O)O--, --NR.sup.L3aC(.dbd.S)--,
--C(.dbd.S)NR.sup.L3a--, trans-CR.sup.L3b.dbd.CR.sup.L3b--,
cis-CR.sup.L3b.dbd.CR.sup.L3b--, --C.ident.C--, --S(.dbd.O)--,
--S(.dbd.O)O--, --OS(.dbd.O)--, --S(.dbd.O)NR.sup.L3a,
--NR.sup.L3aS(.dbd.O)--, --S(.dbd.O).sub.2--, --S(.dbd.O).sub.2O--,
--OS(.dbd.O).sub.2--, --S(.dbd.O).sub.2NR.sup.L3a--, or
--NR.sup.L3aS(.dbd.O).sub.2--, wherein R.sup.L3a is hydrogen,
substituted or unsubstituted C.sub.1-6 alkyl, or a nitrogen
protecting group, and wherein each occurrence of R.sup.L3b is
independently hydrogen, halogen, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, or optionally
substituted heteroaryl, or two R.sup.L3b groups are joined to form
an optionally substituted carbocyclic or optionally substituted
heterocyclic ring; L.sup.4 is a bond or an optionally substituted,
branched or unbranched C.sub.1-6 hydrocarbon chain; each of
R.sup.E1, R.sup.E2, and R.sup.E3 is independently hydrogen,
halogen, optionally substituted alkyl, optionally substituted
alkenyl, optionally substituted alkynyl, optionally substituted
carbocyclyl, optionally substituted heterocyclyl, optionally
substituted aryl, optionally substituted heteroaryl, --CN,
--CH.sub.2OR.sup.EE, --CH.sub.2N(R.sup.EE).sub.2,
--CH.sub.2SR.sup.EE, --OR.sup.EE, --N(R.sup.EE).sub.2,
--Si(R.sup.EE).sub.3, or --SR.sup.EE, wherein each instance of
R.sup.EE is independently hydrogen, optionally substituted alkyl,
optionally substituted alkoxy, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
or optionally substituted heteroaryl, or two R.sup.EE groups are
joined to form an optionally substituted heterocyclic ring; or
R.sup.E1 and R.sup.E3, or R.sup.E2 and R.sup.E3, or R.sup.E1 and
R.sup.E2 are joined to form an optionally substituted carbocyclic
or optionally substituted heterocyclic ring; R.sup.E4 is a leaving
group; R.sup.E5 is halogen; R.sup.E6 is hydrogen, substituted or
unsubstituted C.sub.1-6 alkyl, or a nitrogen protecting group; each
instance of Y is independently O, S, or NR.sup.E7, wherein R.sup.E7
is hydrogen, substituted or unsubstituted C.sub.1-6 alkyl, or a
nitrogen protecting group; a is 1 or 2; each instance of z is
independently 0, 1, 2, 3, 4, 5, or 6, as valency permits; and each
instance of R.sup.8, if present, is independently selected from
hydrogen, halogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, --OR.sup.D1, --N(R.sup.D1a).sub.2, and
--SR.sup.D1, wherein each occurrence of R.sup.D1 is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, and
optionally substituted heteroaryl, an oxygen protecting group when
attached to an oxygen atom, or a sulfur protecting group when
attached to a sulfur atom, wherein each occurrence of R.sup.D1a is
independently selected from hydrogen, optionally substituted acyl,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
and optionally substituted heteroaryl, a nitrogen protecting group,
or optionally two instances of R.sup.D1a are taken together with
their intervening atoms to form a substituted or unsubstituted
heterocyclic or substituted or unsubstituted heteroaryl ring; or
two R.sup.8 groups are joined to form an optionally substituted
carbocyclyl, optionally substituted heterocyclyl, optionally
substituted aryl, or optionally substituted heteroaryl ring; n is
0, 1, 2, 3, 4, 5 or 6; and p is 0, 1, 2, 3, 4, or 5.
4. The compound of claim 1, or a pharmaceutically acceptable salt,
solvate, hydrate, tautomer, or stereoisomer thereof, wherein Ring A
is of formula: ##STR00276##
5-6. (canceled)
7. The compound of claim 1, or a pharmaceutically acceptable salt,
solvate, hydrate, tautomer, or stereoisomer thereof, wherein
R.sup.1b is halogen.
8-10. (canceled)
11. The compound of claim 1, or a pharmaceutically acceptable salt,
solvate, hydrate, tautomer, or stereoisomer thereof, wherein
R.sup.2 is --N(R.sup.6)--.
12. (canceled)
13. The compound of claim 11, or a pharmaceutically acceptable
salt, solvate, hydrate, tautomer, or stereoisomer thereof, wherein
R.sup.6 is H.
14. The compound of claim 1, or a pharmaceutically acceptable salt,
solvate, hydrate, tautomer, or stereoisomer thereof, wherein at
least one instance of R.sup.8 is halogen, --O(alkyl), or optionally
substituted alkyl.
15. The compound of claim 1, or a pharmaceutically acceptable salt,
solvate, hydrate, tautomer, or stereoisomer thereof, wherein Z is
--CH--.
16. The compound of claim 1, or a pharmaceutically acceptable salt,
solvate, hydrate, tautomer, or stereoisomer thereof, wherein Z is
--N--.
17. The compound of claim 1, or a pharmaceutically acceptable salt,
solvate, hydrate, tautomer, or stereoisomer thereof, wherein W is
--C(Me)-.
18. The compound of claim 1, or a pharmaceutically acceptable salt,
solvate, hydrate, tautomer, or stereoisomer thereof, wherein W is
--N.dbd..
19. (canceled)
20. The compound of claim 1, or a pharmaceutically acceptable salt,
solvate, hydrate, tautomer, or stereoisomer thereof, wherein
R.sup.4 is --O--.
21-23. (canceled)
24. The compound of claim 1, or a pharmaceutically acceptable salt,
solvate, hydrate, tautomer, or stereoisomer thereof, wherein
R.sup.7 is of formula: ##STR00277##
25. The compound of claim 1, wherein the compound is of formula:
##STR00278## ##STR00279## ##STR00280## ##STR00281## or a
pharmaceutically acceptable salt, solvate, hydrate, tautomer, or
stereoisomer thereof.
26-28. (canceled)
29. A pharmaceutical composition comprising a compound of claim 1,
or a pharmaceutically acceptable salt, solvate, hydrate, tautomer,
or stereoisomer thereof, and optionally a pharmaceutically
acceptable excipient.
30. (canceled)
31. A method of treating a proliferative disease in a subject in
need thereof, the method comprising administering to the subject a
therapeutically effective amount of a compound of claim 1.
32-57. (canceled)
58. A method of inhibiting the activity of a cyclin-dependent
kinase (CDK) in a biological sample or subject, the method
comprising administering to the subject or contacting the
biological sample with a therapeutically effective amount of a
compound of claim 1.
59-60. (canceled)
61. A method of inhibiting transcription in a biological sample or
subject, the method comprising: administering to the subject or
contacting the biological sample with a therapeutically effective
amount of a compound of claim 1.
62. A method of inhibiting cell growth in a biological sample or
subject, the method comprising: administering to the subject or
contacting the biological sample with a therapeutically effective
amount of a compound of claim 1.
63. A method of inducing apoptosis of a cell in a biological sample
or subject, the method comprising: administering to the subject or
contacting the biological sample with a therapeutically effective
amount of a compound of claim 1.
64-70. (canceled)
Description
RELATED APPLICATIONS
[0001] This application claims priority under 35 U.S.C. .sctn.
119(e) to U.S. Provisional Application, U.S. Ser. No. 62/425,519,
filed Nov. 22, 2016, which is incorporated herein by reference.
BACKGROUND OF THE INVENTION
[0002] The members of the cyclin-dependent kinase (CDK) family play
critical regulatory roles in proliferation. There are currently 20
known mammalian CDKs.
[0003] CDK12 and CDK13 were identified in cDNA screens for cell
cycle regulators. Because their cyclin partners were not yet known,
they were initially named CRKRS and CDC2L5 (Ko et al., J. Cell
Sci., 2001, 114, 2591-2603; Marques et al., Biochem Biophys Res
Commun., 2000, 279(3):832-837), respectively. They were found to be
1490- and 1512-amino acid proteins, respectively, with a conserved
central CTD kinase domain and degenerate RS domains identified in
their N- and C-terminal regions (Even et al., J Cell Biochem.,
2006, 99(3), 890-904).
[0004] Evidence has shown CDK12 and CDK13 play an important role in
cancer development. A comprehensive genomic approach identified
CDK12 to be one of the most frequently somatically mutated genes in
high-grade serous ovarian cancer, the most fatal form of the
disease (Erratum, Nature, 2011, 474(7353), 609-615). Several
identified point mutations in the kinase domain point to the
critical importance of the kinase activity of CDK12 for the
development/progression of this disease. CDK12 has also been found
to contribute to the development of breast cancer. Notably, CDK12
is located on chromosome 17, within the 17q21 locus that contains
several candidate genes for breast cancer susceptibility
(Kauraniemi et al., Cancer Res., 2001, 61(22), 8235-8240), and it
is co-amplified with the tyrosine kinase receptor ERBB2, a protein
amplified and overexpressed in about 20% of breast tumors. Gene
fusion between CDK12 and ERBB2 was also detected in gastric cancer
(Zang et al., Cancer Res., 2011, 71(1), 29-39). CDK12 is also
implicated in the modification of tamoxifen sensitivity in
estrogen-positive breast cancer via the modulation of the
mitogen-activated protein kinase pathway (Iorns et al.,
Carcinogenesis, 2009, 30(10):1696-1701).
[0005] Due to the important regulatory functions of kinases, such
as CDK12, in cell cycle control, cell proliferation,
differentiation, and apoptosis, it is important to develop
modulators of the activities of these kinases, including selective
modulators (e.g., selective inhibitors), for use as research tools
as well as therapeutic agents in the treatment of diseases.
SUMMARY OF THE INVENTION
[0006] Cyclin dependent kinases (CDKs) (e.g., cyclin-dependent
kinase 12 (CDK12)) are key regulators of the cell cycle. Their
successive activation and inactivation drives the cycle forward.
The activity of CDKs is regulated by multiple mechanisms such as
positive and negative phosphorylation, binding of regulatory
proteins like cyclins, and CDK inhibitors. Most CDKs require the
phosphorylation of a threonine residue located in the T-loop to
achieve full kinase activity. This threonine residue is conserved
in all CDKs that function in cell cycle regulation. CDK12 also
plays a role in transcription and possibly in DNA repair. This
suggests that the CDK12 enzyme complexes are involved in multiple
functions in the cell, e.g., cell cycle control, apoptosis,
transcription regulation, and DNA repair.
[0007] Cyclin-dependent kinase 12 (CDK12) is recognized as an
elongation regulator of RNA polymerase II-mediated transcription
through its kinase function of phosphorylation on CTD domain of RNA
Pol II. However, the detailed mechanism is not clear, and the exact
site of phosphorylation on CTD by CDK12 is still controversial. A
genome-wide screening also identified CDK12/cyclin K playing a
critical role in mediating genome stability via regulation of
expression of DDR genes. The deletion of CDK12/cyclin K severely
impaired the expression of several critical regulators of genome
stability, such as BRCA1, ATR, FANCI, and FANCD2 proteins in cells.
Furthermore, several mutations of CDK12 were already identified in
a variety of tumors including ovary, breast, and prostate, and
these alterations on CDK12 sensitized these tumors to DNA damage
agents, such as cisplatin and its derivatives, and inhibitors of
DNA repair, such as PARP inhibitors. Thus, CDK12 is a potential
therapeutic target of drugs for cancers and other diseases.
Cysteine 1039 on CDK12 is three residues away from CDK7 cysteine
312. Recently solved CDK12 structures show that cysteine 1039 is
also targetable with a similar orientation as cysteine 312 on CDK7.
Without wishing to be bound by any particular theory, the inventive
compounds' selectivity for CDK12 may be due to the compounds'
ability to covalently modify a specific cysteine residue of these
kinases (e.g., Cys1039 of CDK12). In contrast to THZ1, these
compounds however do not bind to cysteine 312 of CDK7 and also do
not reversibly inhibit other CDKs. Without wishing to be bound by
any particular theory, the irreversible inhibition of CDK12 by the
inventive compounds results in prolonged disruption of
transcription and induction of apoptosis of a diverse subset of
cancer cell lines. Genome-wide transcript analysis following
inhibitor treatment delineates CDK12-responsive genes important in
the maintenance of the cancer cell state. Selective covalent
inhibition of CDK12 may be a viable cancer therapeutic
strategy.
[0008] The present invention provides compounds of Formulae (I')
and (II), and pharmaceutically acceptable salts, solvates,
hydrates, polymorphs, co-crystals, tautomers, stereoisomers,
isotopically labeled derivatives, prodrugs, and compositions
thereof. The compounds of Formulae (I') and (II), and
pharmaceutically acceptable salts, solvates, hydrates, polymorphs,
co-crystals, tautomers, stereoisomers, isotopically labeled
derivatives, prodrugs, and compositions thereof, may inhibit the
activity of a kinase. In certain embodiments, the kinase is a CDK.
In certain embodiments, the kinase is CDK12. In certain
embodiments, the compounds of Formulae (I') and (II) are selective
for CDK12 compared to other kinases. The present invention further
provides methods of using the inventive compounds, and
pharmaceutically acceptable salts, solvates, hydrates, polymorphs,
co-crystals, tautomers, stereoisomers, isotopically labeled
derivatives, prodrugs, and compositions thereof, to study the
inhibition of a kinase (e.g., CDK12) and as therapeutics for the
prevention and/or treatment of diseases associated with the
overexpression and/or aberrant (e.g., increased) activity of a
kinase (e.g., CDK12). In certain embodiments, the inventive
compounds are used for the prevention and/or treatment of
proliferative diseases (e.g., cancers (e.g., leukemia, lymphoma,
melanoma, multiple myeloma, breast cancer, Ewing's sarcoma,
osteosarcoma, brain cancer, neuroblastoma, lung cancer), benign
neoplasms, angiogenesis, inflammatory diseases, autoinflammatory
diseases, and autoimmune diseases) in a subject.
[0009] The present invention provides compounds of Formulae (I')
and (II), and pharmaceutically acceptable salts, solvates,
hydrates, polymorphs, co-crystals, tautomers, stereoisomers,
isotopically labeled derivatives, prodrugs, and compositions
thereof. The compounds of Formulae (I') and (II), and
pharmaceutically acceptable salts, solvates, hydrates, polymorphs,
co-crystals, tautomers, stereoisomers, isotopically labeled
derivatives, prodrugs, and compositions thereof, may inhibit the
activity of a kinase. The compounds described herein may in certain
embodiments selectively inhibit specific CDK subtypes, for example,
CDK12. In certain embodiments, the compounds of Formulae (I') and
(II) are selective for CDK12 compared to other kinases. The present
invention also provides methods of using the inventive compounds,
and pharmaceutically acceptable salts, solvates, hydrates,
polymorphs, co-crystals, tautomers, stereoisomers, isotopically
labeled derivatives, prodrugs, and compositions thereof, to study
the inhibition of a kinase (e.g., CDK12) and as therapeutics for
the prevention and/or treatment of diseases associated with the
overexpression and/or aberrant activity of a kinase (e.g., CDK12).
In certain embodiments, the inventive compounds are used for the
prevention and/or treatment of proliferative diseases (e.g.,
cancers (e.g., leukemia, acute lymphoblastic leukemia, lymphoma,
Burkitt's lymphoma, melanoma, multiple myeloma, breast cancer,
Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung
cancer, colorectal cancer), benign neoplasms, diseases associated
with angiogenesis, inflammatory diseases, autoinflammatory
diseases, and autoimmune diseases) in a subject.
[0010] In one aspect, the present invention provides compounds of
Formula (I'):
##STR00002##
and pharmaceutically acceptable salts, solvates, hydrates,
polymorphs, co-crystals, tautomers, stereoisomers, isotopically
labeled derivatives, and prodrugs thereof, wherein Ring A, Z, W,
R.sup.1b, R.sup.2, R.sup.3, R.sup.4, R.sup.7, R.sup.8, m, and n are
as defined herein.
[0011] In one aspect, the present invention provides compounds of
Formula (I):
##STR00003##
and pharmaceutically acceptable salts, solvates, hydrates,
polymorphs, co-crystals, tautomers, stereoisomers, isotopically
labeled derivatives, and prodrugs thereof, wherein Ring A, Z,
R.sup.1b, R.sup.2, R.sup.3, R.sup.4, R.sup.7, R.sup.8, m, and n are
as defined herein.
[0012] In one aspect, the present invention provides compounds of
Formula (II):
##STR00004##
and pharmaceutically acceptable salts, solvates, hydrates,
polymorphs, co-crystals, tautomers, stereoisomers, isotopically
labeled derivatives, and prodrugs thereof, wherein Ring A,
R.sup.1b, R.sup.3, R.sup.6, R.sup.7, R.sup.8, n, and p are as
defined herein.
[0013] In another aspect, the present disclosure provides
pharmaceutical compositions including a compound described herein,
and optionally a pharmaceutically acceptable excipient. In certain
embodiments, the pharmaceutical compositions described herein
include a therapeutically or prophylactically effective amount of a
compound described herein. The pharmaceutical composition may be
useful for treating a proliferative disease in a subject in need
thereof, preventing a proliferative disease in a subject in need
thereof, inhibiting the activity of a protein kinase in a subject,
biological sample, tissue, or cell, and/or inducing apoptosis in a
cell. In certain embodiments, the proliferative disease is an
inflammatory disease. In certain embodiments, the inflammatory
disease is rheumatoid arthritis, Crohn's disease, or fibrosis.
[0014] In another aspect, the present invention provides methods
for treating and/or preventing a proliferative disease. Exemplary
proliferative diseases which may be treated include diseases
associated with overexpression of a cyclin-dependent kinase (CDK),
cancer, benign neoplasms, diseases associated with angiogenesis,
inflammatory diseases, autoinflammatory diseases, and autoimmune
diseases. In certain embodiments, the proliferative disease is
cancer. In certain embodiments, the cancer is selected from the
group consisting of pancreatic cancer, lung cancer (e.g., small
cell lung cancer (SCLC), and non-small cell lung cancer), prostate
cancer, breast cancer, ovarian cancer, kidney cancer, liver cancer,
Ewing's sarcoma, osteosarcoma, brain cancer, neuroblastoma, and
colorectal cancer. In certain embodiments, the proliferative
disease is a benign neoplasm or disease associated with
angiogenesis. In certain embodiments, the proliferative disease is
an autoinflammatory disease. In certain embodiments, the
proliferative disease is an autoimmune disease.
[0015] Another aspect of the invention relates to methods of
inhibiting the activity of a kinase (e.g., CDK (e.g., CDK12)) using
a compound described herein in a biological sample or subject. In
certain embodiments, the method involves the selective inhibition
of CDK12.
[0016] Also provided by the present invention are methods of
inhibiting the transcription of one or more genes in the cell of a
biological sample or subject using a compound described herein. The
transcription of genes affected by the activity of CDK12 may be
inhibited by a compound of the invention. In certain embodiments,
these genes are one or more selected from the group consisting of
BRCA1, FANCI, ATR, FANCD2, APEX1, NEK9, CHEK1, CHEK2, ATM, RAD51C,
RAD51D, ORC3L, MDC1, TERF2, ERCC4, FANCF, PARP9, RUNX1, MYB, TAL1,
MCL1, MYC, BCL2, ETS1, and EWS-FLI.
[0017] The present invention also provides methods of inhibiting
cell growth in a biological sample or subject. In still another
aspect, the present invention provides methods of inducing
apoptosis of a cell in a biological sample or subject.
[0018] The present invention provides methods for administering to
a subject in need thereof an effective amount of a compound, or
pharmaceutical composition thereof, as described herein. Also
described are methods for contacting a cell with an effective
amount of a compound, or pharmaceutical composition thereof, as
described herein. In certain embodiments, a method described herein
further includes administering to the subject an additional
pharmaceutical agent. In certain embodiments, a method described
herein further includes contacting the cell with an additional
pharmaceutical agent. The methods described herein may further
include performing radiotherapy, immunotherapy, and/or
transplantation on the subject.
[0019] In yet another aspect, the present invention provides
compounds of Formulae (I') and (II), and pharmaceutically
acceptable salts, solvates, hydrates, polymorphs, co-crystals,
tautomers, stereoisomers, isotopically labeled derivatives,
prodrugs, and compositions thereof, for use in the treatment of a
disease (e.g., a proliferative disease such as cancer) in a
subject.
[0020] Another aspect of the present disclosure relates to kits
comprising a container with a compound, or pharmaceutical
composition thereof, as described herein. The kits described herein
may include a single dose or multiple doses of the compound or
pharmaceutical composition. The kits may be useful in a method of
the disclosure. In certain embodiments, the kit further includes
instructions for using the compound or pharmaceutical composition.
A kit described herein may also include information (e.g.
prescribing information) as required by a regulatory agency, such
as the U.S. Food and Drug Administration (FDA).
[0021] The details of one or more embodiments of the invention are
set forth herein. Other features, objects, and advantages of the
invention will be apparent from the Detailed Description, Examples,
Figures, and Claims.
Definitions
[0022] Definitions of specific functional groups and chemical terms
are described in more detail below. The chemical elements are
identified in accordance with the Periodic Table of the Elements,
CAS version, Handbook of Chemistry and Physics, 75.sup.th Ed.,
inside cover, and specific functional groups are generally defined
as described therein. Additionally, general principles of organic
chemistry, as well as specific functional moieties and reactivity,
are described in Thomas Sorrell, Organic Chemistry, University
Science Books, Sausalito, 1999; Smith and March, March's Advanced
Organic Chemistry, 5.sup.th Edition, John Wiley & Sons, Inc.,
New York, 2001; Larock, Comprehensive Organic Transformations, VCH
Publishers, Inc., New York, 1989; and Carruthers, Some Modern
Methods of Organic Synthesis, 3.sup.rd Edition, Cambridge
University Press, Cambridge, 1987. The disclosure is not intended
to be limited in any manner by the exemplary listing of
substituents described herein.
[0023] Compounds described herein can comprise one or more
asymmetric centers, and thus can exist in various isomeric forms,
e.g., enantiomers and/or diastereomers. For example, the compounds
described herein can be in the form of an individual enantiomer,
diastereomer or geometric isomer, or can be in the form of a
mixture of stereoisomers, including racemic mixtures and mixtures
enriched in one or more stereoisomer. Isomers can be isolated from
mixtures by methods known to those skilled in the art, including
chiral high pressure liquid chromatography (HPLC) and the formation
and crystallization of chiral salts; or preferred isomers can be
prepared by asymmetric syntheses. See, for example, Jacques et al.,
Enantiomers, Racemates and Resolutions (Wiley Interscience, New
York, 1981); Wilen et al., Tetrahedron 33:2725 (1977); Eliel,
Stereochemistry of Carbon Compounds (McGraw-Hill, NY, 1962); and
Wilen, Tables of Resolving Agents and Optical Resolutions p. 268
(E. L. Eliel, Ed., Univ. of Notre Dame Press, Notre Dame, Ind.
1972). The invention additionally encompasses compounds described
herein as individual isomers substantially free of other isomers,
and alternatively, as mixtures of various isomers.
[0024] When a range of values is listed, it is intended to
encompass each value and sub-range within the range. For example
"C.sub.1-6" is intended to encompass, C.sub.1, C.sub.2, C.sub.3,
C.sub.4, C.sub.5, C.sub.6, C.sub.1-6, C.sub.1-5, C.sub.1-4,
C.sub.1-3, C.sub.1-2, C.sub.2-6, C.sub.2-5, C.sub.2-4, C.sub.2-3,
C.sub.3-6, C.sub.3-5, C.sub.3-4, C.sub.4-6, C.sub.4-5, and
C.sub.5-6.
[0025] "Hydrocarbon chain" refers to a substituted or unsubstituted
divalent alkyl, alkenyl, or alkynyl group. A hydrocarbon chain
includes at least one chain, each node ("carbon unit") of which
including at least one carbon atom, between the two radicals of the
hydrocarbon chain. For example, hydrocarbon chain
--C.sup.AH(C.sup.BH.sub.2C.sup.CH.sub.3)-- includes only one carbon
unit C.sup.A. The term "C.sub.x hydrocarbon chain," wherein x is a
positive integer, refers to a hydrocarbon chain that includes x
number of carbon unit(s) between the two radicals of the
hydrocarbon chain. If there is more than one possible value of x,
the smallest possible value of x is used for the definition of the
hydrocarbon chain. For example, --CH(C.sub.2H.sub.5)-- is a C.sub.1
hydrocarbon chain, and
##STR00005##
is a C.sub.3 hydrocarbon chain. When a range of values is used,
e.g., a C.sub.1-6 hydrocarbon chain, the meaning of the range is as
described herein. A hydrocarbon chain may be saturated (e.g.,
--(CH.sub.2).sub.4--). A hydrocarbon chain may also be unsaturated
and include one or more C.dbd.C and/or C.ident.C bonds anywhere in
the hydrocarbon chain. For instance,
--CH.dbd.CH--(CH.sub.2).sub.2--, --CH.sub.2--C.ident.C--CH.sub.2--,
and --C.ident.C--CH.dbd.CH-- are all examples of a unsubstituted
and unsaturated hydrocarbon chain. In certain embodiments, the
hydrocarbon chain is unsubstituted (e.g., --(CH.sub.2).sub.4--). In
certain embodiments, the hydrocarbon chain is substituted (e.g.,
--CH(C.sub.2H.sub.5)-- and --CF.sub.2--). Any two substituents on
the hydrocarbon chain may be joined to form an optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, or optionally substituted heteroaryl
ring. For instance,
##STR00006##
are all examples of a hydrocarbon chain. In contrast, in certain
embodiments
##STR00007##
are not within the scope of the hydrocarbon chains described
herein.
[0026] "Alkyl" refers to a radical of a straight-chain or branched
saturated hydrocarbon group having from 1 to 20 carbon atoms
("C.sub.1-20 alkyl"). In some embodiments, an alkyl group has 1 to
10 carbon atoms ("C.sub.1-10 alkyl"). In some embodiments, an alkyl
group has 1 to 9 carbon atoms ("C.sub.1-9 alkyl"). In some
embodiments, an alkyl group has 1 to 8 carbon atoms ("C.sub.1-8
alkyl"). In some embodiments, an alkyl group has 1 to 7 carbon
atoms ("C.sub.1-7 alkyl"). In some embodiments, an alkyl group has
1 to 6 carbon atoms ("C.sub.1-6 alkyl"). In some embodiments, an
alkyl group has 1 to 5 carbon atoms ("C.sub.1-5 alkyl"). In some
embodiments, an alkyl group has 1 to 4 carbon atoms ("C.sub.1-4
alkyl"). In some embodiments, an alkyl group has 1 to 3 carbon
atoms ("C.sub.1-3 alkyl"). In some embodiments, an alkyl group has
1 to 2 carbon atoms ("C.sub.1-2 alkyl"). In some embodiments, an
alkyl group has 1 carbon atom ("C.sub.1 alkyl"). In some
embodiments, an alkyl group has 2 to 6 carbon atoms ("C.sub.2-6
alkyl"). Examples of C.sub.1-6 alkyl groups include methyl
(C.sub.1), ethyl (C.sub.2), n-propyl (C.sub.3), isopropyl
(C.sub.3), n-butyl (C.sub.4), tert-butyl (C.sub.4), sec-butyl
(C.sub.4), iso-butyl (C.sub.4), n-pentyl (C.sub.5), 3-pentanyl
(C.sub.5), amyl (C.sub.5), neopentyl (C.sub.5), 3-methyl-2-butanyl
(C.sub.5), tertiary amyl (C.sub.5), and n-hexyl (C.sub.6).
Additional examples of alkyl groups include n-heptyl (C.sub.7),
n-octyl (C.sub.8) and the like. Unless otherwise specified, each
instance of an alkyl group is independently optionally substituted,
i.e., unsubstituted (an "unsubstituted alkyl") or substituted (a
"substituted alkyl") with one or more substituents. In certain
embodiments, the alkyl group is unsubstituted C.sub.1-10 alkyl
(e.g., --CH.sub.3). In certain embodiments, the alkyl group is
substituted C.sub.1-10 alkyl.
[0027] "Alkenyl" refers to a radical of a straight-chain or
branched hydrocarbon group having from 2 to 20 carbon atoms, one or
more carbon-carbon double bonds, and no triple bonds ("C.sub.2-20
alkenyl"). In some embodiments, an alkenyl group has 2 to 10 carbon
atoms ("C.sub.2-10 alkenyl"). In some embodiments, an alkenyl group
has 2 to 9 carbon atoms ("C.sub.2-9 alkenyl"). In some embodiments,
an alkenyl group has 2 to 8 carbon atoms ("C.sub.2-8 alkenyl"). In
some embodiments, an alkenyl group has 2 to 7 carbon atoms
("C.sub.2-7 alkenyl"). In some embodiments, an alkenyl group has 2
to 6 carbon atoms ("C.sub.2-6 alkenyl"). In some embodiments, an
alkenyl group has 2 to 5 carbon atoms ("C.sub.2-5 alkenyl"). In
some embodiments, an alkenyl group has 2 to 4 carbon atoms
("C.sub.2-4 alkenyl"). In some embodiments, an alkenyl group has 2
to 3 carbon atoms ("C.sub.2-3 alkenyl"). In some embodiments, an
alkenyl group has 2 carbon atoms ("C.sub.2 alkenyl"). The one or
more carbon-carbon double bonds can be internal (such as in
2-butenyl) or terminal (such as in 1-butenyl). Examples of
C.sub.2-4 alkenyl groups include ethenyl (C.sub.2), 1-propenyl
(C.sub.3), 2-propenyl (C.sub.3), 1-butenyl (C.sub.4), 2-butenyl
(C.sub.4), butadienyl (C.sub.4), and the like. Examples of
C.sub.2-6 alkenyl groups include the aforementioned C.sub.2-4
alkenyl groups as well as pentenyl (C.sub.5), pentadienyl
(C.sub.5), hexenyl (C.sub.6), and the like. Additional examples of
alkenyl include heptenyl (C.sub.7), octenyl (C.sub.8), octatrienyl
(C.sub.8), and the like. Unless otherwise specified, each instance
of an alkenyl group is independently optionally substituted, i.e.,
unsubstituted (an "unsubstituted alkenyl") or substituted (a
"substituted alkenyl") with one or more substituents. In certain
embodiments, the alkenyl group is unsubstituted C.sub.2-10 alkenyl.
In certain embodiments, the alkenyl group is substituted C.sub.2-10
alkenyl.
[0028] "Alkynyl" refers to a radical of a straight-chain or
branched hydrocarbon group having from 2 to 20 carbon atoms, one or
more carbon-carbon triple bonds, and optionally one or more double
bonds ("C.sub.2-20 alkynyl"). In some embodiments, an alkynyl group
has 2 to 10 carbon atoms ("C.sub.2-10 alkynyl"). In some
embodiments, an alkynyl group has 2 to 9 carbon atoms ("C.sub.2-9
alkynyl"). In some embodiments, an alkynyl group has 2 to 8 carbon
atoms ("C.sub.2-8 alkynyl"). In some embodiments, an alkynyl group
has 2 to 7 carbon atoms ("C.sub.2-7 alkynyl"). In some embodiments,
an alkynyl group has 2 to 6 carbon atoms ("C.sub.2-6 alkynyl"). In
some embodiments, an alkynyl group has 2 to 5 carbon atoms
("C.sub.2-5 alkynyl"). In some embodiments, an alkynyl group has 2
to 4 carbon atoms ("C.sub.2-4 alkynyl"). In some embodiments, an
alkynyl group has 2 to 3 carbon atoms ("C.sub.2-3 alkynyl"). In
some embodiments, an alkynyl group has 2 carbon atoms ("C.sub.2
alkynyl"). The one or more carbon-carbon triple bonds can be
internal (such as in 2-butynyl) or terminal (such as in 1-butynyl).
Examples of C.sub.2-4 alkynyl groups include, without limitation,
ethynyl (C.sub.2), 1-propynyl (C.sub.3), 2-propynyl (C.sub.3),
1-butynyl (C.sub.4), 2-butynyl (C.sub.4), and the like. Examples of
C.sub.2-6 alkenyl groups include the aforementioned C.sub.2-4
alkynyl groups as well as pentynyl (C.sub.5), hexynyl (C.sub.6),
and the like. Additional examples of alkynyl include heptynyl
(C.sub.7), octynyl (C.sub.8), and the like. Unless otherwise
specified, each instance of an alkynyl group is independently
optionally substituted, i.e., unsubstituted (an "unsubstituted
alkynyl") or substituted (a "substituted alkynyl") with one or more
substituents. In certain embodiments, the alkynyl group is
unsubstituted C.sub.2-10 alkynyl. In certain embodiments, the
alkynyl group is substituted C.sub.2-10 alkynyl.
[0029] "Carbocyclyl" or "carbocyclic" refers to a radical of a
non-aromatic cyclic hydrocarbon group having from 3 to 10 ring
carbon atoms ("C.sub.3-10 carbocyclyl") and .sub.wwero heteroatoms
in the non-aromatic ring system. In some embodiments, a carbocyclyl
group has 3 to 8 ring carbon atoms ("C.sub.3-8 carbocyclyl"). In
some embodiments, a carbocyclyl group has 3 to 6 ring carbon atoms
("C.sub.3-6 carbocyclyl"). In some embodiments, a carbocyclyl group
has 3 to 6 ring carbon atoms ("C.sub.3-6 carbocyclyl"). In some
embodiments, a carbocyclyl group has 5 to 10 ring carbon atoms
("C.sub.5-10 carbocyclyl"). Exemplary C.sub.3-6 carbocyclyl groups
include, without limitation, cyclopropyl (C.sub.3), cyclopropenyl
(C.sub.3), cyclobutyl (C.sub.4), cyclobutenyl (C.sub.4),
cyclopentyl (C.sub.5), cyclopentenyl (C.sub.5), cyclohexyl
(C.sub.6), cyclohexenyl (C.sub.6), cyclohexadienyl (C.sub.6), and
the like. Exemplary C.sub.3-8 carbocyclyl groups include, without
limitation, the aforementioned C.sub.3-6 carbocyclyl groups as well
as cycloheptyl (C.sub.7), cycloheptenyl (C.sub.7), cycloheptadienyl
(C.sub.7), cycloheptatrienyl (C.sub.7), cyclooctyl (C.sub.8),
cyclooctenyl (C.sub.8), bicyclo[2.2.1]heptanyl (C.sub.7),
bicyclo[2.2.2]octanyl (C.sub.8), and the like. Exemplary C.sub.3-10
carbocyclyl groups include, without limitation, the aforementioned
C.sub.3-8 carbocyclyl groups as well as cyclononyl (C.sub.9),
cyclononenyl (C.sub.9), cyclodecyl (C.sub.10), cyclodecenyl
(C.sub.10), octahydro-1H-indenyl (C.sub.9), decahydronaphthalenyl
(C.sub.10), spiro[4.5]decanyl (C.sub.10), and the like. As the
foregoing examples illustrate, in certain embodiments, the
carbocyclyl group is either monocyclic ("monocyclic carbocyclyl")
or contain a fused, bridged or spiro ring system such as a bicyclic
system ("bicyclic carbocyclyl") and can be saturated or can be
partially unsaturated. "Carbocyclyl" also includes ring systems
wherein the carbocyclic ring, as defined above, is fused with one
or more aryl or heteroaryl groups wherein the point of attachment
is on the carbocyclic ring, and in such instances, the number of
carbons continue to designate the number of carbons in the
carbocyclic ring system. Unless otherwise specified, each instance
of a carbocyclyl group is independently optionally substituted,
i.e., unsubstituted (an "unsubstituted carbocyclyl") or substituted
(a "substituted carbocyclyl") with one or more substituents. In
certain embodiments, the carbocyclyl group is unsubstituted
C.sub.3-10 carbocyclyl. In certain embodiments, the carbocyclyl
group is a substituted C.sub.3-10 carbocyclyl.
[0030] In some embodiments, "carbocyclyl" is a monocyclic,
saturated carbocyclyl group having from 3 to 10 ring carbon atoms
("C.sub.3-10 cycloalkyl"). In some embodiments, a cycloalkyl group
has 3 to 8 ring carbon atoms ("C.sub.3-8 cycloalkyl"). In some
embodiments, a cycloalkyl group has 3 to 6 ring carbon atoms
("C.sub.3-6 cycloalkyl"). In some embodiments, a cycloalkyl group
has 5 to 6 ring carbon atoms ("C.sub.5-6 cycloalkyl"). In some
embodiments, a cycloalkyl group has 5 to 10 ring carbon atoms
("C.sub.5-10 cycloalkyl"). Examples of C.sub.5-6 cycloalkyl groups
include cyclopentyl (C.sub.5) and cyclohexyl (C.sub.5). Examples of
C.sub.3-6 cycloalkyl groups include the aforementioned C.sub.5-6
cycloalkyl groups as well as cyclopropyl (C.sub.3) and cyclobutyl
(C.sub.4). Examples of C.sub.3-8 cycloalkyl groups include the
aforementioned C.sub.3-6 cycloalkyl groups as well as cycloheptyl
(C.sub.7) and cyclooctyl (C.sub.8). Unless otherwise specified,
each instance of a cycloalkyl group is independently unsubstituted
(an "unsubstituted cycloalkyl") or substituted (a "substituted
cycloalkyl") with one or more substituents. In certain embodiments,
the cycloalkyl group is unsubstituted C.sub.3-10 cycloalkyl. In
certain embodiments, the cycloalkyl group is substituted C.sub.3-10
cycloalkyl.
[0031] "Heterocyclyl" or "heterocyclic" refers to a radical of a 3-
to 10-membered non-aromatic ring system having ring carbon atoms
and 1 to 4 ring heteroatoms, wherein each heteroatom is
independently selected from nitrogen, oxygen, sulfur, boron,
phosphorus, and silicon ("3-10 membered heterocyclyl"). In
heterocyclyl groups that contain one or more nitrogen atoms, the
point of attachment can be a carbon or nitrogen atom, as valency
permits. A heterocyclyl group can either be monocyclic ("monocyclic
heterocyclyl") or a fused, bridged or spiro ring system such as a
bicyclic system ("bicyclic heterocyclyl"), and can be saturated or
can be partially unsaturated. Heterocyclyl bicyclic ring systems
can include one or more heteroatoms in one or both rings.
"Heterocyclyl" also includes ring systems wherein the heterocyclic
ring, as defined above, is fused with one or more carbocyclyl
groups wherein the point of attachment is either on the carbocyclyl
or heterocyclic ring, or ring systems wherein the heterocyclic
ring, as defined above, is fused with one or more aryl or
heteroaryl groups, wherein the point of attachment is on the
heterocyclic ring, and in such instances, the number of ring
members continue to designate the number of ring members in the
heterocyclic ring system. Unless otherwise specified, each instance
of heterocyclyl is independently optionally substituted, i.e.,
unsubstituted (an "unsubstituted heterocyclyl") or substituted (a
"substituted heterocyclyl") with one or more substituents. In
certain embodiments, the heterocyclyl group is unsubstituted 3-10
membered heterocyclyl. In certain embodiments, the heterocyclyl
group is substituted 3-10 membered heterocyclyl.
[0032] In some embodiments, a heterocyclyl group is a 5-10 membered
non-aromatic ring system having ring carbon atoms and 1-4 ring
heteroatoms, wherein each heteroatom is independently selected from
nitrogen, oxygen, sulfur, boron, phosphorus, and silicon ("5-10
membered heterocyclyl"). In some embodiments, a heterocyclyl group
is a 5-8 membered non-aromatic ring system having ring carbon atoms
and 1-4 ring heteroatoms, wherein each heteroatom is independently
selected from nitrogen, oxygen, and sulfur ("5-8 membered
heterocyclyl"). In some embodiments, a heterocyclyl group is a 5-6
membered non-aromatic ring system having ring carbon atoms and 1-4
ring heteroatoms, wherein each heteroatom is independently selected
from nitrogen, oxygen, and sulfur ("5-6 membered heterocyclyl"). In
some embodiments, the 5-6 membered heterocyclyl has 1-3 ring
heteroatoms selected from nitrogen, oxygen, and sulfur. In some
embodiments, the 5-6 membered heterocyclyl has 1-2 ring heteroatoms
selected from nitrogen, oxygen, and sulfur. In some embodiments,
the 5-6 membered heterocyclyl has one ring heteroatom selected from
nitrogen, oxygen, and sulfur.
[0033] Exemplary 3-membered heterocyclyl groups containing one
heteroatom include, without limitation, azirdinyl, oxiranyl, and
thiiranyl. Exemplary 4-membered heterocyclyl groups containing one
heteroatom include, without limitation, azetidinyl, oxetanyl and
thietanyl. Exemplary 5-membered heterocyclyl groups containing one
heteroatom include, without limitation, tetrahydrofuranyl,
dihydrofuranyl, tetrahydrothiophenyl, dihydrothiophenyl,
pyrrolidinyl, dihydropyrrolyl, and pyrrolyl-2,5-dione. Exemplary
5-membered heterocyclyl groups containing two heteroatoms include,
without limitation, dioxolanyl, oxasulfuranyl, disulfuranyl, and
oxazolidin-2-one. Exemplary 5-membered heterocyclyl groups
containing three heteroatoms include, without limitation,
triazolinyl, oxadiazolinyl, and thiadiazolinyl. Exemplary
6-membered heterocyclyl groups containing one heteroatom include,
without limitation, piperidinyl, tetrahydropyranyl,
dihydropyridinyl, and thianyl. Exemplary 6-membered heterocyclyl
groups containing two heteroatoms include, without limitation,
piperazinyl, morpholinyl, dithianyl, and dioxanyl. Exemplary
6-membered heterocyclyl groups containing two heteroatoms include,
without limitation, triazinanyl. Exemplary 7-membered heterocyclyl
groups containing one heteroatom include, without limitation,
azepanyl, oxepanyl and thiepanyl. Exemplary 8-membered heterocyclyl
groups containing one heteroatom include, without limitation,
azocanyl, oxecanyl and thiocanyl. Exemplary 5-membered heterocyclyl
groups fused to a C.sub.6 aryl ring (also referred to herein as a
5,6-bicyclic heterocyclic ring) include, without limitation,
indolinyl, isoindolinyl, dihydrobenzofuranyl, dihydrobenzothienyl,
benzoxazolinonyl, and the like. Exemplary 6-membered heterocyclyl
groups fused to an aryl ring (also referred to herein as a
6,6-bicyclic heterocyclic ring) include, without limitation,
tetrahydroquinolinyl, tetrahydroisoquinolinyl, and the like.
[0034] "Aryl" refers to a radical of a monocyclic or polycyclic
(e.g., bicyclic or tricyclic) 4n+2 aromatic ring system (e.g.,
having 6, 10, or 14 pi electrons shared in a cyclic array) having
6-14 ring carbon atoms and zero heteroatoms provided in the
aromatic ring system ("C.sub.6-14 aryl"). In some embodiments, an
aryl group has six ring carbon atoms ("C.sub.6 aryl"; e.g.,
phenyl). In some embodiments, an aryl group has ten ring carbon
atoms ("C.sub.10 aryl"; e.g., naphthyl such as 1-naphthyl and
2-naphthyl). In some embodiments, an aryl group has fourteen ring
carbon atoms ("C.sub.1-4 aryl"; e.g., anthracyl). "Aryl" also
includes ring systems wherein the aryl ring, as defined above, is
fused with one or more carbocyclyl or heterocyclyl groups wherein
the radical or point of attachment is on the aryl ring, and in such
instances, the number of carbon atoms continue to designate the
number of carbon atoms in the aryl ring system. Unless otherwise
specified, each instance of an aryl group is independently
optionally substituted, i.e., unsubstituted (an "unsubstituted
aryl") or substituted (a "substituted aryl") with one or more
substituents. In certain embodiments, the aryl group is
unsubstituted C.sub.614 aryl. In certain embodiments, the aryl
group is substituted C.sub.6-14 aryl.
[0035] "Aralkyl" is a subset of alkyl and aryl and refers to an
optionally substituted alkyl group substituted by an optionally
substituted aryl group. In certain embodiments, the aralkyl is
optionally substituted benzyl. In certain embodiments, the aralkyl
is benzyl. In certain embodiments, the aralkyl is optionally
substituted phenethyl. In certain embodiments, the aralkyl is
phenethyl.
[0036] "Heteroaryl" refers to a radical of a 5-10 membered
monocyclic or bicyclic 4n+2 aromatic ring system (e.g., having 6 or
10 p electrons shared in a cyclic array) having ring carbon atoms
and 1-4 ring heteroatoms provided in the aromatic ring system,
wherein each heteroatom is independently selected from nitrogen,
oxygen and sulfur ("5-10 membered heteroaryl"). In heteroaryl
groups that contain one or more nitrogen atoms, the point of
attachment can be a carbon or nitrogen atom, as valency permits.
Heteroaryl bicyclic ring systems can include one or more
heteroatoms in one or both rings. "Heteroaryl" includes ring
systems wherein the heteroaryl ring, as defined above, is fused
with one or more carbocyclyl or heterocyclyl groups wherein the
point of attachment is on the heteroaryl ring, and in such
instances, the number of ring members continue to designate the
number of ring members in the heteroaryl ring system. "Heteroaryl"
also includes ring systems wherein the heteroaryl ring, as defined
above, is fused with one or more aryl groups wherein the point of
attachment is either on the aryl or heteroaryl ring, and in such
instances, the number of ring members designates the number of ring
members in the fused (aryl/heteroaryl) ring system. Bicyclic
heteroaryl groups wherein one ring does not contain a heteroatom
(e.g., indolyl, quinolinyl, carbazolyl, and the like) the point of
attachment can be on either ring, i.e., either the ring bearing a
heteroatom (e.g., 2-indolyl) or the ring that does not contain a
heteroatom (e.g., 5-indolyl).
[0037] In some embodiments, a heteroaryl group is a 5-10 membered
aromatic ring system having ring carbon atoms and 1-4 ring
heteroatoms provided in the aromatic ring system, wherein each
heteroatom is independently selected from nitrogen, oxygen, and
sulfur ("5-10 membered heteroaryl"). In some embodiments, a
heteroaryl group is a 5-8 membered aromatic ring system having ring
carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring
system, wherein each heteroatom is independently selected from
nitrogen, oxygen, and sulfur ("5-8 membered heteroaryl"). In some
embodiments, a heteroaryl group is a 5-6 membered aromatic ring
system having ring carbon atoms and 1-4 ring heteroatoms provided
in the aromatic ring system, wherein each heteroatom is
independently selected from nitrogen, oxygen, and sulfur ("5-6
membered heteroaryl"). In some embodiments, the 5-6 membered
heteroaryl has 1-3 ring heteroatoms selected from nitrogen, oxygen,
and sulfur. In some embodiments, the 5-6 membered heteroaryl has
1-2 ring heteroatoms selected from nitrogen, oxygen, and sulfur. In
some embodiments, the 5-6 membered heteroaryl has 1 ring heteroatom
selected from nitrogen, oxygen, and sulfur. Unless otherwise
specified, each instance of a heteroaryl group is independently
optionally substituted, i.e., unsubstituted (an "unsubstituted
heteroaryl") or substituted (a "substituted heteroaryl") with one
or more substituents. In certain embodiments, the heteroaryl group
is unsubstituted 5-14 membered heteroaryl. In certain embodiments,
the heteroaryl group is substituted 5-14 membered heteroaryl.
[0038] Exemplary 5-membered heteroaryl groups containing one
heteroatom include, without limitation, pyrrolyl, furanyl and
thiophenyl. Exemplary 5-membered heteroaryl groups containing two
heteroatoms include, without limitation, imidazolyl, pyrazolyl,
oxazolyl, isoxazolyl, thiazolyl, and isothiazolyl. Exemplary
5-membered heteroaryl groups containing three heteroatoms include,
without limitation, triazolyl, oxadiazolyl, and thiadiazolyl.
Exemplary 5-membered heteroaryl groups containing four heteroatoms
include, without limitation, tetrazolyl. Exemplary 6-membered
heteroaryl groups containing one heteroatom include, without
limitation, pyridinyl. Exemplary 6-membered heteroaryl groups
containing two heteroatoms include, without limitation,
pyridazinyl, pyrimidinyl, and pyrazinyl. Exemplary 6-membered
heteroaryl groups containing three or four heteroatoms include,
without limitation, triazinyl and tetrazinyl, respectively.
Exemplary 7-membered heteroaryl groups containing one heteroatom
include, without limitation, azepinyl, oxepinyl, and thiepinyl.
Exemplary 5,6-bicyclic heteroaryl groups include, without
limitation, indolyl, isoindolyl, indazolyl, benzotriazolyl,
benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl,
benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl,
benzthiazolyl, benzisothiazolyl, benzthiadiazolyl, indolizinyl, and
purinyl. Exemplary 6,6-bicyclic heteroaryl groups include, without
limitation, naphthyridinyl, pteridinyl, quinolinyl, isoquinolinyl,
cinnolinyl, quinoxalinyl, phthalazinyl, and quinazolinyl.
[0039] "Heteroaralkyl" is a subset of alkyl and heteroaryl and
refers to an optionally substituted alkyl group substituted by an
optionally substituted heteroaryl group.
[0040] "Partially unsaturated" refers to a group that includes at
least one double or triple bond. A "partially unsaturated" ring
system is further intended to encompass rings having multiple sites
of unsaturation, but is not intended to include aromatic groups
(e.g., aryl or heteroaryl groups) as herein defined. Likewise,
"saturated" refers to a group that does not contain a double or
triple bond, i.e., contains all single bonds.
[0041] Alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl,
and heteroaryl groups, which are divalent bridging groups are
further referred to using the suffix -ene, e.g., alkylene,
alkenylene, alkynylene, carbocyclylene, heterocyclylene, arylene,
and heteroarylene.
[0042] The term "optionally substituted" refers to substituted or
unsubstituted.
[0043] Alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl, aryl,
and heteroaryl groups are optionally substituted (e.g.,
"substituted" or "unsubstituted" alkyl, "substituted" or
"unsubstituted" alkenyl, "substituted" or "unsubstituted" alkynyl,
"substituted" or "unsubstituted" carbocyclyl, "substituted" or
"unsubstituted" heterocyclyl, "substituted" or "unsubstituted" aryl
or "substituted" or "unsubstituted" heteroaryl group). In general,
the term "substituted", whether preceded by the term "optionally"
or not, means that at least one hydrogen present on a group (e.g.,
a carbon or nitrogen atom) is replaced with a permissible
substituent, e.g., a substituent which upon substitution results in
a stable compound, e.g., a compound which does not spontaneously
undergo transformation such as by rearrangement, cyclization,
elimination, or other reaction. Unless otherwise indicated, a
"substituted" group has a substituent at one or more substitutable
positions of the group, and when more than one position in any
given structure is substituted, the substituent is either the same
or different at each position. The term "substituted" is
contemplated to include substitution with all permissible
substituents of organic compounds, any of the substituents
described herein that results in the formation of a stable
compound. The present invention contemplates any and all such
combinations in order to arrive at a stable compound. For purposes
of this invention, heteroatoms such as nitrogen may have hydrogen
substituents and/or any suitable substituent as described herein
which satisfy the valencies of the heteroatoms and results in the
formation of a stable moiety.
[0044] Exemplary carbon atom substituents include, but are not
limited to, halogen, --CN, --NO.sub.2, --N.sub.3, --SO.sub.2H,
--SO.sub.3H, --OH, --OR.sup.aa, --ON(R.sup.bb).sub.2,
--N(R.sup.bb).sub.2, --N(R.sup.bb).sub.3.sup.+X.sup.-,
--N(OR.sup.cc)R.sup.bb, --SH, --SR.sup.aa, --SSR.sup.cc,
--C(.dbd.O)R.sup.aa, --CO.sub.2H, --CHO, --C(OR.sup.cc).sub.2,
--CO.sub.2R.sup.aa, --OC(.dbd.O)R.sup.aa, --OCO.sub.2R.sup.aa,
--C(.dbd.O)N(R.sup.bb).sub.2, --OC(.dbd.O)N(R.sup.bb).sub.2,
--NR.sup.bbC(.dbd.O)R.sup.aa, --NR.sup.bbCO.sub.2R.sup.aa,
--NR.sup.bbC(.dbd.O)N(R.sup.bb).sub.2, --C(.dbd.NR.sup.bb)R.sup.aa,
--C(.dbd.NR.sup.bb)OR.sup.aa, --OC(.dbd.NR.sup.bb)R.sup.aa,
--OC(.dbd.NR.sup.bb)OR.sup.aa,
--C(.dbd.NR.sup.bb)N(R.sup.bb).sub.2,
--OC(.dbd.NR.sup.bb)N(R.sup.bb).sub.2,
--NR.sup.bbC(.dbd.NR.sup.bb)N(R.sup.bb).sub.2,
--C(.dbd.O)NR.sup.bbSO.sub.2R.sup.aa, --NR.sup.bbSO.sub.2R.sup.aa,
--SO.sub.2N(R.sup.bb).sub.2, --SO.sub.2R.sup.aa,
--SO.sub.2OR.sup.aa, --OS.sub.2R.sup.aa, --S(.dbd.O)R.sup.aa,
--OS(.dbd.O)R.sup.aa, --Si(R.sup.aa).sub.3, --OSi(R.sup.aa).sub.3,
--C(.dbd.S)N(R.sup.bb).sub.2, --C(.dbd.O)SR.sup.aa,
--C(.dbd.S)SR.sup.aa, --SC(.dbd.S)SR.sup.aa, --SC(.dbd.O)SR.sup.aa,
--OC(.dbd.O)SR.sup.aa, --SC(.dbd.O)OR.sup.aa, --SC(.dbd.O)R.sup.aa,
--P(.dbd.O)(R.sup.aa).sub.2, --P(.dbd.O)(OR.sup.cc).sub.2,
--OP(.dbd.O)(R.sup.aa).sub.2, --OP(.dbd.O)(OR.sup.cc).sub.2,
--P(.dbd.O)(N(R.sup.bb).sub.2).sub.2,
--OP(.dbd.O)(N(R.sup.bb).sub.2).sub.2,
--NR.sup.bbP(.dbd.O)(R.sup.aa).sub.2,
--NR.sup.bbP(.dbd.O)(OR.sup.cc).sub.2,
--NR.sup.bbP(.dbd.O)(N(R.sup.bb).sub.2).sub.2, --P(R.sup.cc).sub.2,
--P(OR.sup.cc).sub.2, --P(R.sup.cc).sub.3.sup.+X.sup.-,
--P(OR.sup.cc).sub.3.sup.+X.sup.-, --P(R.sup.cc).sub.4,
--P(OR.sup.cc).sub.4, --OP(R.sup.cc).sub.2,
--OP(R.sup.cc).sub.3.sup.+X.sup.-, --OP(OR.sup.cc).sub.2,
--OP(OR.sup.cc).sub.3.sup.+X.sup.-, --OP(R.sup.cc).sub.4,
--OP(OR.sup.cc).sub.4, --B(R.sup.aa).sub.2, --B(OR.sup.cc).sub.2,
--BR.sup.aa(OR.sup.cc), C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl,
C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, heteroC.sub.1-10 alkyl,
heteroC.sub.2-10 alkenyl, heteroC.sub.2-10 alkynyl, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl, wherein each alkyl, alkenyl, alkynyl,
heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl,
heterocyclyl, aryl, and heteroaryl is independently substituted
with 0, 1, 2, 3, 4, or 5 R.sup.dd groups; wherein X.sup.- is a
counterion;
[0045] or two geminal hydrogens on a carbon atom are replaced with
the group .dbd.O, .dbd.S, .dbd.NN(R.sup.bb).sub.2,
.dbd.NNR.sup.bbC(.dbd.O)R.sup.aa,
.dbd.NNR.sup.bbC(.dbd.O)OR.sup.aa,
.dbd.NNR.sup.bbS(.dbd.O).sub.2R.sup.aa, .dbd.NR.sub.bb, or
.dbd.NOR.sup.cc;
[0046] each instance of R.sup.aa is, independently, selected from
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, heteroC.sub.1-10 alkyl,
heteroC.sub.2-10alkenyl, heteroC.sub.2-10alkynyl, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl, or two R.sup.aa groups are joined to form a
3-14 membered heterocyclyl or 5-14 membered heteroaryl ring,
wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl,
heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is
independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd
groups;
[0047] each instance of R.sup.bb is, independently, selected from
hydrogen, --OH, --OR.sup.aa, --N(R.sup.cc).sub.2, --CN,
--C(.dbd.O)R.sup.aa, --C(.dbd.O)N(R.sup.cc).sub.2,
--CO.sub.2R.sup.aa, --SO.sub.2R.sup.aa,
--C(.dbd.NR.sup.cc)OR.sup.aa, --C(.dbd.NR.sup.cc)N(R.sup.cc).sub.2,
--SO.sub.2N(R.sup.cc).sub.2, --SO.sub.2R.sup.cc,
--SO.sub.2OR.sup.cc, --SOR.sup.aa, --C(.dbd.S)N(R.sup.cc).sub.2,
--C(.dbd.O)SR.sup.cc, --C(.dbd.S)SR.sup.cc,
--P(.dbd.O)(R.sup.aa).sub.2, --P(.dbd.O)(OR.sup.cc).sub.2,
--P(.dbd.O)(N(R.sup.cc).sub.2).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl,
heteroC.sub.1-10alkyl, heteroC.sub.2-10alkenyl,
heteroC.sub.2-10alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.bb groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring, wherein each alkyl, alkenyl,
alkynyl, heteroalkyl, heteroalkenyl, heteroalkynyl, carbocyclyl,
heterocyclyl, aryl, and heteroaryl is independently substituted
with 0, 1, 2, 3, 4, or 5 R.sup.dd groups; wherein X.sup.- is a
counterion;
[0048] each instance of R.sup.cc is, independently, selected from
hydrogen, C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10
alkenyl, C.sub.2-10 alkynyl, heteroC.sub.1-10 alkyl,
heteroC.sub.2-10 alkenyl, heteroC.sub.2-10 alkynyl, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl, or two R.sup.cc groups are joined to form a
3-14 membered heterocyclyl or 5-14 membered heteroaryl ring,
wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl,
heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is
independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd
groups;
[0049] each instance of R.sup.dd is, independently, selected from
halogen, --CN, --NO.sub.2, --N.sub.3, --SO.sub.2H, --SO.sub.3H,
--OH, --OR.sup.ee, --ON(R.sup.ff).sub.2, --N(R.sup.ff).sub.2,
--N(R.sup.ff).sub.3.sup.+X.sup.-, --N(OR.sup.ee)R.sup.ff, --SH,
--SR.sup.ee, --SSR.sup.ee, --C(.dbd.O)R.sup.ee, --CO.sub.2H,
--CO.sub.2R.sup.ee, --OC(.dbd.O)R.sup.ee, --OCO.sub.2R.sup.ee,
--C(.dbd.O)N(R.sup.ff).sub.2, --OC(.dbd.O)N(R.sup.ff).sub.2,
--NR.sup.ffC(.dbd.O)R.sup.ee, --NR.sup.ffCO.sub.2R.sup.ee,
--NR.sup.ffC(.dbd.O)N(R.sup.ff).sub.2,
--C(.dbd.NR.sup.ff)OR.sup.ee, --OC(.dbd.NR.sup.ff)R.sup.ee,
--OC(.dbd.NR.sup.ff)OR.sup.ee,
--C(.dbd.NR.sup.ff)N(R.sup.ff).sub.2,
--OC(.dbd.NR.sup.ff)N(R.sup.ff).sub.2,
--NR.sup.ffC(.dbd.NR.sup.ff)N(R.sup.ff).sub.2,
--NR.sup.ffSO.sub.2R.sup.ee, --SO.sub.2N(R.sup.ff).sub.2,
--SO.sub.2R.sup.ee, --SO.sub.2OR.sup.ee, --OSO.sub.2R.sup.ee,
--S(.dbd.O)R.sup.ee, --Si(R.sup.ee).sub.3, --OSi(R.sup.ee).sub.3,
--C(.dbd.S)N(R.sup.ff).sub.2, --C(.dbd.O)SR.sup.ee,
--C(.dbd.S)SR.sup.ee, --SC(.dbd.S)SR.sup.ee,
--P(.dbd.O)(OR.sup.ee).sub.2, --P(.dbd.O)(R.sup.ee).sub.2,
--OP(.dbd.O)(R.sup.ee).sub.2, --OP(.dbd.O)(OR.sup.ee).sub.2,
C.sub.1-6 alkyl, C.sub.1-6 perhaloalkyl, C.sub.2-6 alkenyl,
C.sub.2-6 alkynyl, heteroC.sub.1-6alkyl, heteroC.sub.2-6alkenyl,
heteroC.sub.2-6alkynyl, C.sub.3-10 carbocyclyl, 3-10 membered
heterocyclyl, C.sub.6-10 aryl, 5-10 membered heteroaryl, wherein
each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl,
heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is
independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.gg groups,
or two geminal R.sup.dd substituents can be joined to form .dbd.O
or .dbd.S; wherein X.sup.- is a counterion;
[0050] each instance of R.sup.ee is, independently, selected from
C.sub.1-6 alkyl, C.sub.1-6 perhaloalkyl, C.sub.2-6 alkenyl,
C.sub.2-6 alkynyl, heteroC.sub.1-6 alkyl, heteroC.sub.2-6alkenyl,
heteroC.sub.2-6 alkynyl, C.sub.3-10 carbocyclyl, C.sub.6-10 aryl,
3-10 membered heterocyclyl, and 3-10 membered heteroaryl, wherein
each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl,
heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is
independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.gg
groups;
[0051] each instance of R.sup.ff is, independently, selected from
hydrogen, C.sub.1-6 alkyl, C.sub.1-6 perhaloalkyl, C.sub.2-6
alkenyl, C.sub.2-6 alkynyl, heteroC.sub.1-6alkyl,
heteroC.sub.2-6alkenyl, heteroC.sub.2-6alkynyl, C.sub.3-10
carbocyclyl, 3-10 membered heterocyclyl, C.sub.6-10 aryl and 5-10
membered heteroaryl, or two R.sup.ff groups are joined to form a
3-10 membered heterocyclyl or 5-10 membered heteroaryl ring,
wherein each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl,
heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is
independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.gg groups;
and
[0052] each instance of R.sup.gg is, independently, halogen, --CN,
--NO.sub.2, --N.sub.3, --SO.sub.2H, --SO.sub.3H, --OH, --OC.sub.1-6
alkyl, --ON(C.sub.1-6 alkyl).sub.2, --N(C.sub.1-6 alkyl).sub.2,
--N(C.sub.1-6 alkyl).sub.3.sup.+X.sup.-, --NH(C.sub.1-6
alkyl).sub.2.sup.+X.sup.-, --NH.sub.2(C.sub.1-6
alkyl).sup.+X.sup.-, --NH.sub.3.sup.+X.sup.-, --N(OC.sub.1-6
alkyl)(C.sub.1-6 alkyl), --N(OH)(C.sub.1-6 alkyl), --NH(OH), --SH,
--SC.sub.1-6 alkyl, --SS(C.sub.1-6 alkyl), --C(.dbd.O)(C.sub.1-6
alkyl), --CO.sub.2H, --CO.sub.2(C.sub.1-6 alkyl),
--OC(.dbd.O)(C.sub.1-6 alkyl), --OCO.sub.2(C.sub.1-6 alkyl),
--C(.dbd.O)NH.sub.2, --C(.dbd.O)N(C.sub.1-6 alkyl).sub.2,
--OC(.dbd.O)NH(C.sub.1-6 alkyl), --NHC(.dbd.O)(C.sub.1-6 alkyl),
--N(C.sub.1-6 alkyl)C(.dbd.O)(C.sub.1-6 alkyl),
--NHCO.sub.2(C.sub.1-6 alkyl), --NHC(.dbd.O)N(C.sub.1-6
alkyl).sub.2, --NHC(.dbd.O)NH(C.sub.1-6 alkyl),
--NHC(.dbd.O)NH.sub.2, --C(.dbd.NH)O(C.sub.1-6 alkyl),
--OC(.dbd.NH)(C.sub.1-6 alkyl), --OC(.dbd.NH)OC.sub.1-6 alkyl,
--C(.dbd.NH)N(C.sub.1-6 alkyl).sub.2, --C(.dbd.NH)NH(C.sub.1-6
alkyl), --C(.dbd.NH)NH.sub.2, --OC(.dbd.NH)N(C.sub.1-6
alkyl).sub.2, --OC(NH)NH(C.sub.1-6 alkyl), --OC(NH)NH.sub.2,
--NHC(NH)N(C.sub.1-6 alkyl).sub.2, --NHC(.dbd.NH)NH.sub.2,
--NHSO.sub.2(C.sub.1-6 alkyl), --SO.sub.2N(C.sub.1-6 alkyl).sub.2,
--SO.sub.2NH(C.sub.1-6 alkyl), --SO.sub.2NH.sub.2,
--SO.sub.2C.sub.1-6 alkyl, --SO.sub.2OC.sub.1-6 alkyl,
--OSO.sub.2C.sub.1-6 alkyl, --SOC.sub.1-6 alkyl, --Si(C.sub.1-6
alkyl).sub.3, --OSi(C.sub.1-6 alkyl).sub.3, --C(.dbd.S)N(C.sub.1-6
alkyl).sub.2, C(.dbd.S)NH(C.sub.1-6 alkyl), C(.dbd.S)NH.sub.2,
--C(.dbd.O)S(C.sub.1-6 alkyl), --C(.dbd.S)SC.sub.1-6 alkyl,
--SC(.dbd.S)SC.sub.1-6 alkyl, --P(.dbd.O)(OC.sub.1-6 alkyl).sub.2,
--P(.dbd.O)(C.sub.1-6 alkyl).sub.2, --OP(.dbd.O)(C.sub.1-6
alkyl).sub.2, --OP(.dbd.O)(OC.sub.1-6 alkyl).sub.2, C.sub.1-6
alkyl, C.sub.1-6 perhaloalkyl, C.sub.2-6 alkenyl, C.sub.2-6
alkynyl, heteroC.sub.1-6alkyl, heteroC.sub.2-6alkenyl,
heteroC.sub.2-6alkynyl, C.sub.3-10 carbocyclyl, C.sub.6-10 aryl,
3-10 membered heterocyclyl, 5-10 membered heteroaryl; or two
geminal R.sup.gg substituents can be joined to form .dbd.O or
.dbd.S; wherein X.sup.- is a counterion.
[0053] A "counterion" or "anionic counterion" is a negatively
charged group associated with a positively charged group in order
to maintain electronic neutrality. An anionic counterion may be
monovalent (i.e., including one formal negative charge). An anionic
counterion may also be multivalent (i.e., including more than one
formal negative charge), such as divalent or trivalent. Exemplary
counterions include halide ions (e.g., F.sup.-, Cl.sup.-, Br.sup.-,
I.sup.-), NO.sub.3.sup.-, ClO.sub.4.sup.-, OH.sup.-,
H.sub.2PO.sub.4.sup.-, HCO.sub.3.sup.-, HSO.sub.4.sup.-, sulfonate
ions (e.g., methansulfonate, trifluoromethanesulfonate,
p-toluenesulfonate, benzenesulfonate, 10-camphor sulfonate,
naphthalene-2-sulfonate, naphthalene-1-sulfonic acid-5-sulfonate,
ethan-1-sulfonic acid-2-sulfonate, and the like), carboxylate ions
(e.g., acetate, propanoate, benzoate, glycerate, lactate, tartrate,
glycolate, gluconate, and the like), BF.sub.4.sup.-,
PF.sub.4.sup.-, PF.sub.6.sup.-, AsF.sub.6.sup.-, SbF.sub.6.sup.-,
B[3,5-(CF.sub.3).sub.2C.sub.6H.sub.3].sub.4].sup.-,
B(C.sub.6F.sub.5).sub.4.sup.-, BPh.sub.4.sup.-,
Al(OC(CF.sub.3).sub.3).sub.4.sup.-, and carborane anions (e.g.,
CB.sub.11H.sub.12.sup.- or (HCB.sub.11Me.sub.5Br.sub.6).sup.-).
Exemplary counterions which may be multivalent include
CO.sub.3.sup.2-, HPO.sub.4.sup.2-, PO.sub.4.sup.3-,
B.sub.4O.sub.7.sup.2-, SO.sub.4.sup.2-, S.sub.2O.sub.3.sup.2-,
carboxylate anions (e.g., tartrate, citrate, fumarate, maleate,
malate, malonate, gluconate, succinate, glutarate, adipate,
pimelate, suberate, azelate, sebacate, salicylate, phthalates,
aspartate, glutamate, and the like), and carboranes.
[0054] "Halo" or "halogen" refers to fluorine (fluoro, --F),
chlorine (chloro, --Cl), bromine (bromo, --Br), or iodine (iodo,
--I).
[0055] The term "acyl" refers to a group having the general formula
--C(.dbd.O)R.sup.X1, --C(.dbd.O)OR.sup.X1,
--C(.dbd.O)--O--C(.dbd.O)R.sup.X1, --C(.dbd.O)SR.sup.X1,
--C(.dbd.O)N(R.sup.X1).sub.2, --C(.dbd.S)R.sup.X1,
--C(.dbd.S)N(R.sup.X1).sub.2, and --C(.dbd.S)S(R.sup.X1),
--C(.dbd.NR.sup.X1)R.sup.X1, --C(.dbd.NR.sup.X1)OR.sup.X1,
--C(.dbd.NR.sup.X1)SR.sup.X1, and
--C(.dbd.NR.sup.X1)N(R.sup.X1).sub.2, wherein R.sup.X1 is hydrogen;
halogen; substituted or unsubstituted hydroxyl; substituted or
unsubstituted thiol; substituted or unsubstituted amino;
substituted or unsubstituted acyl, cyclic or acyclic, substituted
or unsubstituted, branched or unbranched aliphatic; cyclic or
acyclic, substituted or unsubstituted, branched or unbranched
heteroaliphatic; cyclic or acyclic, substituted or unsubstituted,
branched or unbranched alkyl; cyclic or acyclic, substituted or
unsubstituted, branched or unbranched alkenyl; substituted or
unsubstituted alkynyl; substituted or unsubstituted aryl,
substituted or unsubstituted heteroaryl, aliphaticoxy,
heteroaliphaticoxy, alkyloxy, heteroalkyloxy, aryloxy,
heteroaryloxy, aliphaticthioxy, heteroaliphaticthioxy, alkylthioxy,
heteroalkylthioxy, arylthioxy, heteroarylthioxy, mono- or
di-aliphaticamino, mono- or di-heteroaliphaticamino, mono- or
di-alkylamino, mono- or di-heteroalkylamino, mono- or di-arylamino,
or mono- or di-heteroarylamino; or two Rx groups taken together
form a 5- to 6-membered heterocyclic ring. Exemplary acyl groups
include aldehydes (--CHO), carboxylic acids (--CO.sub.2H), ketones,
acyl halides, esters, amides, imines, carbonates, carbamates, and
ureas. Acyl substituents include, but are not limited to, any of
the substituents described herein, that result in the formation of
a stable moiety (e.g., aliphatic, alkyl, alkenyl, alkynyl,
heteroaliphatic, heterocyclic, aryl, heteroaryl, acyl, oxo, imino,
thiooxo, cyano, isocyano, amino, azido, nitro, hydroxyl, thiol,
halo, aliphaticamino, heteroaliphaticamino, alkylamino,
heteroalkylamino, arylamino, heteroarylamino, alkylaryl, arylalkyl,
aliphaticoxy, heteroaliphaticoxy, alkyloxy, heteroalkyloxy,
aryloxy, heteroaryloxy, aliphaticthioxy, heteroaliphaticthioxy,
alkylthioxy, heteroalkylthioxy, arylthioxy, heteroarylthioxy,
acyloxy, and the like, each of which may or may not be further
substituted).
[0056] "Alkoxy" or "alkoxyl" refers to a radical of the formula:
--O-alkyl.
[0057] Nitrogen atoms can be substituted or unsubstituted as
valency permits, and include primary, secondary, tertiary, and
quaternary nitrogen atoms. Exemplary nitrogen atom substituents
include, but are not limited to, hydrogen, --OH, --OR.sup.aa,
--N(R.sup.cc).sub.2, --CN, --C(.dbd.O)R.sup.aa,
--C(.dbd.O)N(R.sup.cc).sub.2, --CO.sub.2R.sup.aa,
--SO.sub.2R.sup.aa, --C(.dbd.NR.sup.bb)R.sup.aa--,
--C(.dbd.NR.sup.cc)OR.sup.aa, --C(.dbd.NR.sup.cc)N(R.sup.cc).sub.2,
--SO.sub.2N(R.sup.cc).sub.2, --SO.sub.2R.sup.cc,
--SO.sub.2OR.sup.cc, --SOR.sup.aa, --C(.dbd.S)N(R.sup.cc).sub.2,
--C(.dbd.O)SR.sup.cc, --C(.dbd.S)SR.sup.cc,
--P(.dbd.O)(OR.sup.cc).sub.2, --P(.dbd.O)(R.sup.aa).sub.2,
--P(.dbd.O)(N(R.sup.cc).sub.2).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl,
heteroC.sub.1-10alkyl, heteroC.sub.2-10alkenyl,
heteroC.sub.2-10alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.cc groups attached to an N atom are joined to form a 3-14
membered heterocyclyl or 5-14 membered heteroaryl ring, wherein
each alkyl, alkenyl, alkynyl, heteroalkyl, heteroalkenyl,
heteroalkynyl, carbocyclyl, heterocyclyl, aryl, and heteroaryl is
independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd groups,
and wherein R.sup.aa, R.sup.bb, R.sup.cc and R.sup.dd are as
defined above.
[0058] In certain embodiments, the substituent present on a
nitrogen atom is a nitrogen protecting group (also referred to as
an amino protecting group). Nitrogen protecting groups include, but
are not limited to, --OH, --OR.sup.aa, --N(R.sup.cc).sub.2,
--C(.dbd.O)R.sup.aa, --C(.dbd.O)N(R.sup.cc).sub.2,
--CO.sub.2R.sup.aa, --SO.sub.2R.sup.aa,
--C(.dbd.NR.sup.cc)R.sup.aa, --C(.dbd.NR.sup.cc)OR.sup.aa,
--C(.dbd.NR.sup.cc)N(R.sup.cc).sub.2, --SO.sub.2N(R.sup.cc).sub.2,
--SO.sub.2R.sup.cc, --SO.sub.2OR.sup.cc, --SOR.sup.aa,
--C(.dbd.S)N(R.sup.cc).sub.2, --C(.dbd.O)SR.sup.cc,
--C(.dbd.S)SR.sup.cc, C.sub.1-10 alkyl (e.g., aralkyl,
heteroaralkyl), C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl groups, wherein each alkyl, alkenyl, alkynyl,
carbocyclyl, heterocyclyl, aralkyl, aryl, and heteroaryl is
independently substituted with 0, 1, 2, 3, 4, or 5 R.sup.dd groups,
and wherein R.sup.aa, R.sup.bb, R.sup.cc and R.sup.dd are as
defined herein. Nitrogen protecting groups are well known in the
art and include those described in detail in Protecting Groups in
Organic Synthesis, T. W. Greene and P. G. M. Wuts, 3.sup.rd
edition, John Wiley & Sons, 1999, incorporated herein by
reference.
[0059] For example, nitrogen protecting groups such as amide groups
(e.g., --C(.dbd.O)R.sup.aa) include, but are not limited to,
formamide, acetamide, chloroacetamide, trichloroacetamide,
trifluoroacetamide, phenylacetamide, 3-phenylpropanamide,
picolinamide, 3-pyridylcarboxamide, N-benzoylphenylalanyl
derivative, benzamide, p-phenylbenzamide, o-nitophenylacetamide,
o-nitrophenoxyacetamide, acetoacetamide,
(N'-dithiobenzyloxyacylamino)acetamide,
3-(p-hydroxyphenyl)propanamide, 3-(o-nitrophenyl)propanamide,
2-methyl-2-(o-nitrophenoxy)propanamide,
2-methyl-2-(o-phenylazophenoxy)propanamide, 4-chlorobutanamide,
3-methyl-3-nitrobutanamide, o-nitrocinnamide, N-acetylmethionine
derivative, o-nitrobenzamide, and
o-(benzoyloxymethyl)benzamide.
[0060] Nitrogen protecting groups, such as carbamate groups (e.g.,
--C(.dbd.O)OR.sup.aa), include, but are not limited to, methyl
carbamate, ethyl carbamante, 9-fluorenylmethyl carbamate (Fmoc),
9-(2-sulfo)fluorenylmethyl carbamate,
9-(2,7-dibromo)fluoroenylmethyl carbamate,
2,7-di-t-butyl-[9-(10,10-dioxo-10,10,10,10-tetrahydrothioxanthyl)]methyl
carbamate (DBD-Tmoc), 4-methoxyphenacyl carbamate (Phenoc),
2,2,2-trichloroethyl carbamate (Troc), 2-trimethylsilylethyl
carbamate (Teoc), 2-phenylethyl carbamate (hZ),
1-(1-adamantyl)-1-methylethyl carbamate (Adpoc),
1,1-dimethyl-2-haloethyl carbamate, 1,1-dimethyl-2,2-dibromoethyl
carbamate (DB-t-BOC), 1,1-dimethyl-2,2,2-trichloroethyl carbamate
(TCBOC), 1-methyl-1-(4-biphenylyl)ethyl carbamate (Bpoc),
1-(3,5-di-t-butylphenyl)-1-methylethyl carbamate (t-Bumeoc), 2-(2'-
and 4'-pyridyl)ethyl carbamate (Pyoc),
2-(N,N-dicyclohexylcarboxamido)ethyl carbamate, t-butyl carbamate
(BOC), 1-adamantyl carbamate (Adoc), vinyl carbamate (Voc), allyl
carbamate (Alloc), 1-isopropylallyl carbamate (Ipaoc), cinnamyl
carbamate (Coc), 4-nitrocinnamyl carbamate (Noc), 8-quinolyl
carbamate, N-hydroxypiperidinyl carbamate, alkyldithio carbamate,
benzyl carbamate (Cbz), p-methoxybenzyl carbamate (Moz),
p-nitrobenzyl carbamate, p-bromobenzyl carbamate, p-chlorobenzyl
carbamate, 2,4-dichlorobenzyl carbamate, 4-methylsulfinylbenzyl
carbamate (Msz), 9-anthrylmethyl carbamate, diphenylmethyl
carbamate, 2-methylthioethyl carbamate, 2-methylsulfonylethyl
carbamate, 2-(p-toluenesulfonyl)ethyl carbamate,
[2-(1,3-dithianyl)]methyl carbamate (Dmoc), 4-methylthiophenyl
carbamate (Mtpc), 2,4-dimethylthiophenyl carbamate (Bmpc),
2-phosphonioethyl carbamate (Peoc), 2-triphenylphosphonioisopropyl
carbamate (Ppoc), 1,1-dimethyl-2-cyanoethyl carbamate,
m-chloro-p-acyloxybenzyl carbamate, p-(dihydroxyboryl)benzyl
carbamate, 5-benzisoxazolylmethyl carbamate,
2-(trifluoromethyl)-6-chromonylmethyl carbamate (Tcroc),
m-nitrophenyl carbamate, 3,5-dimethoxybenzyl carbamate,
o-nitrobenzyl carbamate, 3,4-dimethoxy-6-nitrobenzyl carbamate,
phenyl(o-nitrophenyl)methyl carbamate, t-amyl carbamate, S-benzyl
thiocarbamate, p-cyanobenzyl carbamate, cyclobutyl carbamate,
cyclohexyl carbamate, cyclopentyl carbamate, cyclopropylmethyl
carbamate, p-decyloxybenzyl carbamate, 2,2-dimethoxyacylvinyl
carbamate, o-(N,N-dimethylcarboxamido)benzyl carbamate,
1,1-dimethyl-3-(N,N-dimethylcarboxamido)propyl carbamate,
1,1-dimethylpropynyl carbamate, di(2-pyridyl)methyl carbamate,
2-furanylmethyl carbamate, 2-iodoethyl carbamate, isoborynl
carbamate, isobutyl carbamate, isonicotinyl carbamate,
p-(p'-methoxyphenylazo)benzyl carbamate, 1-methylcyclobutyl
carbamate, 1-methylcyclohexyl carbamate,
1-methyl-1-cyclopropylmethyl carbamate,
1-methyl-1-(3,5-dimethoxyphenyl)ethyl carbamate,
1-methyl-1-(p-phenylazophenyl)ethyl carbamate,
1-methyl-1-phenylethyl carbamate, 1-methyl-1-(4-pyridyl)ethyl
carbamate, phenyl carbamate, p-(phenylazo)benzyl carbamate,
2,4,6-tri-t-butylphenyl carbamate, 4-(trimethylammonium)benzyl
carbamate, and 2,4,6-trimethylbenzyl carbamate.
[0061] Nitrogen protecting groups, such as sulfonamide groups
(e.g., --S(.dbd.O).sub.2R.sup.aa), include, but are not limited to,
p-toluenesulfonamide (Ts), benzenesulfonamide,
2,3,6-trimethyl-4-methoxybenzenesulfonamide (Mtr),
2,4,6-trimethoxybenzenesulfonamide (Mtb),
2,6-dimethyl-4-methoxybenzenesulfonamide (Pme),
2,3,5,6-tetramethyl-4-methoxybenzenesulfonamide (Mte),
4-methoxybenzenesulfonamide (Mbs),
2,4,6-trimethylbenzenesulfonamide (Mts),
2,6-dimethoxy-4-methylbenzenesulfonamide (iMds),
2,2,5,7,8-pentamethylchroman-6-sulfonamide (Pmc),
methanesulfonamide (Ms), 3-trimethylsilylethanesulfonamide (SES),
9-anthracenesulfonamide,
4-(4',8'-dimethoxynaphthylmethyl)benzenesulfonamide (DNMBS),
benzylsulfonamide, trifluoromethylsulfonamide, and
phenacylsulfonamide.
[0062] Other nitrogen protecting groups include, but are not
limited to, phenothiazinyl-(10)-acyl derivative,
N'-p-toluenesulfonylaminoacyl derivative, N'-phenylaminothioacyl
derivative, N-benzoylphenylalanyl derivative, N-acetylmethionine
derivative, 4,5-diphenyl-3-oxazolin-2-one, N-phthalimide,
N-dithiasuccinimide (Dts), N-2,3-diphenylmaleimide,
N-2,5-dimethylpyrrole, N-1,1,4,4-tetramethyldisilylazacyclopentane
adduct (STABASE), 5-substituted
1,3-dimethyl-1,3,5-triazacyclohexan-2-one, 5-substituted
1,3-dibenzyl-1,3,5-triazacyclohexan-2-one, 1-substituted
3,5-dinitro-4-pyridone, N-methylamine, N-allylamine,
N-[2-(trimethylsilyl)ethoxy]methylamine (SEM),
N-3-acetoxypropylamine,
N-(1-isopropyl-4-nitro-2-oxo-3-pyroolin-3-yl)amine, quaternary
ammonium salts, N-benzylamine, N-di(4-methoxyphenyl)methylamine,
N-5-dibenzosuberylamine, N-triphenylmethylamine (Tr),
N-[(4-methoxyphenyl)diphenylmethyl]amine (MMTr),
N-9-phenylfluorenylamine (PhF),
N-2,7-dichloro-9-fluorenylmethyleneamine, N-ferrocenylmethylamino
(Fcm), N-2-picolylamino N'-oxide, N-1,1-dimethylthiomethyleneamine,
N-benzylideneamine, N-p-methoxybenzylideneamine,
N-diphenylmethyleneamine, N-[(2-pyridyl)mesityl]methyleneamine,
N--(N',N'-dimethylaminomethylene)amine, N,N'-isopropylidenediamine,
N-p-nitrobenzylideneamine, N-salicylideneamine,
N-5-chlorosalicylideneamine,
N-(5-chloro-2-hydroxyphenyl)phenylmethyleneamine,
N-cyclohexylideneamine, N-(5,5-dimethyl-3-oxo-1-cyclohexenyl)amine,
N-borane derivative, N-diphenylborinic acid derivative,
N-[phenyl(pentaacylchromium- or tungsten)acyl]amine, N-copper
chelate, N-zinc chelate, N-nitroamine, N-nitrosoamine, amine
N-oxide, diphenylphosphinamide (Dpp), dimethylthiophosphinamide
(Mpt), diphenylthiophosphinamide (Ppt), dialkyl phosphoramidates,
dibenzyl phosphoramidate, diphenyl phosphoramidate,
benzenesulfenamide, o-nitrobenzenesulfenamide (Nps),
2,4-dinitrobenzenesulfenamide, pentachlorobenzenesulfenamide,
2-nitro-4-methoxybenzenesulfenamide, triphenylmethylsulfenamide,
and 3-nitropyridinesulfenamide (Npys).
[0063] In certain embodiments, the substituent present on an oxygen
atom is an oxygen protecting group (also referred to herein as an
"hydroxyl protecting group"). Oxygen protecting groups include, but
are not limited to, --R.sup.aa, --N(R.sup.bb).sub.2,
--C(.dbd.O)SR.sup.aa, --C(.dbd.O)R.sup.aa, --CO.sub.2R.sup.aa,
--C(.dbd.O)N(R.sup.bb).sub.2, --C(.dbd.NR.sup.bb)R.sup.aa,
--C(.dbd.NR.sup.bb)OR.sup.aa, --C(.dbd.NR.sup.bb)N(R.sup.bb).sub.2,
--S(.dbd.O)R.sup.aa, --SO.sub.2R.sup.aa, --Si(R.sup.aa).sub.3,
--P(R.sup.cc).sub.2, --P(R.sup.cc).sub.3.sup.+X.sup.-,
--P(OR.sup.cc).sub.2, --P(OR.sup.cc).sub.3.sup.+X.sup.-,
--P(.dbd.O)(R.sup.aa).sub.2, --P(.dbd.O)(OR.sup.cc).sub.2, and
--P(.dbd.O)(N(R.sup.bb).sub.2).sub.2, wherein X.sup.-, R.sup.aa,
R.sup.bb, and R.sup.cc are as defined herein. Oxygen protecting
groups are well known in the art and include those described in
detail in Protecting Groups in Organic Synthesis, T. W. Greene and
P. G. M. Wuts, 3.sup.rd edition, John Wiley & Sons, 1999,
incorporated herein by reference.
[0064] Exemplary oxygen protecting groups include, but are not
limited to, methyl, methoxylmethyl (MOM), methylthiomethyl (MTM),
t-butylthiomethyl, (phenyldimethylsilyl)methoxymethyl (SMOM),
benzyloxymethyl (BOM), p-methoxybenzyloxymethyl (PMBM),
(4-methoxyphenoxy)methyl (p-AOM), guaiacolmethyl (GUM),
t-butoxymethyl, 4-pentenyloxymethyl (POM), siloxymethyl,
2-methoxyethoxymethyl (MEM), 2,2,2-trichloroethoxymethyl,
bis(2-chloroethoxy)methyl, 2-(trimethylsilyl)ethoxymethyl (SEMOR),
tetrahydropyranyl (THP), 3-bromotetrahydropyranyl,
tetrahydrothiopyranyl, 1-methoxycyclohexyl,
4-methoxytetrahydropyranyl (MTHP), 4-methoxytetrahydrothiopyranyl,
4-methoxytetrahydrothiopyranyl S,S-dioxide,
1-[(2-chloro-4-methyl)phenyl]-4-methoxypiperidin-4-yl (CTMP),
1,4-dioxan-2-yl, tetrahydrofuranyl, tetrahydrothiofuranyl,
2,3,3a,4,5,6,7,7a-octahydro-7,8,8-trimethyl-4,7-methanobenzofuran-2-yl,
1-ethoxyethyl, 1-(2-chloroethoxy)ethyl, 1-methyl-1-methoxyethyl,
1-methyl-1-benzyloxyethyl, 1-methyl-1-benzyloxy-2-fluoroethyl,
2,2,2-trichloroethyl, 2-trimethylsilylethyl,
2-(phenylselenyl)ethyl, t-butyl, allyl, p-chlorophenyl,
p-methoxyphenyl, 2,4-dinitrophenyl, benzyl (Bn), p-methoxybenzyl,
3,4-dimethoxybenzyl, o-nitrobenzyl, p-nitrobenzyl, p-halobenzyl,
2,6-dichlorobenzyl, p-cyanobenzyl, p-phenylbenzyl, 2-picolyl,
4-picolyl, 3-methyl-2-picolyl N-oxido, diphenylmethyl,
p,p'-dinitrobenzhydryl, 5-dibenzosuberyl, triphenylmethyl,
.alpha.-naphthyldiphenylmethyl, p-methoxyphenyldiphenylmethyl,
di(p-methoxyphenyl)phenylmethyl, tri(p-methoxyphenyl)methyl,
4-(4'-bromophenacyloxyphenyl)diphenylmethyl,
4,4',4''-tris(4,5-dichlorophthalimidophenyl)methyl,
4,4',4''-tris(levulinoyloxyphenyl)methyl,
4,4',4''-tris(benzoyloxyphenyl)methyl,
3-(imidazol-1-yl)bis(4',4''-dimethoxyphenyl)methyl,
1,1-bis(4-methoxyphenyl)-1'-pyrenylmethyl, 9-anthryl,
9-(9-phenyl)xanthenyl, 9-(9-phenyl-10-oxo)anthryl,
1,3-benzodisulfuran-2-yl, benzisothiazolyl S,S-dioxido,
trimethylsilyl (TMS), triethylsilyl (TES), triisopropylsilyl
(TIPS), dimethylisopropylsilyl (IPDMS), diethylisopropylsilyl
(DEIPS), dimethylthexylsilyl, t-butyldimethylsilyl (TBDMS),
t-butyldiphenylsilyl (TBDPS), tribenzylsilyl, tri-p-xylylsilyl,
triphenylsilyl, diphenylmethylsilyl (DPMS),
t-butylmethoxyphenylsilyl (TBMPS), formate, benzoylformate,
acetate, chloroacetate, dichloroacetate, trichloroacetate,
trifluoroacetate, methoxyacetate, triphenylmethoxyacetate,
phenoxyacetate, p-chlorophenoxyacetate, 3-phenylpropionate,
4-oxopentanoate (levulinate), 4,4-(ethylenedithio)pentanoate
(levulinoyldithioacetal), pivaloate, adamantoate, crotonate,
4-methoxycrotonate, benzoate, p-phenylbenzoate,
2,4,6-trimethylbenzoate (mesitoate), alkyl methyl carbonate,
9-fluorenylmethyl carbonate (Fmoc), alkyl ethyl carbonate, alkyl
2,2,2-trichloroethyl carbonate (Troc), 2-(trimethylsilyl)ethyl
carbonate (TMSEC), 2-(phenylsulfonyl) ethyl carbonate (Psec),
2-(triphenylphosphonio) ethyl carbonate (Peoc), alkyl isobutyl
carbonate, alkyl vinyl carbonate alkyl allyl carbonate, alkyl
p-nitrophenyl carbonate, alkyl benzyl carbonate, alkyl
p-methoxybenzyl carbonate, alkyl 3,4-dimethoxybenzyl carbonate,
alkyl o-nitrobenzyl carbonate, alkyl p-nitrobenzyl carbonate, alkyl
S-benzyl thiocarbonate, 4-ethoxy-1-napththyl carbonate, methyl
dithiocarbonate, 2-iodobenzoate, 4-azidobutyrate,
4-nitro-4-methylpentanoate, o-(dibromomethyl)benzoate,
2-formylbenzenesulfonate, 2-(methylthiomethoxy)ethyl,
4-(methylthiomethoxy)butyrate, 2-(methylthiomethoxymethyl)benzoate,
2,6-dichloro-4-methylphenoxyacetate,
2,6-dichloro-4-(1,1,3,3-tetramethylbutyl)phenoxyacetate,
2,4-bis(1,1-dimethylpropyl)phenoxyacetate, chlorodiphenylacetate,
isobutyrate, monosuccinoate, (E)-2-methyl-2-butenoate,
o-(methoxyacyl)benzoate, .alpha.-naphthoate, nitrate, alkyl
N,N,N',N'-tetramethylphosphorodiamidate, alkyl N-phenylcarbamate,
borate, dimethylphosphinothioyl, alkyl 2,4-dinitrophenylsulfenate,
sulfate, methanesulfonate (mesylate), benzylsulfonate, and tosylate
(Ts).
[0065] In certain embodiments, the substituent present on a sulfur
atom is a sulfur protecting group (also referred to as a "thiol
protecting group"). Sulfur protecting groups include, but are not
limited to, --R.sup.aa, --N(R.sup.bb).sub.2, --C(.dbd.O)SR.sup.aa,
--C(.dbd.O)R.sup.aa, --CO.sub.2R.sup.aa,
--C(.dbd.O)N(R.sup.bb).sub.2, --C(.dbd.NR.sup.bb)R.sup.aa,
--C(.dbd.NR.sup.bb)OR.sup.aa, --C(.dbd.NR.sup.bb)N(R.sup.bb).sub.2,
--S(.dbd.O)R.sup.aa, --SO.sub.2R.sup.aa, --Si(R.sup.aa).sub.3,
--P(R.sup.cc).sub.2, --P(R.sup.cc).sub.3.sup.+X.sup.-,
--P(OR.sup.cc).sub.2, --P(OR.sup.cc).sub.3.sup.+X.sup.-,
--P(.dbd.O)(R.sup.aa).sub.2, --P(.dbd.O)(OR.sup.cc).sub.2, and
--P(.dbd.O)(N(R.sup.bb).sub.2).sub.2, wherein R.sup.aa, R.sup.bb,
and R.sup.cc are as defined herein. Sulfur protecting groups are
well known in the art and include those described in detail in
Protecting Groups in Organic Synthesis, T. W. Greene and P. G. M.
Wuts, 3rd edition, John Wiley & Sons, 1999, incorporated herein
by reference.
[0066] As used herein, a "leaving group" (LG) is an art-understood
term referring to a molecular fragment that departs with a pair of
electrons in heterolytic bond cleavage, wherein the molecular
fragment is an anion or neutral molecule. As used herein, a leaving
group can be an atom or a group capable of being displaced by a
nucleophile. See, for example, Smith, March's Advanced Organic
Chemistry 6th ed. (501-502). Exemplary leaving groups include, but
are not limited to, halo (e.g., chloro, bromo, iodo) and activated
substituted hydroxyl groups (e.g., --OC(.dbd.O)SR.sup.aa,
--OC(.dbd.O)R.sup.aa, --OCO.sub.2R.sup.aa,
--OC(.dbd.O)N(R.sup.bb).sub.2, --OC(.dbd.NR.sup.bb)R--,
--OC(.dbd.NR.sup.bb)OR.sup.aa,
--OC(.dbd.NR.sup.bb)N(R.sup.bb).sub.2, --OS(.dbd.O)R.sup.aa,
--OSO.sub.2R.sup.aa, --OP(R.sup.cc).sub.2, --OP(R.sup.cc).sub.3,
--OP(.dbd.O).sub.2R.sup.aa, --OP(.dbd.O)(R.sup.aa).sub.2,
--OP(.dbd.O)(OR.sup.cc).sub.2, --OP(.dbd.O).sub.2N(R.sup.bb).sub.2,
and --OP(.dbd.O)(NR.sup.bb).sub.2, wherein R.sup.aa, R.sup.bb, and
R.sup.cc are as defined herein). Examples of suitable leaving
groups include, but are not limited to, halogen (such as F, Cl, Br,
or I (iodine)), alkoxycarbonyloxy, aryloxycarbonyloxy,
alkanesulfonyloxy, arenesulfonyloxy, alkyl-carbonyloxy (e.g.,
acetoxy), arylcarbonyloxy, aryloxy, methoxy,
N,O-dimethylhydroxylamino, pixyl, and haloformates. In some cases,
the leaving group is a sulfonic acid ester, such as
toluenesulfonate (tosylate, --OTs), methanesulfonate (mesylate,
--OMs), p-bromobenzenesulfonyloxy (brosylate, --OBs), or
trifluoromethanesulfonate (triflate, --OTf). In some cases, the
leaving group is a brosylate, such as p-bromobenzenesulfonyloxy. In
some cases, the leaving group is a nosylate, such as
2-nitrobenzenesulfonyloxy. In some embodiments, the leaving group
is a sulfonate-containing group. In some embodiments, the leaving
group is a tosylate group. The leaving group may also be a
phosphineoxide (e.g., formed during a Mitsunobu reaction) or an
internal leaving group such as an epoxide or cyclic sulfate. Other
non-limiting examples of leaving groups are water, ammonia,
alcohols, ether moieties, thioether moieties, zinc halides,
magnesium moieties, diazonium salts, and copper moieties.
[0067] These and other exemplary substituents are described in more
detail in the Detailed Description, Figures, Examples, and Claims.
The invention is not intended to be limited in any manner by the
above exemplary listing of substituents.
Other Definitions
[0068] The following definitions are more general terms used
throughout the present application:
[0069] The term "pharmaceutically acceptable salt" refers to those
salts which are, within the scope of sound medical judgment,
suitable for use in contact with the tissues of humans and lower
animals without undue toxicity, irritation, allergic response and
the like, and are commensurate with a reasonable benefit/risk
ratio. Pharmaceutically acceptable salts are well known in the art.
For example, Berge et al., describe pharmaceutically acceptable
salts in detail in J. Pharmaceutical Sciences, 1977, 66, 1-19,
incorporated herein by reference. Pharmaceutically acceptable salts
of the compounds of this invention include those derived from
suitable inorganic and organic acids and bases. Examples of
pharmaceutically acceptable, nontoxic acid addition salts are salts
of an amino group formed with inorganic acids such as hydrochloric
acid, hydrobromic acid, phosphoric acid, sulfuric acid, and
perchloric acid or with organic acids such as acetic acid, oxalic
acid, maleic acid, tartaric acid, citric acid, succinic acid, or
malonic acid or by using other methods known in the art such as ion
exchange. Other pharmaceutically acceptable salts include adipate,
alginate, ascorbate, aspartate, benzenesulfonate, benzoate,
bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate,
cyclopentanepropionate, digluconate, dodecylsulfate,
ethanesulfonate, formate, fumarate, glucoheptonate,
glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate,
hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate,
laurate, lauryl sulfate, malate, maleate, malonate,
methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate,
oleate, oxalate, palmitate, pamoate, pectinate, persulfate,
3-phenylpropionate, phosphate, picrate, pivalate, propionate,
stearate, succinate, sulfate, tartrate, thiocyanate,
p-toluenesulfonate, undecanoate, valerate salts, and the like.
Salts derived from appropriate bases include alkali metal, alkaline
earth metal, ammonium and N.sup.+(C.sub.1-4 alkyl).sub.4.sup.-
salts. Representative alkali or alkaline earth metal salts include
sodium, lithium, potassium, calcium, magnesium, and the like.
Further pharmaceutically acceptable salts include, when
appropriate, nontoxic ammonium, quaternary ammonium, and amine
cations formed using counterions such as halide, hydroxide,
carboxylate, sulfate, phosphate, nitrate, lower alkyl sulfonate,
and aryl sulfonate.
[0070] The term "solvate" refers to forms of the compound that are
associated with a solvent, usually by a solvolysis reaction. This
physical association may include hydrogen bonding. Conventional
solvents include water, methanol, ethanol, acetic acid, DMSO, THF,
diethyl ether, and the like. The compounds of Formulae (I') and
(II) may be prepared, e.g., in crystalline form, and may be
solvated. Suitable solvates include pharmaceutically acceptable
solvates and further include both stoichiometric solvates and
non-stoichiometric solvates. In certain instances, the solvate will
be capable of isolation, for example, when one or more solvent
molecules are incorporated in the crystal lattice of a crystalline
solid. "Solvate" encompasses both solution-phase and isolable
solvates. Representative solvates include hydrates, ethanolates,
and methanolates.
[0071] The term "hydrate" refers to a compound that is associated
with water. Typically, the number of the water molecules contained
in a hydrate of a compound is in a definite ratio to the number of
the compound molecules in the hydrate. Therefore, a hydrate of a
compound may be represented, for example, by the general formula
R.xH.sub.2O, wherein R is the compound and wherein x is a number
greater than 0. A given compound may form more than one type of
hydrates, including, e.g., monohydrates (x is 1), lower hydrates (x
is a number greater than 0 and smaller than 1, e.g., hemihydrates
(R.0.5H.sub.2O)), and polyhydrates (x is a number greater than 1,
e.g., dihydrates (R.2H.sub.2O) and hexahydrates (R.6H.sub.2O)).
[0072] The term "tautomers" refer to compounds that are
interchangeable forms of a particular compound structure, and that
vary in the displacement of hydrogen atoms and electrons. Thus, two
structures may be in equilibrium through the movement of 7
electrons and an atom (usually H). For example, enols and ketones
are tautomers because they are rapidly interconverted by treatment
with either acid or base. Another example of tautomerism is the
aci- and nitro- forms of phenylnitromethane, that are likewise
formed by treatment with acid or base.
[0073] Tautomeric forms may be relevant to the attainment of the
optimal chemical reactivity and biological activity of a compound
of interest.
[0074] It is also to be understood that compounds that have the
same molecular formula but differ in the nature or sequence of
bonding of their atoms or the arrangement of their atoms in space
are termed "isomers". Isomers that differ in the arrangement of
their atoms in space are termed "stereoisomers".
[0075] Stereoisomers that are not mirror images of one another are
termed "diastereomers" and those that are non-superimposable mirror
images of each other are termed "enantiomers". When a compound has
an asymmetric center, for example, it is bonded to four different
groups, a pair of enantiomers is possible. An enantiomer can be
characterized by the absolute configuration of its asymmetric
center and is described by the R- and S-sequencing rules of Cahn
and Prelog, or by the manner in which the molecule rotates the
plane of polarized light and designated as dextrorotatory or
levorotatory (i.e., as (+) or (-)-isomers respectively). A chiral
compound can exist as either individual enantiomer or as a mixture
thereof. A mixture containing equal proportions of the enantiomers
is called a "racemic mixture".
[0076] The term "polymorphs" refers to a crystalline form of a
compound (or a salt, hydrate, or solvate thereof) in a particular
crystal packing arrangement. All polymorphs have the same elemental
composition. Different crystalline forms usually have different
X-ray diffraction patterns, infrared spectra, melting points,
density, hardness, crystal shape, optical and electrical
properties, stability, and solubility. Recrystallization solvent,
rate of crystallization, storage temperature, and other factors may
cause one crystal form to dominate. Various polymorphs of a
compound can be prepared by crystallization under different
conditions.
[0077] The term "prodrugs" refer to compounds, including
derivatives of the compounds of Formulae (I') and (II), which have
cleavable groups and become by solvolysis or under physiological
conditions the compounds of Formulae (I') and (II) which are
pharmaceutically active in vivo. Such examples include, but are not
limited to, ester derivatives and the like. Other derivatives of
the compounds of this invention have activity in both their acid
and acid derivative forms, but in the acid sensitive form often
offers advantages of solubility, tissue compatibility, or delayed
release in the mammalian organism (see, Bundgard, H., Design of
Prodrugs, pp. 7-9, 21-24, Elsevier, Amsterdam 1985). Prodrugs
include acid derivatives well known to practitioners of the art,
such as, for example, esters prepared by reaction of the parent
acid with a suitable alcohol, or amides prepared by reaction of the
parent acid compound with a substituted or unsubstituted amine, or
acid anhydrides, or mixed anhydrides. Simple aliphatic or aromatic
esters, amides, and anhydrides derived from acidic groups pendant
on the compounds of this invention are particular prodrugs. In some
cases it is desirable to prepare double ester type prodrugs such as
(acyloxy)alkyl esters or ((alkoxycarbonyl)oxy)alkylesters. C.sub.1
to C.sub.8 alkyl, C.sub.2-C.sub.8 alkenyl, C.sub.2-C.sub.8 alkynyl,
aryl, C.sub.7-C.sub.12 substituted aryl, and C.sub.7-C.sub.12
arylalkyl esters of the compounds of Formulae (I') and (II) may be
preferred.
[0078] A "subject" to which administration is contemplated
includes, but is not limited to, humans (i.e., a male or female of
any age group, e.g., a pediatric subject (e.g., infant, child,
adolescent) or adult subject (e.g., young adult, middle-aged adult,
or senior adult)) and/or other non-human animals, for example,
mammals (e.g., primates (e.g., cynomolgus monkeys, rhesus monkeys);
commercially relevant mammals such as cattle, pigs, horses, sheep,
goats, cats, and/or dogs) and birds (e.g., commercially relevant
birds such as chickens, ducks, geese, and/or turkeys). In certain
embodiments, the animal is a mammal. The animal may be a male or
female and at any stage of development. A non-human animal may be a
transgenic animal.
[0079] The terms "administer," "administering," or
"administration," refers to implanting, absorbing, ingesting,
injecting, inhaling, or otherwise introducing an inventive
compound, or a pharmaceutical composition thereof.
[0080] The terms "treatment," "treat," and "treating" refer to
reversing, alleviating, delaying the onset of, or inhibiting the
progress of a "pathological condition" (e.g., a disease, disorder,
or condition, or one or more signs or symptoms thereof) described
herein. In some embodiments, treatment may be administered after
one or more signs or symptoms have developed or have been observed.
In other embodiments, treatment may be administered in the absence
of signs or symptoms of the disease or condition. For example,
treatment may be administered to a susceptible individual prior to
the onset of symptoms (e.g., in light of a history of symptoms
and/or in light of genetic or other susceptibility factors).
Treatment may also be continued after symptoms have resolved, for
example, to delay or prevent recurrence.
[0081] The terms "condition," "disease," and "disorder" are used
interchangeably.
[0082] An "effective amount" of a compound of Formula (I') or (II)
refers to an amount sufficient to elicit the desired biological
response, i.e., treating the condition. As will be appreciated by
those of ordinary skill in this art, the effective amount of a
compound of Formula (I') or (II) may vary depending on such factors
as the desired biological endpoint, the pharmacokinetics of the
compound, the condition being treated, the mode of administration,
and the age and health of the subject. An effective amount
encompasses therapeutic and prophylactic treatment. For example, in
treating cancer, an effective amount of an inventive compound may
reduce the tumor burden or stop the growth or spread of a
tumor.
[0083] A "therapeutically effective amount" of a compound of
Formula (I') or (II) is an amount sufficient to provide a
therapeutic benefit in the treatment of a condition or to delay or
minimize one or more symptoms associated with the condition. A
therapeutically effective amount of a compound means an amount of
therapeutic agent, alone or in combination with other therapies,
which provides a therapeutic benefit in the treatment of the
condition. The term "therapeutically effective amount" can
encompass an amount that improves overall therapy, reduces or
avoids symptoms or causes of the condition, or enhances the
therapeutic efficacy of another therapeutic agent.
[0084] A "prophylactically effective amount" of a compound of
Formula (I') or (II) is an amount sufficient to prevent a
condition, or one or more symptoms associated with the condition or
prevent its recurrence. A prophylactically effective amount of a
compound means an amount of a therapeutic agent, alone or in
combination with other agents, which provides a prophylactic
benefit in the prevention of the condition. The term
"prophylactically effective amount" can encompass an amount that
improves overall prophylaxis or enhances the prophylactic efficacy
of another prophylactic agent.
[0085] A "proliferative disease" refers to a disease that occurs
due to abnormal growth or extension by the multiplication of cells
(Walker, Cambridge Dictionary of Biology; Cambridge University
Press: Cambridge, UK, 1990). A proliferative disease may be
associated with: 1) the pathological proliferation of normally
quiescent cells; 2) the pathological migration of cells from their
normal location (e.g., metastasis of neoplastic cells); 3) the
pathological expression of proteolytic enzymes such as the matrix
metalloproteinases (e.g., collagenases, gelatinases, and
elastases); or 4) the pathological angiogenesis as in proliferative
retinopathy and tumor metastasis. Exemplary proliferative diseases
include cancers (i.e., "malignant neoplasms"), benign neoplasms,
angiogenesis, inflammatory diseases, autoinflammatory diseases, and
autoimmune diseases.
[0086] The terms "neoplasm" and "tumor" are used interchangeably
and refer to an abnormal mass of tissue wherein the growth of the
mass surpasses and is not coordinated with the growth of a normal
tissue. A neoplasm or tumor may be "benign" or "malignant,"
depending on the following characteristics: degree of cellular
differentiation (including morphology and functionality), rate of
growth, local invasion, and metastasis. A "benign neoplasm" is
generally well differentiated, has characteristically slower growth
than a malignant neoplasm, and remains localized to the site of
origin. In addition, a benign neoplasm does not have the capacity
to infiltrate, invade, or metastasize to distant sites. Exemplary
benign neoplasms include, but are not limited to, lipoma,
chondroma, adenomas, acrochordon, senile angiomas, seborrheic
keratoses, lentigos, and sebaceous hyperplasias. In some cases,
certain "benign" tumors may later give rise to malignant neoplasms,
which may result from additional genetic changes in a subpopulation
of the tumor's neoplastic cells, and these tumors are referred to
as "pre-malignant neoplasms." An exemplary pre-malignant neoplasm
is a teratoma. In contrast, a "malignant neoplasm" is generally
poorly differentiated (anaplasia) and has characteristically rapid
growth accompanied by progressive infiltration, invasion, and
destruction of the surrounding tissue. Furthermore, a malignant
neoplasm generally has the capacity to metastasize to distant
sites.
[0087] The term "metastasis," "metastatic," or "metastasize" refers
to the spread or migration of cancerous cells from a primary or
original tumor to another organ or tissue and is typically
identifiable by the presence of a "secondary tumor" or "secondary
cell mass" of the tissue type of the primary or original tumor and
not of that of the organ or tissue in which the secondary
(metastatic) tumor is located. For example, a prostate cancer that
has migrated to bone is said to be metastasized prostate cancer and
includes cancerous prostate cancer cells growing in bone
tissue.
[0088] The term "cancer" refers to a malignant neoplasm (Stedman's
Medical Dictionary, 25th ed.; Hensyl ed.; Williams & Wilkins:
Philadelphia, 1990). Exemplary cancers include, but are not limited
to, acoustic neuroma; adenocarcinoma; adrenal gland cancer; anal
cancer; angiosarcoma (e.g., lymphangiosarcoma,
lymphangioendotheliosarcoma, hemangiosarcoma); appendix cancer;
benign monoclonal gammopathy; biliary cancer (e.g.,
cholangiocarcinoma); bladder cancer; breast cancer (e.g.,
adenocarcinoma of the breast, papillary carcinoma of the breast,
mammary cancer, medullary carcinoma of the breast); brain cancer
(e.g., meningioma, glioblastomas, glioma (e.g., astrocytoma,
oligodendroglioma), medulloblastoma); bronchus cancer; carcinoid
tumor; cervical cancer (e.g., cervical adenocarcinoma);
choriocarcinoma; chordoma; craniopharyngioma; colorectal cancer
(e.g., colon cancer, rectal cancer, colorectal adenocarcinoma);
connective tissue cancer; epithelial carcinoma; ependymoma;
endotheliosarcoma (e.g., Kaposi's sarcoma, multiple idiopathic
hemorrhagic sarcoma); endometrial cancer (e.g., uterine cancer,
uterine sarcoma); esophageal cancer (e.g., adenocarcinoma of the
esophagus, Barrett's adenocarcinoma); Ewing's sarcoma; eye cancer
(e.g., intraocular melanoma, retinoblastoma); familiar
hypereosinophilia; gall bladder cancer; gastric cancer (e.g.,
stomach adenocarcinoma); gastrointestinal stromal tumor (GIST);
germ cell cancer; head and neck cancer (e.g., head and neck
squamous cell carcinoma, oral cancer (e.g., oral squamous cell
carcinoma), throat cancer (e.g., laryngeal cancer, pharyngeal
cancer, nasopharyngeal cancer, oropharyngeal cancer));
hematopoietic cancers (e.g., leukemia such as acute lymphocytic
leukemia (ALL) (e.g., B-cell ALL, T-cell ALL), acute myelocytic
leukemia (AML) (e.g., B-cell AML, T-cell AML), chronic myelocytic
leukemia (CML) (e.g., B-cell CML, T-cell CML), and chronic
lymphocytic leukemia (CLL) (e.g., B-cell CLL, T-cell CLL));
lymphoma such as Hodgkin lymphoma (HL) (e.g., B-cell HL, T-cell HL)
and non-Hodgkin lymphoma (NHL) (e.g., B-cell NHL such as diffuse
large cell lymphoma (DLCL) (e.g., diffuse large B-cell lymphoma),
follicular lymphoma, chronic lymphocytic leukemia/small lymphocytic
lymphoma (CLL/SLL), mantle cell lymphoma (MCL), marginal zone
B-cell lymphomas (e.g., mucosa-associated lymphoid tissue (MALT)
lymphomas, nodal marginal zone B-cell lymphoma, splenic marginal
zone B-cell lymphoma), primary mediastinal B-cell lymphoma, Burkitt
lymphoma, lymphoplasmacytic lymphoma (i.e., Waldenstram's
macroglobulinemia), hairy cell leukemia (HCL), immunoblastic large
cell lymphoma, precursor B-lymphoblastic lymphoma and primary
central nervous system (CNS) lymphoma; and T-cell NHL such as
precursor T-lymphoblastic lymphoma/leukemia, peripheral T-cell
lymphoma (PTCL) (e.g., cutaneous T-cell lymphoma (CTCL) (e.g.,
mycosis fungoides, Sezary syndrome), angioimmunoblastic T-cell
lymphoma, extranodal natural killer T-cell lymphoma, enteropathy
type T-cell lymphoma, subcutaneous panniculitis-like T-cell
lymphoma, and anaplastic large cell lymphoma); a mixture of one or
more leukemia/lymphoma as described above; and multiple myeloma
(MM)), heavy chain disease (e.g., alpha chain disease, gamma chain
disease, mu chain disease); hemangioblastoma; hypopharynx cancer;
inflammatory myofibroblastic tumors; immunocytic amyloidosis;
kidney cancer (e.g., nephroblastoma a.k.a. Wilms' tumor, renal cell
carcinoma); liver cancer (e.g., hepatocellular cancer (HCC),
malignant hepatoma); lung cancer (e.g., bronchogenic carcinoma,
small cell lung cancer (SCLC), non-small cell lung cancer (NSCLC),
adenocarcinoma of the lung); leiomyosarcoma (LMS); mastocytosis
(e.g., systemic mastocytosis); muscle cancer; myelodysplastic
syndrome (MDS); mesothelioma; myeloproliferative disorder (MPD)
(e.g., polycythemia vera (PV), essential thrombocytosis (ET),
agnogenic myeloid metaplasia (AMM) a.k.a. myelofibrosis (MF),
chronic idiopathic myelofibrosis, chronic myelocytic leukemia
(CML), chronic neutrophilic leukemia (CNL), hypereosinophilic
syndrome (HES)); neuroblastoma; neurofibroma (e.g.,
neurofibromatosis (NF) type 1 or type 2, schwannomatosis);
neuroendocrine cancer (e.g., gastroenteropancreatic
neuroendocrinetumor (GEP-NET), carcinoid tumor); osteosarcoma
(e.g., bone cancer); ovarian cancer (e.g., cystadenocarcinoma,
ovarian embryonal carcinoma, ovarian adenocarcinoma); papillary
adenocarcinoma; pancreatic cancer (e.g., pancreatic
andenocarcinoma, intraductal papillary mucinous neoplasm (IPMN),
Islet cell tumors); penile cancer (e.g., Paget's disease of the
penis and scrotum); pinealoma; primitive neuroectodermal tumor
(PNT); plasma cell neoplasia; paraneoplastic syndromes;
intraepithelial neoplasms; prostate cancer (e.g., prostate
adenocarcinoma); rectal cancer; rhabdomyosarcoma; salivary gland
cancer; skin cancer (e.g., squamous cell carcinoma (SCC),
keratoacanthoma (KA), melanoma, basal cell carcinoma (BCC)); small
bowel cancer (e.g., appendix cancer); soft tissue sarcoma (e.g.,
malignant fibrous histiocytoma (MFH), liposarcoma, malignant
peripheral nerve sheath tumor (MPNST), chondrosarcoma,
fibrosarcoma, myxosarcoma); sebaceous gland carcinoma; small
intestine cancer; sweat gland carcinoma; synovioma; testicular
cancer (e.g., seminoma, testicular embryonal carcinoma); thyroid
cancer (e.g., papillary carcinoma of the thyroid, papillary thyroid
carcinoma (PTC), medullary thyroid cancer); urethral cancer;
vaginal cancer; and vulvar cancer (e.g., Paget's disease of the
vulva).
[0089] The term "angiogenesis" refers to the formation and the
growth of new blood vessels. Normal angiogenesis occurs in the
healthy body of a subject for healing wounds and for restoring
blood flow to tissues after injury. The healthy body controls
angiogenesis through a number of means, e.g.,
angiogenesis-stimulating growth factors and angiogenesis
inhibitors. Many disease states, such as cancer, diabetic
blindness, age-related macular degeneration, rheumatoid arthritis,
and psoriasis, are characterized by abnormal (i.e., increased or
excessive) angiogenesis. Abnormal or pathological angiogenesis
refers to angiogenesis greater than that in a normal body,
especially angiogenesis in an adult not related to normal
angiogenesis (e.g., menstruation or wound healing). Abnormal
angiogenesis can provide new blood vessels that feed diseased
tissues and/or destroy normal tissues, and in the case of cancer,
the new vessels can allow tumor cells to escape into the
circulation and lodge in other organs (tumor metastases). In
certain embodiments, the angiogenesis is pathological
angiogenesis.
[0090] An "inflammatory disease" refers to a disease caused by,
resulting from, or resulting in inflammation. The term
"inflammatory disease" may also refer to a dysregulated
inflammatory reaction that causes an exaggerated response by
macrophages, granulocytes, and/or T-lymphocytes leading to abnormal
tissue damage and/or cell death. An inflammatory disease can be
either an acute or chronic inflammatory condition and can result
from infections or non-infectious causes. Inflammatory diseases
include, without limitation, atherosclerosis, arteriosclerosis,
autoimmune disorders, multiple sclerosis, systemic lupus
erythematosus, polymyalgia rheumatica (PMR), gouty arthritis,
degenerative arthritis, tendonitis, bursitis, psoriasis, cystic
fibrosis, arthrosteitis, rheumatoid arthritis, inflammatory
arthritis, Sjogren's syndrome, giant cell arteritis, progressive
systemic sclerosis (scleroderma), ankylosing spondylitis,
polymyositis, dermatomyositis, pemphigus, pemphigoid, diabetes
(e.g., Type I), myasthenia gravis, Hashimoto's thyroiditis, Graves'
disease, Goodpasture's disease, mixed connective tissue disease,
sclerosing cholangitis, inflammatory bowel disease, Crohn's
disease, ulcerative colitis, pernicious anemia, inflammatory
dermatoses, usual interstitial pneumonitis (UIP), asbestosis,
silicosis, bronchiectasis, berylliosis, talcosis, pneumoconiosis,
sarcoidosis, desquamative interstitial pneumonia, lymphoid
interstitial pneumonia, giant cell interstitial pneumonia, cellular
interstitial pneumonia, extrinsic allergic alveolitis, Wegener's
granulomatosis and related forms of angiitis (temporal arteritis
and polyarteritis nodosa), inflammatory dermatoses, hepatitis,
delayed-type hypersensitivity reactions (e.g., poison ivy
dermatitis), pneumonia, respiratory tract inflammation, Adult
Respiratory Distress Syndrome (ARDS), encephalitis, immediate
hypersensitivity reactions, asthma, hayfever, allergies, acute
anaphylaxis, rheumatic fever, glomerulonephritis, pyelonephritis,
cellulitis, cystitis, chronic cholecystitis, ischemia (ischemic
injury), reperfusion injury, allograft rejection, host-versus-graft
rejection, appendicitis, arteritis, blepharitis, bronchiolitis,
bronchitis, cervicitis, cholangitis, chorioamnionitis,
conjunctivitis, dacryoadenitis, dermatomyositis, endocarditis,
endometritis, enteritis, enterocolitis, epicondylitis,
epididymitis, fasciitis, fibrositis, gastritis, gastroenteritis,
gingivitis, ileitis, iritis, laryngitis, myelitis, myocarditis,
nephritis, omphalitis, oophoritis, orchitis, osteitis, otitis,
pancreatitis, parotitis, pericarditis, pharyngitis, pleuritis,
phlebitis, pneumonitis, proctitis, prostatitis, rhinitis,
salpingitis, sinusitis, stomatitis, synovitis, testitis,
tonsillitis, urethritis, urocystitis, uveitis, vaginitis,
vasculitis, vulvitis, vulvovaginitis, angitis, chronic bronchitis,
osteomyelitis, optic neuritis, temporal arteritis, transverse
myelitis, necrotizing fasciitis, and necrotizing enterocolitis.
[0091] An "autoimmune disease" refers to a disease arising from an
inappropriate immune response of the body of a subject against
substances and tissues normally present in the body. In other
words, the immune system mistakes some part of the body as a
pathogen and attacks its own cells. This may be restricted to
certain organs (e.g., in autoimmune thyroiditis) or involve a
particular tissue in different places (e.g., Goodpasture's disease
which may affect the basement membrane in both the lung and
kidney). The treatment of autoimmune diseases is typically with
immunosuppression, e.g., medications which decrease the immune
response. Exemplary autoimmune diseases include, but are not
limited to, glomerulonephritis, Goodpasture's syndrome, necrotizing
vasculitis, lymphadenitis, peri-arteritis nodosa, systemic lupus
erythematosis, rheumatoid, arthritis, psoriatic arthritis, systemic
lupus erythematosis, psoriasis, ulcerative colitis, systemic
sclerosis, dermatomyositis/polymyositis, anti-phospholipid antibody
syndrome, scleroderma, pemphigus vulgaris, ANCA-associated
vasculitis (e.g., Wegener's granulomatosis, microscopic
polyangiitis), uveitis, Sjogren's syndrome, Crohn's disease,
Reiter's syndrome, ankylosing spondylitis, Lyme arthritis,
Guillain-Barre syndrome, Hashimoto's thyroiditis, and
cardiomyopathy.
[0092] The term "autoinflammatory disease" refers to a category of
diseases that are similar but different from autoimmune diseases.
Autoinflammatory and autoimmune diseases share common
characteristics in that both groups of disorders result from the
immune system attacking a subject's own tissues and result in
increased inflammation. In autoinflammatory diseases, a subject's
innate immune system causes inflammation for unknown reasons. The
innate immune system reacts even though it has never encountered
autoantibodies or antigens in the subject. Autoinflammatory
disorders are characterized by intense episodes of inflammation
that result in such symptoms as fever, rash, or joint swelling.
These diseases also carry the risk of amyloidosis, a potentially
fatal buildup of a blood protein in vital organs. Autoinflammatory
diseases include, but are not limited to, familial Mediterranean
fever (FMF), neonatal onset multisystem inflammatory disease
(NOMID), tumor necrosis factor (TNF) receptor-associated periodic
syndrome (TRAPS), deficiency of the interleukin-1 receptor
antagonist (DIRA), and Behget's disease.
[0093] The term "biological sample" refers to any sample including
tissue samples (such as tissue sections and needle biopsies of a
tissue); cell samples (e.g., cytological smears (such as Pap or
blood smears) or samples of cells obtained by microdissection);
samples of whole organisms (such as samples of yeasts or bacteria);
or cell fractions, fragments or organelles (such as obtained by
lysing cells and separating the components thereof by
centrifugation or otherwise). Other examples of biological samples
include blood, serum, urine, semen, fecal matter, cerebrospinal
fluid, interstitial fluid, mucus, tears, sweat, pus, biopsied
tissue (e.g., obtained by a surgical biopsy or needle biopsy),
nipple aspirates, milk, vaginal fluid, saliva, swabs (such as
buccal swabs), or any material containing biomolecules that is
derived from a first biological sample. Biological samples also
include those biological samples that are transgenic, such as
transgenic oocyte, sperm cell, blastocyst, embryo, fetus, donor
cell, or cell nucleus.
[0094] A "protein" or "peptide" comprises a polymer of amino acid
residues linked together by peptide bonds. The term refers to
proteins, polypeptides, and peptides of any size, structure, or
function. Typically, a protein will be at least three amino acids
long. A protein may refer to an individual protein or a collection
of proteins. Inventive proteins preferably contain only natural
amino acids, although non-natural amino acids (i.e., compounds that
do not occur in nature but that can be incorporated into a
polypeptide chain) and/or amino acid analogs as are known in the
art may alternatively be employed. Also, one or more of the amino
acids in an inventive protein may be modified, for example, by the
addition of a chemical entity such as a carbohydrate group, a
hydroxyl group, a phosphate group, a farnesyl group, an isofarnesyl
group, a fatty acid group, a linker for conjugation or
functionalization, or other modification. A protein may also be a
single molecule or may be a multi-molecular complex. A protein may
be a fragment of a naturally occurring protein or peptide. A
protein may be naturally occurring, recombinant, or synthetic, or
any combination of these.
[0095] The term "kinase" refers to any enzyme that catalyzes the
addition of phosphate groups to an amino acid residue of a
substrate (e.g., a protein or nucleoside). For example, a serine
kinase catalyzes the addition of a phosphate group to serine
residue in a protein. In certain embodiments, the kinase is a
protein kinase. Examples of kinases include, but are not limited
to, a CMGC kinase (e.g., a cyclin-dependent kinase (CDK, e.g.,
CDK1, CDK2, CDK2, CDK4, CDK5, CDK7, CDK8, CDK9, CDK10, CDK11,
CDK12, CDK13, CDK14, CDK16, CDK20), a mitogen-activated protein
kinase (MAPK, e.g., MAPK1, MAPK3, MAPK4, MAPK6, MAPK7, MAPK8,
MAPK9, MAPK10, MAPK11, MAPK12, MAPK13, MAPK14, MAPK15), a glycogen
synthase kinase 3 (GSK3, e.g., GSK3a, GSK3P), or a CDC-like kinase
(CLK, e.g., CLK1, CLK2, CLK3, CLK4)), an AGC kinase (e.g., protein
kinase A (PKA), protein kinase C (PKC), protein kinase G (PKG)), a
Ca.sup.2+/calmodulin-dependent protein kinase (CaM kinase, e.g., a
specialized CaM kinase, a multifunctional CaM kinase), a casein
kinase 1 (CK1, e.g., CK1alpha, CK1beta 1, CK1gamma 1, CK1gamma 2,
CK1gamma 3, CK1delta, CK1epsilon), a STE kinase (e.g., a homolog of
yeast Sterile 7, Sterile 11, or Sterile 20 kinase), a tyrosine
kinase (TK, e.g., a receptor tyrosine kinase (RTK), a non-receptor
tyrosine kinase (nRTK)), and a tyrosine-kinase-like kinase (TKL,
e.g., a mixed lineage kinase (MLK), RAF, a serine threonine kinase
receptor (STKR), a leucine rich repeat kinase (LRRK), a LIM domain
kinase (LIMK), a testis expressed serine kinase (TESK), an IL1
receptor associated kinase (IRAK), a receptor interacting protein
kinase (RIPK)).
[0096] The term "CDK" refers to a cyclin-dependent kinase. A CDK
binds a cyclin (e.g., Cyclin H), which is a regulatory protein.
CDKs phosphorylate their substrates at serines and threonines. The
consensus sequence for the phosphorylation site in the amino acid
sequence of a CDK substrate is [S/T*]PX[K/R], where S/T* is the
phosphorylated serine or threonine, P is proline, X is any amino
acid, K is lysine, and R is arginine. CDKs include CDK1, CDK2,
CDK2, CDK4, CDK5, CDK7, CDK8, CDK9, CDK10, CDK11, CDK12, CDK14,
CDK16, and CDK20.
[0097] CDK7, cyclin-dependent kinase 7, is a CDK, wherein the
substrate is Cyclin H, MAT1 (e.g., MNAT1), or Cyclin H and MAT1.
CDK7 is alternatively referred to as CAK, HCAK, MO15, STK1, CDKN7,
and p39MO15. Non-limiting examples of the nucleotide and protein
sequences for human CDK7 are described in GenBank Accession Number:
NP_001790, incorporated herein by reference. The amino acid
sequence of this CDK7 is as follows:
TABLE-US-00001 (SEQ ID NO: 1)
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEA
KDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVII
KDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKL
ADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILA
ELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGI
PLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQ
LPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
[0098] CDK12, cyclin-dependent kinase 12, is a CDK, wherein the
substrate is Cyclin K or flavopiridol. CDK12 is alternatively
referred to as Cdc2-related kinase, CDC2-related protein kinase 7,
Cell division cycle 2-related protein kinase 7, Cell division
protein kinase 12, CRK7, CRKR, CRKRS, cyclin-dependent kinase 12,
or KIAA0904. Non-limiting examples of the nucleotide and protein
sequences for human CDK12 are described in Uniprot Number: Q9NYV4,
which is incorporated herein by reference. The amino acid sequence
of this CDK12 is as follows:
TABLE-US-00002 (SEQ ID NO: 2)
MPNSERHGGKKDGSGGASGTLQPSSGGGSSNSRERHRLVSKHKRHKSKHSK
DMGLVTPEAASLGTVIKPLVEYDDISSDSDTFSDDMAFKLDRRENDERRGS
DRSDRLHKHRHHQHRRSRDLLKAKQTEKEKSQEVSSKSGSMKDRISGSSKR
SNEETDDYGKAQVAKSSSKESRSSKLHKEKTRKERELKSGHKDRSKSHRKR
ETPKSYKTVDSPKRRSRSPHRKWSDSSKQDDSPSGASYGQDYDLSPSRSHT
SSNYDSYKKSPGSTSRRQSVSPPYKEPSAYQSSTRSPSPYSRRQRSVSPYS
RRRSSSYERSGSYSGRSPSPYGRRRSSSPFLSKRSLSRSPLPSRKSMKSRS
RSPAYSRHSSSHSKKKRSSSRSRHSSISPVRLPLNSSLGAELSRKKKERAA
AAAAAKMDGKESKGSPVFLPRKENSSVEAKDSGLESKKLPRSVKLEKSAPD
TELVNVTHLNTEVKNSSDTGKVKLDENSEKHLVKDLKAQGTRDSKPIALKE
EIVTPKETETSEKETPPPLPTIASPPPPLPTTTPPPQTPPLPPLPPIPALP
QQPPLPPSQPAFSQVPASSTSTLPPSTHSKTSAVSSQANSQPPVQVSVKTQ
VSVTAAIPHLKTSTLPPLPLPPLLPGDDDMDSPKETLPSKPVKKEKEQRTR
HLLTDLPLPPELPGGDLSPPDSPEPKAITPPQQPYKKRPKICCPRYGERRQ
TESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKE
GFPITAIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYM
DHDLMGLLESGLVHFSEDHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILL
NNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGEERYTPAID
VWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYF
NTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFL
KDVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVVVEEPPPSKTSRKETT
SGTSTEPVKNSSPAPPQPAPGKVESGAGDAIGLADITQQLNQSELAVLLNL
LQSQTDLSIPQMAQLLNIHSNPEMQQQLEALNQSISALTEATSQQQDSETM
APEESLKEAPSAPVILPSAEQTTLEASSTPADMQNILAVLLSQLMKTQEPA
GSLEENNSDKNSGPQGPRRTPTMPQEEAAACPPHILPPEKRPPEPPGPPPP
PPPPPLVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEHQALRPM
EYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFS
GSLSHLGESSSYQGTGSVQFPGDQDLRFARVPLALHPVVGQPFLKAEGSSN
SVVHAETKLQNYGELGPGTTGASSSGAGLHWGGPTQSSAYGKLYRGPTRVP PRGGRGRGVPY
[0099] CDK13, cyclin-dependent kinase 13, is a CDK, wherein the
relevant cyclin is cyclin K and a reference inhibitor is the
pan-CDK inhibitor flavopiridol and the c-terminal domain (CTD) of
RNA-polymerase II is a physiological substrate. CDK13 is
alternatively referred to as CHED; CDC2L; CDC2L5; or hCDK13.
Non-limiting examples of the nucleotide and protein sequences for
human CDK12 are described in GenBank Accession Number M80629, which
is incorporated herein by reference. The amino acid sequence of
this CDK13 is as follows:
TABLE-US-00003 (SEQ ID NO: 3)
MPSSSDTALGGGGGLSWAEKKLEERRKRRRFLSPQQPPLLLPLLQPQLLQP
PPPPPPLLFLAAPGTAAAAAAAAAASSSCFSPGPPLEVKRLARGKRRAGGR
QKRRRGPRAGQEAEKRRVFSLPQPQQDGGGGASSGGGVTPLVEYEDVSSQS
EQGLLLGGASAATAATAAGGTGGSGGSPASSSGTQRRGEGSERRPRRDRRS
SSGRSKERHREHRRRDGQRGGSEASKSRSRHSHSGEERAEVAKSGSSSSSG
GRRKSASATSSSSSSRKDRDSKAHRSRTKSSKEPPSAYKEPPKAYREDKTE
PKAYRRRRSLSPLGGRDDSPVSHRASQSLRSRKSPSPAGGGSSPYSRRLPR
SPSPYSRRRSPSYSRHSSYERGGDVSPSPYSSSSWRRSRSPYSPVLRRSGK
SRSRSPYSSRHSRSRSRHRLSRSRSRHSSISPSTLTLKSSLAAELNKNKKA
RAAEAARAAEAAKAAEATKAAEAAAKAAKASNTSTPTKGNTETSASASQTN
HVKDVKKIKIEHAPSPSSGGTLKNDKAKTKPPLQVTKVENNLIVDKATKKA
VIVGKESKSAATKEESVSLKEKTKPLTPSIGAKEKEQHVALVTSTLPPLPL
PPMLPEDKEADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDDLSK
SPEEKKTATQLHSKRRPKICGPRYGETKEKDIDWGKRCVDKFDIIGIIGEG
TYGQVYKARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSII
NMKEIVTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKS
FMRQLMEGLDYCHKKNFLHRDIKCSNILLNNRGQIKLADFGLARLYSSEES
RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANQ
ELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKLREEFVFIPA
AALDLFDYMLALDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHEL
WSKKRRRQKQMGMTDDVSTIKAPRKDLSLGLDDSRTNTPQGVLPSSQLKSQ
GSSNVAPVKTGPGQHLNHSELAILLNLLQSKTSVNMADFVQVLNIKVNSET
QQQLNKINLPAGILATGEKQTDPSTPQQESSKPLGGIQPSSQTIQPKVETD
AAQAAVQSAFAVLLTQLIKAQQSKQKDVLLEERENGSGHEASLQLRPPPEP
STPVSGQDDLIQHQDMRILELTPEPDRPRILPPDQRPPEPPEPPPVTEEDL
DYRTENQHVPTTSSSLTDPHAGVKAALLQLLAQHQPQDDPKREGGIDYQAG
DTYVSTSDYKDNFGSSSFSSAPYVSNDGLGSSSAPPLERRSFIGNSDIQSL
DNYSTASSHSGGPPQPSAFSESFPSSVAGYGDIYLNAGPMLFSGDKDHRFE
YSHGPIAVLANSSDPSTGPESTHPLPAKMHNYNYGGNLQENPSGPSLMHGQ
TWTSPAQGPGYSQGYRGHISTSTGRGRGRGLPY
BRIEF DESCRIPTION OF THE DRAWINGS
[0100] The accompanying drawings, which constitute a part of this
specification, illustrate several embodiments of the invention and
together with the description, serve to explain the principles of
the invention.
[0101] FIG. 1. Cyclin K pull down with THZ1-biotin probe. Exemplary
compound BSJ-01-175-1 selectively binds intracellular
CDK12/13-cyclin K complexes, and not CDK7-cyclin H complexes.
[0102] Jurkat cells were treated with THZ1 (1 .mu.M), compound
BSJ-01-175-1 (1 .mu.M), or DMSO vehicle control for 6 hrs.
Clarified cellular lysates from each treatment condition were then
incubated with either 1 .mu.M THZ1-biotin, a concentration that
binds CDK7-cyclin H, CDK12-cyclin K, and CDK13-cyclin K complexes.
Lysates were incubated with THZ1-biotin overnight at 4 degrees
Celsius. Subsequent addition of streptavidin-coated beads permits
the immunoprecipitation of the indicated protein complexes.
Following washing of beads with lysis buffer, the
immunoprecipitated proteins were eluted from the beads by boiling
in SDS buffer. Western blotting for cyclin K was used to identify
precipitated CDK12-cyclin K or CDK13-cyclin K complexes. Western
blotting for cyclin H was used to identify precipitated CDK7-cyclin
H complexes. As THZ1 and compound BSJ-01-175-1 bind to their
intended targets covalently, pretreatment of cells with these
compounds would be expected to block subsequent capture and
immunoprecipitation of these protein complexes with THZ1-biotin.
The western blot data indicates that THZ1 binds intracellular
CDK12-cyclin K, CDK13-cyclin K and CDK7-cyclin H complexes, while
compound BSJ-01-175-1 binds intracellular CDK12-cyclin K and
CDK13-cyclin K complexes selectively (and not CDK7-cyclin H).
[0103] FIG. 2 shows inhibition of Jurkat cell viability by
exemplified compounds at a concentration of 1.0 .mu.M for 6 hours,
followed by lysing and pulldown with Biotin-THZ1, and subsequent
blot for cyclin K (Cyc K) and cyclin H (Cyc H). Compounds
BSJ-01-033, BSJ-01-175, BSJ-01-202, BSJ-02-139, BSJ-02-109 and
BSJ-02-108 show a loss in cyclin K pulldown, indicating loss of
CDK12 binding and BSJ-02-139 and BSJ-02-108 also show a loss in
cyclin H pulldown, indicating loss of CDK7 binding.
[0104] FIG. 3. shows exemplary mass spectrum labeling of CDK12 with
compound BSJ-01-175. Compound BSJ-01-175 is able to label CDK12
once treated with a 5-fold excess of compound BSJ-01-175 for 1 hour
at room temperature.
DETAILED DESCRIPTION OF CERTAIN EMBODIMENTS OF THE INVENTION
[0105] The present invention provides compounds, which inhibit the
activity of a kinase, for the prevention and/or treatment of a
proliferative disease of a subject. In certain embodiments, the
inventive compounds inhibit the activity of cyclin-dependent kinase
(CDK). In certain embodiments, the inventive compounds inhibit the
activity of cyclin-dependent kinase 12 (CDK12). The present
invention further provides methods of using the compounds described
herein, e.g., as biological probes to study the inhibition of the
activity of a kinase (e.g., CDK (e.g., CDK12)), and as
therapeutics, e.g., in the prevention and/or treatment of diseases
associated with the overexpression and/or aberrant activity of the
kinase (e.g., CDK (e.g., CDK12)). In certain embodiments, the
diseases are proliferative diseases. The proliferative diseases
include, but are not limited to, cancer (e.g., leukemia, melanoma,
multiple myeloma), benign neoplasm, angiogenesis, inflammatory
diseases, autoinflammatory diseases, and autoimmune diseases. In
certain embodiments, the cancer is associated with the
overexpression and/or aberrant activity of a kinase (e.g., CDK
(e.g., CDK12)). Also provided by the present disclosure are
pharmaceutical compositions, kits, methods, and uses of a compound
of Formulae (I') or (II) as described herein.
Compounds
[0106] In certain embodiments, a compound described herein is a
compound of any one of Formulae (I') and (II), or a
pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0107] In one aspect of the present invention, provided are
compounds of Formula (I'):
##STR00008##
and pharmaceutically acceptable salts, solvates, hydrates,
tautomers, and stereoisomers thereof, wherein:
[0108] Ring A is an optionally substituted heteroaryl ring of any
one of the Formulae (ii-1)-(ii-5):
##STR00009##
[0109] or an optionally substituted 6-membered aryl or heteroaryl
ring;
[0110] each instance of V.sup.1, V.sup.2, V.sup.3, V.sup.4,
V.sup.5, V.sup.6, V.sup.7, V.sup.8, V.sup.9, V.sup.10, V.sup.11,
V.sup.12, V.sup.13, and V.sup.14 is independently O, S, N,
N(R.sup.A1), C, or C(R.sup.A2);
[0111] Z is --CH-- or --N--;
[0112] each instance of R.sup.A1 is independently selected from
hydrogen, optionally substituted acyl, optionally substituted
alkyl, optionally substituted alkenyl, optionally substituted
alkynyl, optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, and optionally
substituted heteroaryl;
[0113] each instance of R.sup.A is independently selected from
hydrogen, halogen, --CN, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, --OR.sup.A2a, --N(R.sup.A2b).sub.2, and
--SR.sup.A2a, wherein R.sup.A2a is independently selected from
hydrogen, optionally substituted acyl, optionally substituted
alkyl, optionally substituted alkenyl, optionally substituted
alkynyl, optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, optionally substituted
heteroaryl, an oxygen protecting group when attached to an oxygen
atom, and a sulfur protecting group when attached to a sulfur
atom;
[0114] wherein each occurrence of R.sup.A2b is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, and a nitrogen protecting group, or
optionally two instances of R.sup.A2b are taken together with their
intervening atoms to form a substituted or unsubstituted
heterocyclic or substituted or unsubstituted heteroaryl ring;
or
[0115] any two R.sup.A1, any two R.sup.A2, or one R.sup.A1 and one
R.sup.A2 are joined to form an optionally substituted carbocyclic,
optionally substituted heterocyclic, optionally substituted aryl,
or optionally substituted heteroaryl ring;
[0116] each of R.sup.1b is independently selected from hydrogen,
halogen, optionally substituted acyl, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, optionally substituted
heteroaryl, --CN, --OR.sup.B1a, --N(R.sup.B1b).sub.2, and
--SR.sup.B1a, wherein each occurrence of R.sup.B1a is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, an oxygen protecting group when attached to
an oxygen atom, and a sulfur protecting group when attached to a
sulfur atom, wherein each occurrence of R.sup.B1b is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, and a nitrogen protecting group, or
optionally two instances of R.sup.B1b are taken together with their
intervening atoms to form a substituted or unsubstituted
heterocyclic or substituted or unsubstituted heteroaryl ring;
[0117] R.sup.2 is --O--, --S--, --N(R.sup.6)--, or an optionally
substituted C.sub.1-C.sub.4 alkylene, wherein one or more methylene
units of the alkylene are optionally and independently replaced
with --O--, --S--, or --N(R.sup.6)--;
[0118] each instance of R.sup.3, if present, is independently
selected from halogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, --OR.sup.C1, --N(R.sup.C1a).sub.2, and
--SR.sup.C1, wherein each occurrence of R.sup.C1 is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, an oxygen protecting group when attached to
an oxygen atom, and a sulfur protecting group when attached to a
sulfur atom;
[0119] wherein each occurrence of R.sup.C1a is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, and a nitrogen protecting group, or
optionally two instances of R.sup.C1a are taken together with their
intervening atoms to form a substituted or unsubstituted
heterocyclic or substituted or unsubstituted heteroaryl ring;
or
[0120] two R.sup.3 groups bound to the same ring carbon atom are
taken together to form .dbd.O, or
[0121] two R.sup.3 groups bound to the same or different ring
carbon atoms are joined to form an optionally substituted
carbocyclyl, optionally substituted heterocyclyl, optionally
substituted aryl, or optionally substituted heteroaryl ring;
[0122] R.sup.4 is selected from a bond, --C(.dbd.O)--, --O--,
--S--, --N(R.sup.6)--, --S(.dbd.O).sub.2--, and optionally
substituted C.sub.1-C.sub.4 alkylene, wherein:
[0123] one or more methylene units of the alkylene other than a
methylene unit bound to a nitrogen atom is optionally and
independently replaced with --C(.dbd.O), --O--, --S--,
--N(R.sup.6)--, or --S(.dbd.O).sub.2--;
[0124] each R.sup.6 is independently selected from hydrogen and
--C.sub.1-C.sub.6 alkyl;
[0125] R.sup.7 is a warhead of formula:
##STR00010## ##STR00011## ##STR00012## ##STR00013##
##STR00014##
[0126] wherein: [0127] L.sup.3 is a bond or an optionally
substituted C.sub.1-4 hydrocarbon chain, optionally wherein one or
more carbon units of the hydrocarbon chain are independently
replaced with --C.dbd.O--, --O--, --S--, --NR.sup.L3a--,
--NR.sup.L3aC(.dbd.O)--, --C(.dbd.O)NR.sup.L3a--, --SC(.dbd.O)--,
--C(.dbd.O)S--, --OC(.dbd.O)--, --C(.dbd.O)O--,
--NR.sup.L3aC(.dbd.S)--, --C(.dbd.S)NR.sup.L3a--,
trans-CR.sup.L3b.dbd.CR.sup.L3b--, cis-CR.sup.L3b.dbd.CR.sup.L3b--,
--C.ident.C--, --S(.dbd.O)--, --S(.dbd.O)O--, --OS(.dbd.O)--,
--S(.dbd.O)NR.sup.L3a--, --NR.sup.L3aS(.dbd.O)--,
--S(.dbd.O).sub.2--, --S(.dbd.O).sub.2O--, --OS(.dbd.O).sub.2--,
--S(.dbd.O).sub.2NR.sup.L3a--, or --NR.sup.L3aS(.dbd.O).sub.2--,
wherein R.sup.L3a is hydrogen, substituted or unsubstituted
C.sub.1-6 alkyl, or a nitrogen protecting group, and wherein each
occurrence of R.sup.L3b is independently hydrogen, halogen,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
or optionally substituted heteroaryl, or two R.sup.L3b groups are
joined to form an optionally substituted carbocyclic or optionally
substituted heterocyclic ring; [0128] L.sup.4 is a bond or an
optionally substituted, branched or unbranched C.sub.1-6
hydrocarbon chain; [0129] each of R.sup.E1, R.sup.E2, and R.sup.E3
is independently hydrogen, halogen, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, optionally substituted
heteroaryl, --CN, --CH.sub.2OR.sup.EE, --CH.sub.2N(R.sup.EE).sub.2,
--CH.sub.2SR.sup.EE, --OR.sup.EE, --N(R.sup.EE).sub.2,
--Si(R.sup.EE).sub.3, or --SR.sup.EE, wherein each instance of
R.sup.EE is independently hydrogen, optionally substituted alkyl,
optionally substituted alkoxy, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
or optionally substituted heteroaryl, or two R.sup.EE groups are
joined to form an optionally substituted heterocyclic ring; or
R.sup.E1 and R.sup.E3, or R.sup.E2 and R.sup.E3, or R.sup.E1 and
R.sup.E2 are joined to form an optionally substituted carbocyclic
or optionally substituted heterocyclic ring; [0130] R.sup.E4 is a
leaving group; [0131] R.sup.E5 is halogen; [0132] R.sup.E6 is
hydrogen, substituted or unsubstituted C.sub.1-6 alkyl, or a
nitrogen protecting group; [0133] each instance of Y is
independently O, S, or NR.sup.E7, wherein R.sup.E7 is hydrogen,
substituted or unsubstituted C.sub.1-4 alkyl, or a nitrogen
protecting group; [0134] a is 1 or 2; [0135] each instance of z is
independently 0, 1, 2, 3, 4, 5, or 6, as valency permits; [0136]
and
[0137] W is --CR.sup.D1-- or --N.dbd.;
[0138] each instance of R.sup.8, if present, is independently
selected from hydrogen, halogen, optionally substituted acyl,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
optionally substituted heteroaryl, --OR.sup.D1,
--N(R.sup.D1a).sub.2, and --SR.sup.D1, wherein each occurrence of
R.sup.D1 is independently selected from hydrogen, optionally
substituted acyl, optionally substituted alkyl, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, optionally substituted heteroaryl, an
oxygen protecting group when attached to an oxygen atom, and a
sulfur protecting group when attached to a sulfur atom,
[0139] wherein each occurrence of R.sup.D1a is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, and a nitrogen protecting group, or
optionally two instances of R.sup.D1a are taken together with their
intervening atoms to form a substituted or unsubstituted
heterocyclic or substituted or unsubstituted heteroaryl ring;
or
[0140] two R.sup.8 groups are joined to form an optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, or optionally substituted heteroaryl
ring;
[0141] m is 0, 1, 2, 3 or 4; and
n is 0, 1, 2, 3, 4, 5 or 6.
[0142] In certain embodiments, a compound of Formula (I') is of
Formula (I).
[0143] In one aspect of the present invention, provided are
compounds of Formula (I):
##STR00015##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein:
[0144] Ring A is an optionally substituted heteroaryl ring of any
one of the Formulae (ii-1)-(ii-5):
##STR00016##
[0145] or an optionally substituted 6-membered aryl or heteroaryl
ring;
[0146] each instance of V.sup.1, V.sup.2, V.sup.3, V.sup.4,
V.sup.5, V.sup.6, V.sup.7, V.sup.8, V.sup.9, V.sup.10, V.sup.11,
V.sup.12, V.sup.13 and V.sup.14 is independently O, S, N,
N(R.sup.A1), C, or C(R.sup.A2);
[0147] Z is --CH-- or --N--;
[0148] each instance of R.sup.A1 is independently selected from
hydrogen, optionally substituted acyl, optionally substituted
alkyl, optionally substituted alkenyl, optionally substituted
alkynyl, optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, and optionally
substituted heteroaryl;
[0149] each instance of R.sup.A2 is independently selected from
hydrogen, halogen, --CN, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, --OR.sup.A2a, --N(R.sup.A2b).sub.2, and
--SR.sup.A2a, wherein R.sup.A2a is independently selected from
hydrogen, optionally substituted acyl, optionally substituted
alkyl, optionally substituted alkenyl, optionally substituted
alkynyl, optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, and optionally
substituted heteroaryl, an oxygen protecting group when attached to
an oxygen atom, or a sulfur protecting group when attached to a
sulfur atom;
[0150] wherein each occurrence of R.sup.A2b is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, and
optionally substituted heteroaryl, a nitrogen protecting group, or
optionally two instances of R.sup.A2b are taken together with their
intervening atoms to form a substituted or unsubstituted
heterocyclic or substituted or unsubstituted heteroaryl ring;
or
[0151] any two R.sup.A1, any two R.sup.A2, or one R.sup.A1 and one
R.sup.A2 are joined to form an optionally substituted carbocyclic,
optionally substituted heterocyclic, optionally substituted aryl,
or optionally substituted heteroaryl ring;
[0152] each of R.sup.1b is independently selected from hydrogen,
halogen, optionally substituted acyl, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, optionally substituted
heteroaryl, --CN, --OR.sup.B1a, --N(R.sup.B1b).sub.2, and
--SR.sup.B1a, wherein each occurrence of R.sup.B1a is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, and
optionally substituted heteroaryl, an oxygen protecting group when
attached to an oxygen atom, or a sulfur protecting group when
attached to a sulfur atom;
[0153] wherein each occurrence of R.sup.B1b is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, and
optionally substituted heteroaryl, a nitrogen protecting group, or
optionally two instances of R.sup.B1b are taken together with their
intervening atoms to form a substituted or unsubstituted
heterocyclic or substituted or unsubstituted heteroaryl ring;
[0154] R.sup.2 is --O--, --S--, --N(R.sup.6)--, or an optionally
substituted C.sub.1-C.sub.4 alkylene, wherein one or more methylene
units of the alkylene are optionally and independently replaced
with --O--, --S--, or --N(R.sup.6)--;
[0155] each instance of R.sup.3, if present, is independently
selected from halogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, --OR.sup.C1, --N(R.sup.C1a).sub.2, and
--SR.sup.C1, wherein each occurrence of R.sup.C1 is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, and
optionally substituted heteroaryl, an oxygen protecting group when
attached to an oxygen atom, or a sulfur protecting group when
attached to a sulfur atom;
[0156] wherein each occurrence of R.sup.C1a is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, and
optionally substituted heteroaryl, a nitrogen protecting group, or
optionally two instances of R.sup.C1a are taken together with their
intervening atoms to form a substituted or unsubstituted
heterocyclic or substituted or unsubstituted heteroaryl ring;
or
[0157] two R.sup.3 groups bound to the same ring carbon atom are
taken together to form .dbd.O, or
[0158] two R.sup.3 groups bound to the same or different ring
carbon atoms are joined to form an optionally substituted
carbocyclyl, optionally substituted heterocyclyl, optionally
substituted aryl, or optionally substituted heteroaryl ring;
[0159] R.sup.4 is selected from a bond, --C(.dbd.O)--, --O--,
--S--, --N(R.sup.6)--, --S(.dbd.O).sub.2--, or an optionally
substituted C.sub.1-C.sub.4 alkylene, wherein:
[0160] one or more methylene units of the alkylene other than a
methylene unit bound to a nitrogen atom is optionally and
independently replaced with --C(.dbd.O), --O--, --S--,
--N(R.sup.6)--, or --S(.dbd.O).sub.2--;
[0161] each R.sup.6 is independently selected from hydrogen and
--C.sub.1-C.sub.6 alkyl;
[0162] R.sup.7 is a warhead of formula:
##STR00017## ##STR00018## ##STR00019## ##STR00020## ##STR00021##
##STR00022##
[0163] wherein: [0164] L.sup.3 is a bond or an optionally
substituted C.sub.1-4 hydrocarbon chain, optionally wherein one or
more carbon units of the hydrocarbon chain are independently
replaced with --C.dbd.O--, --O--, --S--, --NR.sup.L3a--,
--NR.sup.L3aC(.dbd.O)--, --C(.dbd.O)NR.sup.L3a--, --SC(.dbd.O)--,
--C(.dbd.O)S--, --OC(.dbd.O)--, --C(.dbd.O)O--,
--NR.sup.L3aC(.dbd.S)--, --C(.dbd.S)NR.sup.L3a--,
trans-CR.sup.L3b.dbd.CR.sup.L3b--, cis-CR.sup.L3b.dbd.CR.sup.L3b--,
--C.ident.C--, --S(.dbd.O)--, --S(.dbd.O)O--, --OS(.dbd.O)--,
--S(.dbd.O)NR.sup.L3a--, --NR.sup.L3aS(.dbd.O)--,
--S(.dbd.O).sub.2--, --S(.dbd.O).sub.2O--, --OS(.dbd.O).sub.2--,
--S(.dbd.O).sub.2NR.sup.L3a--, or --NR.sup.L3aS(.dbd.O).sub.2--,
wherein R.sup.L3a is hydrogen, substituted or unsubstituted
C.sub.1-6 alkyl, or a nitrogen protecting group, and wherein each
occurrence of R.sup.L3b is independently hydrogen, halogen,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
or optionally substituted heteroaryl, or two R.sup.L3b groups are
joined to form an optionally substituted carbocyclic or optionally
substituted heterocyclic ring; [0165] L.sup.4 is a bond or an
optionally substituted, branched or unbranched C.sub.1-6
hydrocarbon chain; [0166] each of R.sup.E1, R.sup.E2, and R.sup.E3
is independently hydrogen, halogen, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, optionally substituted
heteroaryl, --CN, --CH.sub.2OR.sup.EE, --CH.sub.2N(R.sup.EE).sub.2,
--CH.sub.2SR.sup.EE, --OR.sup.EE, --N(R.sup.EE).sub.2,
--Si(R.sup.EE).sub.3, or --SR.sup.EE, wherein each instance of
R.sup.EE is independently hydrogen, optionally substituted alkyl,
optionally substituted alkoxy, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
or optionally substituted heteroaryl, or two R.sup.EE groups are
joined to form an optionally substituted heterocyclic ring; or
R.sup.E1 and R.sup.E3, or R.sup.E2 and R.sup.E3, or R.sup.E1 and
R.sup.E2 are joined to form an optionally substituted carbocyclic
or optionally substituted heterocyclic ring; [0167] R.sub.E4 is a
leaving group; [0168] R.sup.E5 is halogen; [0169] R.sup.E6 is
hydrogen, substituted or unsubstituted C.sub.1-6 alkyl, or a
nitrogen protecting group; [0170] each instance of Y is
independently O, S, or NR.sup.E7, wherein R.sup.E7 is hydrogen,
substituted or unsubstituted C.sub.1-6 alkyl, or a nitrogen
protecting group; [0171] a is 1 or 2; [0172] each instance of z is
independently 0, 1, 2, 3, 4, 5, or 6, as valency permits; and
[0173] each instance of R.sup.8, if present, is independently
selected from hydrogen, halogen, optionally substituted acyl,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
optionally substituted heteroaryl, --OR.sup.D1,
--N(R.sup.D1a).sub.2, and --SR.sup.D1, wherein each occurrence of
R.sup.D1 is independently selected from hydrogen, optionally
substituted acyl, optionally substituted alkyl, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, optionally substituted heteroaryl, an
oxygen protecting group when attached to an oxygen atom, and a
sulfur protecting group when attached to a sulfur atom;
[0174] wherein each occurrence of R.sup.D1a is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, and
optionally substituted heteroaryl, a nitrogen protecting group, or
optionally two instances of R.sup.D1a are taken together with their
intervening atoms to form a substituted or unsubstituted
heterocyclic or substituted or unsubstituted heteroaryl ring;
or
[0175] two R.sup.8 groups are joined to form an optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, or optionally substituted heteroaryl
ring;
[0176] m is 0, 1, 2, 3 or 4; and
[0177] n is 0, 1, 2, 3, 4, 5 or 6.
[0178] In certain embodiments, a compound described herein is of
Formula (II):
##STR00023##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, wherein:
[0179] Ring A is an optionally substituted heteroaryl ring of any
one of the Formulae (ii-1)-(ii-5):
##STR00024##
[0180] or an optionally substituted 6-membered aryl or heteroaryl
ring;
[0181] each instance of V.sup.1, V.sup.2, V.sup.3, V.sup.4,
V.sup.5, V.sup.6, V.sup.7, V.sup.8, V.sup.9, V.sup.10, V.sup.11,
V.sup.12, V.sup.13, and V.sup.14 is independently O, S, N,
N(R.sup.A1), C, or C(R.sup.A2);
[0182] each instance of R.sup.A1 is independently selected from
hydrogen, optionally substituted acyl, optionally substituted
alkyl, optionally substituted alkenyl, optionally substituted
alkynyl, optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, and optionally
substituted heteroaryl;
[0183] each instance of R.sup.A2 is independently selected from
hydrogen, halogen, --CN, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, --OR.sup.A2a, --N(R.sup.A2b).sub.2, and
--SR.sup.A2a, wherein R.sup.A2a is independently selected from
hydrogen, optionally substituted acyl, optionally substituted
alkyl, optionally substituted alkenyl, optionally substituted
alkynyl, optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, and optionally
substituted heteroaryl, an oxygen protecting group when attached to
an oxygen atom, or a sulfur protecting group when attached to a
sulfur atom;
[0184] wherein each occurrence of R.sup.A2b is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, and
optionally substituted heteroaryl, a nitrogen protecting group, or
optionally two instances of R.sup.A2b are taken together with their
intervening atoms to form a substituted or unsubstituted
heterocyclic or substituted or unsubstituted heteroaryl ring;
or
[0185] any two R.sup.A1, any two R.sup.A2, or one R.sup.A1 and one
R.sup.A2 are joined to form an optionally substituted carbocyclic,
optionally substituted heterocyclic, optionally substituted aryl,
or optionally substituted heteroaryl ring;
[0186] each of R.sup.1b is independently selected from hydrogen,
halogen, optionally substituted acyl, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, optionally substituted
heteroaryl, --CN, --OR.sup.B1a, --N(R.sup.B1b).sub.2, and
--SR.sup.B1a, wherein each occurrence of R.sup.B1a is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, and
optionally substituted heteroaryl, an oxygen protecting group when
attached to an oxygen atom, or a sulfur protecting group when
attached to a sulfur atom;
[0187] wherein each occurrence of R.sup.B1b is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, and
optionally substituted heteroaryl, a nitrogen protecting group, or
optionally two instances of R.sup.B1b are taken together with their
intervening atoms to form a substituted or unsubstituted
heterocyclic or substituted or unsubstituted heteroaryl ring;
[0188] each instance of R.sup.3, if present, is independently
selected from halogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, optionally
substituted heteroaryl, --OR.sup.C1, --N(R.sup.C1a).sub.2, and
--SR.sup.C1, wherein each occurrence of R.sup.C1 is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, and
optionally substituted heteroaryl, an oxygen protecting group when
attached to an oxygen atom, or a sulfur protecting group when
attached to a sulfur atom;
[0189] wherein each occurrence of R.sup.C1a is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, and
optionally substituted heteroaryl, a nitrogen protecting group, or
optionally two instances of R.sup.C1a are taken together with their
intervening atoms to form a substituted or unsubstituted
heterocyclic or substituted or unsubstituted heteroaryl ring;
or
[0190] two R.sup.3 groups bound to the same ring carbon atom are
taken together to form .dbd.O, or
[0191] two R.sup.3 groups bound to the same or different ring
carbon atoms are joined to form an optionally substituted
carbocyclyl, optionally substituted heterocyclyl, optionally
substituted aryl, or optionally substituted heteroaryl ring;
[0192] each R.sup.6 is independently selected from hydrogen and
--C.sub.1-C.sub.6 alkyl;
[0193] R.sup.7 is a warhead of formula:
##STR00025## ##STR00026## ##STR00027## ##STR00028## ##STR00029##
##STR00030##
wherein
[0194] L.sup.3 is a bond or an optionally substituted C.sub.1-4
hydrocarbon chain, optionally wherein one or more carbon units of
the hydrocarbon chain are independently replaced with --C.dbd.O--,
--O--, --S--, --NR.sup.L3a--, --NR.sup.L3aC(.dbd.O)--,
--C(.dbd.O)NR.sup.L3a--, --SC(.dbd.O)--, --C(.dbd.O)S--,
--OC(.dbd.O)--, --C(.dbd.O)O--, --NR.sup.L3aC(.dbd.S)--,
--C(.dbd.S)NR.sup.L3a--, trans-CR.sup.L3b.dbd.CR.sup.L3b--,
cis-CR.sup.L3b.dbd.CR.sup.L3b--, --C.ident.--, --S(.dbd.O)--,
--S(.dbd.O)O--, --OS(.dbd.O)--, --S(.dbd.O)NR.sup.L3a--,
--NR.sup.L3aS(.dbd.O)--, --S(.dbd.O).sub.2--, --S(.dbd.O).sub.2O--,
--OS(.dbd.O).sub.2--, --S(.dbd.O).sub.2NR.sup.L3a--, or
--NR.sup.L3aS(.dbd.O).sub.2--, wherein R.sup.L3a is hydrogen,
substituted or unsubstituted C.sub.1-6 alkyl, or a nitrogen
protecting group, and wherein each occurrence of R.sup.L3b is
independently hydrogen, halogen, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, or optionally
substituted heteroaryl, or two R.sup.L3b groups are joined to form
an optionally substituted carbocyclic or optionally substituted
heterocyclic ring;
[0195] L.sup.4 is a bond or an optionally substituted, branched or
unbranched C.sub.1-6 hydrocarbon chain;
[0196] each of R.sup.E1, R.sup.E2, and R.sup.E3 is independently
hydrogen, halogen, optionally substituted alkyl, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, optionally substituted heteroaryl,
--CN, --CH.sub.2OR.sup.EE, --CH.sub.2N(R.sup.EE).sub.2,
--CH.sub.2SR.sup.EE, --OR.sup.EE, --N(R.sup.EE).sub.2,
--Si(R.sup.EE).sub.3, or --SR.sup.EE, wherein each instance of
R.sup.EE is independently hydrogen, optionally substituted alkyl,
optionally substituted alkoxy, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
or optionally substituted heteroaryl, or two R.sup.EE groups are
joined to form an optionally substituted heterocyclic ring; or
R.sup.E1 and R.sup.E3, or R.sup.E2 and R.sup.E3, or R.sup.E1 and
R.sup.E2 are joined to form an optionally substituted carbocyclic
or optionally substituted heterocyclic ring;
[0197] R.sup.E4 is a leaving group;
[0198] R.sup.E5 is halogen;
[0199] R.sup.E6 is hydrogen, substituted or unsubstituted C.sub.1-6
alkyl, or a nitrogen protecting group;
[0200] each instance of Y is independently O, S, or NR.sup.E7,
wherein R.sup.E7 is hydrogen, substituted or unsubstituted
C.sub.1-6 alkyl, or a nitrogen protecting group;
[0201] a is 1 or 2;
[0202] each instance of z is independently 0, 1, 2, 3, 4, 5, or 6,
as valency permits; and
[0203] each instance of R.sup.8, if present, is independently
selected from hydrogen, halogen, optionally substituted acyl,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
optionally substituted heteroaryl, --OR.sup.D1,
--N(R.sup.D1a).sub.2, and --SR.sup.D1, wherein each occurrence of
R.sup.D1 is independently selected from hydrogen, optionally
substituted acyl, optionally substituted alkyl, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, and optionally substituted heteroaryl,
an oxygen protecting group when attached to an oxygen atom, or a
sulfur protecting group when attached to a sulfur atom;
[0204] wherein each occurrence of R.sup.D1a is independently
selected from hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, and
optionally substituted heteroaryl, a nitrogen protecting group, or
optionally two instances of R.sup.D1a are taken together with their
intervening atoms to form a substituted or unsubstituted
heterocyclic or substituted or unsubstituted heteroaryl ring;
or
[0205] two R.sup.8 groups are joined to form an optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, or optionally substituted heteroaryl
ring;
[0206] n is 0, 1, 2, 3, 4, 5 or 6; and
[0207] p is 0, 1, 2, 3, 4, or 5.
[0208] As generally defined herein in Formulae (I') and (II), Ring
A is an optionally substituted heteroaryl ring of any one of the
Formulae (ii-1)-(ii-5):
##STR00031##
or an optionally substituted 6-membered aryl or heteroaryl ring;
wherein each instance of V.sup.1, V.sup.2, V.sup.3, V.sup.4,
V.sup.5, V.sup.6, V.sup.7, V.sup.8, V.sup.9, V.sup.10, V.sup.11,
V.sup.12, V.sup.13, and V.sup.14 is independently O, S, N,
N(R.sup.A1), C, or C(R.sup.A2).
[0209] Compounds of Formulae (I') and (II) include Ring A. In
certain embodiments, Ring A is an optionally substituted monocyclic
heteroaryl ring fused with an optionally substituted monocyclic
aryl ring. In certain embodiments, Ring A is an optionally
substituted 6-membered aryl ring. In certain embodiments, Ring A is
an optionally substituted 6-membered heteroaryl ring. In certain
embodiments, Ring A is an optionally substituted bicyclic
heteroaryl ring. In certain embodiments, Ring A is an optionally
substituted monocyclic heteroaryl ring fused with another
optionally substituted monocyclic heteroaryl ring. Ring A may be an
optionally substituted 6,5-membered heteroaryl ring or an
optionally substituted 5,6-membered heteroaryl ring. In certain
embodiments, Ring A is an optionally substituted monocyclic
5-membered heteroaryl ring fused with an optionally substituted
monocyclic 6-membered aryl ring. In certain embodiments, Ring A is
an optionally substituted monocyclic 5-membered heteroaryl ring
fused with an optionally substituted monocyclic 6-membered
heteroaryl ring. The point of attachment of Ring A to Ring B may be
at any atom of Ring A, as valency permits. In certain embodiments,
Ring A is of Formula (ii-1):
##STR00032##
In certain embodiments, Ring A is of Formula (ii-2):
##STR00033##
In certain embodiments, Ring A is of Formula (ii-3):
##STR00034##
In certain embodiments, Ring A is of Formula (ii-4):
##STR00035##
As generally described herein, in Formulae (I') and (II), V.sup.1,
V.sup.2, V.sup.3, V.sup.4, V.sup.5, V.sup.6, V.sup.7, V.sup.8, and
V.sup.9 of Ring A may each independently be O, S, N, NR.sup.A1, C,
or CR.sup.A2, as valency permits. In certain embodiments, V.sup.1
is O, S, N or NR.sup.A1. In certain embodiments, V.sup.1 is N or
NR.sup.A1. In certain embodiments, Ring A is of formula:
##STR00036##
In certain embodiments, Ring A is of formula:
##STR00037##
In certain embodiments, Ring A is of formula:
##STR00038##
In certain embodiments, Ring A is of formula:
##STR00039##
In certain embodiments, Ring A is of formula:
##STR00040##
In certain embodiments, Ring A is of formula:
##STR00041##
In certain embodiments, Ring A is of formula:
##STR00042##
[0210] In certain embodiments, only one of V.sup.1, V.sup.2,
V.sup.3, V.sup.4, V.sup.5, V.sup.6, V.sup.7, V.sup.8, and V.sup.9
is selected from the group consisting of O, S, N, and NR.sup.A1. In
certain embodiments, only one of V.sup.1, V.sup.2, V.sup.3,
V.sup.4, V.sup.5, V.sup.6, V.sup.7, V.sup.8, and V.sup.9 is
selected from the group consisting of N and NR.sup.A1. In certain
embodiments, V.sup.1 is N or NR.sup.A1; V.sup.2, V.sup.3, V.sup.4,
V.sup.5, V.sup.6, V.sup.7, V.sup.8, and V.sup.9 are each
independently C or CR.sup.A2; and therefore, Ring A is an
optionally substituted indole ring. In certain embodiments, Ring A
is of Formula (iii-1):
##STR00043##
In certain embodiments, Ring A is of Formula (iii-2):
##STR00044##
In certain embodiments, Ring A is of Formula (iii-3):
##STR00045##
In certain embodiments, Ring A is of formula:
##STR00046##
In certain embodiments, Ring A is of formula:
##STR00047##
In certain embodiments, Ring A is of formula:
##STR00048##
In certain embodiments, Ring A is of formula:
##STR00049##
In certain embodiments, Ring A is of formula:
##STR00050##
[0211] In certain embodiments, Ring A is of Formula (iii-4):
##STR00051##
In certain embodiments, Ring A is of Formula (iii-5):
##STR00052##
In certain embodiments, Ring A is of Formula (iii-6):
##STR00053##
In certain embodiments, Ring A is of Formula (iii-7):
##STR00054##
[0212] In certain embodiments, only two of V.sup.1, V.sup.2,
V.sup.3, V.sup.4, V.sup.5, V.sup.6, V.sup.7, V.sup.8, and V.sup.9
are each independently selected from the group consisting of O, S,
N, and NR.sup.A1. In certain embodiments, only two of V.sup.1,
V.sup.2, V.sup.3, V.sup.4, V.sup.5, V.sup.6, V.sup.7, V.sup.8, and
V.sup.9 are each independently selected from the group consisting
of N and NR.sup.A1. In certain embodiments, V is N or NR.sup.A1;
and only one of V.sup.2, V.sup.3, V.sup.4, V.sup.5, V.sup.6,
V.sup.7, V.sup.8, and V.sup.9 is N or NR.sup.A1. In certain
embodiments, V.sup.1 and V.sup.2 are each independently N or
NR.sup.A1; V.sup.3, V.sup.4, V.sup.5, V.sup.6, V.sup.7, V.sup.8,
and V.sup.9 are each independently C or CR.sup.A2; and therefore,
Ring A is an optionally substituted indazole ring. In certain
embodiments, Ring A is of formula:
##STR00055##
In certain embodiments, Ring A is of formula:
##STR00056##
In certain embodiments, Ring A is of formula:
##STR00057##
In certain embodiments, Ring A is of formula:
##STR00058##
In certain embodiments, Ring A is of formula:
##STR00059##
In certain embodiments, Ring A is of formula:
##STR00060##
[0213] In certain embodiments, V.sup.1 and V.sup.3 are each
independently N or NR.sup.A1; V.sup.2, V.sup.4, V.sup.5, V.sup.6,
V.sup.7, V.sup.8, and V.sup.9 are each independently C or
CR.sup.A2; and therefore, Ring A is an optionally substituted
benzimidazole ring. In certain embodiments, Ring A is of Formula
(iv-1):
##STR00061##
In certain embodiments, Ring A is of Formula (iv-2):
##STR00062##
In certain embodiments, Ring A is of Formula (iv-3):
##STR00063##
In certain embodiments, Ring A is of Formula (iv-4):
##STR00064##
In certain embodiments, Ring A is of Formula (iv-5):
##STR00065##
In certain embodiments, Ring A is of Formula (iv-6):
##STR00066##
[0214] In certain embodiments, V.sup.1 and V.sup.4 are each
independently N or NR.sup.A1; V.sup.2, V.sup.3, V.sup.5, V.sup.6,
V.sup.7, V.sup.8, and V.sup.9 are each independently C or
CR.sup.A2; and therefore, Ring A is an optionally substituted
4-azaindazole ring. In certain embodiments, Ring A is of
formula:
##STR00067##
In certain embodiments, Ring A is of formula:
##STR00068##
In certain embodiments, Ring A is of formula:
##STR00069##
In certain embodiments, Ring A is of formula:
##STR00070##
In certain embodiments, Ring A is of formula:
##STR00071##
In certain embodiments, Ring A is of formula:
##STR00072##
[0215] In certain embodiments, V.sup.1 and V.sup.5 are each
independently N or NR.sup.A1; V.sup.2, V.sup.3, V.sup.4, V.sup.6,
V.sup.7, V.sup.8, and V.sup.9 are each independently C or
CR.sup.A2; and therefore, Ring A is an optionally substituted
5-azaindazole ring. In certain embodiments, Ring A is of
formula:
##STR00073##
In certain embodiments, Ring A is of formula:
##STR00074##
In certain embodiments, Ring A is of formula:
##STR00075##
In certain embodiments, Ring A is of formula:
##STR00076##
In certain embodiments, Ring A is of formula:
##STR00077##
In certain embodiments, Ring A is of formula:
##STR00078##
[0216] In certain embodiments, V.sup.1 and V.sup.6 are each
independently N or NR.sup.A1; V.sup.2, V.sup.3, V.sup.4, V.sup.5,
V.sup.7, V.sup.8, and V.sup.9 are each independently C or
CR.sup.A2; and therefore, Ring A is an optionally substituted
6-azaindole ring. In certain embodiments, Ring A is of formula:
##STR00079##
In certain embodiments, Ring A is of formula:
##STR00080##
In certain embodiments, Ring A is of formula:
##STR00081##
In certain embodiments, Ring A is of formula:
##STR00082##
In certain embodiments, Ring A is of formula:
##STR00083##
In certain embodiments, Ring A is of formula:
##STR00084##
[0217] In certain embodiments, V.sup.1 and V.sup.7 are each
independently N or NR.sup.A1; V.sup.2, V.sup.3, V.sup.4, V.sup.5,
V.sup.6, V.sup.8, and V.sup.9 are each independently C or
CR.sup.A2; and therefore, Ring A is an optionally substituted
7-azaindole ring. In certain embodiments, Ring A is of Formula
(v-1):
##STR00085##
In certain embodiments, Ring A is of Formula (v-2):
##STR00086##
In certain embodiments, Ring A is of Formula (v-3):
##STR00087##
In certain embodiments, Ring A is of Formula (v-4):
##STR00088##
In certain embodiments, Ring A is of Formula (v-5):
##STR00089##
In certain embodiments, Ring A is of Formula (v-6):
##STR00090##
[0218] In certain embodiments, V.sup.1 and V.sup.8 are each
independently N or NR.sup.A1, V.sup.2, V.sup.3, V.sup.4, V.sup.5,
V.sup.6, V.sup.7, and V.sup.9 are each independently C or
CR.sup.A2; and therefore, Ring A is an optionally substituted
8-azaindole ring. In certain embodiments, Ring A is of Formula
(vi-1):
##STR00091##
In certain embodiments, Ring A is of Formula (vi-2):
##STR00092##
In certain embodiments, Ring A is of Formula (vi-3):
##STR00093##
In certain embodiments, Ring A is of Formula (vi-4):
##STR00094##
In certain embodiments, Ring A is of Formula (vi-5):
##STR00095##
In certain embodiments, Ring A is of Formula (vi-6):
##STR00096##
[0219] In certain embodiments, V.sup.1 and V.sup.9 are each
independently N or NR.sup.A1; V.sup.2, V.sup.3, V.sup.4, V.sup.5,
V.sup.6, V.sup.7, and V.sup.8 are each independently C or
CR.sup.A2; and therefore, Ring A is an optionally substituted
9-azaindole ring. In certain embodiments, Ring A is of formula:
##STR00097##
In certain embodiments, Ring A is of formula:
##STR00098##
In certain embodiments, Ring A is of formula:
##STR00099##
In certain embodiments, Ring A is of formula:
##STR00100##
In certain embodiments, Ring A is of formula:
##STR00101##
In certain embodiments, Ring A is of formula:
##STR00102##
[0220] In certain embodiments, only three of V.sup.1, V.sup.2,
V.sup.3, V.sup.4, V.sup.5, V.sup.6, V.sup.7, V.sup.8, and V.sup.9
are each independently selected from the group consisting of O, S,
N, and NR.sup.A1. In certain embodiments, only three of V.sup.1,
V.sup.2, V.sup.3, V.sup.4, V.sup.5, V.sup.6, V.sup.7, V.sup.8, and
V.sup.9 are each independently selected from the group consisting
of N and NR.sup.A1. In certain embodiments, V.sup.1 is N or
NR.sup.A1; and only two of V.sup.2, V.sup.3, V.sup.4, V.sup.5,
V.sup.6, V.sup.7, V.sup.8, and V.sup.9 are each independently N or
NR.sup.A1.
[0221] As generally described herein, in Formulae (I') and (II),
Ring A may also be an optionally substituted 5-membered heteroaryl
ring. In certain embodiments, Ring A is of Formula (ii-5):
##STR00103##
[0222] As generally described herein, in Formulae (I') and (II),
V.sup.10, V.sup.11, V.sup.12, V.sup.13, and V.sup.14 of Ring A may
each independently be O, S, N, NR.sup.A1, C, or CR.sup.A2, as
valency permits. In certain embodiments, only one of V.sup.10,
V.sup.11, V.sup.12, V.sup.13, and V.sup.14 is selected from the
group consisting of O, S, N, and NR.sup.A1. In certain embodiments,
Ring A is of formula:
##STR00104##
[0223] In certain embodiments, Ring A is of formula:
##STR00105##
[0224] In certain embodiments, Ring A is of formula:
##STR00106##
[0225] In certain embodiments, only two of V.sup.10, V.sup.11,
V.sup.12, V.sup.13, and V.sup.14 are independently selected from
the group consisting of O, S, N, and NR.sup.A. In certain
embodiments, Ring A is of formula:
##STR00107##
[0226] In certain embodiments, Ring A is of formula:
##STR00108##
[0227] In certain embodiments, Ring A is of formula:
##STR00109##
[0228] In certain embodiments, Ring A is of Formula (vii):
##STR00110##
[0229] In certain embodiments, Ring A is of formula:
##STR00111##
In certain embodiments, Ring A is of formula:
##STR00112##
In certain embodiments, Ring A is of formula:
##STR00113##
[0230] In certain embodiments, only three of V.sup.10, V.sup.11,
V.sup.12, V.sup.13, and V.sup.14 are each independently selected
from the group consisting of O, S, N, and NR.sup.A1. In certain
embodiments, Ring A is of formula:
##STR00114##
[0231] In certain embodiments, Ring A is of formula:
##STR00115##
[0232] In certain embodiments, Ring A is of formula:
##STR00116##
[0233] In certain embodiments, only four of V.sup.10, V.sup.11,
V.sup.12, V.sup.13 and V.sup.14 are each independently selected
from the group consisting of N and NR.sup.A1. In certain
embodiments, Ring A is of formula:
##STR00117##
[0234] In certain embodiments, Ring A is an optionally substituted
6-membered aryl ring. In certain embodiments, Ring A is optionally
substituted phenyl. In certain embodiments, Ring A is an optionally
substituted 6-membered heteroaryl ring. In certain embodiments,
Ring A is of Formula (ii-6):
##STR00118##
In certain embodiments, V.sup.10, V.sup.11, V.sup.12, V.sup.13,
V.sup.14, and V.sup.15 of Ring A may each independently be N, C, or
CR.sup.A2, as valency permits. In certain embodiments, only one of
V.sup.10, V.sup.11, V.sup.12, V.sup.13, V.sup.14, and V.sup.15 is
N. In certain embodiments, Ring A is of formula:
##STR00119##
In certain embodiments, only two of V.sup.10, V.sup.11, V.sup.12,
V.sup.13, V.sup.14, and V.sup.15 are N. In certain embodiments,
Ring A is of formula:
##STR00120##
In certain embodiments, only three of V.sup.10, V.sup.11, V.sup.12,
V.sup.13, V.sup.14, and V.sup.15 are N. In certain embodiments,
Ring A is of formula:
##STR00121##
[0235] In certain embodiments, Ring A is of Formula (ii-1), (ii-5),
or (ii-6). In certain embodiments, Ring A is of formula:
##STR00122##
[0236] As generally described herein, in Formulae (I') and (II),
Ring A may be substituted with one or more R.sup.A1 groups when the
R.sup.A1 group is attached to a nitrogen atom. In certain
embodiments, at least one instance of R.sup.A1 is H (hydrogen). In
certain embodiments, at least one instance of R.sup.A1 is halogen.
In certain embodiments, at least one instance of R.sup.A1 is F
(fluorine). In certain embodiments, at least one instance of
R.sup.A1 is Cl (chlorine). In certain embodiments, at least one
instance of R.sup.A1 is Br (bromine). In certain embodiments, at
least one instance of R.sup.A1 is I (iodine). In certain
embodiments, at least one instance of R.sup.A1 is substituted acyl.
In certain embodiments, at least one instance of R.sup.A1 is
unsubstituted acyl. In certain embodiments, at least one instance
of R.sup.A1 is acetyl. In certain embodiments, at least one
instance of R.sup.A1 is substituted acetyl. In certain embodiments,
at least one instance of R.sup.A1 is substituted alkyl. In certain
embodiments, at least one instance of R.sup.A1 is unsubstituted
alkyl. In certain embodiments, at least one instance of R.sup.A1 is
C.sub.1-6 alkyl. In certain embodiments, at least one instance of
R.sup.A1 is methyl. In certain embodiments, at least one instance
of R.sup.A1 is ethyl. In certain embodiments, at least one instance
of R.sup.A1 is propyl. In certain embodiments, at least one
instance of R.sup.A1 is butyl. In certain embodiments, at least one
instance of R.sup.A1 is substituted alkenyl. In certain
embodiments, at least one instance of R.sup.A1 is unsubstituted
alkenyl. In certain embodiments, at least one instance of R.sup.A1
is vinyl. In certain embodiments, at least one instance of R.sup.A1
is substituted alkynyl. In certain embodiments, at least one
instance of R.sup.A1 is unsubstituted alkynyl. In certain
embodiments, at least one instance of R.sup.A1 is ethynyl. In
certain embodiments, at least one instance of R.sup.A1 is
substituted carbocyclyl. In certain embodiments, at least one
instance of R.sup.A1 is unsubstituted carbocyclyl. In certain
embodiments, at least one instance of R.sup.A1 is substituted
heterocyclyl. In certain embodiments, at least one instance of
R.sup.A1 is unsubstituted heterocyclyl. In certain embodiments, at
least one instance of R.sup.A1 is substituted aryl. In certain
embodiments, at least one instance of R.sup.A1 is unsubstituted
aryl. In certain embodiments, at least one instance of R.sup.A1 is
substituted phenyl. In certain embodiments, at least one instance
of R.sup.A1 is unsubstituted phenyl. In certain embodiments, at
least one instance of R.sup.A1 is substituted heteroaryl. In
certain embodiments, at least one instance of R.sup.A1 is
unsubstituted heteroaryl. In certain embodiments, at least one
instance of R.sup.A1 is substituted pyridyl. In certain
embodiments, at least one instance of R.sup.A1 is unsubstituted
pyridyl. In certain embodiments, at least one instance of R.sup.A1
is a nitrogen protecting group (e.g., Bn, BOC, Cbz, Fmoc,
trifluoroacetyl, triphenylmethyl, acetyl, or Ts).
[0237] In certain embodiments, at least one R.sup.A1 is hydrogen,
C.sub.1-6 alkyl, or a nitrogen protecting group. In certain
embodiments, all instances of R.sup.A1 are each independently
hydrogen, C.sub.1-6 alkyl, or a nitrogen protecting group. In
certain embodiments, all instances of R.sup.A1 are hydrogen.
[0238] In Formulae (I') and (II), Ring A may be substituted with
one or more R.sup.A2 groups when the R.sup.A group is attached to a
carbon atom. In certain embodiments, at least one R.sup.A2 is H. In
certain embodiments, at least one R.sup.A is halogen. In certain
embodiments, at least one R.sup.A2 is F. In certain embodiments, at
least one R.sup.A2 is Cl. In certain embodiments, at least one
R.sup.A2 is Br. In certain embodiments, at least one R.sup.A2 is I
(iodine). In certain embodiments, at least one R.sup.A2 is
substituted acyl. In certain embodiments, at least one R.sup.A2 is
unsubstituted acyl. In certain embodiments, at least one R.sup.A2
is acetyl. In certain embodiments, at least one R.sup.A2 is
substituted acetyl. In certain embodiments, at least one R.sup.A2
is substituted alkyl. In certain embodiments, at least one R.sup.A2
is unsubstituted alkyl. In certain embodiments, at least one
R.sup.A2 is C.sub.1-6 alkyl. In certain embodiments, at least one
R.sup.A2 is methyl. In certain embodiments, at least one R.sup.A2
is ethyl. In certain embodiments, at least one R.sup.A2 is propyl.
In certain embodiments, at least one R.sup.A2 is butyl. In certain
embodiments, at least one R.sup.A2 is substituted alkenyl. In
certain embodiments, at least one R.sup.A2 is unsubstituted
alkenyl. In certain embodiments, at least one R.sup.A2 is vinyl. In
certain embodiments, at least one R.sup.A2 is substituted alkynyl.
In certain embodiments, at least one R.sup.A2 is unsubstituted
alkynyl. In certain embodiments, at least one R.sup.A2 is ethynyl.
In certain embodiments, at least one R.sup.A2 is substituted
carbocyclyl. In certain embodiments, at least one R.sup.A2 is
unsubstituted carbocyclyl. In certain embodiments, at least one
R.sup.A2 is substituted heterocyclyl. In certain embodiments, at
least one R.sup.A2 is unsubstituted heterocyclyl. In certain
embodiments, at least one R.sup.A2 is substituted aryl. In certain
embodiments, at least one R.sup.A2 is unsubstituted aryl. In
certain embodiments, at least one R.sup.A2 is substituted phenyl.
In certain embodiments, at least one R.sup.2A is unsubstituted
phenyl. In certain embodiments, at least one R.sup.A2 is
substituted heteroaryl. In certain embodiments, at least one
R.sup.A2 is unsubstituted heteroaryl. In certain embodiments, at
least one R.sup.A2 is substituted pyridyl. In certain embodiments,
at least one R.sup.A2 is unsubstituted pyridyl. In certain
embodiments, at least one R.sup.A2 is --CN. In certain embodiments,
at least one R.sup.A2 is --OR.sup.A2a. In certain embodiments, at
least one R.sup.A2 is --N(R.sup.A2b).sub.2. In certain embodiments,
at least one R.sup.A2 is --SR.sup.A2a.
[0239] In certain embodiments, two R.sup.A2 groups are each
independently halogen, optionally substituted alkyl, or optionally
substituted aryl; and all other instances of R.sup.A2 are hydrogen.
In certain embodiments, two R.sup.A2 groups are each independently
halogen or optionally substituted alkyl; and all other instances of
R.sup.A2 are hydrogen. In certain embodiments, two R.sup.A2 groups
are halogen; and all other instances of R.sup.A2 are hydrogen. In
certain embodiments, two R.sup.A2 groups are optionally substituted
alkyl; and all other instances of R.sup.A2 are hydrogen. In certain
embodiments, two R.sup.A2 groups are C.sub.1-6 alkyl; and all other
instances of R.sup.A2 are hydrogen. In certain embodiments, two
R.sup.A2 groups are methyl; and all other instances of R.sup.A2 are
hydrogen. In certain embodiments, two R.sup.A2 groups are ethyl;
and all other instances of R.sup.A2 are hydrogen. In certain
embodiments, two R.sup.A2 groups are propyl; and all other
instances of R.sup.A2 are hydrogen. In certain embodiments, two
R.sup.A2 groups are butyl; and all other instances of R.sup.A2 are
hydrogen. In certain embodiments, two R.sup.A2 groups are
optionally substituted aryl; and all other instances of R.sup.A2
are hydrogen. In certain embodiments, two R.sup.A2 groups are
optionally substituted phenyl; and all other instances of R.sup.A2
are hydrogen.
[0240] In certain embodiments, one R.sup.A2 groups is halogen,
optionally substituted alkyl, or optionally substituted aryl; and
all other instances of R.sup.A2 are hydrogen. In certain
embodiments, one R.sup.A2 is halogen or optionally substituted
alkyl; and all other instances of R.sup.A2 are hydrogen. In certain
embodiments, one R.sup.A2 is halogen; and all other instances of
R.sup.A2 are hydrogen. In certain embodiments, one R.sup.A2 is
optionally substituted alkyl; and all other instances of R.sup.A2
are hydrogen. In certain embodiments, one R.sup.A2 is C.sub.1-6
alkyl; and all other instances of R.sup.A2 are hydrogen. In certain
embodiments, one R.sup.A2 is methyl; and all other instances of
R.sup.A2 are hydrogen. In certain embodiments, one R.sup.A2 is
ethyl; and all other instances of R.sup.A2 are hydrogen. In certain
embodiments, one R.sup.A2 is propyl; and all other instances of
R.sup.A2 are hydrogen. In certain embodiments, one R.sup.A2 is
butyl; and all other instances of R.sup.A2 are hydrogen. In certain
embodiments, one R.sup.A2 is optionally substituted aryl; and all
other instances of R.sup.A2 are hydrogen. In certain embodiments,
one R.sup.A2 is optionally substituted phenyl; and all other
instances of R.sup.A2 are hydrogen. In certain embodiments, all
instances of R.sup.A2 are hydrogen.
[0241] In certain embodiments, when R.sup.A2 is --OR.sup.A2a or
--SR.sup.A2a, R.sup.A2a is H. In certain embodiments, R.sup.A2a is
halogen. In certain embodiments, R.sup.A2a is F. In certain
embodiments, R.sup.A2a is Cl. In certain embodiments, R.sup.A2a is
Br. In certain embodiments, R.sup.A2a is I (iodine). In certain
embodiments, R.sup.A2a is substituted acyl. In certain embodiments,
R.sup.A2a is unsubstituted acyl. In certain embodiments, R.sup.A2a
is acetyl. In certain embodiments, R.sup.A2a is substituted acetyl.
In certain embodiments, R.sup.A2a is substituted alkyl. In certain
embodiments, R.sup.A2a is unsubstituted alkyl. In certain
embodiments, R.sup.A2a is C.sub.1-6 alkyl. In certain embodiments,
R.sup.A2a is methyl. In certain embodiments, R.sup.A2a is ethyl. In
certain embodiments, R.sup.A2a is propyl. In certain embodiments,
R.sup.A2a is butyl. In certain embodiments, R.sup.A2a is
substituted alkenyl. In certain embodiments, R.sup.A2a is
unsubstituted alkenyl. In certain embodiments, R.sup.A2a is vinyl.
In certain embodiments, R.sup.A2a is substituted alkynyl. In
certain embodiments, R.sup.A2a is unsubstituted alkynyl. In certain
embodiments, R.sup.A2a is ethynyl. In certain embodiments,
R.sup.A2a is substituted carbocyclyl. In certain embodiments,
R.sup.A2a is unsubstituted carbocyclyl. In certain embodiments,
R.sup.A2a is substituted heterocyclyl. In certain embodiments,
R.sup.A2a is unsubstituted heterocyclyl. In certain embodiments,
R.sup.A2a is substituted aryl. In certain embodiments, R.sup.A2a is
unsubstituted aryl. In certain embodiments, R.sup.A2a is
substituted phenyl. In certain embodiments, R.sup.A2a is
unsubstituted phenyl. In certain embodiments, R.sup.A2a is
substituted heteroaryl. In certain embodiments, R.sup.A2a is
unsubstituted heteroaryl. In certain embodiments, R.sup.A2a is
substituted pyridyl. In certain embodiments, R.sup.A2a is
unsubstituted pyridyl. In certain embodiments, R.sup.A2a is an
oxygen protecting group when attached to an oxygen atom (e.g.,
silyl, TBDPS, TBDMS, TIPS, TES, TMS, MOM, THP, t-Bu, Bn, allyl,
acetyl, pivaloyl, or benzoyl). In certain embodiments, R.sup.A2a is
a sulfur protecting group when attached to a sulfur atom. In
certain embodiments, R.sup.A2a is acetamidomethyl, t-Bu,
3-nitro-2-pyridine sulfenyl, 2-pyridine-sulfenyl, or
triphenylmethyl when attached to a sulfur atom.
[0242] In certain embodiments, when R.sup.A2 is
--N(R.sup.A2).sub.2, at least one R.sup.A2b is H. In certain
embodiments, at least one R.sup.A2b is halogen. In certain
embodiments, at least one R.sup.A2b is F. In certain embodiments,
at least one R.sup.A2b is Cl. In certain embodiments, at least one
R.sup.A2b is Br. In certain embodiments, at least one R.sup.A2b is
I (iodine). In certain embodiments, at least one R.sup.A2b is
substituted acyl. In certain embodiments, at least one R.sup.A2b is
unsubstituted acyl. In certain embodiments, at least one R.sup.A2b
is acetyl. In certain embodiments, at least one R.sup.A2b is
substituted acetyl. In certain embodiments, at least one R.sup.A2b
is substituted alkyl. In certain embodiments, at least one
R.sup.A2b is unsubstituted alkyl. In certain embodiments, at least
one R.sup.A2b is C.sub.1-6 alkyl. In certain embodiments, at least
one R.sup.A2b is methyl. In certain embodiments, at least one
R.sup.A2b is ethyl. In certain embodiments, at least one R.sup.A2b
is propyl. In certain embodiments, at least one R.sup.A2b is butyl.
In certain embodiments, at least one R.sup.A2b is substituted
alkenyl. In certain embodiments, at least one R.sup.A2b is
unsubstituted alkenyl. In certain embodiments, at least one
R.sup.A2b is vinyl. In certain embodiments, at least one R.sup.A2b
is substituted alkynyl. In certain embodiments, at least one
R.sup.A2b is unsubstituted alkynyl. In certain embodiments, at
least one R.sup.A2b is ethynyl. In certain embodiments, at least
one R.sup.A2b is substituted carbocyclyl. In certain embodiments,
at least one R.sup.A2b is unsubstituted carbocyclyl. In certain
embodiments, at least one R.sup.A2b is substituted heterocyclyl. In
certain embodiments, at least one R.sup.A2b is unsubstituted
heterocyclyl. In certain embodiments, at least one R.sup.A2b is
substituted aryl. In certain embodiments, at least one R.sup.A2b is
unsubstituted aryl. In certain embodiments, at least one R.sup.A2b
is substituted phenyl. In certain embodiments, at least one
R.sup.A2b is unsubstituted phenyl. In certain embodiments, at least
one R.sup.A2b is substituted heteroaryl. In certain embodiments, at
least one R.sup.A2b is unsubstituted heteroaryl. In certain
embodiments, at least one R.sup.A2b is substituted pyridyl. In
certain embodiments, at least one R.sup.A2b is unsubstituted
pyridyl. In certain embodiments, at least one R.sup.A2b is a
nitrogen protecting group when attached to a nitrogen atom. In
certain embodiments, at least one R.sup.A2b is Bn, BOC, Cbz, Fmoc,
trifluoroacetyl, triphenylmethyl, acetyl, or Ts when attached to a
nitrogen atom. In certain embodiments, two R.sup.A2b groups are
joined to form a substituted heterocyclic ring. In certain
embodiments, two R.sup.A2b groups are joined to form an
unsubstituted heterocyclic ring.
[0243] In Formulae (I') and (II), any two instances of R.sup.A1,
any two instances of R.sup.A2, or one instance of R.sup.A1 and one
instance of R.sup.A2 may be joined to form an optionally
substituted carbocyclic, optionally substituted heterocyclic,
optionally substituted aryl, or optionally substituted heteroaryl
ring. In certain embodiments, two instances of R.sup.A1 are joined
to form a substituted or unsubstituted carbocyclic ring. In certain
embodiments, two instances of R are joined to form a substituted or
unsubstituted heterocyclic ring. In certain embodiments, two
instances of R.sup.A1 are joined to form a substituted or
unsubstituted aryl ring. In certain embodiments, two instances of
R.sup.A1 are joined to form a substituted or unsubstituted
heteroaryl ring. In certain embodiments, two instances of R.sup.A2
are joined to form a substituted or unsubstituted carbocyclic ring.
In certain embodiments, two instances of R.sup.A2 are joined to
form a substituted or unsubstituted heterocyclic ring. In certain
embodiments, two instances of R.sup.A2 are joined to form a
substituted or unsubstituted aryl ring. In certain embodiments, two
instances of R.sup.A2 are joined to form a substituted or
unsubstituted heteroaryl ring. In certain embodiments, one instance
of R.sup.A1 and one instance of R.sup.A2 are joined to form a
substituted carbocyclic ring. In certain embodiments, one instance
of R.sup.A1 and one instance of R.sup.A2 are joined to form an
unsubstituted carbocyclic ring. In certain embodiments, one
instance of R and one instance of R.sup.A2 are joined to form a
substituted heterocyclic ring. In certain embodiments, one instance
of R.sup.A1 and one instance of R.sup.A2 are joined to form an
unsubstituted heterocyclic ring. In certain embodiments, one
instance of R.sup.A1 and one instance of R.sup.A2 are joined to
form a substituted aryl ring. In certain embodiments, one instance
of R.sup.A1 and one instance of R.sup.A2 are joined to form an
unsubstituted aryl ring. In certain embodiments, one instance of
R.sup.A1 and one instance of R.sup.A2 are joined to form a
substituted heteroaryl ring. In certain embodiments, one instance
of R.sup.A1 and one instance of R.sup.A2 are joined to form an
unsubstituted heteroaryl ring.
[0244] As generally defined herein, Formulae (I') and (II) include
substituent R.sup.1b. In certain embodiments, R.sup.1b is H. In
certain embodiments, R.sup.1b is halogen. In certain embodiments,
R.sup.1b is F. In certain embodiments, R.sup.1b is Cl. In certain
embodiments, R.sup.1b is Br. In certain embodiments, R.sup.1b is I
(iodine). In certain embodiments, R.sup.1b is substituted acyl. In
certain embodiments, R.sup.1b is unsubstituted acyl. In certain
embodiments, R.sup.1b is acetyl. In certain embodiments, R.sup.1b
is substituted acetyl. In certain embodiments, R.sup.1b is
substituted alkyl. In certain embodiments, R.sup.1b is
unsubstituted alkyl. In certain embodiments, R.sup.1b is C.sub.1-6
alkyl. In certain embodiments, R.sup.1b is methyl. In certain
embodiments, R.sup.1b is ethyl. In certain embodiments, R.sup.1b is
propyl. In certain embodiments, R.sup.1b is butyl. In certain
embodiments, R.sup.1b is substituted alkenyl. In certain
embodiments, R.sup.1b is unsubstituted alkenyl. In certain
embodiments, R.sup.1b is vinyl. In certain embodiments, R.sup.1b is
substituted alkynyl. In certain embodiments, R.sup.1b is
unsubstituted alkynyl. In certain embodiments, R.sup.1b is ethynyl.
In certain embodiments, R.sup.1b is substituted carbocyclyl. In
certain embodiments, R.sup.1b is unsubstituted carbocyclyl. In
certain embodiments, R.sup.1b is substituted aryl. In certain
embodiments, R.sup.1b is unsubstituted aryl. In certain
embodiments, R.sup.1b is substituted phenyl. In certain
embodiments, R.sup.1b is unsubstituted phenyl. In certain
embodiments, R.sup.1b is substituted heteroaryl. In certain
embodiments, R.sup.1b is unsubstituted heteroaryl. In certain
embodiments, R.sup.1b is substituted pyridyl. In certain
embodiments, R.sup.1b is unsubstituted pyridyl. In certain
embodiments, R.sup.1b is --CN. In certain embodiments, R.sup.1b is
--OR.sup.B1a. In certain embodiments, R.sup.1b is
--N(R.sup.B1b).sub.2 (e.g., --NMe.sub.2). In certain embodiments,
R.sup.1b is --SR.sup.B1a. In certain embodiments, R.sup.1b is
hydrogen, halogen, substituted or unsubstituted C.sub.1-6 alkyl,
--CN, --OR.sup.B1a, or --N(R.sup.B1b).sub.2. In certain
embodiments, R.sup.1b is hydrogen, halogen, --CN, --OR.sup.B1a,
--N(R.sup.B1b).sub.2, unsubstituted C.sub.1-6 alkyl, or C.sub.1-6
alkyl substituted with one or more halogen, wherein each instance
of R.sup.B1a is independently hydrogen, unsubstituted C.sub.1-6
alkyl, or C.sub.1-6 alkyl substituted with one or more halogen; and
each occurrence of R.sup.B1b is independently selected from
hydrogen, optionally substituted acyl, optionally substituted
alkyl, optionally substituted alkenyl, optionally substituted
alkynyl, optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, and optionally
substituted heteroaryl, a nitrogen protecting group.
[0245] In certain embodiments, when R.sup.B1b is --OR.sup.B1a or
--SR.sup.B1a, R.sup.B1a is H. In certain embodiments, R.sup.B1a is
substituted acyl. In certain embodiments, R.sup.R1a is
unsubstituted acyl. In certain embodiments, R.sup.R1a is acetyl. In
certain embodiments, R.sup.R1a is substituted acetyl. In certain
embodiments, R.sup.R1a is substituted alkyl. In certain
embodiments, R.sup.B1a is unsubstituted alkyl. In certain
embodiments, R.sup.R1a is C.sub.1-6 alkyl. In certain embodiments,
R.sup.R1a is methyl. In certain embodiments, R.sup.R1a is ethyl. In
certain embodiments, R.sup.R1a is propyl. In certain embodiments,
R.sup.B1a is butyl. In certain embodiments, R.sup.R1a is
substituted alkenyl. In certain embodiments, R.sup.R1a is
unsubstituted alkenyl. In certain embodiments, R.sup.R1a is vinyl.
In certain embodiments, R.sup.R1a is substituted alkynyl. In
certain embodiments, R.sup.B1a is unsubstituted alkynyl. In certain
embodiments, R.sup.R1a is ethynyl. In certain embodiments,
R.sup.B1a is substituted carbocyclyl. In certain embodiments,
R.sup.R1a is unsubstituted carbocyclyl. In certain embodiments,
R.sup.R1a is substituted heterocyclyl. In certain embodiments,
R.sup.B1a is unsubstituted heterocyclyl. In certain embodiments,
R.sup.R1a is substituted aryl. In certain embodiments, R.sup.B1a is
unsubstituted aryl. In certain embodiments, R.sup.R1a is
substituted phenyl. In certain embodiments, R.sup.R1a is
unsubstituted phenyl. In certain embodiments, R.sup.R1a is
substituted or unsubstituted heteroaryl. In certain embodiments,
R.sup.R1a is substituted or unsubstituted pyridyl. In certain
embodiments, R.sup.R1a is an oxygen protecting group when attached
to an oxygen atom. In certain embodiments, R.sup.R1a is silyl,
TBDPS, TBDMS, TIPS, TES, TMS, MOM, THP, t-Bu, Bn, allyl, acetyl,
pivaloyl, or benzoyl when attached to an oxygen atom. In certain
embodiments, R.sup.R1a is a sulfur protecting group when attached
to a sulfur atom. In certain embodiments, R.sup.R1a is
acetamidomethyl, t-Bu, 3-nitro-2-pyridine sulfenyl,
2-pyridine-sulfenyl, or triphenylmethyl when attached to a sulfur
atom.
[0246] In certain embodiments, R.sup.1b is --N(R.sup.B1b).sub.2. In
certain embodiments, at least one instance of R.sup.B1b is
substituted acyl. In certain embodiments, at least one instance of
R.sup.B1b is unsubstituted acyl. In certain embodiments, at least
one instance of R.sup.B1b is substituted or unsubstituted acetyl.
In certain embodiments, at least one instance of R.sup.B1b is
substituted alkyl. In certain embodiments, at least one instance of
R.sup.B1b is unsubstituted alkyl. In certain embodiments, at least
one instance of R.sup.B1b is C.sub.1-6 alkyl. In certain
embodiments, at least one instance of R.sup.B1b is methyl. In
certain embodiments, at least one instance of R.sup.B1b is ethyl.
In certain embodiments, at least one instance of R.sup.B1b is
propyl. In certain embodiments, at least one instance of R.sup.B1b
is butyl. In certain embodiments, at least one instance of
R.sup.B1b is substituted alkenyl. In certain embodiments, at least
one instance of R.sup.B1b unsubstituted alkenyl. In certain
embodiments, R.sup.B1b is vinyl. In contain embodiments, at least
one instance of R.sup.B1b is substituted alkynyl. In certain
embodiments, at least one instance of R.sup.B1b is unsubstituted
alkynyl. In certain embodiments, at least one instance of R.sup.B1b
is ethynyl. In certain embodiments, at least one instance of
R.sup.B1b is substituted carbocyclyl. In certain embodiments, at
least one instance of R.sup.B1b is unsubstituted carbocyclyl. In
certain embodiments, at least one instance of R.sup.B1b is
substituted heterocyclyl. In certain embodiments, at least one
instance of R.sup.B1b is unsubstituted heterocyclyl. In certain
embodiments, at least one instance of R.sup.B1b is substituted
aryl. In certain embodiments, at least one instance of R.sup.B1b is
unsubstituted aryl. In certain embodiments, R.sup.B1b is
substituted phenyl. In certain embodiments, R.sup.B1b is
unsubstituted phenyl. In certain embodiments, at least one instance
of R.sup.B1b is substituted or unsubstituted heteroaryl. In certain
embodiments, at least one instance of R.sup.B1b is substituted or
unsubstituted pyridyl. In certain embodiments, at least one
instance of R.sup.B1b is a nitrogen protecting group when attached
to a nitrogen atom (e.g., Bn, BOC, Cbz, Fmoc, trifluoroacetyl,
triphenylmethyl, acetyl, or Ts). In certain embodiments, two
instances of R.sup.B1b are taken together with their intervening
atoms to form a substituted or unsubstituted heterocyclic or
substituted or unsubstituted heteroaryl ring.
[0247] As generally defined herein, in Formulae (I') and (II),
R.sup.2 is a divalent linker moiety connecting Ring B and Ring C.
In certain embodiments, R.sup.2 is --O--. In certain embodiments,
R.sup.2 is --S--. In certain embodiments, R.sup.2 is
--N(R.sup.6)--, wherein each R.sup.6 is independently selected from
hydrogen and --C.sub.1-C.sub.6 alkyl. In certain embodiments,
R.sup.2 is --NH--. In certain embodiments, R.sup.2 is
--N(C.sub.1-C.sub.6 alkyl)- (e.g., --N(Me). In certain embodiments,
R.sup.2 is an optionally substituted C.sub.1-C.sub.4 alkylene,
wherein one ore methylene units of the alkylene are optionally and
independently replaced with --O--, --S--, or --N(R.sup.6)--. In
certain embodiments, R.sup.2 is an optionally substituted C.sub.2
hydrocarbon chain, optionally wherein one or two carbon units of
the hydrocarbon chain is replaced with --O--, --S--, or
--NR.sup.6--. In certain embodiments, R.sup.2 is an optionally
substituted C.sub.3 hydrocarbon chain, optionally wherein one or
more carbon units of the hydrocarbon chain is replaced with --O--,
--S--, or --NR.sup.6--. In certain embodiments, R.sup.2 is an
optionally substituted C.sub.4 hydrocarbon chain, optionally
wherein one or more carbon units of the hydrocarbon chain is
replaced with --O--, --S--, or --NR.sup.6--. In certain
embodiments, at least one carbon unit of the C.sub.1-4 hydrocarbon
chain is substituted with one or more substituents independently
selected from the group consisting of --O--, --S--, or --NR.sup.6--
(e.g., --NH-- or --NMe-).
[0248] Formulae (I') and (II) include Ring C of the formula:
##STR00123##
In certain embodiments, Z is --CH--. In certain embodiments, Z is
N. In certain embodiments, Ring C is of formula:
##STR00124##
In certain embodiments, Ring C is of formula:
##STR00125##
In certain embodiments, Ring C is of formula:
##STR00126##
In certain embodiments, Ring C is of formula:
##STR00127##
In certain embodiments, Ring C is of formula:
##STR00128##
In certain embodiments, Ring C is of formula:
##STR00129##
In certain embodiments, Ring C is of formula:
##STR00130##
In certain embodiments, Ring C is of formula:
##STR00131##
Ring C may include one or more instances of substituent R.sup.3. In
certain embodiments, n is 0. In certain embodiments, n is 1. In
certain embodiments, n is 2. In certain embodiments, n is 3. In
certain embodiments, n is 4. In certain embodiments, n is 5. In
certain embodiments, n is 6.
[0249] In certain embodiments, at least one instance of R.sup.3 is
halogen (e.g., F, Cl, Br, or I). In certain embodiments, at least
one instance of R.sup.3 is substituted or unsubstituted acyl (e.g.,
--C(.dbd.O)Me). In certain embodiments, at least one instance of
R.sup.3 is substituted or unsubstituted alkyl (e.g., substituted or
unsubstituted C.sub.1-6 alkyl). In certain embodiments, at least
one instance of R.sup.3 is substituted or unsubstituted methyl. In
certain embodiments, at least one instance of R.sup.3 is
substituted or unsubstituted ethyl. In certain embodiments, at
least one instance of R.sup.3 is substituted or unsubstituted
propyl. In certain embodiments, at least one instance of R.sup.3 is
substituted or unsubstituted alkenyl (e.g., substituted or
unsubstituted C.sub.2-6 alkenyl). In certain embodiments, at least
one instance of R.sup.3 is substituted or unsubstituted alkynyl
(e.g., substituted or unsubstituted C.sub.2-6 alkynyl). In certain
embodiments, at least one instance of R.sup.3 is substituted or
unsubstituted carbocyclyl (e.g., substituted or unsubstituted, 3-
to 7-membered, monocyclic carbocyclyl comprising zero, one, or two
double bonds in the carbocyclic ring system). In certain
embodiments, at least one instance of R.sup.3 is substituted or
unsubstituted heterocyclyl (e.g., substituted or unsubstituted, 5-
to 10-membered monocyclic or bicyclic heterocyclic ring, wherein
one or two atoms in the heterocyclic ring are independently
nitrogen, oxygen, or sulfur). In certain embodiments, at least one
instance of R.sup.3 is substituted or unsubstituted aryl (e.g.,
substituted or unsubstituted, 6- to 10-membered aryl). In certain
embodiments, at least one instance of R.sup.3 is benzyl. In certain
embodiments, at least one instance of R.sup.3 is substituted or
unsubstituted phenyl. In certain embodiments, at least one instance
of R.sup.A1 is substituted or unsubstituted heteroaryl (e.g.,
substituted or unsubstituted, 5- to 6-membered, monocyclic
heteroaryl, wherein one, two, three, or four atoms in the
heteroaryl ring system are independently nitrogen, oxygen, or
sulfur; or substituted or unsubstituted, 9- to 10-membered,
bicyclic heteroaryl, wherein one, two, three, or four atoms in the
heteroaryl ring system are independently nitrogen, oxygen, or
sulfur). In certain embodiments, at least one instance of R.sup.3
is --OR.sup.C1 (e.g., --OH or --OMe). In certain embodiments, at
least one instance of R.sup.3 is --N(R.sup.C1a).sub.2 (e.g.,
--NMe.sub.2). In certain embodiments, at least one instance of
R.sup.3 is --SR.sup.C1 (e.g., --SMe). In certain embodiments, two
R.sup.3 groups bound to the same ring carbon atom are taken
together to form .dbd.O. In certain embodiments, two R.sup.3 groups
bound to the same or different ring carbon atoms are joined to form
an optionally substituted carbocyclyl ring (e.g., substituted or
unsubstituted, 3- to 7-membered, monocyclic carbocyclyl comprising
zero, one, or two double bonds in the carbocyclic ring system). In
certain embodiments, two R.sup.3 groups bound to the same or
different ring carbon atoms are joined to form an optionally
substituted heterocyclyl (e.g., substituted or unsubstituted, 5- to
10-membered monocyclic or bicyclic heterocyclic ring, wherein one
or two atoms in the heterocyclic ring are independently nitrogen,
oxygen, or sulfur). In certain embodiments, two R.sup.3 groups
bound to the same or different ring carbon atoms are joined to form
an optionally substituted aryl. In certain embodiments, two R.sup.3
groups bound to the same or different ring carbon atoms are joined
to form an optionally substituted heteroaryl ring (e.g.,
substituted or unsubstituted, 5- to 6-membered, monocyclic
heteroaryl, wherein one, two, three, or four atoms in the
heteroaryl ring system are independently nitrogen, oxygen, or
sulfur; or substituted or unsubstituted, 9- to 10-membered,
bicyclic heteroaryl, wherein one, two, three, or four atoms in the
heteroaryl ring system are independently nitrogen, oxygen, or
sulfur).
[0250] In certain embodiments, each occurrence of R.sup.C1 is
independently selected from hydrogen, optionally substituted acyl,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
and optionally substituted heteroaryl, an oxygen protecting group
when attached to an oxygen atom, or a sulfur protecting group when
attached to a sulfur atom. In certain embodiments, each occurrence
of R.sup.C1a is independently selected from hydrogen, optionally
substituted acyl, optionally substituted alkyl, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, and optionally substituted heteroaryl,
a nitrogen protecting group, or optionally two instances of
R.sup.C1a are taken together with their intervening atoms to form a
substituted or unsubstituted heterocyclic or substituted or
unsubstituted heteroaryl ring.
[0251] As generally defined herein, in Formula (I'), R.sup.4 is a
divalent linker moiety connecting Ring C and Ring D1. As generally
defined herein, in Formula (I), R.sup.4 is a divalent linker moiety
connecting Ring C and Ring D. In certain embodiments, R.sup.4 is a
bond. In certain embodiments, R.sup.4 is a single bond. In certain
embodiments, R.sup.4 is --C(.dbd.O)--. In certain embodiments,
R.sup.4 is --O--. In certain embodiments, R.sup.4 is --S--. In
certain embodiments, R.sup.4 is --N(R.sup.6)-- (e.g., --NH--). In
certain embodiments, R.sup.4 is --S(.dbd.O).sub.2--. In certain
embodiments, R.sup.4 is an optionally substituted C.sub.1-C.sub.4
alkylene, wherein: one or more methylene units of the alkylene
other than a methylene unit bound to a nitrogen atom is optionally
and independently replaced with --C(.dbd.O)--, --O--, --S--,
--N(R.sup.6)--, or --S(.dbd.O).sub.2--. In certain embodiments,
R.sup.4 is an optionally substituted C.sub.2 hydrocarbon chain,
optionally wherein one or two carbon units of the hydrocarbon chain
is replaced with --O--, --S--, --NR.sup.6--, or
--S(.dbd.O).sub.2--. In certain embodiments, R.sup.4 is
--NR.sup.6C(.dbd.O)--, --C(.dbd.O)NR.sup.6--,
--NR.sup.6S(.dbd.O).sub.2--, --S(.dbd.O).sub.2NR.sup.6--,
--NR.sup.6(C.sub.1-2 alkylene)-, or --(C.sub.1-2
alkylene)NR.sup.6--. In certain embodiments, R.sup.4 is
--NR.sup.6C(.dbd.O)--, --C(.dbd.O)NR.sup.6--,
--NR.sup.6S(.dbd.O).sub.2--, --S(.dbd.O).sub.2NR.sup.6--,
--NR.sup.6(C.sub.1-2 alkylene)-. In certain embodiments, R.sup.4 is
--NHC(.dbd.O)--, --C(.dbd.O)NH--, --NHS(.dbd.O).sub.2--,
--N(C(O)OC(CH.sub.3).sub.3)--, --N(Boc)-CH.sub.2--, --NH--,
--NHCH.sub.2--, --NMeCH.sub.2--, or --OCH.sub.2--. In certain
embodiments, R.sup.4 is an optionally substituted C.sub.4
hydrocarbon chain, optionally wherein one or more carbon units of
the hydrocarbon chain is replaced with --C(.dbd.O)--, --O--, --S--,
--N(R.sup.6)--, or --S(.dbd.O).sub.2--. In certain embodiments, at
least one carbon unit of the C.sub.1-4 hydrocarbon chain is
substituted with one or more substituents independently selected
from the group consisting of --C(.dbd.O)--, --O--, --S--,
--N(R.sup.6)--, or --S(.dbd.O).sub.2--.
[0252] Formula (I') includes Ring D1 of the formula:
##STR00132##
wherein W is --CR.sup.D1.dbd. or --N.dbd., and R.sup.D1 is
independently hydrogen, optionally substituted acyl, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, or
optionally substituted heteroaryl. In certain embodiments, Ring D1
is
##STR00133##
In certain embodiments, W is --CH.dbd.. In certain embodiments, W
is --C(Me)-. In certain embodiments, W is --N.dbd..
[0253] In certain embodiments, Ring D1 is a compound of Ring D of
the formula:
##STR00134##
[0254] Formula (I) includes Ring D of the formula:
##STR00135##
Ring D includes zero or more instances of substituent R.sup.8. In
certain embodiments, m is 0. In certain embodiments, m is 1. In
certain embodiments, m is 2. In certain embodiments, m is 3. In
certain embodiments, m is 4. In certain embodiments, at least one
instance of R.sup.8 is hydrogen. halogen (e.g., F, Cl, Br, or I).
In certain embodiments, at least one instance of R.sup.8 is F. In
certain embodiments, at least one instance of R.sup.8 is Cl. In
certain embodiments, at least one instance of R.sup.8 is Br. In
certain embodiments, at least one instance of R.sup.8 is I
(iodine). In certain embodiments, at least one instance of R.sup.8
is substituted or unsubstituted acyl (e.g., --C(.dbd.O)Me). In
certain embodiments, at least one instance of R.sup.8 is
substituted or unsubstituted alkyl (e.g., substituted or
unsubstituted C.sub.1-6 alkyl). In certain embodiments, at least
one instance of R.sup.8 is substituted or unsubstituted C.sub.1-6
alkyl. In certain embodiments, at least one instance of R.sup.8 is
unsubstituted C.sub.1-6 alkyl. In certain embodiments, at least one
instance of R.sup.8 is substituted or unsubstituted methyl. In
certain embodiments, at least one instance of R.sup.8 is
substituted methyl. In certain embodiments, at least one instance
of R.sup.8 is unsubstituted methyl. In certain embodiments, at
least one instance of R.sup.8 is substituted or unsubstituted
ethyl. In certain embodiments, at least one instance of R.sup.8 is
substituted or unsubstituted propyl. In certain embodiments, at
least one instance of R.sup.8 is substituted or unsubstituted
alkenyl (e.g., substituted or unsubstituted C.sub.2-6 alkenyl). In
certain embodiments, at least one instance of R.sup.8 is
substituted or unsubstituted alkynyl (e.g., substituted or
unsubstituted C.sub.2-6 alkynyl). In certain embodiments, at least
one instance of R.sup.8 is substituted or unsubstituted carbocyclyl
(e.g., substituted or unsubstituted, 3- to 7-membered, monocyclic
carbocyclyl comprising zero, one, or two double bonds in the
carbocyclic ring system). In certain embodiments, at least one
instance of R.sup.8 is substituted or unsubstituted heterocyclyl
(e.g., substituted or unsubstituted, 5- to 10-membered monocyclic
or bicyclic heterocyclic ring, wherein one or two atoms in the
heterocyclic ring are independently nitrogen, oxygen, or sulfur).
In certain embodiments, at least one instance of R.sup.8 is
substituted or unsubstituted aryl (e.g., substituted or
unsubstituted, 6- to 10-membered aryl). In certain embodiments, at
least one instance of R.sup.8 is benzyl. In certain embodiments, at
least one instance of R.sup.8 is substituted or unsubstituted
phenyl. In certain embodiments, at least one instance of R.sup.8 is
substituted or unsubstituted heteroaryl (e.g., substituted or
unsubstituted, 5- to 6-membered, monocyclic heteroaryl, wherein
one, two, three, or four atoms in the heteroaryl ring system are
independently nitrogen, oxygen, or sulfur; or substituted or
unsubstituted, 9- to 10-membered, bicyclic heteroaryl, wherein one,
two, three, or four atoms in the heteroaryl ring system are
independently nitrogen, oxygen, or sulfur). In certain embodiments,
at least one instance of R.sup.8 is --OR.sup.D (e.g., --OH or
--OMe). In certain embodiments, at least one instance of R.sup.8 is
--OH. In certain embodiments, at least one instance of R.sup.8 is
--OMe. In certain embodiments, at least one instance of R.sup.8 is
--O(C.sub.1-6 alkyl). In certain embodiments, at least one instance
of R.sup.8 is --N(R.sup.D1a).sub.2 (e.g., --NMe.sub.2). In certain
embodiments, at least one instance of R.sup.8 is --NMe.sub.2. In
certain embodiments, at least one instance of R.sup.8 is --SR.sup.D
(e.g., --SMe). In certain embodiments, at least one instance of
R.sup.8 is halogen, --O(alkyl), or optionally substituted alkyl. In
certain embodiments, two R.sup.8 groups are joined to form an
optionally substituted carbocyclyl (e.g., substituted or
unsubstituted, 3- to 7-membered, monocyclic carbocyclyl comprising
zero, one, or two double bonds in the carbocyclic ring system). In
certain embodiments, two R.sup.8 groups are joined to form an
optionally substituted heterocyclyl (e.g., substituted or
unsubstituted, 5- to 10-membered monocyclic or bicyclic
heterocyclic ring, wherein one or two atoms in the heterocyclic
ring are independently nitrogen, oxygen, or sulfur). In certain
embodiments, two R.sup.8 groups are joined to form an optionally
substituted aryl ring (e.g., substituted or unsubstituted, 6- to
10-membered aryl). In certain embodiments, two R.sup.8 groups are
joined to form an optionally substituted heteroaryl ring (e.g.,
substituted or unsubstituted, 5- to 6-membered, monocyclic
heteroaryl, wherein one, two, three, or four atoms in the
heteroaryl ring system are independently nitrogen, oxygen, or
sulfur; or substituted or unsubstituted, 9- to 10-membered,
bicyclic heteroaryl, wherein one, two, three, or four atoms in the
heteroaryl ring system are independently nitrogen, oxygen, or
sulfur).
[0255] In certain embodiments, each occurrence of R.sup.D1 is
independently selected from hydrogen, optionally substituted acyl,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
and optionally substituted heteroaryl, an oxygen protecting group
when attached to an oxygen atom, or a sulfur protecting group when
attached to a sulfur atom. In certain embodiments, each occurrence
of R.sup.D1a is independently selected from hydrogen, optionally
substituted acyl, optionally substituted alkyl, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, and optionally substituted heteroaryl,
a nitrogen protecting group, or optionally two instances of
R.sup.D1a are taken together with their intervening atoms to form a
substituted or unsubstituted heterocyclic or substituted or
unsubstituted heteroaryl ring.
[0256] Formula (II) includes Ring E of the formula:
##STR00136##
Ring E includes zero or more instances of substituent R.sup.8. In
certain embodiments, p is 0. In certain embodiments, p is 1. In
certain embodiments, p is 2. In certain embodiments, m is 3. In
certain embodiments, p is 4. In certain embodiments, p is 5. In
certain embodiments, at least one instance of R.sup.8 is hydrogen.
In certain embodiments, at least one instance of R.sup.8 is halogen
(e.g., F, Cl, Br, or I). In certain embodiments, at least one
instance of R.sup.8 is F. In certain embodiments, at least one
instance of R.sup.8 is Cl. In certain embodiments, at least one
instance of R.sup.8 is Br. In certain embodiments, at least one
instance of R.sup.8 is I (iodine). In certain embodiments, at least
one instance of R.sup.8 is substituted or unsubstituted acyl (e.g.,
--C(.dbd.O)Me). In certain embodiments, at least one instance of
R.sup.8 is substituted or unsubstituted alkyl (e.g., substituted or
unsubstituted C.sub.1-6 alkyl). In certain embodiments, at least
one instance of R.sup.8 is substituted or unsubstituted C.sub.1-6
alkyl. In certain embodiments, at least one instance of R.sup.8 is
unsubstituted C.sub.1-6 alkyl. In certain embodiments, at least one
instance of R.sup.8 is substituted or unsubstituted methyl. In
certain embodiments, at least one instance of R.sup.8 is
substituted methyl. In certain embodiments, at least one instance
of R.sup.8 is unsubstituted methyl. In certain embodiments, at
least one instance of R.sup.8 is substituted or unsubstituted
ethyl. In certain embodiments, at least one instance of R.sup.8 is
substituted or unsubstituted propyl. In certain embodiments, at
least one instance of R.sup.8 is substituted or unsubstituted
alkenyl (e.g., substituted or unsubstituted C.sub.2-6 alkenyl). In
certain embodiments, at least one instance of R.sup.8 is
substituted or unsubstituted alkynyl (e.g., substituted or
unsubstituted C.sub.2-6 alkynyl). In certain embodiments, at least
one instance of R.sup.8 is substituted or unsubstituted carbocyclyl
(e.g., substituted or unsubstituted, 3- to 7-membered, monocyclic
carbocyclyl comprising zero, one, or two double bonds in the
carbocyclic ring system). In certain embodiments, at least one
instance of R.sup.8 is substituted or unsubstituted heterocyclyl
(e.g., substituted or unsubstituted, 5- to 10-membered monocyclic
or bicyclic heterocyclic ring, wherein one or two atoms in the
heterocyclic ring are independently nitrogen, oxygen, or sulfur).
In certain embodiments, at least one instance of R.sup.8 is
substituted or unsubstituted aryl (e.g., substituted or
unsubstituted, 6- to 10-membered aryl). In certain embodiments, at
least one instance of R.sup.8 is benzyl. In certain embodiments, at
least one instance of R.sup.8 is substituted or unsubstituted
phenyl. In certain embodiments, at least one instance of R.sup.8 is
substituted or unsubstituted heteroaryl (e.g., substituted or
unsubstituted, 5- to 6-membered, monocyclic heteroaryl, wherein
one, two, three, or four atoms in the heteroaryl ring system are
independently nitrogen, oxygen, or sulfur; or substituted or
unsubstituted, 9- to 10-membered, bicyclic heteroaryl, wherein one,
two, three, or four atoms in the heteroaryl ring system are
independently nitrogen, oxygen, or sulfur). In certain embodiments,
at least one instance of R.sup.8 is --OR.sup.D1 (e.g., --OH or
--OMe). In certain embodiments, at least one instance of R.sup.8 is
--OH. In certain embodiments, at least one instance of R.sup.8 is
--OMe. In certain embodiments, at least one instance of R.sup.8 is
--O(C.sub.1-6 alkyl). In certain embodiments, at least one instance
of R.sup.8 is --N(R.sup.D1a).sub.2 (e.g., --NMe.sub.2). In certain
embodiments, at least one instance of R.sup.8 is --NMe.sub.2. In
certain embodiments, at least one instance of R.sup.8 is
--SR.sup.D1 (e.g., --SMe). In certain embodiments, two R.sup.8
groups are joined to form an optionally substituted carbocyclyl
(e.g., substituted or unsubstituted, 3- to 7-membered, monocyclic
carbocyclyl comprising zero, one, or two double bonds in the
carbocyclic ring system). In certain embodiments, two R.sup.8
groups are joined to form an optionally substituted heterocyclyl
(e.g., substituted or unsubstituted, 5- to 10-membered monocyclic
or bicyclic heterocyclic ring, wherein one or two atoms in the
heterocyclic ring are independently nitrogen, oxygen, or sulfur).
In certain embodiments, two R.sup.8 groups are joined to form an
optionally substituted aryl ring (e.g., substituted or
unsubstituted, 6- to 10-membered aryl). In certain embodiments, two
R.sup.8 groups are joined to form an optionally substituted
heteroaryl ring (e.g., substituted or unsubstituted, 5- to
6-membered, monocyclic heteroaryl, wherein one, two, three, or four
atoms in the heteroaryl ring system are independently nitrogen,
oxygen, or sulfur; or substituted or unsubstituted, 9- to
10-membered, bicyclic heteroaryl, wherein one, two, three, or four
atoms in the heteroaryl ring system are independently nitrogen,
oxygen, or sulfur).
[0257] In certain embodiments, each occurrence of R.sup.D1 is
independently selected from hydrogen, optionally substituted acyl,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
and optionally substituted heteroaryl, an oxygen protecting group
when attached to an oxygen atom, or a sulfur protecting group when
attached to a sulfur atom. In certain embodiments, each occurrence
of R.sup.D1a is independently selected from hydrogen, optionally
substituted acyl, optionally substituted alkyl, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, and optionally substituted heteroaryl,
a nitrogen protecting group, or optionally two instances of
R.sup.D1a are taken together with their intervening atoms to form a
substituted or unsubstituted heterocyclic or substituted or
unsubstituted heteroaryl ring.
[0258] As generally defined herein, Formulae (I') and (II) include
substituent R.sup.7, wherein R.sup.7 is a warhead of formula:
##STR00137## ##STR00138## ##STR00139## ##STR00140## ##STR00141##
##STR00142##
wherein:
[0259] L.sup.3 is a bond or an optionally substituted C.sub.1-4
hydrocarbon chain, optionally wherein one or more carbon units of
the hydrocarbon chain are independently replaced with --C.dbd.O--,
--O--, --S--, --NR.sup.L3a--, --NR.sup.L3aC(.dbd.O)--,
--C(.dbd.O)NR.sup.L3a--, --SC(.dbd.O)--, --C(.dbd.O)S--,
--OC(.dbd.O)--, --C(.dbd.O)O--, --NR.sup.L3aC(.dbd.S)--,
--C(.dbd.S)NR.sup.L3a--, trans-CR.sup.L3b.dbd.CR.sup.L3b--,
cis-CR.sup.L3b.dbd.CR.sup.L3b--, --C.ident.C--, --S(.dbd.O)--,
--S(.dbd.O)O--, --OS(.dbd.O)--, --S(.dbd.O)NR.sup.L3a--,
--NR.sup.L3aS(.dbd.O)--, --S(.dbd.O).sub.2--, --S(.dbd.O).sub.2O--,
--OS(.dbd.O).sub.2--, --S(.dbd.O).sub.2NR.sup.L3a--, or
--NR.sup.L3aS(.dbd.O).sub.2--, wherein R.sup.L3a is hydrogen,
substituted or unsubstituted C.sub.1-6 alkyl, or a nitrogen
protecting group, and wherein each occurrence of R.sup.L3b is
independently hydrogen, halogen, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, or optionally
substituted heteroaryl, or two R.sup.L3b groups are joined to form
an optionally substituted carbocyclic or optionally substituted
heterocyclic ring; L.sup.4 is a bond or an optionally substituted,
branched or unbranched C.sub.1-6 hydrocarbon chain; each of
R.sup.E1, R.sup.E2, and R.sup.E3 is independently hydrogen,
halogen, optionally substituted alkyl, optionally substituted
alkenyl, optionally substituted alkynyl, optionally substituted
carbocyclyl, optionally substituted heterocyclyl, optionally
substituted aryl, optionally substituted heteroaryl, --CN,
--CH.sub.2OR.sup.EE, --CH.sub.2N(R.sup.EE).sub.2,
--CH.sub.2SR.sup.EE, --OR.sup.EE, --N(R.sup.EE).sub.2,
--Si(R.sup.EE).sub.3, or --SR.sup.EE, wherein each instance of
R.sup.EE is independently hydrogen, optionally substituted alkyl,
optionally substituted alkoxy, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted carbocyclyl,
optionally substituted heterocyclyl, optionally substituted aryl,
or optionally substituted heteroaryl, or two R.sup.EE groups are
joined to form an optionally substituted heterocyclic ring; or
R.sup.E1 and R.sup.E3, or R.sup.E2 and R.sup.E3, or R.sup.E1 and
R.sup.E2 are joined to form an optionally substituted carbocyclic
or optionally substituted heterocyclic ring; R.sup.E4 is a leaving
group; R.sup.E5 is halogen; R.sup.E6 is hydrogen, substituted or
unsubstituted C.sub.1-6 alkyl, or a nitrogen protecting group; each
instance of Y is independently O, S, or NR.sup.E7, wherein R.sup.E7
is hydrogen, substituted or unsubstituted C.sub.1-6 alkyl, or a
nitrogen protecting group; a is 1 or 2; and each instance of z is
independently 0, 1, 2, 3, 4, 5, or 6, as valency permits.
[0260] In certain embodiments, R.sup.7 is a warhead of formula
(i-1) through (i-41). In certain embodiments, the warhead is of
formula
##STR00143##
In certain embodiments, R.sup.7 is a warhead is of formula
##STR00144##
In certain embodiments, R.sup.7 is a warhead is of formula
##STR00145##
In certain embodiments, the warhead is of formula
##STR00146##
In certain embodiments, the warhead is of formula
##STR00147##
In certain embodiments, the warhead is of formula
##STR00148##
In certain embodiments, the warhead is of formula
##STR00149##
In certain embodiments, the warhead is of formula
##STR00150##
In certain embodiments, the warhead is of formula
##STR00151##
In certain embodiments, the warhead is of formula
##STR00152##
In certain embodiments, the warhead is of formula
##STR00153##
In certain embodiments, the warhead is of formula
##STR00154##
In certain embodiments, the warhead is
##STR00155##
In certain embodiments, the warhead is of formula
##STR00156##
In certain embodiments, the warhead is of formula
##STR00157##
In certain embodiments, the warhead is of formula
##STR00158##
In certain embodiments, the warhead is of formula
##STR00159##
[0261] In certain embodiments, the warhead is of formula
##STR00160##
In certain embodiments, the warhead is of formula
##STR00161##
In certain embodiments, the warhead is of formula
##STR00162##
In certain embodiments, the warhead is of formula
##STR00163##
In certain embodiments, the warhead is of formula
##STR00164##
In certain embodiments, the warhead is
##STR00165##
In certain embodiments, the warhead is of formula
##STR00166##
In certain embodiments, the warhead is of formula
##STR00167##
In certain embodiments, the warhead is of formula
##STR00168##
In certain embodiments, the warhead is of formula
##STR00169##
In certain embodiments, the warhead is of formula
##STR00170##
In certain embodiments, the warhead is of formula
##STR00171##
In certain embodiments, the warhead is of formula
##STR00172##
In certain embodiments, the warhead is of formula
##STR00173##
[0262] In certain embodiments, the warhead is of formula
##STR00174##
In certain embodiments, the warhead is of formula
##STR00175##
In certain embodiments, the warhead is of formula
##STR00176##
In certain embodiments, the warhead is of formula
##STR00177##
In certain embodiments, the warhead is of formula
##STR00178##
In certain embodiments, the warhead is of formula
##STR00179##
In certain embodiments, the warhead is of formula
##STR00180##
In certain embodiments, the warhead is of formula
##STR00181##
In certain embodiments, the warhead is of formula
##STR00182##
In certain embodiments the warhead is of formula
##STR00183##
In certain embodiments, the warhead is of formula
##STR00184##
In certain embodiments, the warhead is of formula
##STR00185##
[0263] In certain embodiments, L.sup.3 is a bond (e.g., a single
bond, a double bond, or a triple bond). In certain embodiments,
L.sup.3 is a single bond. In certain embodiments, L.sup.3 is a
double bond. In certain embodiments, L.sup.3 is a triple bond. In
certain embodiments, L.sup.3 is an optionally substituted C.sub.1-4
hydrocarbon chain, optionally wherein one or more carbon units of
the hydrocarbon chain are independently replaced with --C.dbd.O--,
--O--, --S--, --NR.sup.L3a--, --NR.sup.L3aC(.dbd.O)--,
--C(.dbd.O)NR.sup.L3a--, --SC(.dbd.O)--, --C(.dbd.O)S--,
--OC(.dbd.O)--, --C(.dbd.O)O--, --NR.sup.L3aC(.dbd.S)--,
--C(.dbd.S)NR.sup.L3a--, trans-CR.sup.L3b.dbd.CR.sup.L3b--,
cis-CR.sup.L3b.dbd.CR.sup.L3b--, --C.ident.C--, --S(.dbd.O)--,
--S(.dbd.O)O--, --OS(.dbd.O)--, --S(.dbd.O)NR.sup.L3a--,
--NR.sup.L3aS(.dbd.O)--, --S(.dbd.O).sub.2--, --S(.dbd.O).sub.2O--,
--OS(.dbd.O).sub.2--, --S(.dbd.O).sub.2NR.sup.L3a--, or
--NR.sup.L3aS(.dbd.O).sub.2--, wherein R.sup.L3a is hydrogen,
substituted or unsubstituted C.sub.1-6 alkyl, or a nitrogen
protecting group, and wherein each occurrence of R.sup.L3b is
independently hydrogen, halogen, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted carbocyclyl, optionally substituted
heterocyclyl, optionally substituted aryl, or optionally
substituted heteroaryl, or two R.sup.L3b groups are joined to form
an optionally substituted carbocyclic or optionally substituted
heterocyclic ring. In certain embodiments, L.sup.4 is a bond (e.g.,
a single bond, a double bond, or a triple bond). In certain
embodiments, L.sup.4 is an optionally substituted branched
C.sub.1-6 hydrocarbon chain (e.g., i-Pr). In certain embodiments,
L.sup.4 is an optionally substituted unbranched C.sub.1-4
hydrocarbon chain (e.g., n-Pr, or n-Bu). In certain embodiments, at
least one instance of R.sup.E1 is H. In certain embodiments, at
least one instance of R.sup.E1 is halogen (e.g., F, Cl, Br, or I).
In certain embodiments, at least one instance of R.sup.E1 is
optionally substituted alkyl (e.g., Me, or Et). In certain
embodiments, at least one instance of R.sup.E1 is optionally
substituted alkenyl (e.g., optionally substituted vinyl). In
certain embodiments, at least one instance of R.sup.E1 is
optionally substituted alkynyl. In certain embodiments, at least
one instance of R.sup.E1 is substituted or unsubstituted
carbocyclyl (e.g., substituted or unsubstituted, 3- to 7-membered,
monocyclic carbocyclyl comprising zero, one, or two double bonds in
the carbocyclic ring system). In certain embodiments, at least one
instance of R.sup.E1 is substituted or unsubstituted heterocyclyl
(e.g., substituted or unsubstituted, 3- to 7-membered, monocyclic
heterocyclyl comprising zero, one, or two double bonds in the
heterocyclic ring system, wherein one, two, or three atoms in the
heterocyclic ring system are independently nitrogen, oxygen, or
sulfur). In certain embodiments, at least one instance of R.sup.E1
is substituted or unsubstituted aryl (e.g., substituted or
unsubstituted, 6- to 10-membered aryl). In certain embodiments, at
least one instance of R.sup.E1 is substituted or unsubstituted
phenyl. In certain embodiments, at least one instance of R.sup.E1
is substituted or unsubstituted heteroaryl (e.g., substituted or
unsubstituted, 5- to 6-membered, monocyclic heteroaryl, wherein
one, two, three, or four atoms in the heteroaryl ring system are
independently nitrogen, oxygen, or sulfur). In certain embodiments,
at least one instance of R.sup.E1 is --CN. In certain embodiments,
at least one instance of R.sup.E1 is --CH.sub.2OR.sup.EE, wherein
each instance of R.sup.EE is independently hydrogen, optionally
substituted alkyl, optionally substituted alkoxy, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, or optionally substituted heteroaryl.
In certain embodiments, at least one instance of R.sup.E1 is
--CH.sub.2N(R.sup.EF).sub.2 or N(R.sup.EF).sub.2, wherein each
instance of R.sup.EF is independently hydrogen, optionally
substituted alkyl, optionally substituted alkoxy, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, or optionally substituted heteroaryl,
optionally wherein two R.sup.EF groups are joined to form an
optionally substituted heterocyclic ring. In certain embodiments,
at least one instance of R.sup.E1 is --CH.sub.2SR.sup.EE or
--SR.sup.EE (e.g., --CH.sub.2SMe or --SMe). In certain embodiments,
at least one instance of R.sup.E1 is --OR.sup.EE (e.g., --OMe). In
certain embodiments, at least one instance of R.sup.E1 is
--Si(R.sup.EG).sub.3, wherein each instance of R.sup.EG is
independently hydrogen, optionally substituted alkyl, optionally
substituted alkoxy, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, or
optionally substituted heteroaryl (e.g., --Si(Me).sub.3).
[0264] In certain embodiments, at least one instance of R.sup.E2 is
H. In certain embodiments, at least one instance of R.sup.E2 is
halogen (e.g., F, Cl, Br, or I). In certain embodiments, at least
one instance of R.sup.E2 is optionally substituted alkyl (e.g., Me,
or Et). In certain embodiments, at least one instance of R.sup.E2
is optionally substituted alkenyl (e.g., optionally substituted
vinyl). In certain embodiments, at least one instance of R.sup.E2
is optionally substituted alkynyl. In certain embodiments, at least
one instance of R.sup.E2 is substituted or unsubstituted
carbocyclyl (e.g., substituted or unsubstituted, 3- to 7-membered,
monocyclic carbocyclyl comprising zero, one, or two double bonds in
the carbocyclic ring system). In certain embodiments, at least one
instance of R.sup.E2 is substituted or unsubstituted heterocyclyl
(e.g., substituted or unsubstituted, 3- to 7-membered, monocyclic
heterocyclyl comprising zero, one, or two double bonds in the
heterocyclic ring system, wherein one, two, or three atoms in the
heterocyclic ring system are independently nitrogen, oxygen, or
sulfur). In certain embodiments, at least one instance of R.sup.E2
is substituted or unsubstituted aryl (e.g., substituted or
unsubstituted, 6- to 10-membered aryl). In certain embodiments, at
least one instance of R.sup.E2 is substituted or unsubstituted
phenyl. In certain embodiments, at least one instance of R.sup.E2
is substituted or unsubstituted heteroaryl (e.g., substituted or
unsubstituted, 5- to 6-membered, monocyclic heteroaryl, wherein
one, two, three, or four atoms in the heteroaryl ring system are
independently nitrogen, oxygen, or sulfur). In certain embodiments,
at least one instance of R.sup.E2 is --CN. In certain embodiments,
at least one instance of R.sup.E2 is-CH.sub.2OR.sup.EE, wherein
each instance of R.sup.EE is independently hydrogen, optionally
substituted alkyl, optionally substituted alkoxy, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, or optionally substituted heteroaryl.
In certain embodiments, at least one instance of R.sup.E2 is
--CH.sub.2N(R.sup.EF).sub.2 or N(R.sup.EF).sub.2, wherein each
instance of R.sup.EF is independently hydrogen, optionally
substituted alkyl, optionally substituted alkoxy, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, or optionally substituted heteroaryl,
optionally wherein two R.sup.EF groups are joined to form an
optionally substituted heterocyclic ring. In certain embodiments,
at least one instance of R.sup.E2 is --CH.sub.2SR.sup.EE or
--SR.sup.EE(e.g., --CH.sub.2SMe or --SMe). In certain embodiments,
at least one instance of R.sup.E2 is --OR.sup.EE(e.g., --OMe). In
certain embodiments, at least one instance of R.sup.E2 is
--Si(R.sup.EG).sub.3, wherein each instance of R.sup.EG is
independently hydrogen, optionally substituted alkyl, optionally
substituted alkoxy, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, or
optionally substituted heteroaryl (e.g., --Si(Me).sub.3). In
certain embodiments, at least one instance of R.sup.E3 is H. In
certain embodiments, at least one instance of R.sup.E3 is halogen
(e.g., F, Cl, Br, or I). In certain embodiments, at least one
instance of R.sup.E3 is optionally substituted alkyl (e.g., Me, or
Et). In certain embodiments, at least one instance of R.sup.E3 is
optionally substituted alkenyl (e.g., optionally substituted
vinyl). In certain embodiments, at least one instance of R.sup.E3
is optionally substituted alkynyl. In certain embodiments, at least
one instance of R.sup.E3 is substituted or unsubstituted
carbocyclyl (e.g., substituted or unsubstituted, 3- to 7-membered,
monocyclic carbocyclyl comprising zero, one, or two double bonds in
the carbocyclic ring system). In certain embodiments, at least one
instance of R.sup.E3 is substituted or unsubstituted heterocyclyl
(e.g., substituted or unsubstituted, 3- to 7-membered, monocyclic
heterocyclyl comprising zero, one, or two double bonds in the
heterocyclic ring system, wherein one, two, or three atoms in the
heterocyclic ring system are independently nitrogen, oxygen, or
sulfur). In certain embodiments, at least one instance of R.sup.E3
is substituted or unsubstituted aryl (e.g., substituted or
unsubstituted, 6- to 10-membered aryl). In certain embodiments, at
least one instance of R.sup.E3 is substituted or unsubstituted
phenyl. In certain embodiments, at least one instance of R.sup.E3
is substituted or unsubstituted heteroaryl (e.g., substituted or
unsubstituted, 5- to 6-membered, monocyclic heteroaryl, wherein
one, two, three, or four atoms in the heteroaryl ring system are
independently nitrogen, oxygen, or sulfur). In certain embodiments,
at least one instance of R.sup.E3 is --CN. In certain embodiments,
at least one instance of R.sup.E3 is --CH.sub.2OR.sup.EE, wherein
each instance of R.sup.EE is independently hydrogen, optionally
substituted alkyl, optionally substituted alkoxy, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, or optionally substituted heteroaryl.
In certain embodiments, at least one instance of R.sup.E3 is
--CH.sub.2N(R.sup.EF).sub.2 or N(R.sup.EF).sub.2, wherein each
instance of R.sup.EF is independently hydrogen, optionally
substituted alkyl, optionally substituted alkoxy, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted carbocyclyl, optionally substituted heterocyclyl,
optionally substituted aryl, or optionally substituted heteroaryl,
optionally wherein two R.sup.EF groups are joined to form an
optionally substituted heterocyclic ring. In certain embodiments,
at least one instance of R.sup.E3 is-CH.sub.2SR.sup.EE or
--SR.sup.EE (e.g., --CH.sub.2SMe or --SMe). In certain embodiments,
at least one instance of R.sup.E3 is --OR.sup.EE (e.g., --OMe). In
certain embodiments, at least one instance of R.sup.E3
is-Si(R.sup.EG).sub.3, wherein each instance of R.sup.EG is
independently hydrogen, optionally substituted alkyl, optionally
substituted alkoxy, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted carbocyclyl, optionally
substituted heterocyclyl, optionally substituted aryl, or
optionally substituted heteroaryl (e.g., --Si(Me).sub.3). In
certain embodiments, R.sup.E1 and R.sup.E3 are joined to form an
optionally substituted carbocyclic ring (e.g., substituted or
unsubstituted, 3- to 7-membered, monocyclic carbocyclyl comprising
zero, one, or two double bonds in the carbocyclic ring system). In
certain embodiments, R.sup.E1 and R.sup.E3 are joined to form an
optionally substituted heterocyclic ring (e.g., substituted or
unsubstituted, 3- to 7-membered, monocyclic heterocyclyl comprising
zero, one, or two double bonds in the heterocyclic ring system,
wherein one, two, or three atoms in the heterocyclic ring system
are independently nitrogen, oxygen, or sulfur). In certain
embodiments, R.sup.E2 and R.sup.E3 are joined to form an optionally
substituted carbocyclic ring (e.g., substituted or unsubstituted,
3- to 7-membered, monocyclic carbocyclyl comprising zero, one, or
two double bonds in the carbocyclic ring system). In certain
embodiments, R.sup.E2 and R.sup.E3 are joined to form an optionally
substituted heterocyclic ring (e.g., substituted or unsubstituted,
3- to 7-membered, monocyclic heterocyclyl comprising zero, one, or
two double bonds in the heterocyclic ring system, wherein one, two,
or three atoms in the heterocyclic ring system are independently
nitrogen, oxygen, or sulfur). In certain embodiments, R.sup.E1 and
R.sup.E2 are joined to form an optionally substituted carbocyclic
ring (e.g., substituted or unsubstituted, 3- to 7-membered,
monocyclic carbocyclyl comprising zero, one, or two double bonds in
the carbocyclic ring system). In certain embodiments, R.sup.E1 and
R.sup.E2 are joined to form an optionally substituted heterocyclic
ring (e.g., substituted or unsubstituted, 3- to 7-membered,
monocyclic heterocyclyl comprising zero, one, or two double bonds
in the heterocyclic ring system, wherein one, two, or three atoms
in the heterocyclic ring system are independently nitrogen, oxygen,
or sulfur). In certain embodiments, R.sup.E4 is a leaving group
(e.g., halogen, or a sulfonic acid ester, e.g., --O(tosylate) or
--O(mesylate)). In certain embodiments, R.sup.E5 is halogen (e.g.,
F, Cl, Br, or I). In certain embodiments, R.sup.E6 is H. In certain
embodiments, R.sup.E6 is substituted or unsubstituted C.sub.1-6
alkyl (e.g., Me, is --CF.sub.3, Bn, Et, perfluoroethyl, Pr,
perfluoropropyl, Bu, or perfluorobutyl). In certain embodiments,
R.sup.E6 is a nitrogen protecting group (e.g., Bn, Boc, Cbz, Fmoc,
trifluoroacetyl, triphenylmethyl, acetyl, or Ts). In certain
embodiments, at least one instance of Y is O. In certain
embodiments, at least one instance of Y is S. In certain
embodiments, at least one instance of Y is NR.sup.E7, wherein
R.sup.E7 is hydrogen, substituted or unsubstituted C.sub.1-6 alkyl,
or a nitrogen protecting group (e.g., NMe). In certain embodiments,
a is 1. In certain embodiments, a is 2. In certain embodiments, at
least one instance of z is 0. In certain embodiments, at least one
instance of z is 1. In certain embodiments, at least one instance
of z is 2. In certain embodiments, at least one instance of z is 3.
In certain embodiments, at least one instance of z is 4. In certain
embodiments, at least one instance of z is 5. In certain
embodiments, at least one instance of z is 6.
[0265] In certain embodiments, the compound of Formula (I') is of
formula:
##STR00186##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0266] In certain embodiments, the compound of Formula (I) is of
formula:
##STR00187##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0267] In certain embodiments, the compound of Formula (I') is of
formula:
##STR00188##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0268] In certain embodiments, the compound of Formula (I) is of
formula:
##STR00189##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0269] In certain embodiments, the compound of Formula (I') is of
formula:
##STR00190##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0270] In certain embodiments, the compound of Formula (I) is of
formula:
##STR00191##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0271] In certain embodiments, the compound of Formula (I') is of
formula:
##STR00192##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0272] In certain embodiments, the compound of Formula (I) is of
formula:
##STR00193##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0273] In certain embodiments, the compound of Formula (I') is of
formula:
##STR00194##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0274] In certain embodiments, the compound of Formula (I) is of
formula:
##STR00195##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0275] In certain embodiments, the compound of Formula (I') is of
formula:
##STR00196##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0276] In certain embodiments, the compound of Formula (I) is of
formula:
##STR00197##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0277] In certain embodiments, the compound of Formula (I') is of
formula:
##STR00198##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0278] In certain embodiments, the compound of Formula (I) is of
formula:
##STR00199##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0279] In certain embodiments, the compound of Formula (I') is of
formula:
##STR00200##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0280] In certain embodiments, the compound of Formula (I) is of
formula:
##STR00201##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0281] In certain embodiments, the compound of Formula (I') is of
formula:
##STR00202##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0282] In certain embodiments, the compound of Formula (I) is of
formula:
##STR00203##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0283] In certain embodiments, the compound of Formula (I') is of
formula:
##STR00204##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0284] In certain embodiments, the compound of Formula (I) is of
formula:
##STR00205##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0285] Exemplary compounds of Formula (I') include, but are not
limited to:
##STR00206##
and pharmaceutically acceptable salts, solvates, hydrates,
polymorphs, co-crystals, tautomers, stereoisomers, isotopically
labeled derivatives, and prodrugs thereof.
[0286] Exemplary compounds of Formula (I) include, but are not
limited to:
##STR00207##
and pharmaceutically acceptable salts, solvates, hydrates,
polymorphs, co-crystals, tautomers, stereoisomers, isotopically
labeled derivatives, and prodrugs thereof.
[0287] In another aspect, the present disclosure provides compounds
of Formula (II):
##STR00208##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0288] In certain embodiments, the compound of Formula (II) is of
formula:
##STR00209##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0289] In certain embodiments, the compound of Formula (II) is of
formula:
##STR00210##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0290] In certain embodiments, the compound of Formula (II) is of
formula:
##STR00211##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0291] In certain embodiments, the compound of Formula (II) is of
formula:
##STR00212##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0292] In certain embodiments, the compound of Formula (II) is of
formula:
##STR00213##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0293] In certain embodiments, the compound of Formula (II) is of
formula:
##STR00214##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0294] In certain embodiments, the compound of Formula (II) is of
formula:
##STR00215##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0295] In certain embodiments, the compound of Formula (II) is of
formula:
##STR00216## ##STR00217##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0296] In certain embodiments, the compound of Formula (II) is of
formula:
##STR00218## ##STR00219##
or a pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof.
[0297] Exemplary compounds of Formula (II) include, but are not
limited to:
##STR00220##
and pharmaceutically acceptable salts, solvates, hydrates,
polymorphs, co-crystals, tautomers, stereoisomers, isotopically
labeled derivatives, and prodrugs thereof.
[0298] Exemplary compounds of Formula (II) include, but are not
limited to:
##STR00221##
and pharmaceutically acceptable salts, solvates, hydrates,
polymorphs, co-crystals, tautomers, stereoisomers, isotopically
labeled derivatives, and prodrugs thereof.
Pharmaceutical Compositions, Kits, and Administration
[0299] The present disclosure also provides pharmaceutical
compositions comprising a compound described herein and optionally
a pharmaceutically acceptable excipient. In certain embodiments, a
compound described herein is a compound of Formula (I') or (II), or
a pharmaceutically acceptable salt thereof, and a pharmaceutically
acceptable excipient.
[0300] In certain embodiments, the compound described herein is
provided in an effective amount in the pharmaceutical composition.
In certain embodiments, the effective amount is a therapeutically
effective amount. In certain embodiments, the effective amount is a
prophylactically effective amount. In certain embodiments, a
therapeutically effective amount is an amount effective for
inhibiting the activity of a CDK (e.g., CDK12). In certain
embodiments, a therapeutically effective amount is an amount
effective for treating a disease (e.g., a disease associated with
aberrant activity of a CDK (e.g., proliferative disease)). In
certain embodiments, a therapeutically effective amount is an
amount effective for inhibiting the activity of a CDK (e.g., CDK12)
and treating a disease (e.g., a disease associated with aberrant
activity of a CDK (e.g., proliferative disease)). In certain
embodiments, a therapeutically effective amount is an amount
effective for inducing apoptosis in a cell. In certain embodiments,
a therapeutically effective amount is an amount effective for
affecting cell cycle control. In certain embodiments, a
therapeutically effective amount is an amount effective for
affecting DNA repair or DNA damage response. In certain
embodiments, a prophylactically effective amount is an amount
effective for inhibiting the activity of a CDK (e.g., CDK12). In
certain embodiments, a prophylactically effective amount is an
amount effective for preventing or keeping a subject in need
thereof in remission of a disease (e.g., a disease associated with
aberrant activity of a CDK (e.g., proliferative disease)). In
certain embodiments, a prophylactically effective amount is an
amount effective for inhibiting the activity of a CDK (e.g., CDK12,
or a mutant form of CDK12), and preventing or keeping a subject in
need thereof in remission of a disease (e.g., a disease associated
with the activity of a CDK (e.g., proliferative disease)). In
certain embodiments, a prophylactically effective amount is an
amount effective for inducing apoptosis in a cell.
[0301] In certain embodiments, the effective amount is an amount
effective for inhibiting the activity of a CDK (e.g., CDK12) by at
least 10%, at least 20%, at least 30%, at least 40%, at least 50%,
at least 60%, at least 70%, at least 80%, at least 90%, at least
95%, or at least 98%. In certain embodiments, the effective amount
is an amount effective for inhibiting the activity of a CDK (e.g.,
CDK12) by not more than 10%, not more than 20%, not more than 30%,
not more than 40%, not more than 50%, not more than 60%, not more
than 70%, not more than 80%, not more than 90%, not more than 95%,
or not more than 98%.
[0302] In certain embodiments, the subject is an animal. The animal
may be of either sex and may be at any stage of development. In
certain embodiments, the subject described herein is a human. In
certain embodiments, the subject is a non-human animal. In certain
embodiments, the subject is a mammal. In certain embodiments, the
subject is a non-human mammal. In certain embodiments, the subject
is a domesticated animal, such as a dog, cat, cow, pig, horse,
sheep, or goat. In certain embodiments, the subject is a companion
animal, such as a dog or cat. In certain embodiments, the subject
is a livestock animal, such as a cow, pig, horse, sheep, or goat.
In certain embodiments, the subject is a zoo animal. In another
embodiment, the subject is a research animal, such as a rodent
(e.g., mouse, rat), dog, pig, or non-human primate. In certain
embodiments, the animal is a genetically engineered animal. In
certain embodiments, the animal is a transgenic animal (e.g.,
transgenic mice and transgenic pigs). In certain embodiments, the
subject is a fish or reptile.
[0303] In certain embodiments, the cell being contacted with a
compound or composition described herein is in vitro. In certain
embodiments, the cell being contacted with a compound or
composition described herein is in vivo.
[0304] Pharmaceutical compositions described herein can be prepared
by any method known in the art of pharmacology. In general, such
preparatory methods include bringing the compound described herein
(i.e., the "active ingredient") into association with a carrier or
excipient, and/or one or more other accessory ingredients, and
then, if necessary and/or desirable, shaping, and/or packaging the
product into a desired single- or multi-dose unit.
[0305] Pharmaceutical compositions can be prepared, packaged,
and/or sold in bulk, as a single unit dose, and/or as a plurality
of single unit doses. A "unit dose" is a discrete amount of the
pharmaceutical composition comprising a predetermined amount of the
active ingredient. The amount of the active ingredient is generally
equal to the dosage of the active ingredient which would be
administered to a subject and/or a convenient fraction of such a
dosage, such as one-half or one-third of such a dosage.
[0306] Relative amounts of the active ingredient, the
pharmaceutically acceptable excipient, and/or any additional
ingredients in a pharmaceutical composition described herein will
vary, depending upon the identity, size, and/or condition of the
subject treated and further depending upon the route by which the
composition is to be administered. The composition may comprise
between 0.1% and 100% (w/w) active ingredient.
[0307] Pharmaceutically acceptable excipients used in the
manufacture of provided pharmaceutical compositions include inert
diluents, dispersing and/or granulating agents, surface active
agents and/or emulsifiers, disintegrating agents, binding agents,
preservatives, buffering agents, lubricating agents, and/or oils.
Excipients such as cocoa butter and suppository waxes, coloring
agents, coating agents, sweetening, flavoring, and perfuming agents
may also be present in the composition.
[0308] Exemplary diluents include calcium carbonate, sodium
carbonate, calcium phosphate, dicalcium phosphate, calcium sulfate,
calcium hydrogen phosphate, sodium phosphate lactose, sucrose,
cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol,
inositol, sodium chloride, dry starch, cornstarch, powdered sugar,
and mixtures thereof.
[0309] Exemplary granulating and/or dispersing agents include
potato starch, corn starch, tapioca starch, sodium starch
glycolate, clays, alginic acid, guar gum, citrus pulp, agar,
bentonite, cellulose, and wood products, natural sponge,
cation-exchange resins, calcium carbonate, silicates, sodium
carbonate, cross-linked poly(vinyl-pyrrolidone) (crospovidone),
sodium carboxymethyl starch (sodium starch glycolate),
carboxymethyl cellulose, cross-linked sodium carboxymethyl
cellulose (croscarmellose), methylcellulose, pregelatinized starch
(starch 1500), microcrystalline starch, water insoluble starch,
calcium carboxymethyl cellulose, magnesium aluminum silicate
(Veegum), sodium lauryl sulfate, quaternary ammonium compounds, and
mixtures thereof.
[0310] Exemplary surface active agents and/or emulsifiers include
natural emulsifiers (e.g., acacia, agar, alginic acid, sodium
alginate, tragacanth, chondrux, cholesterol, xanthan, pectin,
gelatin, egg yolk, casein, wool fat, cholesterol, wax, and
lecithin), colloidal clays (e.g., bentonite (aluminum silicate) and
Veegum (magnesium aluminum silicate)), long chain amino acid
derivatives, high molecular weight alcohols (e.g., stearyl alcohol,
cetyl alcohol, oleyl alcohol, triacetin monostearate, ethylene
glycol distearate, glyceryl monostearate, and propylene glycol
monostearate, polyvinyl alcohol), carbomers (e.g., carboxy
polymethylene, polyacrylic acid, acrylic acid polymer, and
carboxyvinyl polymer), carrageenan, cellulosic derivatives (e.g.,
carboxymethylcellulose sodium, powdered cellulose, hydroxymethyl
cellulose, hydroxypropyl cellulose, hydroxypropyl methylcellulose,
methylcellulose), sorbitan fatty acid esters (e.g., polyoxyethylene
sorbitan monolaurate (Tween.RTM. 20), polyoxyethylene sorbitan
(Tween.RTM. 60), polyoxyethylene sorbitan monooleate (Tween.RTM.
80), sorbitan monopalmitate (Span.RTM. 40), sorbitan monostearate
(Span.RTM. 60), sorbitan tristearate (Span.RTM. 65), glyceryl
monooleate, sorbitan monooleate (Span.RTM. 80), polyoxyethylene
esters (e.g., polyoxyethylene monostearate (Myrj.RTM. 45),
polyoxyethylene hydrogenated castor oil, polyethoxylated castor
oil, polyoxymethylene stearate, and Solutol.RTM.), sucrose fatty
acid esters, polyethylene glycol fatty acid esters (e.g.,
Cremophor.RTM.), polyoxyethylene ethers, (e.g., polyoxyethylene
lauryl ether (Brij.RTM. 30)), poly(vinyl-pyrrolidone), diethylene
glycol monolaurate, triethanolamine oleate, sodium oleate,
potassium oleate, ethyl oleate, oleic acid, ethyl laurate, sodium
lauryl sulfate, Pluronic.RTM. F-68, poloxamer P-188, cetrimonium
bromide, cetylpyridinium chloride, benzalkonium chloride, docusate
sodium, and/or mixtures thereof.
[0311] Exemplary binding agents include starch (e.g., cornstarch
and starch paste), gelatin, sugars (e.g., sucrose, glucose,
dextrose, dextrin, molasses, lactose, lactitol, mannitol, etc.),
natural and synthetic gums (e.g., acacia, sodium alginate, extract
of Irish moss, panwar gum, ghatti gum, mucilage of isapol husks,
carboxymethylcellulose, methylcellulose, ethylcellulose,
hydroxyethylcellulose, hydroxypropyl cellulose, hydroxypropyl
methylcellulose, microcrystalline cellulose, cellulose acetate,
poly(vinyl-pyrrolidone), magnesium aluminum silicate (Veegum.RTM.),
and larch arabogalactan), alginates, polyethylene oxide,
polyethylene glycol, inorganic calcium salts, silicic acid,
polymethacrylates, waxes, water, alcohol, and/or mixtures
thereof.
[0312] Exemplary preservatives include antioxidants, chelating
agents, antimicrobial preservatives, antifungal preservatives,
antiprotozoan preservatives, alcohol preservatives, acidic
preservatives, and other preservatives. In certain embodiments, the
preservative is an antioxidant. In other embodiments, the
preservative is a chelating agent.
[0313] Exemplary antioxidants include alpha tocopherol, ascorbic
acid, acorbyl palmitate, butylated hydroxyanisole, butylated
hydroxytoluene, monothioglycerol, potassium metabisulfite,
propionic acid, propyl gallate, sodium ascorbate, sodium bisulfite,
sodium metabisulfite, and sodium sulfite.
[0314] Exemplary chelating agents include
ethylenediaminetetraacetic acid (EDTA) and salts and hydrates
thereof (e.g., sodium edetate, disodium edetate, trisodium edetate,
calcium disodium edetate, dipotassium edetate, and the like),
citric acid and salts and hydrates thereof (e.g., citric acid
monohydrate), fumaric acid and salts and hydrates thereof, malic
acid and salts and hydrates thereof, phosphoric acid and salts and
hydrates thereof, and tartaric acid and salts and hydrates thereof.
Exemplary antimicrobial preservatives include benzalkonium
chloride, benzethonium chloride, benzyl alcohol, bronopol,
cetrimide, cetylpyridinium chloride, chlorhexidine, chlorobutanol,
chlorocresol, chloroxylenol, cresol, ethyl alcohol, glycerin,
hexetidine, imidurea, phenol, phenoxyethanol, phenylethyl alcohol,
phenylmercuric nitrate, propylene glycol, and thimerosal.
[0315] Exemplary antifungal preservatives include butyl paraben,
methyl paraben, ethyl paraben, propyl paraben, benzoic acid,
hydroxybenzoic acid, potassium benzoate, potassium sorbate, sodium
benzoate, sodium propionate, and sorbic acid.
[0316] Exemplary alcohol preservatives include ethanol,
polyethylene glycol, phenol, phenolic compounds, bisphenol,
chlorobutanol, hydroxybenzoate, and phenylethyl alcohol.
[0317] Exemplary acidic preservatives include vitamin A, vitamin C,
vitamin E, beta-carotene, citric acid, acetic acid, dehydroacetic
acid, ascorbic acid, sorbic acid, and phytic acid.
[0318] Other preservatives include tocopherol, tocopherol acetate,
deteroxime mesylate, cetrimide, butylated hydroxyanisol (BHA),
butylated hydroxytoluened (BHT), ethylenediamine, sodium lauryl
sulfate (SLS), sodium lauryl ether sulfate (SLES), sodium
bisulfite, sodium metabisulfite, potassium sulfite, potassium
metabisulfite, Glydant.RTM. Plus, Phenonip.RTM., methylparaben,
Germall.RTM. 115, Germaben.RTM. II, Neolone.RTM., Kathon.RTM., and
Euxyl.RTM..
[0319] Exemplary buffering agents include citrate buffer solutions,
acetate buffer solutions, phosphate buffer solutions, ammonium
chloride, calcium carbonate, calcium chloride, calcium citrate,
calcium glubionate, calcium gluceptate, calcium gluconate,
D-gluconic acid, calcium glycerophosphate, calcium lactate,
propanoic acid, calcium levulinate, pentanoic acid, dibasic calcium
phosphate, phosphoric acid, tribasic calcium phosphate, calcium
hydroxide phosphate, potassium acetate, potassium chloride,
potassium gluconate, potassium mixtures, dibasic potassium
phosphate, monobasic potassium phosphate, potassium phosphate
mixtures, sodium acetate, sodium bicarbonate, sodium chloride,
sodium citrate, sodium lactate, dibasic sodium phosphate, monobasic
sodium phosphate, sodium phosphate mixtures, tromethamine,
magnesium hydroxide, aluminum hydroxide, alginic acid, pyrogen-free
water, isotonic saline, Ringer's solution, ethyl alcohol, and
mixtures thereof.
[0320] Exemplary lubricating agents include magnesium stearate,
calcium stearate, stearic acid, silica, talc, malt, glyceryl
behanate, hydrogenated vegetable oils, polyethylene glycol, sodium
benzoate, sodium acetate, sodium chloride, leucine, magnesium
lauryl sulfate, sodium lauryl sulfate, and mixtures thereof.
[0321] Exemplary natural oils include almond, apricot kernel,
avocado, babassu, bergamot, black current seed, borage, cade,
camomile, canola, caraway, carnauba, castor, cinnamon, cocoa
butter, coconut, cod liver, coffee, corn, cotton seed, emu,
eucalyptus, evening primrose, fish, flaxseed, geraniol, gourd,
grape seed, hazel nut, hyssop, isopropyl myristate, jojoba, kukui
nut, lavandin, lavender, lemon, litsea cubeba, macademia nut,
mallow, mango seed, meadowfoam seed, mink, nutmeg, olive, orange,
orange roughy, palm, palm kernel, peach kernel, peanut, poppy seed,
pumpkin seed, rapeseed, rice bran, rosemary, safflower, sandalwood,
sasquana, savoury, sea buckthorn, sesame, shea butter, silicone,
soybean, sunflower, tea tree, thistle, tsubaki, vetiver, walnut,
and wheat germ oils. Exemplary synthetic oils include, but are not
limited to, butyl stearate, caprylic triglyceride, capric
triglyceride, cyclomethicone, diethyl sebacate, dimethicone 360,
isopropyl myristate, mineral oil, octyldodecanol, oleyl alcohol,
silicone oil, and mixtures thereof.
[0322] Liquid dosage forms for oral and parenteral administration
include pharmaceutically acceptable emulsions, microemulsions,
solutions, suspensions, syrups and elixirs. In addition to the
active ingredients, the liquid dosage forms may comprise inert
diluents commonly used in the art such as, for example, water or
other solvents, solubilizing agents and emulsifiers such as ethyl
alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl
alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol,
dimethylformamide, oils (e.g., cottonseed, groundnut, corn, germ,
olive, castor, and sesame oils), glycerol, tetrahydrofurfuryl
alcohol, polyethylene glycols and fatty acid esters of sorbitan,
and mixtures thereof. Besides inert diluents, the oral compositions
can include adjuvants such as wetting agents, emulsifying and
suspending agents, sweetening, flavoring, and perfuming agents. In
certain embodiments for parenteral administration, the conjugates
described herein are mixed with solubilizing agents such as
Cremophor.RTM., alcohols, oils, modified oils, glycols,
polysorbates, cyclodextrins, polymers, and mixtures thereof.
[0323] Injectable preparations, for example, sterile injectable
aqueous or oleaginous suspensions can be formulated according to
the known art using suitable dispersing or wetting agents and
suspending agents. The sterile injectable preparation can be a
sterile injectable solution, suspension, or emulsion in a nontoxic
parenterally acceptable diluent or solvent, for example, as a
solution in 1,3-butanediol. Among the acceptable vehicles and
solvents that can be employed are water, Ringer's solution, U.S.P.,
and isotonic sodium chloride solution. In addition, sterile, fixed
oils are conventionally employed as a solvent or suspending medium.
For this purpose any bland fixed oil can be employed including
synthetic mono- or di-glycerides. In addition, fatty acids such as
oleic acid are used in the preparation of injectables.
[0324] The injectable formulations can be sterilized, for example,
by filtration through a bacterial-retaining filter, or by
incorporating sterilizing agents in the form of sterile solid
compositions which can be dissolved or dispersed in sterile water
or other sterile injectable medium prior to use.
[0325] In order to prolong the effect of a drug, it is often
desirable to slow the absorption of the drug from subcutaneous or
intramuscular injection. This can be accomplished by the use of a
liquid suspension of crystalline or amorphous material with poor
water solubility. The rate of absorption of the drug then depends
upon its rate of dissolution, which, in turn, may depend upon
crystal size and crystalline form. Alternatively, delayed
absorption of a parenterally administered drug form may be
accomplished by dissolving or suspending the drug in an oil
vehicle.
[0326] Compositions for rectal or vaginal administration are
typically suppositories which can be prepared by mixing the
conjugates described herein with suitable non-irritating excipients
or carriers such as cocoa butter, polyethylene glycol, or a
suppository wax which are solid at ambient temperature but liquid
at body temperature and therefore melt in the rectum or vaginal
cavity and release the active ingredient.
[0327] Solid dosage forms for oral administration include capsules,
tablets, pills, powders, and granules. In such solid dosage forms,
the active ingredient is mixed with at least one inert,
pharmaceutically acceptable excipient or carrier such as sodium
citrate or dicalcium phosphate and/or (a) fillers or extenders such
as starches, lactose, sucrose, glucose, mannitol, and silicic acid,
(b) binders such as, for example, carboxymethylcellulose,
alginates, gelatin, polyvinylpyrrolidinone, sucrose, and acacia,
(c) humectants such as glycerol, (d) disintegrating agents such as
agar, calcium carbonate, potato or tapioca starch, alginic acid,
certain silicates, and sodium carbonate, (e) solution retarding
agents such as paraffin, (f) absorption accelerators such as
quaternary ammonium compounds, (g) wetting agents such as, for
example, cetyl alcohol and glycerol monostearate, (h) absorbents
such as kaolin and bentonite clay, and (i) lubricants such as talc,
calcium stearate, magnesium stearate, solid polyethylene glycols,
sodium lauryl sulfate, and mixtures thereof. In the case of
capsules, tablets, and pills, the dosage form may include a
buffering agent.
[0328] Solid compositions of a similar type can be employed as
fillers in soft and hard-filled gelatin capsules using such
excipients as lactose or milk sugar as well as high molecular
weight polyethylene glycols and the like. The solid dosage forms of
tablets, dragees, capsules, pills, and granules can be prepared
with coatings and shells such as enteric coatings and other
coatings well known in the art of pharmacology. They may optionally
comprise opacifying agents and can be of a composition that they
release the active ingredient(s) only, or preferentially, in a
certain part of the intestinal tract, optionally, in a delayed
manner. Examples of encapsulating compositions which can be used
include polymeric substances and waxes. Solid compositions of a
similar type can be employed as fillers in soft and hard-filled
gelatin capsules using such excipients as lactose or milk sugar as
well as high molecular weight polethylene glycols and the like.
[0329] The active ingredient can be in a micro-encapsulated form
with one or more excipients as noted above. The solid dosage forms
of tablets, dragees, capsules, pills, and granules can be prepared
with coatings and shells such as enteric coatings, release
controlling coatings, and other coatings well known in the
pharmaceutical formulating art. In such solid dosage forms the
active ingredient can be admixed with at least one inert diluent
such as sucrose, lactose, or starch. Such dosage forms may
comprise, as is normal practice, additional substances other than
inert diluents, e.g., tableting lubricants and other tableting aids
such a magnesium stearate and microcrystalline cellulose. In the
case of capsules, tablets and pills, the dosage forms may comprise
buffering agents. They may optionally comprise opacifying agents
and can be of a composition that they release the active
ingredient(s) only, or preferentially, in a certain part of the
intestinal tract, optionally, in a delayed manner. Examples of
encapsulating agents which can be used include polymeric substances
and waxes.
[0330] Dosage forms for topical and/or transdermal administration
of a compound described herein may include ointments, pastes,
creams, lotions, gels, powders, solutions, sprays, inhalants,
and/or patches. Generally, the active ingredient is admixed under
sterile conditions with a pharmaceutically acceptable carrier or
excipient and/or any needed preservatives and/or buffers as can be
required. Additionally, the present disclosure contemplates the use
of transdermal patches, which often have the added advantage of
providing controlled delivery of an active ingredient to the body.
Such dosage forms can be prepared, for example, by dissolving
and/or dispensing the active ingredient in the proper medium.
Alternatively or additionally, the rate can be controlled by either
providing a rate controlling membrane and/or by dispersing the
active ingredient in a polymer matrix and/or gel.
[0331] Suitable devices for use in delivering intradermal
pharmaceutical compositions described herein include short needle
devices. Intradermal compositions can be administered by devices
which limit the effective penetration length of a needle into the
skin. Alternatively or additionally, conventional syringes can be
used in the classical mantoux method of intradermal administration.
Jet injection devices which deliver liquid formulations to the
dermis via a liquid jet injector and/or via a needle which pierces
the stratum corneum and produces a jet which reaches the dermis are
suitable. Ballistic powder/particle delivery devices which use
compressed gas to accelerate the compound in powder form through
the outer layers of the skin to the dermis are suitable.
[0332] Formulations suitable for topical administration include,
but are not limited to, liquid and/or semi-liquid preparations such
as liniments, lotions, oil-in-water and/or water-in-oil emulsions
such as creams, ointments, and/or pastes, and/or solutions and/or
suspensions. Topically administrable formulations may, for example,
comprise from about 1% to about 10% (w/w) active ingredient,
although the concentration of the active ingredient can be as high
as the solubility limit of the active ingredient in the solvent.
Formulations for topical administration may further comprise one or
more of the additional ingredients described herein.
[0333] A pharmaceutical composition described herein can be
prepared, packaged, and/or sold in a formulation suitable for
pulmonary administration via the buccal cavity. Such a formulation
may comprise dry particles which comprise the active ingredient and
which have a diameter in the range from about 0.5 to about 7
nanometers, or from about 1 to about 6 nanometers. Such
compositions are conveniently in the form of dry powders for
administration using a device comprising a dry powder reservoir to
which a stream of propellant can be directed to disperse the powder
and/or using a self-propelling solvent/powder dispensing container
such as a device comprising the active ingredient dissolved and/or
suspended in a low-boiling propellant in a sealed container. Such
powders comprise particles wherein at least 98% of the particles by
weight have a diameter greater than 0.5 nanometers and at least 95%
of the particles by number have a diameter less than 7 nanometers.
Alternatively, at least 95% of the particles by weight have a
diameter greater than 1 nanometer and at least 90% of the particles
by number have a diameter less than 6 nanometers. Dry powder
compositions may include a solid fine powder diluent such as sugar
and are conveniently provided in a unit dose form.
[0334] Low boiling propellants generally include liquid propellants
having a boiling point of below 65.degree. F. at atmospheric
pressure. Generally the propellant may constitute 50 to 99.9% (w/w)
of the composition, and the active ingredient may constitute 0.1 to
20% (w/w) of the composition. The propellant may further comprise
additional ingredients such as a liquid non-ionic and/or solid
anionic surfactant and/or a solid diluent (which may have a
particle size of the same order as particles comprising the active
ingredient).
[0335] Pharmaceutical compositions described herein formulated for
pulmonary delivery may provide the active ingredient in the form of
droplets of a solution and/or suspension. Such formulations can be
prepared, packaged, and/or sold as aqueous and/or dilute alcoholic
solutions and/or suspensions, optionally sterile, comprising the
active ingredient, and may conveniently be administered using any
nebulization and/or atomization device. Such formulations may
further comprise one or more additional ingredients including, but
not limited to, a flavoring agent such as saccharin sodium, a
volatile oil, a buffering agent, a surface active agent, and/or a
preservative such as methylhydroxybenzoate. The droplets provided
by this route of administration may have an average diameter in the
range from about 0.1 to about 200 nanometers.
[0336] Formulations described herein as being useful for pulmonary
delivery are useful for intranasal delivery of a pharmaceutical
composition described herein. Another formulation suitable for
intranasal administration is a coarse powder comprising the active
ingredient and having an average particle from about 0.2 to 500
micrometers. Such a formulation is administered by rapid inhalation
through the nasal passage from a container of the powder held close
to the nares.
[0337] Formulations for nasal administration may, for example,
comprise from about as little as 0.1% (w/w) to as much as 100%
(w/w) of the active ingredient, and may comprise one or more of the
additional ingredients described herein. A pharmaceutical
composition described herein can be prepared, packaged, and/or sold
in a formulation for buccal administration. Such formulations may,
for example, be in the form of tablets and/or lozenges made using
conventional methods, and may contain, for example, 0.1 to 20%
(w/w) active ingredient, the balance comprising an orally
dissolvable and/or degradable composition and, optionally, one or
more of the additional ingredients described herein. Alternately,
formulations for buccal administration may comprise a powder and/or
an aerosolized and/or atomized solution and/or suspension
comprising the active ingredient. Such powdered, aerosolized,
and/or aerosolized formulations, when dispersed, may have an
average particle and/or droplet size in the range from about 0.1 to
about 200 nanometers, and may further comprise one or more of the
additional ingredients described herein.
[0338] A pharmaceutical composition described herein can be
prepared, packaged, and/or sold in a formulation for ophthalmic
administration. Such formulations may, for example, be in the form
of eye drops including, for example, a 0.1-1.0% (w/w) solution
and/or suspension of the active ingredient in an aqueous or oily
liquid carrier or excipient. Such drops may further comprise
buffering agents, salts, and/or one or more other of the additional
ingredients described herein. Other opthalmically-administrable
formulations which are useful include those which comprise the
active ingredient in microcrystalline form and/or in a liposomal
preparation. Ear drops and/or eye drops are also contemplated as
being within the scope of this disclosure.
[0339] Although the descriptions of pharmaceutical compositions
provided herein are principally directed to pharmaceutical
compositions which are suitable for administration to humans, it
will be understood by the skilled artisan that such compositions
are generally suitable for administration to animals of all sorts.
Modification of pharmaceutical compositions suitable for
administration to humans in order to render the compositions
suitable for administration to various animals is well understood,
and the ordinarily skilled veterinary pharmacologist can design
and/or perform such modification with ordinary experimentation.
[0340] Compounds provided herein are typically formulated in dosage
unit form for ease of administration and uniformity of dosage. It
will be understood, however, that the total daily usage of the
compositions described herein will be decided by a physician within
the scope of sound medical judgment. The specific therapeutically
effective dose level for any particular subject or organism will
depend upon a variety of factors including the disease being
treated and the severity of the disorder; the activity of the
specific active ingredient employed; the specific composition
employed; the age, body weight, general health, sex, and diet of
the subject; the time of administration, route of administration,
and rate of excretion of the specific active ingredient employed;
the duration of the treatment; drugs used in combination or
coincidental with the specific active ingredient employed; and like
factors well known in the medical arts.
[0341] The compounds and compositions provided herein can be
administered by any route, including enteral (e.g., oral),
parenteral, intravenous, intramuscular, intra-arterial,
intramedullary, intrathecal, subcutaneous, intraventricular,
transdermal, interdermal, rectal, intravaginal, intraperitoneal,
topical (as by powders, ointments, creams, and/or drops), mucosal,
nasal, bucal, sublingual; by intratracheal instillation, bronchial
instillation, and/or inhalation; and/or as an oral spray, nasal
spray, and/or aerosol. Specifically contemplated routes are oral
administration, intravenous administration (e.g., systemic
intravenous injection), regional administration via blood and/or
lymph supply, and/or direct administration to an affected site. In
general, the most appropriate route of administration will depend
upon a variety of factors including the nature of the agent (e.g.,
its stability in the environment of the gastrointestinal tract),
and/or the condition of the subject (e.g., whether the subject is
able to tolerate oral administration). In certain embodiments, the
compound or pharmaceutical composition described herein is suitable
for topical administration to the eye of a subject.
[0342] The exact amount of a compound required to achieve an
effective amount will vary from subject to subject, depending, for
example, on species, age, and general condition of a subject,
severity of the side effects or disorder, identity of the
particular compound, mode of administration, and the like. An
effective amount may be included in a single dose (e.g., single
oral dose) or multiple doses (e.g., multiple oral doses). In
certain embodiments, when multiple doses are administered to a
subject or applied to a biological sample, tissue, or cell, any two
doses of the multiple doses include different or substantially the
same amounts of a compound described herein. In certain
embodiments, when multiple doses are administered to a subject or
applied to a biological sample, tissue, or cell, the frequency of
administering the multiple doses to the subject or applying the
multiple doses to the biological sample, tissue, or cell is three
doses a day, two doses a day, one dose a day, one dose every other
day, one dose every third day, one dose every week, one dose every
two weeks, one dose every three weeks, or one dose every four
weeks. In certain embodiments, the frequency of administering the
multiple doses to the subject or applying the multiple doses to the
biological sample, tissue, or cell is one dose per day. In certain
embodiments, the frequency of administering the multiple doses to
the subject or applying the multiple doses to the biological
sample, tissue, or cell is two doses per day. In certain
embodiments, the frequency of administering the multiple doses to
the subject or applying the multiple doses to the biological
sample, tissue, or cell is three doses per day. In certain
embodiments, when multiple doses are administered to a subject or
applied to a biological sample, tissue, or cell, the duration
between the first dose and last dose of the multiple doses is one
day, two days, four days, one week, two weeks, three weeks, one
month, two months, three months, four months, six months, nine
months, one year, two years, three years, four years, five years,
seven years, ten years, fifteen years, twenty years, or the
lifetime of the subject, tissue, or cell. In certain embodiments,
the duration between the first dose and last dose of the multiple
doses is three months, six months, or one year. In certain
embodiments, the duration between the first dose and last dose of
the multiple doses is the lifetime of the subject, tissue, or cell.
In certain embodiments, a dose (e.g., a single dose, or any dose of
multiple doses) described herein includes independently between 0.1
.mu.g and 1 .mu.g, between 0.001 mg and 0.01 mg, between 0.01 mg
and 0.1 mg, between 0.1 mg and 1 mg, between 1 mg and 3 mg, between
3 mg and 10 mg, between 10 mg and 30 mg, between 30 mg and 100 mg,
between 100 mg and 300 mg, between 300 mg and 1,000 mg, or between
1 g and 10 g, inclusive, of a compound described herein. In certain
embodiments, a dose described herein includes independently between
1 mg and 3 mg, inclusive, of a compound described herein. In
certain embodiments, a dose described herein includes independently
between 3 mg and 10 mg, inclusive, of a compound described herein.
In certain embodiments, a dose described herein includes
independently between 10 mg and 30 mg, inclusive, of a compound
described herein. In certain embodiments, a dose described herein
includes independently between 30 mg and 100 mg, inclusive, of a
compound described herein.
[0343] Dose ranges as described herein provide guidance for the
administration of provided pharmaceutical compositions to an adult.
The amount to be administered to, for example, a child or an
adolescent can be determined by a medical practitioner or person
skilled in the art and can be lower or the same as that
administered to an adult.
[0344] A compound or composition, as described herein, can be
administered in combination with one or more additional
pharmaceutical agents (e.g., therapeutically and/or
prophylactically active agents). The compounds or compositions can
be administered in combination with additional pharmaceutical
agents that improve their activity (e.g., activity (e.g., potency
and/or efficacy) in treating a disease in a subject in need
thereof, in preventing a disease in a subject in need thereof, in
inhibiting the activity of a protein kinase (e.g., CDK) in a
subject, biological sample, tissue, or cell), improve
bioavailability, improve safety, reduce drug resistance, reduce
and/or modify metabolism, inhibit excretion, and/or modify
distribution in a subject, biological sample, tissue, or cell. It
will also be appreciated that the therapy employed may achieve a
desired effect for the same disorder, and/or it may achieve
different effects. In certain embodiments, a pharmaceutical
composition described herein including a compound described herein
and an additional pharmaceutical agent shows a synergistic effect
that is absent in a pharmaceutical composition including one of the
compound and the additional pharmaceutical agent, but not both.
[0345] The compound or composition can be administered concurrently
with, prior to, or subsequent to one or more additional
pharmaceutical agents, which may be useful as, e.g., combination
therapies. Pharmaceutical agents include therapeutically active
agents. Pharmaceutical agents also include prophylactically active
agents. Pharmaceutical agents include small organic molecules such
as drug compounds (e.g., compounds approved for human or veterinary
use by the U.S. Food and Drug Administration as provided in the
Code of Federal Regulations (CFR)), peptides, proteins,
carbohydrates, monosaccharides, oligosaccharides, polysaccharides,
nucleoproteins, mucoproteins, lipoproteins, synthetic polypeptides
or proteins, small molecules linked to proteins, glycoproteins,
steroids, nucleic acids, DNAs, RNAs, nucleotides, nucleosides,
oligonucleotides, antisense oligonucleotides, lipids, hormones,
vitamins, and cells. In certain embodiments, the additional
pharmaceutical agent is a pharmaceutical agent useful for treating
and/or preventing a disease (e.g., proliferative disease,
inflammatory disease, autoimmune disease, genetic disease,
hematological disease, neurological disease, painful condition,
psychiatric disorder, or metabolic disorder). Each additional
pharmaceutical agent may be administered at a dose and/or on a time
schedule determined for that pharmaceutical agent. The additional
pharmaceutical agents may also be administered together with each
other and/or with the compound or composition described herein in a
single dose or administered separately in different doses. The
particular combination to employ in a regimen will take into
account compatibility of the compound described herein with the
additional pharmaceutical agent(s) and/or the desired therapeutic
and/or prophylactic effect to be achieved. In general, it is
expected that the additional pharmaceutical agent(s) in combination
be utilized at levels that do not exceed the levels at which they
are utilized individually. In some embodiments, the levels utilized
in combination will be lower than those utilized individually.
[0346] The additional pharmaceutical agents include, but are not
limited to, anti-proliferative agents, anti-cancer agents,
anti-angiogenesis agents, anti-inflammatory agents,
immunosuppressants, anti-bacterial agents, anti-viral agents,
cardiovascular agents, cholesterol-lowering agents, anti-diabetic
agents, anti-allergic agents, contraceptive agents, pain-relieving
agents, and a combination thereof. In certain embodiments, the
additional pharmaceutical agent is an anti-proliferative agent
(e.g., anti-cancer agent). In certain embodiments, the additional
pharmaceutical agent is an anti-leukemia agent. In certain
embodiments, the additional pharmaceutical agent is ABITREXATE
(methotrexate), ADE, Adriamycin RDF (doxorubicin hydrochloride),
Ambochlorin (chlorambucil), ARRANON (nelarabine), ARZERRA
(ofatumumab), BOSULIF (bosutinib), BUSULFEX (busulfan), CAMPATH
(alemtuzumab), CERUBIDINE (daunorubicin hydrochloride), CLAFEN
(cyclophosphamide), CLOFAREX (clofarabine), CLOLAR (clofarabine),
CVP, CYTOSAR-U (cytarabine), CYTOXAN (cyclophosphamide), ERWINAZE
(Asparaginase Erwinia Chrysanthemi), FLUDARA (fludarabine
phosphate), FOLEX (methotrexate), FOLEX PFS (methotrexate), GAZYVA
(obinutuzumab), GLEEVEC (imatinib mesylate), Hyper-CVAD, ICLUSIG
(ponatinib hydrochloride), IMBRUVICA (ibrutinib), LEUKERAN
(chlorambucil), LINFOLIZIN (chlorambucil), MARQIBO (vincristine
sulfate liposome), METHOTREXATE LPF (methorexate), MEXATE
(methotrexate), MEXATE-AQ (methotrexate), mitoxantrone
hydrochloride, MUSTARGEN (mechlorethamine hydrochloride), MYLERAN
(busulfan), NEOSAR (cyclophosphamide), ONCASPAR (Pegaspargase),
PURINETHOL (mercaptopurine), PURIXAN (mercaptopurine), Rubidomycin
(daunorubicin hydrochloride), SPRYCEL (dasatinib), SYNRIBO
(omacetaxine mepesuccinate), TARABINE PFS (cytarabine), TASIGNA
(nilotinib), TREANDA (bendamustine hydrochloride), TRISENOX
(arsenic trioxide), VINCASAR PFS (vincristine sulfate), ZYDELIG
(idelalisib), or a combination thereof. In certain embodiments, the
additional pharmaceutical agent is an anti-lymphoma agent. In
certain embodiments, the additional pharmaceutical agent is
ABITREXATE (methotrexate), ABVD, ABVE, ABVE-PC, ADCETRIS
(brentuximab vedotin), ADRIAMYCIN PFS (doxorubicin hydrochloride),
ADRIAMYCIN RDF (doxorubicin hydrochloride), AMBOCHLORIN
(chlorambucil), AMBOCLORIN (chlorambucil), ARRANON (nelarabine),
BEACOPP, BECENUM (carmustine), BELEODAQ (belinostat), BEXXAR
(tositumomab and iodine I 131 tositumomab), BICNU (carmustine),
BLENOXANE (bleomycin), CARMUBRIS (carmustine), CHOP, CLAFEN
(cyclophosphamide), COPP, COPP-ABV, CVP, CYTOXAN
(cyclophosphamide), DEPOCYT (liposomal cytarabine), DTIC-DOME
(dacarbazine), EPOCH, FOLEX (methotrexate), FOLEX PFS
(methotrexate), FOLOTYN (pralatrexate), HYPER-CVAD, ICE, IMBRUVICA
(ibrutinib), INTRON A (recombinant interferon alfa-2b), ISTODAX
(romidepsin), LEUKERAN (chlorambucil), LINFOLIZIN (chlorambucil),
Lomustine, MATULANE (procarbazine hydrochloride), METHOTREXATE LPF
(methotrexate), MEXATE (methotrexate), MEXATE-AQ (methotrexate),
MOPP, MOZOBIL (plerixafor), MUSTARGEN (mechlorethamine
hydrochloride), NEOSAR (cyclophosphamide), OEPA, ONTAK (denileukin
diftitox), OPPA, R-CHOP, REVLIMID (lenalidomide), RITUXAN
(rituximab), STANFORD V, TREANDA (bendamustine hydrochloride),
VAMP, VELBAN (vinblastine sulfate), VELCADE (bortezomib), VELSAR
(vinblastine sulfate), VINCASAR PFS (vincristine sulfate), ZEVALIN
(ibritumomab tiuxetan), ZOLINZA (vorinostat), ZYDELIG (idelalisib),
or a combination thereof. In certain embodiments, the additional
pharmaceutical agent is REVLIMID (lenalidomide), DACOGEN
(decitabine), VIDAZA (azacitidine), CYTOSAR-U (cytarabine),
IDAMYCIN (idarubicin), CERUBIDINE (daunorubicin), LEUKERAN
(chlorambucil), NEOSAR (cyclophosphamide), FLUDARA (fludarabine),
LEUSTATIN (cladribine), or a combination thereof. In certain
embodiments, the additional pharmaceutical agent is ABITREXATE
(methotrexate), ABRAXANE (paclitaxel albumin-stabilized
nanoparticle formulation), AC, AC-T, ADE, ADRIAMYCIN PFS
(doxorubicin hydrochloride), ADRUCIL (fluorouracil), AFINITOR
(everolimus), AFINITOR DISPERZ (everolimus), ALDARA (imiquimod),
ALIMTA (pemetrexed disodium), AREDIA (pamidronate disodium),
ARIMIDEX (anastrozole), AROMASIN (exemestane), AVASTIN
(bevacizumab), BECENUM (carmustine), BEP, BICNU (carmustine),
BLENOXANE (bleomycin), CAF, CAMPTOSAR (irinotecan hydrochloride),
CAPOX, CAPRELSA (vandetanib), CARBOPLATIN-TAXOL, CARMUBRIS
(carmustine), CASODEX (bicalutamide), CEENU (lomustine), CERUBIDINE
(daunorubicin hydrochloride), CERVARIX (recombinant HPV bivalent
vaccine), CLAFEN (cyclophosphamide), CMF, COMETRIQ
(cabozantinib-s-malate), COSMEGEN (dactinomycin), CYFOS
(ifosfamide), CYRAMZA (ramucirumab), CYTOSAR-U (cytarabine),
CYTOXAN (cyclophosphamide), DACOGEN (decitabine), DEGARELIX, DOXIL
(doxorubicin hydrochloride liposome), DOXORUBICIN HYDROCHLORIDE,
DOX-SL (doxorubicin hydrochloride liposome), DTIC-DOME
(dacarbazine), EFUDEX (fluorouracil), ELLENCE (epirubicin
hydrochloride), ELOXATIN (oxaliplatin), ERBITUX (cetuximab),
ERIVEDGE (vismodegib), ETOPOPHOS (etoposide phosphate), EVACET
(doxorubicin hydrochloride liposome), FARESTON (toremifene),
FASLODEX (fulvestrant), FEC, FEMARA (letrozole), FLUOROPLEX
(fluorouracil), FOLEX (methotrexate), FOLEX PFS (methotrexate),
FOLFIRI, FOLFIRI-BEVACIZUMAB, FOLFIRI-CETUXIMAB, FOLFIRINOX,
FOLFOX, FU-LV, GARDASIL (recombinant human papillomavirus (HPV)
quadrivalent vaccine), GEMCITABINE-CISPLATIN,
GEMCITABINE-OXALIPLATIN, GEMZAR (gemcitabine hydrochloride),
GILOTRIF (afatinib dimaleate), GLEEVEC (imatinib mesylate), GLIADEL
(carmustine implant), GLIADEL WAFER (carmustine implant), HERCEPTIN
(trastuzumab), HYCAMTIN (topotecan hydrochloride), IFEX
(ifosfamide), IFOSFAMIDUM (ifosfamide), INLYTA (axitinib), INTRON A
(recombinant interferon alfa-2b), IRESSA (gefitinib), IXEMPRA
(ixabepilone), JAKAFI (ruxolitinib phosphate), JEVTANA
(cabazitaxel), KADCYLA (ado-trastuzumab emtansine), KEYTRUDA
(pembrolizumab), KYPROLIS (carfilzomib), LIPODOX (doxorubicin
hydrochloride liposome), LUPRON (leuprolide acetate), LUPRON DEPOT
(leuprolide acetate), LUPRON DEPOT-3 MONTH (leuprolide acetate),
LUPRON DEPOT-4 MONTH (leuprolide acetate), LUPRON DEPOT-PED
(leuprolide acetate), MEGACE (megestrol acetate), MEKINIST
(trametinib), METHAZOLASTONE (temozolomide), METHOTREXATE LPF
(methotrexate), MEXATE (methotrexate), MEXATE-AQ (methotrexate),
MITOXANTRONE HYDROCHLORIDE, MITOZYTREX (mitomycin c), MOZOBIL
(plerixafor), MUSTARGEN (mechlorethamine hydrochloride), MUTAMYCIN
(mitomycin c), MYLOSAR (azacitidine), NAVELBINE (vinorelbine
tartrate), NEOSAR (cyclophosphamide), NEXAVAR (sorafenib tosylate),
NOLVADEX (tamoxifen citrate), NOVALDEX (tamoxifen citrate), OFF,
PAD, PARAPLAT (carboplatin), PARAPLATIN (carboplatin), PEG-INTRON
(peginterferon alfa-2b), PEMETREXED DISODIUM, PERJETA (pertuzumab),
PLATINOL (cisplatin), PLATINOL-AQ (cisplatin), POMALYST
(pomalidomide), prednisone, PROLEUKIN (aldesleukin), PROLIA
(denosumab), PROVENGE (sipuleucel-t), REVLIMID (lenalidomide),
RUBIDOMYCIN (daunorubicin hydrochloride), SPRYCEL (dasatinib),
STIVARGA (regorafenib), SUTENT (sunitinib malate), SYLATRON
(peginterferon alfa-2b), SYLVANT (siltuximab), SYNOVIR
(thalidomide), TAC, TAFINLAR (dabrafenib), TARABINE PFS
(cytarabine), TARCEVA (erlotinib hydrochloride), TASIGNA
(nilotinib), TAXOL (paclitaxel), TAXOTERE (docetaxel), TEMODAR
(temozolomide), THALOMID (thalidomide), TOPOSAR (etoposide),
TORISEL (temsirolimus), TPF, TRISENOX (arsenic trioxide), TYKERB
(lapatinib ditosylate), VECTIBIX (panitumumab), VEIP, VELBAN
(vinblastine sulfate), VELCADE (bortezomib), VELSAR (vinblastine
sulfate), VEPESID (etoposide), VIADUR (leuprolide acetate), VIDAZA
(azacitidine), VINCASAR PFS (vincristine sulfate), VOTRIENT
(pazopanib hydrochloride), WELLCOVORIN (leucovorin calcium),
XALKORI (crizotinib), XELODA (capecitabine), XELOX, XGEVA
(denosumab), XOFIGO (radium 223 dichloride), XTANDI (enzalutamide),
YERVOY (ipilimumab), ZALTRAP (ziv-aflibercept), ZELBORAF
(vemurafenib), ZOLADEX (goserelin acetate), ZOMETA (zoledronic
acid), ZYKADIA (ceritinib), ZYTIGA (abiraterone acetate),
ENMD-2076, PCI-32765, AC220, dovitinib lactate (TK1258, CHIR-258),
BIBW 2992 (TOVOK.TM.), SGX523, PF-04217903, PF-02341066, PF-299804,
BMS-777607, ABT-869, MP470, BIBF 1120 (VARGATEF.RTM.), AP24534,
JNJ-26483327, MGCD265, DCC-2036, BMS-690154, CEP-11981, tivozanib
(AV-951), OSI-930, MM-121, XL-184, XL-647, and/or XL228),
proteasome inhibitors (e.g., bortezomib (Velcade)), mTOR inhibitors
(e.g., rapamycin, temsirolimus (CCI-779), everolimus (RAD-001),
ridaforolimus, AP23573 (Ariad), AZD8055 (AstraZeneca), BEZ235
(Novartis), BGT226 (Norvartis), XL765 (Sanofi Aventis), PF-4691502
(Pfizer), GDC0980 (Genetech), SF1126 (Semafoe) and OSI-027 (OSI)),
oblimersen, gemcitabine, carminomycin, leucovorin, pemetrexed,
cyclophosphamide, dacarbazine, procarbizine, prednisolone,
dexamethasone, campathecin, plicamycin, asparaginase, aminopterin,
methopterin, porfiromycin, melphalan, leurosidine, leurosine,
chlorambucil, trabectedin, procarbazine, discodermolide,
carminomycin, aminopterin, and hexamethyl melamine, or a
combination thereof. In certain embodiments, the additional
pharmaceutical agent is a binder or inhibitor of a CDK (e.g.,
CDK12). In certain embodiments, the additional pharmaceutical agent
is a protein kinase inhibitor (e.g., tyrosine protein kinase
inhibitor). In certain embodiments, the additional pharmaceutical
agent is selected from the group consisting of epigenetic or
transcriptional modulators (e.g., DNA methyltransferase inhibitors,
histone deacetylase inhibitors (HDAC inhibitors), lysine
methyltransferase inhibitors), antimitotic drugs (e.g., taxanes and
vinca alkaloids), hormone receptor modulators (e.g., estrogen
receptor modulators and androgen receptor modulators), cell
signaling pathway inhibitors (e.g., tyrosine protein kinase
inhibitors), modulators of protein stability (e.g., proteasome
inhibitors), Hsp90 inhibitors, glucocorticoids, all-trans retinoic
acids, and other agents that promote differentiation. In certain
embodiments, the compounds described herein or pharmaceutical
compositions can be administered in combination with an anti-cancer
therapy including, but not limited to, surgery, radiation therapy,
transplantation (e.g., stem cell transplantation, bone marrow
transplantation), immunotherapy, and chemotherapy.
[0347] Also encompassed by the disclosure are kits (e.g.,
pharmaceutical packs). The kits provided may comprise a
pharmaceutical composition or compound described herein and a
container (e.g., a vial, ampule, bottle, syringe, and/or dispenser
package, or other suitable container). In some embodiments,
provided kits may optionally further include a second container
comprising a pharmaceutical excipient for dilution or suspension of
a pharmaceutical composition or compound described herein. In some
embodiments, the pharmaceutical composition or compound described
herein provided in the first container and the second container are
combined to form one unit dosage form.
[0348] Thus, in one aspect, provided are kits including a first
container comprising a compound or pharmaceutical composition
described herein. In certain embodiments, the kits are useful for
treating a disease (e.g., proliferative disease, inflammatory
disease, autoimmune disease, genetic disease, hematological
disease, neurological disease, painful condition, psychiatric
disorder, or metabolic disorder) in a subject in need thereof. In
certain embodiments, the kits are useful for preventing a disease
(e.g., proliferative disease, inflammatory disease, autoimmune
disease, genetic disease, hematological disease, neurological
disease, painful condition, psychiatric disorder, or metabolic
disorder) in a subject in need thereof. In certain embodiments, the
kits are useful for inhibiting the activity (e.g., aberrant
activity, such as increased activity) of a protein kinase (e.g.,
CDK) in a subject, biological sample, tissue, or cell. In certain
embodiments, the kits are useful for inducing apoptosis in a
cell.
[0349] In certain embodiments, a kit described herein further
includes instructions for using the compound or pharmaceutical
composition included in the kit. A kit described herein may also
include information as required by a regulatory agency such as the
U.S. Food and Drug Administration (FDA). In certain embodiments,
the information included in the kits is prescribing information. In
certain embodiments, the kits and instructions provide for treating
a disease (e.g., proliferative disease, inflammatory disease,
autoimmune disease, genetic disease, hematological disease,
neurological disease, painful condition, psychiatric disorder, or
metabolic disorder) in a subject in need thereof. In certain
embodiments, the kits and instructions provide for preventing a
disease (e.g., proliferative disease, inflammatory disease,
autoimmune disease, genetic disease, hematological disease,
neurological disease, painful condition, psychiatric disorder, or
metabolic disorder) in a subject in need thereof. In certain
embodiments, the kits and instructions provide for modulating
(e.g., inhibiting) the activity (e.g., aberrant activity, such as
increased activity) of a CDK in a subject, biological sample,
tissue, or cell. In certain embodiments, the kits and instructions
provide for inducing apoptosis in a cell. A kit described herein
may include one or more additional pharmaceutical agents described
herein as a separate composition.
Methods of Treatment and Uses
[0350] The present disclosure provides methods of modulating (e.g.,
inhibiting or increasing) the activity (e.g., aberrant activity,
such as increased or decreased activity) of a protein kinase (e.g.,
CDK). The present disclosure provides methods of modulating (e.g.,
inhibiting or increasing) the activity (e.g., aberrant activity,
such as unwanted activity, increased activity, activity above
normal levels, or decreased activity) of a CDK (e.g., CDK12) in a
subject or cell. In certain embodiments, the CDK is a mutant form
of CDK12. The present disclosure also provides methods for the
treatment of a wide range of diseases, such as diseases associated
with aberrant activity (e.g., increased activity) of a protein
kinase, e.g., proliferative diseases, musculoskeletal diseases,
genetic diseases, hematological diseases, neurological diseases,
painful conditions, psychiatric disorders, metabolic disorders,
benign neoplasms, diseases associated with angiogenesis,
inflammatory diseases, autoinflammatory diseases, and autoimmune
diseases in a subject in need thereof. The present invention
provides methods for the treatment or prevention of a proliferative
disease (e.g., cancers (e.g., leukemia, acute lymphoblastic
leukemia, lymphoma, Burkitt's lymphoma, melanoma, multiple myeloma,
breast cancer, Ewing's sarcoma, osteosarcoma, brain cancer,
neuroblastoma, lung cancer, colorectal cancer), benign neoplasms,
diseases associated with angiogenesis, inflammatory diseases,
autoinflammatory diseases, and autoimmune diseases) in a
subject.
[0351] In another aspect, the present disclosure provides methods
of modulating the activity of a protein kinase (e.g., CDK, (e.g.,
CDK12)) in a subject or cell. In certain embodiments, provided are
methods of inhibiting the activity of a protein kinase in a
subject. In certain embodiments, the kinase is a mutant form of
CDK12. In certain embodiments, provided are methods of inhibiting
the activity of a protein kinase in a cell. In certain embodiments,
provided are methods of increasing the activity of a protein kinase
(e.g., CDK, (e.g., CDK12)) in a subject. The compounds described
herein may exhibit kinase inhibitory activity; the ability to
inhibit cyclin-dependent kinase (CDK); the ability to inhibit
cyclin-dependent kinase 12 (CDK12); the ability to inhibit
cyclin-dependent kinase 12 (CDK12), without inhibiting another
cyclin-dependent kinase (CDK); a therapeutic effect and/or
preventative effect in the treatment of cancers; a therapeutic
effect and/or preventative effect in the treatment of Myc-dependent
cancers; and/or a therapeutic profile (e.g., optimum safety and
curative effect) that is superior to existing chemotherapeutic
agents. In certain embodiments, provided are methods of inhibiting
CDK12, without inhibiting another cyclin-dependent kinase (CDK7).
In certain embodiments, provided are methods of inhibiting a mutant
form of cyclin-dependent kinase 12 (CDK12), without inhibiting
another cyclin-dependent kinase (CDK).
[0352] In certain embodiments, provided are methods of decreasing
the activity of a protein kinase (e.g., CDK, (e.g., CDK12)) in a
subject or cell described herein by at least about 1%, at least
about 3%, at least about 10%, at least about 20%, at least about
30%, at least about 40%, at least about 50%, at least about 60%, at
least about 70%, at least about 80%, or at least about 90%. In
certain embodiments, the activity of a protein kinase (e.g., CDK,
(e.g., CDK12)) in a subject or cell is decreased by a method
described herein by at least about 1%, at least about 3%, at least
about 10%, at least about 20%, at least about 30%, at least about
40%, at least about 50%, at least about 60%, at least about 70%, at
least about 80%, or at least about 90%. In some embodiments, the
activity of a protein kinase (e.g., CDK, (e.g., CDK12)) in a
subject or cell is selectively inhibited by the method. In some
embodiments, the activity of a protein kinase (e.g., CDK, (e.g.,
CDK12)) in a subject or cell is selectively decreased by the
method.
[0353] Without wishing to be bound by any particular theory, in
certain embodiments the compounds described herein are able to bind
(e.g., covalently modify) the protein kinase being inhibited. In
certain embodiments, a compound described herein is able to bind
(e.g., covalently modify) to the protein kinase. In certain
embodiments, the compound described herein is able to covalently
bind a cysteine residue of the protein kinase. In certain
embodiments, the compound described herein is able to covalently
bind residue Cys1039 of CDK12, without covalently binding other
kinases. In certain embodiments, the compound described herein is
able to covalently bind residue Cys1039 of CDK12, without
covalently binding Cys312 of CDK7. In certain embodiments, the
compound described herein is able to covalently bind residue
Cys1039 of CDK12, without covalently binding other residues of
CDK12. In certain embodiments, the compound is capable of
covalently modifying CDK12 (e.g., Cys1039 of CDK12). In certain
embodiments, the compound described herein is able to covalently
modify residue Cys1039 of CDK12. In certain embodiments, the
compound described herein is able to covalently modify residue
Cys1039 of CDK12, without covalently modifying other kinases. In
certain embodiments, the compound described herein is able to
covalently modify residue Cys1039 of CDK12, without covalently
modifying Cys312 of CDK7. In certain embodiments, the compound
described herein is able to covalently modify residue Cys1039 of
CDK12, without covalently modifying other residues of CDK12.
[0354] In another aspect, the present disclosure provides methods
of inhibiting the activity of a protein kinase in a subject, the
methods comprising administering to the subject an effective amount
(e.g., therapeutically effective amount) of a compound, or
pharmaceutical composition thereof, as described herein. In another
aspect, the present disclosure provides methods of inhibiting the
activity of a protein kinase in a biological sample, the methods
comprising contacting the biological sample with an effective
amount of a compound, or pharmaceutical composition thereof, as
described herein. In another aspect, the present disclosure
provides methods of inhibiting the activity of a protein kinase in
a tissue, the methods comprising contacting the tissue with an
effective amount of a compound, or pharmaceutical composition
thereof, as described herein.
[0355] In another aspect, the present disclosure provides methods
of inhibiting the activity of a protein kinase in a cell, the
methods comprising contacting the cell with an effective amount of
a compound, or pharmaceutical composition thereof, as described
herein.
[0356] In certain embodiments, the subject being treated is a
mammal. In certain embodiments, the subject is a human. In certain
embodiments, the subject is a domesticated animal, such as a dog,
cat, cow, pig, horse, sheep, or goat. In certain embodiments, the
subject is a companion animal such as a dog or cat. In certain
embodiments, the subject is a livestock animal such as a cow, pig,
horse, sheep, or goat. In certain embodiments, the subject is a zoo
animal. In another embodiment, the subject is a research animal
such as a rodent, dog, or non-human primate. In certain
embodiments, the subject is a non-human transgenic animal such as a
transgenic mouse or transgenic pig.
[0357] In certain embodiments, the biological sample being
contacted with the compound or composition is breast tissue, bone
marrow, lymph node, lymph tissue, spleen, or blood.
[0358] In certain embodiments, the cell being contacted with the
compound or composition is present in vitro. In certain
embodiments, the cell being contacted with the compound or
composition is present in vivo. In certain embodiments, the cell
being contacted with the compound or composition is present ex
vivo. In certain embodiments, the cell being contacted with the
compound or composition is a malignant cell (e.g., malignant blood
cell). In certain embodiments, the cell being contacted with the
compound or composition is a malignant hematopoietic stem cell
(e.g., malignant myeloid cell or malignant lymphoid cell). In
certain embodiments, the cell being contacted with the compound or
composition is a malignant lymphocyte (e.g., malignant T-cell or
malignant B-cell). In certain embodiments, the cell being contacted
with the compound or composition is a malignant red blood cell,
malignant white blood cell, or malignant platelet. In certain
embodiments, the cell being contacted with the compound or
composition is a malignant neutrophil, malignant macrophage, or
malignant plasma cell. In certain embodiments, the cell being
contacted with the compound or composition is a carcinoma cell. In
certain embodiments, the cell being contacted with the compound or
composition is a carcinoma breast cell. In certain embodiments, the
cell being contacted with the compound or composition is a sarcoma
cell. In certain embodiments, the cell being contacted with the
compound or composition is a sarcoma cell from breast tissue.
[0359] The proliferative disease to be treated or prevented using
the compounds described herein may be associated with
overexpression of a kinase, such as cyclin-dependent kinase (CDK).
The process of eukaryotic cell division may be broadly divided into
a series of sequential phases termed G1, S, G2, and M. Correct
progression through the various phases of the cell cycle has been
shown to be critically dependent upon the spatial and temporal
regulation of a family of proteins known as cyclin dependent
kinases (CDKs) and a diverse set of their cognate protein partners
termed cyclins. CDKs are CDC2 (also known as CDK1) homologous
serine-threonine kinase proteins that are able to utilize ATP as a
substrate in the phosphorylation of diverse polypeptides in a
sequence-dependent context. Cyclins are a family of proteins
characterized by a homology region, containing approximately 100
amino acids, termed the "cyclin box" which is used in binding to,
and defining selectivity for, specific CDK partner proteins.
[0360] Modulation of the expression levels, degradation rates,
protein levels, and activity levels of various CDKs and cyclins
throughout the cell cycle leads to the cyclical formation of a
series of CDK/cyclin complexes, in which the CDKs are enzymatically
active. The formation of these complexes controls passage through
discrete cell cycle checkpoints and thereby enables the process of
cell division to continue. Failure to satisfy the prerequisite
biochemical criteria at a given cell cycle checkpoint, e.g.,
failure to form a required CDK/cyclin complex, can lead to cell
cycle arrest and/or cellular apoptosis. Aberrant cellular
proliferation can often be attributed to loss of correct cell cycle
control. Inhibition of CDK enzymatic activity therefore provides a
means by which abnormally dividing cells can have their division
arrested and/or be killed. The diversity of CDKs, and CDK
complexes, and their critical roles in mediating the cell cycle,
provides a broad spectrum of potential therapeutic targets selected
on the basis of a defined biochemical rationale.
[0361] In certain embodiments, the proliferative disease to be
treated or prevented using the compounds described herein may be
associated with overexpression of a CDK (e.g., CDK12).
[0362] CDK12 and CDK13 are Cdc2-related proteins that share 92%
identity in their kinase domains (Chen et al., Exp. Neurol., 2014,
261, 10-21). CDK12 plays a critical role in cell processes, for
example, regulating transcription and splicing machinery by
stabilizing the RNAPII and DNA interaction, and regulating DNA
damage response (DDR) and maintenance of genomic stability by
modulating the expression of DDR genes. Overexpression of CDK12 has
been found to correlate, both at the transcriptional and protein
level, with pathological parameters of breast cancer disease.
[0363] A proliferative disease may be associated with aberrant
activity of a CDK (e.g., CDK12). Aberrant activity of a CDK (e.g.,
CDK12) may be an elevated and/or an inappropriate activity of the
CDK. Deregulation of cell cycle progression is a characteristic of
a proliferative disease, and a majority of proliferative diseases
have abnormalities in some component of CDK (e.g., CDK12) activity,
frequently through elevated and/or inappropriate CDK activation.
Inhibition of the catalytic activity of CDK12 would be expected to
inhibit cell cycle progression by blocking the phosphorylation of
cell cycle CDKs, and would additionally inhibit transcription of
effectors of cell division. In certain embodiments, CDK12 is not
overexpressed, but the activity of CDK12 is elevated and/or
inappropriate. In certain embodiments, CDK12 is overexpressed, and
the activity of CDK12 is elevated and/or inappropriate. The
compounds described herein, and pharmaceutically acceptable salts,
solvates, hydrates, polymorphs, co-crystals, tautomers,
stereoisomers, isotopically labeled derivatives, prodrugs, and
compositions thereof, may inhibit the activity of CDK7 and be
useful in treating and/or preventing proliferative diseases. The
compounds described herein, and pharmaceutically acceptable salts,
solvates, hydrates, polymorphs, co-crystals, tautomers,
stereoisomers, isotopically labeled derivatives, prodrugs, and
compositions thereof, may inhibit the activity of CDK12 and be
useful in treating and/or preventing proliferative diseases.
[0364] A proliferative disease may also be associated with
inhibition of apoptosis of a cell in a biological sample or
subject. All types of biological samples described herein or known
in the art are contemplated as being within the scope of the
invention. Apoptosis is the process of programmed cell death.
Inhibition of apoptosis may result in uncontrolled cell
proliferation and, therefore, may cause proliferative diseases. The
CycK/Cdk12 complex regulates phosphorylation of Ser2 in the
C-terminal domain of RNA polymerase II and expression of a small
subset of human genes, as revealed in expression microarrays.
Through regulation of expression of DNA damage response genes (i.e.
oncogenes), CycK/Cdk12 protects cells from genomic instability. In
certain embodiments, the DNA damage response genes regulated by
CDK12 are BRCA1, BRCA2, HER1, HER2, ATR, FANCI, or FANCD2. In
certain embodiments, the DNA damage response genes regulated by
CDK12 are BRCA1, HER2, ATR, FANCI, and FANCD2. In certain
embodiments, the DNA damage response gene regulated by CDK12 is
BRCA1. In certain embodiments, the DNA damage response gene
regulated by CDK12 is HER2. In certain embodiments, the DNA damage
response genes are down-regulated by CDK12.
[0365] In certain embodiments, the proliferative disease to be
treated or prevented using the compounds described herein is
cancer. All types of cancers disclosed herein or known in the art
are contemplated as being within the scope of the invention. In
certain embodiments, the proliferative disease is a cancer
associated with BCL-2 anti-apoptotic proteins (e.g., MCL-1 and/or
XIAP) (e.g., cancer associated with dependence on BCL-2
anti-apoptotic proteins). In certain embodiments, the proliferative
disease is a cancer associated with overexpression of MYC (a gene
that codes for a transcription factor). In certain embodiments, the
cancer is a MYC-dependent cancer. In certain embodiments, the
proliferative disease is a cancer associated with the amplification
of BRCA1. In certain embodiments, the proliferative disease is a
cancer associated with the amplification of HER2. In certain
embodiments, the proliferative disease is a hematological
malignancy. In certain embodiments, the proliferative disease is a
blood cancer. In certain embodiments, the proliferative disease is
a hematological malignancy. In certain embodiments, the
proliferative disease is a leukemia. In certain embodiments, the
proliferative disease is chronic lymphocytic leukemia (CLL). In
certain embodiments, the proliferative disease is acute
lymphoblastic leukemia (ALL). In certain embodiments, the
proliferative disease is T-cell acute lymphoblastic leukemia
(T-ALL). In certain embodiments, the proliferative disease is
chronic myelogenous leukemia (CML). In certain embodiments, the
proliferative disease is acute myelogenous leukemia (AML). In
certain embodiments, the proliferative disease is acute monocytic
leukemia (AMoL). In certain embodiments, the proliferative disease
is lymphoma. In some embodiments, the proliferative disease is
Burkitt's lymphoma. In certain embodiments, the proliferative
disease is a Hodgkin's lymphoma. In certain embodiments, the
proliferative disease is a non-Hodgkin's lymphoma. In certain
embodiments, the proliferative disease is multiple myeloma. In
certain embodiments, the proliferative disease is melanoma. In
certain embodiments, the proliferative disease is colorectal
cancer. In certain embodiments, the proliferative disease is breast
cancer. In certain embodiments, the proliferative disease is
recurring breast cancer. In certain embodiments, the proliferative
disease is mutant breast cancer. In certain embodiments, the
proliferative disease is HER2+ breast cancer. In certain
embodiments, the proliferative disease is HER2- breast cancer. In
certain embodiments, the proliferative disease is triple-negative
breast cancer (TNBC). In certain embodiments, the proliferative
disease is a bone cancer. In certain embodiments, the proliferative
disease is osteosarcoma. In certain embodiments, the proliferative
disease is Ewing's sarcoma. In some embodiments, the proliferative
disease is a brain cancer. In some embodiments, the proliferative
disease is neuroblastoma. In some embodiments, the proliferative
disease is a lung cancer. In some embodiments, the proliferative
disease is small cell lung cancer (SCLC). In some embodiments, the
proliferative disease is non-small cell lung cancer. In some
embodiments, the proliferative disease is a benign neoplasm. All
types of benign neoplasms disclosed herein or known in the art are
contemplated as being within the scope of the invention. In some
embodiments, the proliferative disease is associated with
angiogenesis. All types of angiogenesis disclosed herein or known
in the art are contemplated as being within the scope of the
invention. In certain embodiments, the proliferative disease is an
inflammatory disease. All types of inflammatory diseases disclosed
herein or known in the art are contemplated as being within the
scope of the invention. In certain embodiments, the inflammatory
disease is rheumatoid arthritis.
[0366] In certain embodiments, the proliferative disease is an
acute inflammatory disease. In certain embodiments, the acute
inflammatory disease is rheumatoid arthritis, Crohn's disease, or
fibrosis. In some embodiments, the proliferative disease is an
autoinflammatory disease. All types of autoinflammatory diseases
disclosed herein or known in the art are contemplated as being
within the scope of the invention. In some embodiments, the
proliferative disease is an autoimmune disease. All types of
autoimmune diseases disclosed herein or known in the art are
contemplated as being within the scope of the invention.
[0367] Another aspect of the invention relates to methods of
inhibiting the activity of a kinase in a biological sample, tissue,
cell, or subject. In certain embodiments, the kinase is a CDK. In
certain embodiments, the kinase is CDK12. In certain embodiments,
the kinase is a mutant form of CDK12. In certain embodiments, the
activity of the kinase is aberrant or undesired activity of the
kinase. In certain embodiments, the activity of the kinase is
increased activity of the kinase. In certain embodiments, the
inhibition of the activity of the kinase is irreversible. In other
embodiments, the inhibition of the activity of the kinase is
reversible. In certain embodiments, the methods of inhibiting the
activity of the kinase include covalently attaching a compound
described herein to the kinase.
[0368] Also provided in the present invention are methods of
inhibiting transcription of genes in a biological sample or
subject. In certain embodiments, the transcription of genes
regulated by the activity of CDK12 may be inhibited by a compound
of the invention. In certain embodiments, the transcription of
genes regulated by the activity of CDK12 may be inhibited by a
compound of the invention. In certain embodiments, the genes which
may have their transcription inhibited by the activity of CDK12 are
one or more genes selected from the group consisting of BRCA1,
FANCI, ATR, FANCD2, APEX1, NEK9, CHEK1, CHEK2, ATM, RAD51C, RAD51D,
ORC3L, MDC1, TERF2, ERCC4, FANCF, PARP9, RUNX1, MYB, TAL1, MCL1,
MYC, BCL2, ETS1, and EWS-FLI. In certain embodiments, administering
a compound described herein to a subject in need thereof will
up-regulate one or more genes selected from the group consisting of
BRCA1, FANCI, ATR, FANCD2, APEX1, NEK9, CHEK1, CHEK2, ATM, RAD51C,
RAD51D, ORC3L, MDC1, TERF2, ERCC4, FANCF, PARP9, RUNX1, MYB, TAL1,
MCL1, MYC, BCL2, ETS1, and EWS-FLI. The present invention also
provides methods of up-regulating one or more genes selected from
the group consisting of BRCA1, FANCI, ATR, FANCD2, APEX1, NEK9,
CHEK1, CHEK2, ATM, RAD51C, RAD51D, ORC3L, MDC1, TERF2, ERCC4,
FANCF, PARP9, RUNX1, MYB, TAL1, MCL1, MYC, BCL2, ETS1, and EWS-FLI,
the method comprising administering to a subject in need thereof a
compound described herein. The present invention also provides uses
of the compounds described herein, for up-regulating one or more
genes selected from the group consisting of BRCA1, FANCI, ATR,
FANCD2, APEX1, NEK9, CHEK1, CHEK2, ATM, RAD51C, RAD51D, ORC3L,
MDC1, TERF2, ERCC4, FANCF, PARP9, RUNX1, MYB, TAL1, MCL1, MYC,
BCL2, ETS1, and EWS-FLI, comprising administering to a subject in
need thereof the compound described herein.
[0369] The present invention also provides methods of inhibiting
cell growth in a biological sample, tissue, cell, or subject.
[0370] In still another aspect, the present invention provides
methods of inducing apoptosis of a cell in a biological sample,
tissue, cell, or subject.
[0371] In certain embodiments, the methods described herein include
administering to a subject or contacting a biological sample with
an effective amount of a compound described herein, or a
pharmaceutically acceptable salt, solvate, hydrate, polymorph,
co-crystal, tautomer, stereoisomer, isotopically labeled
derivative, or prodrug thereof, or a pharmaceutical composition
thereof. In certain embodiments, the methods described herein
include administering to a subject or contacting a biological
sample with an effective amount of a compound described herein, or
a pharmaceutically acceptable salt thereof, or a pharmaceutical
composition thereof. In certain embodiments, the compound is
contacted with a biological sample. In certain embodiments, the
compound is administered to a subject. In certain embodiments, the
compound is administered in combination with one or more additional
pharmaceutical agents described herein. The additional
pharmaceutical agent may be an anti-proliferative agent. In certain
embodiments, the additional pharmaceutical agent is an anti-cancer
agent. The additional pharmaceutical agent may also be a kinase
inhibitor. In certain embodiments, the additional pharmaceutical
agent is an inhibitor of a CDK. In certain embodiments, the
additional pharmaceutical agent is an inhibitor of CDK12. In
certain embodiments, the additional pharmaceutical agent is a
selective inhibitor of CDK12. In certain embodiments, the
additional pharmaceutical agent is a nonselective inhibitor of
CDK12. In certain embodiments, the additional pharmaceutical agent
is an inhibitor of another CDK. In certain embodiments, the
additional pharmaceutical agent is a selective inhibitor of another
CDK. In certain embodiments, the additional pharmaceutical agent is
a nonselective inhibitor of another CDK. In certain embodiments,
the additional pharmaceutical agent is flavopiridol, triptolide,
SNS-032 (BMS-387032), PHA-767491, PHA-793887, BS-181, (S)-CR8,
(R)-CR8, or NU6140. In certain embodiments, the additional
pharmaceutical agent is an inhibitor of a mitogen-activated protein
kinase (MAPK). In certain embodiments, the additional
pharmaceutical agent is an inhibitor of a glycogen synthase kinase
3 (GSK3). In certain embodiments, the additional pharmaceutical
agent is an inhibitor of an AGC kinase. In certain embodiments, the
additional pharmaceutical agent is an inhibitor of a
calmodulin-dependent kinase (CaM Kinase). In certain embodiments,
the additional pharmaceutical agent is an inhibitor of a casein
kinase 1. In certain embodiments, the additional pharmaceutical
agent is an inhibitor of a STE kinase. In certain embodiments, the
additional pharmaceutical agent is an inhibitor of a tyrosine
kinase.
[0372] In some embodiments, the additional pharmaceutical agent is
a topoisomerase inhibitor, a MCL1 inhibitor, a BCL-2 inhibitor, a
BCL-xL inhibitor, a BRD4 inhibitor, a BRCA1 inhibitor, BRCA2
inhibitor, HER1 inhibitor, HER2 inhibitor, a CDK9 inhibitor, a
Jumonji histone demethylase inhibitor, or a DNA damage inducer. In
some embodiments, the additional pharmaceutical agent is etoposide,
obatoclax, navitoclax, JQ1,
4-(((5'-chloro-2'-(((1R,4R)-4-(((R)-1-methoxypropan-2-yl)amino)cyclohexyl-
)amino)-[2,4'-bipyridin]-6-yl)amino)methyl)tetrahydro-2H-pyran-4-carbonitr-
ile, JIB04, or cisplatin. In some embodiments, the additional
pharmaceutical agent is etoposide, obatoclax, or navitoclax, and
the disease to be treated is breast cancer, e.g., triple-negative
breast cancer, HER2 positive breast cancer, HER2 negative breast
cancer, ER-positive breast cancer, ER-negative breast cancer, or
ER/PR-positive breast cancer. In some embodiments, the additional
pharmaceutical agent is etoposide, JIB04, or cisplatin, and the
disease to be treated is Ewing's sarcoma. In some embodiments, the
additional pharmaceutical agent is JQ1 or NVP2, and the disease to
be treated is leukemia, e.g., acute myelogenous leukemia,
myeloblastic leukemia, promyelocytic leukemia, myelomonocytic
leukemia, monocytic leukemia, monoblastic leukemia, or
megakaryoblastic leukemia. In certain embodiments, a pharmaceutical
composition described herein further comprises a combination of the
additional pharmaceutical agents described herein.
[0373] The inventive compounds or compositions may synergistically
augment inhibition of CDK12 induced by the additional
pharmaceutical agent(s) in the biological sample or subject. Thus,
the combination of the inventive compounds or compositions and the
additional pharmaceutical agent(s) may be useful in treating
proliferative diseases resistant to a treatment using the
additional pharmaceutical agent(s) without the inventive compounds
or compositions.
[0374] In some embodiments, the activity of a protein kinase is
non-selectively inhibited by the compounds or pharmaceutical
compositions described herein. In some embodiments, the activity of
the protein kinase being inhibited is selectively inhibited by the
compounds or pharmaceutical compositions described herein, compared
to the activity of a different protein (e.g., a different protein
kinase). In certain embodiments, the activity of CDK (e.g., CDK12)
is selectively inhibited by a compound or pharmaceutical
composition described herein, compared to the activity of a
different protein. In certain embodiments, the activity of CDK12 is
selectively inhibited by a compound or pharmaceutical composition
described herein, compared to the activity of another CDK (e.g.,
CDK7 or CDK13).
[0375] The selectivity of a compound or pharmaceutical composition
described herein in inhibiting the activity of a protein kinase
over a different protein (e.g., a different protein kinase) may be
measured by the quotient of the IC.sub.50 value of the compound or
pharmaceutical composition in inhibiting the activity of the
different protein over the ICso value of the compound or
pharmaceutical composition in inhibiting the activity of the
protein kinase. The selectivity of a compound or pharmaceutical
composition described herein for a protein kinase over a different
protein may also be measured by the quotient of the K.sub.d value
of an adduct of the compound or pharmaceutical composition and the
different protein over the K.sub.d value of an adduct of the
compound or pharmaceutical composition and the protein kinase. In
certain embodiments, the selectivity is at least 2-fold, at least
3-fold, at least 5-fold, at least 10-fold, at least 30-fold, at
least 100-fold, at least 300-fold, at least 1,000-fold, at least
3,000-fold, at least 10,000-fold, at least 30,000-fold, or at least
100,000-fold. In certain embodiments, the selectivity is not more
than 100,000-fold, not more than 10,000-fold, not more than
1,000-fold, not more than 100-fold, not more than 10-fold, or not
more than 2-fold. Combinations of the above-referenced ranges
(e.g., at least 2-fold and not more than 10,000-fold) are also
within the scope of the disclosure.
[0376] In certain embodiments, a kit described herein includes a
first container comprising a compound or pharmaceutical composition
described herein. In certain embodiments, a kit described herein is
useful in treating a proliferative disease (e.g., cancers (e.g.,
leukemia, acute lymphoblastic leukemia, lymphoma, Burkitt's
lymphoma, melanoma, multiple myeloma, breast cancer, Ewing's
sarcoma, osteosarcoma, brain cancer, neuroblastoma, lung cancer,
colorectal cancer), benign neoplasms, diseases associated with
angiogenesis, inflammatory diseases, autoinflammatory diseases, and
autoimmune diseases) in a subject in need thereof, preventing a
proliferative disease in a subject in need thereof, inhibiting the
activity of a protein kinase (e.g., CDK (e.g., CDK12)) in a
subject, biological sample, tissue, or cell, and/or inducing
apoptosis in a cell.
[0377] In certain embodiments, a kit described herein further
includes instructions for using the compound or pharmaceutical
composition included in the kit. A kit described herein may also
include information as required by a regulatory agency such as the
U.S. Food and Drug Administration (FDA). In certain embodiments,
the information included in the kits is prescribing information. In
certain embodiments, the kits and instructions provide for treating
a proliferative disease in a subject in need thereof, preventing a
proliferative disease in a subject in need thereof, inhibiting the
activity of a protein kinase (e.g., CDK (e.g., CDK12)) in a
subject, biological sample, tissue, or cell, and/or inducing
apoptosis in a cell. A kit described herein may include one or more
additional pharmaceutical agents described herein as a separate
composition.
EXAMPLES
[0378] In order that the invention described herein may be more
fully understood, the following examples are set forth. The
synthetic and biological examples described in this application are
offered to illustrate the compounds, pharmaceutical compositions,
and methods provided herein and are not to be construed in any way
as limiting their scope.
Structure-Activity Analyses for Selected Compounds
[0379] Select compounds described herein were evaluated for
structure-activity analyses. Exemplary results of the IC.sub.50
values of exemplary compound BSJ-01-175-1 on other CDK kinases from
an Invitrogen biochemical assay are shown in Table 1. In vitro
kinase assays were performed by Life Technologies in duplicate at
an ATP concentration=K.sub.m for each kinase. The IC.sub.50 on
Jurkat cell is from an anti-proliferation assay; IC.sub.50 on CDK2,
CDK7 and CDK9 is from a biochemical kinase inhibition assay from
Life technology. See Table 1A and Table 1.
TABLE-US-00004 TABLE 1A IC.sub.50 values of exemplary compounds
described herein. IC.sub.50 (nM) CDK7/ IC.sub.50 (nM) CDK2/ cyclin
H/ CDK9/ ID Jurkat Cell Cyclin A MNAT1 Cyclin T1 BSJ-01-033 139.8
>10000 587 585 BSJ-01-175 160.6 4510 121 367 BSJ-01-193
BSJ-01-202 54.32 3870 402 658 BSJ-02-057 2040 272 505 BSJ-02-058
3740 251 734 BSJ-02-108 492 74 87.7 BSJ-02-109 11.22 1940 433 121
BSJ-02-139 3550 162 171 BSJ-03-005 131.7 266 118 230 BSJ-03-014 344
3360 403 522 BSJ-03-055 3390 919 530 BSJ-03-161 62.16 >10000 878
786 BSJ-03-162 154.3 3570 269 286
TABLE-US-00005 TABLE 1 IC.sub.50 values of exemplary compounds
described herein. Invitrogen Invitrogen Technology: Invitrogen
Technology: Kinase [ATP] Tested Technology: Tested (uM) IC.sub.50
(nM) CDK2/cyclin A Km app 4510 CDK7/cyclin H/MNAT1 Km app 121
CDK9/cyclin T1 Km app 367
Assay of Anti-Proliferation Activity on Jurkat Cells
[0380] Jurkat cells were plated at 30,000 cells/well and treated
with a titration of compounds indicated. Cells were allowed to grow
for 72 hours. Cells were assayed using CELLTITER GLO (Promega) to
determine cell viability by measuring the amount of ATP present,
which is an indicator of cell metabolic activity. Results are
graphed calculated as relative as luminescence as compared to
DMSOP=.cent values. Curves were generated using PRISM and an IC50
value was determined. See Table 1A.
Assay of Anti-Proliferative Activity for Selected Compounds
[0381] Select compounds described herein were evaluated for
anti-proliferative activity. Exemplary results of the assay for
anti-proliferative activity (in nM) are shown in Table 2. HAP1 WT
and CDK12 C1039S/CDK13 C1017S double mutants cells were seeded at a
density of 12,000 cells/well in 96-well plates. Twenty-four hours
later cells were then treated with compound BSJ-01-175-1 in a 10-pt
dose escalation format from 1 nM to 10 .mu.M or DMSO control for 72
hrs. After 72 hrs, cells were assayed using CellTiter-Glo
Luminescent Cell Viability Assay (Promega) to determine cell
viability by measuring the amount of ATP present in each sample
cell population, which is an indicator of cell metabolic activity.
Results are graphed as fraction of the DMSO control at 72 hrs. All
data points were performed in biological triplicate. HAP1 cells
expressing putative inhibitor-refractory mutations in CDK12
(C1039S) and CDK13 (C1017S) are approximately half as sensitive to
compound BSJ-01-175-1 as compared to control WT HAP1 cells. This
result indicates that a portion of intracellular compound activity
comes from covalent inhibition of CDK12 and/or CDK13 and mutation
of the targeted cysteines (C1039 in CDK12 and C1017 in CDK13) to
less nucleophilic serines is sufficient to rescue some of compound
BSJ-01-175-1's anti-proliferative activity. Compound BSJ-1-0175-1
anti-proliferative effects were found to be partially rescued by
mutation of critical cysteines in CDK12 and CDK13.
TABLE-US-00006 TABLE 2 Assay of Anti-Proliferative Activity for
Selected Compounds HAP1 HAP1 CDK12/13 ID (IC.sub.50, nM) mutant
(IC.sub.50, nM) BSJ-01-175 313 670
Pull-Down Assay for Selected Compounds
[0382] Jurkat cells were treated with THZ1 (1 .mu.M), compound
BSJ-01-175-1 (1 .mu.M), or DMSO vehicle control for 6 hrs.
Clarified cellular lysates from each treatment condition were then
incubated with either 1 .mu.M THZ1-biotin, a concentration that
binds CDK7-cyclin H, CDK12-cyclin K, and CDK13-cyclin K complexes.
Lysates were incubated with THZ1-biotin overnight at 4 degrees
Celsius. Subsequent addition of streptavidin-coated beads permits
the immunoprecipitation of the indicated protein complexes.
Following washing of beads with lysis buffer, the
immunoprecipitated proteins were eluted from the beads by boiling
in SDS buffer. Western blotting for cyclin K was used to identify
precipitated CDK12-cyclin K or CDK13-cyclin K complexes. Western
blotting for cyclin H was used to identify precipitated CDK7-cyclin
H complexes. As THZ1 and compound BSJ-01-175-1 bind to their
intended targets covalently, pretreatment of cells with these
compounds would be expected to block subsequent capture and
immunoprecipitation of these protein complexes with THZ1-biotin.
The western blot data indicates that THZ1 binds intracellular
CDK12-cyclin K, CDK13-cyclin K and CDK7-cyclin H complexes, while
compound BSJ-01-175-1 binds intracellular CDK12-cyclin K and
CDK13-cyclin K complexes selectively (and not CDK7-cyclin H). FIG.
1 depicts the results of this pull-down assay of a Cyclin K pull
down with THZ1-biotin probe. Indicating that exemplary compound
BSJ-01-175-1 selectively binds intracellular CDK12/13-cyclin K
complexes, and not CDK7-cyclin H complexes.
[0383] In another experiment, Jurkat cells were treated with DMSO
or 1. .mu.M of the exemplary compounds BSJ-01-033, BSJ-01-175,
BSJ-01-202, BSJ-02-139, BSJ-02-109 and BSJ-02-108. 6 hours after
treatment, cells were washed and harvested by resuspending in lysis
buffer (50 mM Hepes pH 7.4, 150 mM NaCl, 1% NP-40, 5 mM EDTA,
protease and phosphatase inhibitors) and lysing on ice for 30
minutes. Lysates were cleared by centrifugation at 15,000 rpm for
30 minutes. Biotin-labeled THZ1 was added to 1 .mu.M to lysates and
rotated at 4.degree. C. overnight. Streptavidin-agarose beads were
washed and 30 .mu.L slurry was added to each lysate and rotated for
1 hour at 4.degree. C. Beads were washed 5 times with lysis buffer
and 50 .mu.L 2.times.LDS buffer was added to each sample. Samples
were boiled and equal volume of protein was loaded onto gel. Gel
was transferred to nitrocellulose and blotted for Cyclin K and
Cyclin H. FIG. 2 depicts the results of this pull-down assay.
Preparation of the Compounds Described Herein
[0384] The compounds provided herein can be prepared from readily
available starting materials using the following general methods
and procedures. Where typical or preferred process conditions
(i.e., reaction temperatures, times, mole ratios of reactants,
solvents, pressures, etc.) are given, other process conditions can
also be used unless otherwise stated. Optimum reaction conditions
may vary with the particular reactants or solvents used, but such
conditions can be determined by those skilled in the art by routine
optimization procedures.
Example 1. Synthesis of
N-(4-((1R,3R)-3-(5-chloro-4-(1H-indol-3-yl)pyrimidin-2-ylamino)cyclohexyl-
oxy)phenyl)acrylamide (BSJ-01-033)
##STR00222##
[0385] (1R,3R)-3-(4-nitrophenoxy)cyclohexanamine
##STR00223##
[0387] To a suspension of NaH (0.8 g, 8.25 mmol) in 3.0 mL of
anhydrous DMF was added (1R,3R)-3-aminocyclohexanol HCl salt (0.5
g, 3.3 mmol) slowly at 0.degree. C. and kept stirring for 0.5 h,
then 1-fluoro-4-nitrobenzene (0.465 g, 3.3 mmol) was added. The
reaction mixture was kept stirring at 0.degree. C. for another 0.5
h, then warm to room temperature and kept stirring for 2 h. 1.0 mL
of H.sub.2O was added dropwise to quench the reaction. The mixture
was extracted with DCM (100 mL), washed with brine (3.times.50 mL),
dried (anhydrous Na.sub.2SO.sub.4), filtered and concentrated under
reduced pressure. The residue was purified by chromatography on
silica gel to give the title compound (623 mg, 80%) as a brown
solid. LC-MS (m/z): 237 [M+H].sup.+.
5-chloro-N-((1R,3R)-3-(4-nitrophenoxy)cyclohexyl)-4-(1-(phenylsulfonyl)-1H-
-indol-3-yl)pyrimidin-2-amine
##STR00224##
[0389] 3-(2,5-dichloropyrimidin-4-yl)-1-(phenylsulfonyl)-1H-indole
(50 mg, 0.12 mmol) and (1R,3R)-3-(4-nitrophenoxy)cyclohexanamine
(58 mg, 0.25 mmol) were dissolved in 1.0 mL of NMP, 0.2 mL of DIPEA
was added and the mixture was heated to 140.degree. C. and kept
stirring for 5 h. The reaction mixture was then cooled to room
temperature and diluted with EtOAc (20 mL), washed with sat.
NaHCO.sub.3 (5 mL), brine (5 mL), dried (anhydrous
Na.sub.2SO.sub.4), filtered and concentrated under reduced
pressure. The residue was used directly for the next step without
further purification. LC-MS (m/z): 604 [M+H].sup.+.
N-((1R,3R)-3-(4-aminophenoxy)cyclohexyl)-5-chloro-4-(1-(phenylsulfonyl)-1H-
-indol-3-yl)pyrimidin-2-amine
##STR00225##
[0391] To a solution of
5-chloro-N-((1R,3R)-3-(4-nitrophenoxy)cyclohexyl)-4-(1-(phenylsulfonyl)-1-
H-indol-3-yl)pyrimidin-2-amine obtained from last step in 5.0 mL of
ethyl ester (4.0 mL) and MeOH (1.0 mL) was added SnCl.sub.2 (230
mg, 1.2 mmol). The mixture was heated to 80.degree. C. and kept
stirring for 2 h. Then the reaction mixture was cooled to room
temperature and diluted with 100 mL of sat. NaHCO.sub.3, extracted
with 200 mL of CHCl.sub.3/i-PrOH (v/v=4:1), washed with brine
(3.times.100 mL), dried (anhydrous Na.sub.2SO.sub.4), filtered and
concentrated under reduced pressure. The residue was used directly
for the next step without further purification. LC-MS (m/z): 574
[M+H].sup.+.
N-((1R,3R)-3-(4-aminophenoxy)cyclohexyl)-5-chloro-4-(1H-indol-3-yl)pyrimid-
in-2-amine
##STR00226##
[0393] To a suspension of
N-((1R,3R)-3-(4-aminophenoxy)cyclohexyl)-5-chloro-4-(1-(phenylsulfonyl)-1-
H-indol-3-yl)pyrimidin-2-amine obtained from last step in 2.0 mL of
dioxane was added 2.0 mL of 1N of aqu. NaOH and stirred for 5 h at
room temperature. Then 2.0 mL of 1N HCl was added to quench the
reaction and the solvent was evaporated under reduced pressure. The
residue was purified by prep-HPLC (MeOH/H.sub.2O, 0.05% TFA) to
give the title compound (38.9 mg, 75% in 3 steps). LC-MS (m/z): 434
[M+H].sup.+.
N-(4-((1R,3R)-3-(5-chloro-4-(1H-indol-3-yl)pyrimidin-2-ylamino)cyclohexylo-
xy)phenyl)acrylamide (BSJ-01-033)
##STR00227##
[0395] To a solution of
N-((1R,3R)-3-(4-aminophenoxy)cyclohexyl)-5-chloro-4-(1H-indol-3-yl)pyrimi-
din-2-amine (15 mg, 0.035 mmol) and 0.1 mL of DIPEA in 2.0 mL of
anhydrous CH.sub.3CN was added acryloy chloride (3.46 mg, 0.038
mmol) in 1.0 mL of DCM dropwise, and stirred for 1 h at 0.degree.
C. The reaction mixture was then concentrated and the residue was
purified by prep-HPLC (MeOH/H.sub.2O, 0.05% TFA) to give the title
compound (14.8 mg, 87%) as a light yellow solid after
lyophilisation. LC-MS (m/z): 488 [M+H].sup.+. .sup.1H NMR (500 MHz,
DMSO-d6) .delta. 10.99 (dd, J=10.4, 5.6 Hz, 1H), 10.36 (s, 1H),
8.60 (d, J=8.4 Hz, 2H), 8.36 (s, 1H), 7.66 (d, J=8.7 Hz, 2H), 7.54
(d, J=8.1 Hz, 1H), 7.49-7.31 (m, 1H), 7.25 (t, J=7.6 Hz, 1H),
7.21-7.13 (m, 3H), 7.09-6.96 (m, 2H), 6.76 (dt, J=14.7, 7.2 Hz,
1H), 6.48 (d, J=15.3 Hz, 1H), 4.81 (s, 1H), 2.22-1.94 (m, 2H),
1.88-1.69 (m, 3H), 1.69-1.50 (m, 2H), 1.43 (d, J=11.9 Hz, 2H).
Example 2. Synthesis of
(E)-N-(4-((1R,3R)-3-(5-chloro-4-(1H-indol-3-yl)pyrimidin-2-ylamino)cycloh-
exyloxy)phenyl)-4-(dimethylamino)but-2-enamide (BSJ-01-175)
##STR00228##
[0397] To a cold solution (0.degree. C.) of
N-((1R,3R)-3-(4-aminophenoxy)cyclohexyl)-5-chloro-4-(1H-indol-3-yl)pyrimi-
din-2-amine (15 mg, 0.035 mmol) and 0.1 mL of DIPEA in 2.0 mL of
anhydrous CH.sub.3CN was added a solution of (E)-4-bromobut-2-enoyl
chloride (6.34 mg, 0.035 mmol) in 1.0 mL of DCM dropwise. After 0.5
h at 0.degree. C., a 2M solution of dimethylamine in THF (1.0 mL)
was added and the mixture was stirred for 1 h at 0.degree. C. Then
1.5 mL of DMSO was added, followed by removal of the low boiling
point solvents under reduced pressure. The residue was purified by
prep-HPLC (MeOH/H.sub.2O, 0.05% TFA) to give the title compound (11
mg, 58%) as a light yellow solid after lyophilisation. LC-MS (m/z):
545 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d6) .delta. 10.92 (dd,
J=10.4, 5.6 Hz, 1H), 10.38 (s, 1H), 8.65 (d, J=8.4 Hz, 2H), 8.36
(s, 1H), 7.59 (d, J=8.7 Hz, 2H), 7.54 (d, J=8.1 Hz, 1H), 7.34 (d,
J=50.9 Hz, 1H), 7.25 (t, J=7.6 Hz, 1H), 7.21-7.13 (m, 2H), 6.95 (d,
J=9.0 Hz, 2H), 6.76 (dt, J=14.7, 7.2 Hz, 1H), 6.48 (d, J=15.3 Hz,
1H), 4.81 (s, 1H), 3.89 (t, J=6.1 Hz, 2H), 2.74 (s, 3H), 2.73 (s,
3H), 2.22-1.94 (m, 2H), 1.88-1.69 (m, 3H), 1.69-1.50 (m, 2H), 1.43
(d, J=11.9 Hz, 2H).
Example 3. Synthesis of
(E)-N-(4-(3-(5-chloro-4-(1H-indol-3-yl)pyrimidin-2-ylamino)cyclohexyloxy)-
phenyl)-4-(dimethylamino)but-2-enamide (BSJ-01-193)
##STR00229##
[0398] 3-(4-nitrophenoxy)cyclohexanamine
##STR00230##
[0400] To a suspension of NaH (0.8 g, 8.25 mmol) in 3.0 mL of
anhydrous DMF was added 3-aminocyclohexanol HCl salt (0.5 g, 3.3
mmol) slowly at 0.degree. C. and kept stirring for 0.5 h, then
1-fluoro-4-nitrobenzene (0.465 g, 3.3 mmol) was added. The reaction
mixture was kept stirring at 0.degree. C. for another 0.5 h, then
warm to room temperature and kept stirring for 2 h. 1.0 mL of
H.sub.2O was added dropwise to quench the reaction. The mixture was
extracted with DCM (100 mL), washed with brine (3.times.50 mL),
dried (anhydrous Na.sub.2SO.sub.4), filtered and concentrated under
reduced pressure. The residue was purified by chromatography on
silica gel to give the title compound (623 mg, 80%) as a brown
solid. LC-MS (m/z): 237 [M+H].sup.+.
5-chloro-N-(3-(4-nitrophenoxy)cyclohexyl)-4-(1-(phenylsulfonyl)-1H-indol-3-
-yl)pyrimidin-2-amine
##STR00231##
[0402] 3-(2,5-dichloropyrimidin-4-yl)-1-(phenylsulfonyl)-1H-indole
(50 mg, 0.12 mmol) and 3-(4-nitrophenoxy)cyclohexanamine (58 mg,
0.25 mmol) were dissolved in 1.0 mL of NMP, 0.2 mL of DIPEA was
added and the mixture was heated to 140.degree. C. and kept
stirring for 5 h. The reaction mixture was then cooled to room
temperature and diluted with EtOAc (20 mL), washed with sat.
NaHCO.sub.3 (5 mL), brine (5 mL), dried (anhydrous
Na.sub.2SO.sub.4), filtered and concentrated under reduced
pressure. The residue was used directly for the next step without
further purification. LC-MS (m/z): 604 [M+H].sup.+.
N-(3-(4-aminophenoxy)cyclohexyl)-5-chloro-4-(1-(phenylsulfonyl)-1H-indol-3-
-yl)pyrimidin-2-amine
##STR00232##
[0404] To a solution of
5-chloro-N-(3-(4-nitrophenoxy)cyclohexyl)-4-(1-(phenylsulfonyl)-1H-indol--
3-yl)pyrimidin-2-amine obtained from last step in 5.0 mL of ethyl
ester (4.0 mL) and MeOH (1.0 mL) was added SnCl.sub.2 (230 mg, 1.2
mmol). The mixture was heated to 80.degree. C. and kept stirring
for 2 h. Then the reaction mixture was cooled to room temperature
and diluted with 100 mL of sat. NaHCO.sub.3, extracted with 200 mL
of CHCl.sub.3/i-PrOH (v/v=4:1), washed with brine (3.times.100 mL),
dried (anhydrous Na.sub.2SO.sub.4), filtered and concentrated under
reduced pressure. The residue was used directly for the next step
without further purification.
[0405] LC-MS (m/z): 574 [M+H].sup.+.
N-(3-(4-aminophenoxy)cyclohexyl)-5-chloro-4-(1H-indol-3-yl)pyrimidin-2-ami-
ne
##STR00233##
[0407] To a suspension of
N-(3-(4-aminophenoxy)cyclohexyl)-5-chloro-4-(1-(phenylsulfonyl)-1H-indol--
3-yl)pyrimidin-2-amine obtained from last step in 2.0 mL of dioxane
was added 2.0 mL of 1N of aq. NaOH and stirred for 5 h at room
temperature. Then 2.0 mL of 1N HCl was added to quench the reaction
and the solvent was evaporated under reduced pressure. The residue
was purified by prep-HPLC (MeOH/H.sub.2O, 0.05% TFA) to give the
title compound (38.8 mg, 75% in 3 steps). LC-MS (m/z): 434
[M+H].sup.+.
(E)-N-(4-(3-(5-chloro-4-(1H-indol-3-yl)pyrimidin-2-ylamino)cyclohexyloxy)p-
henyl)-4-(dimethylamino)but-2-enamide
##STR00234##
[0409] To a cold solution (0.degree. C.) of
N-(3-(4-aminophenoxy)cyclohexyl)-5-chloro-4-(1H-indol-3-yl)pyrimidin-2-am-
ine (15 mg, 0.035 mmol) and 0.1 mL of DIPEA in 2.0 mL of anhydrous
CH.sub.3CN was added a solution of (E)-4-bromobut-2-enoyl chloride
(6.34 mg, 0.035 mmol) in 1.0 mL of DCM dropwise. After 0.5 h at
0.degree. C., a 2M solution of dimethylamine in THF (1.0 mL) was
added and the mixture was stirred for 1 h at 0.degree. C. Then 1.5
mL of DMSO was added, followed by removal of the low boiling point
solvents under reduced pressure. The residue was purified by
prep-HPLC (MeOH/H.sub.2O, 0.05% TFA) to give the title compound (11
mg, 58%) as a light yellow solid after lyophilisation. LC-MS (m/z):
545[M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d6) .delta. 10.92 (dd,
J=10.4, 5.6 Hz, 1H), 10.38 (s, 1H), 8.65 (d, J=8.4 Hz, 2H), 8.36
(s, 1H), 7.59 (d, J=8.7 Hz, 2H), 7.54 (d, J=8.1 Hz, 1H), 7.34 (d,
J=50.9 Hz, 1H), 7.25 (t, J=7.6 Hz, 1H), 7.21-7.13 (m, 2H), 6.95 (d,
J=9.0 Hz, 2H), 6.76 (dt, J=14.7, 7.2 Hz, 1H), 6.48 (d, J=15.3 Hz,
1H), 4.81 (s, 1H), 3.89 (t, J=6.1 Hz, 2H), 2.74 (s, 3H), 2.73 (s,
3H), 2.22-1.94 (m, 2H), 1.88-1.69 (m, 3H), 1.69-1.50 (m, 2H), 1.43
(d, J=11.9 Hz, 2H).
Example 4. Synthesis of
(E)-N-(6-(3-(5-chloro-4-(1H-indol-3-yl)pyrimidin-2-ylamino)piperidine-1-c-
arbonyl)pyridin-3-yl)-4-(dimethylamino)but-2-enamide
(BSJ-01-202)
##STR00235##
[0410] (R)-tert-butyl
3-(5-chloro-4-(1-(phenylsulfonyl)-1H-indol-3-yl)pyrimidin-2-ylamino)piper-
idine-1-carboxylate
##STR00236##
[0412] 3-(2,5-dichloropyrimidin-4-yl)-1-(phenylsulfonyl)-1H-indole
(500 mg, 1.2 mmol) and (R)-tert-butyl
3-aminopiperidine-1-carboxylate (480 mg, 2.4 mmol) were dissolved
in 5.0 mL of NMP, 0.8 mL of DIPEA was added and the mixture was
heated to 140.degree. C. and kept stirring for 5 h. The reaction
mixture was then cooled to room temperature and diluted with EtOAc
(20 mL), washed with sat. NaHCO.sub.3 (5 mL), brine (5 mL), dried
(anhydrous Na.sub.2SO.sub.4), filtered and concentrated under
reduced pressure. The residue was purified by chromatography on
silica gel to give the title compound (620 mg, 91%). LC-MS (m/z):
568 [M+H].sup.+.
(R)-(3-(5-chloro-4-(1-(phenylsulfonyl)-1H-indol-3-yl)pyrimidin-2-ylamino)p-
iperidin-1-yl)(5-nitropyridin-2-yl)methanone
##STR00237##
[0414] A solution of (R)-tert-butyl
3-(5-chloro-4-(1-(phenylsulfonyl)-1H-indol-3-yl)pyrimidin-2-ylamino)piper-
idine-1-carboxylate (100 mg, 0.18 mmol) in 5 mL of MeOH was treated
with 2.0 mL of 4N HCl in dioxane. The resulting mixture was stirred
for 4 h at room temperature before being evaporated to dryness. The
residue was then dissolved in 5.0 mL of DCM, 0.5 mL of DIPEA was
added and the mixture was cooled to 0.degree. C. 5-nitropicolinoyl
chloride (36.2 mg, 0.19 mmol) was added and the reaction mixture
was kept stirring for 2 h at room temperature before being
evaporated to dryness. The residue was used directly for the next
step without further purification. LC-MS (m/z): 618
[M+H].sup.+.
(R)-(5-aminopyridin-2-yl)(3-(5-chloro-4-(1-(phenylsulfonyl)-1H-indol-3-yl)-
pyrimidin-2-ylamino)piperidin-1-yl)methanone
##STR00238##
[0416] To a solution of
(R)-(3-(5-chloro-4-(1-(phenylsulfonyl)-1H-indol-3-yl)pyrimidin-2-ylamino)-
piperidin-1-yl)(5-nitropyridin-2-yl)methanone obtained from last
step in 5 mL of ethyl ester (4.0 mL) and MeOH (1.0 mL) was added
SnCl.sub.2 (340.0 mg, 1.8 mmol). The mixture was heated to
80.degree. C. and kept stirring for 2 h. Then the reaction mixture
was cooled to room temperature and diluted with 100 mL of sat.
NaHCO.sub.3, extracted with 200 mL of CHCl.sub.3/i-PrOH (v/v=4:1),
washed with brine (3.times.100 mL), dried (anhydrous
Na.sub.2SO.sub.4), filtered and concentrated under reduced
pressure. The residue was used directly for the next step without
further purification. LC-MS (m/z): 588 [M+H].sup.+.
(R)-(5-aminopyridin-2-yl)(3-(5-chloro-4-(1H-indol-3-yl)pyrimidin-2-ylamino-
)piperidin-1-yl)methanone
##STR00239##
[0418] To a solution of
(R)-(5-aminopyridin-2-yl)(3-(5-chloro-4-(1-(phenylsulfonyl)-1H-indol-3-yl-
)pyrimidin-2-ylamino)piperidin-1-yl)methanone obtained from last
step in 2.0 mL of dioxane was added 2.0 mL of 1N of aq. NaOH and
stirred for 5 h at room temperature. Then 2.0 mL of 1N HCl was
added to quench the reaction and the solvent was evaporated under
reduced pressure. The residue was purified by prep-HPLC
(MeOH/H.sub.2O, 0.05% TFA) to give the title compound (40 mg, 50%
in 4 steps). LC-MS (m/z): 448 [M+H].sup.+.
(E)-N-(6-(3-(5-chloro-4-(1H-indol-3-yl)pyrimidin-2-ylamino)piperidine-1-ca-
rbonyl)pyridin-3-yl)-4-(dimethylamino)but-2-enamide
##STR00240##
[0420] To a cold solution (0.degree. C.) of
(R)-(5-aminopyridin-2-yl)(3-(5-chloro-4-(1H-indol-3-yl)pyrimidin-2-ylamin-
o)piperidin-1-yl)methanone (16 mg, 0.035 mmol) and 0.1 mL of DIPEA
in 2.0 mL of anhydrous CH.sub.3CN was added a solution of
(E)-4-bromobut-2-enoyl chloride (6.34 mg, 0.035 mmol) in 1.0 mL of
DCM dropwise. After 0.5 h at 0.degree. C., a 2M solution of
dimethylamine in THF (1.0 mL) was added and the mixture was stirred
for 1 h at 0.degree. C. Then 1.5 mL of DMSO was added, followed by
removal of the low boiling point solvents under reduced pressure.
The residue was purified by prep-HPLC (MeOH/H.sub.2O, 0.05% TFA) to
give the title compound (12 mg, 61%) as a light yellow solid after
lyophilisation. LC-MS (m/z): 559 [M+H]. .sup.1H NMR (500 MHz,
DMSO-d6) .delta. 11.99-11.79 (m, 1H), 10.81-10.54 (M, 1H), 9.88 (s,
1H), 8.92-8.57 (m, 1H), 8.39-8.22 (m, 1H), 8.02 (d, J=8.6 Hz, 1H),
7.63 (d, J=8.5 Hz, 1H), 7.55-7.29 (m, 2H), 7.25-7.17 (m, 1H),
7.16-7.05 (m, 1H), 6.91-6.68 (m, 1H), 6.56-6.39 (m, 1H), 3.96 (d,
J=9.2 Hz, 2H), 3.85-3.61 (m, 1H), 3.48 (s, 1H), 3.07 (s, 1H), 2.81
(s, 6H), 2.17-1.94 (m, 2H), 1.84-1.70 (m, 2H), 1.70-1.45 (m,
2H).
Example 5. Synthesis of
N-(6-(3-(5-bromo-4-(1H-indol-3-yl)pyrimidin-2-ylamino)piperidine-1-carbon-
yl)pyridin-3-yl)acrylamide (BSJ-02-057)
##STR00241##
[0421] (R)-tert-butyl
3-(5-bromo-4-(1-(phenylsulfonyl)-1H-indol-3-yl)pyrimidin-2-ylamino)piperi-
dine-1-carboxylate
##STR00242##
[0423]
3-(5-bromo-2-chloropyrimidin-4-yl)-1-(phenylsulfonyl)-1H-indole
(536 mg, 1.2 mmol) and (R)-tert-butyl
3-aminopiperidine-1-carboxylate (480 mg, 2.4 mmol) were dissolved
in 5.0 mL of NMP, 0.8 mL of DIPEA was added and the mixture was
heated to 140.degree. C. and kept stirring for 5 h. The reaction
mixture was then cooled to room temperature and diluted with EtOAc
(20 mL), washed with sat. NaHCO.sub.3 (5 mL), brine (5 mL), dried
(anhydrous Na.sub.2SO.sub.4), filtered and concentrated under
reduced pressure. The residue was purified by chromatography on
silica gel to give the title compound (594 mg, 81%). LC-MS (m/z):
612 [M+H].sup.+.
(R)-(3-(5-bromo-4-(1-(phenylsulfonyl)-1H-indol-3-yl)pyrimidin-2-ylamino)pi-
peridin-1-yl)(5-nitropyridin-2-yl)methanone
##STR00243##
[0425] A solution of (R)-tert-butyl
3-(5-bromo-4-(1-(phenylsulfonyl)-1H-indol-3-yl)pyrimidin-2-ylamino)piperi-
dine-1-carboxylate (110 mg, 0.18 mmol) in 5 mL of MeOH was treated
with 2.0 mL of 4N HCl in dioxane. The resulting mixture was stirred
for 4 h at room temperature before being evaporated to dryness. The
residue was then dissolved in 5.0 mL of DCM, 0.5 mL of DIPEA was
added and the mixture was cooled to 0.degree. C. 5-nitropicolinoyl
chloride (36.2 mg, 0.19 mmol) was added and the reaction mixture
was kept stirring for 2 h at room temperature before being
evaporated to dryness. The residue was used directly for the next
step without further purification. LC-MS (m/z): 662
[M+H].sup.+.
(R)-(5-aminopyridin-2-yl)(3-(5-bromo-4-(1-(phenylsulfonyl)-1H-indol-3-yl)p-
yrimidin-2-ylamino)piperidin-1-yl)methanone
##STR00244##
[0427] To a solution of
(R)-(3-(5-bromo-4-(1-(phenylsulfonyl)-1H-indol-3-yl)pyrimidin-2-ylamino)p-
iperidin-1-yl)(5-nitropyridin-2-yl)methanone obtained from last
step in 5 mL of ethyl ester (4.0 mL) and MeOH (1.0 mL) was added
SnCl.sub.2 (340.0 mg, 1.8 mmol). The mixture was heated to
80.degree. C. and kept stirring for 2 h. Then the reaction mixture
was cooled to room temperature and diluted with 100 mL of sat.
NaHCO.sub.3, extracted with 200 mL of CHCl.sub.3/i-PrOH (v/v=4:1),
washed with brine (3.times.100 mL), dried (anhydrous
Na.sub.2SO.sub.4), filtered and concentrated under reduced
pressure. The residue was used directly for the next step without
further purification. LC-MS (m/z): 632 [M+H].sup.+.
(R)-(5-aminopyridin-2-yl)(3-(5-bromo-4-(1H-indol-3-yl)pyrimidin-2-ylamino)-
piperidin-1-yl)methanone
##STR00245##
[0429] To a solution of
(R)-(3-(5-bromo-4-(1-(phenylsulfonyl)-1H-indol-3-yl)pyrimidin-2-ylamino)p-
iperidin-1-yl)(5-nitropyridin-2-yl)methanone obtained from last
step in 2.0 mL of dioxane was added 2.0 mL of 1N of aq. NaOH and
stirred for 5 h at room temperature. Then 2.0 mL of 1N HCl was
added to quench the reaction and the solvent was evaporated under
reduced pressure. The residue was purified by prep-HPLC
(MeOH/H.sub.2O, 0.05% TFA) to give the title compound (51 mg, 51%
in 4 steps). LC-MS (m/z): 492 [M+H].sup.+.
N-(6-(3-(5-bromo-4-(1H-indol-3-yl)pyrimidin-2-ylamino)piperidine-1-carbony-
l)pyridin-3-yl)acrylamide
##STR00246##
[0431] To a solution of
(R)-(5-aminopyridin-2-yl)(3-(5-bromo-4-(1H-indol-3-yl)pyrimidin-2-ylamino-
)piperidin-1-yl)methanone (17 mg, 0.035 mmol) and 0.1 mL of DIPEA
in 2.0 mL of anhydrous CH.sub.3CN was added acryloy chloride (3.46
mg, 0.038 mmol) in 1.0 mL of DCM dropwise, and stirred for 1 h at
0.degree. C. The reaction mixture was then concentrated and the
residue was purified by prep-HPLC (MeOH/H.sub.2O, 0.05% TFA) to
give the title compound (17.2 mg, 90%) as a light yellow solid
after lyophilisation. LC-MS (m/z): 546 [M+H]. .sup.1H NMR (500 MHz,
DMSO-d6) .delta. 11.94-11.70 (m, 1H), 10.69-10.25 (m, 1H),
8.94-8.69 (m, 1H), 8.65-8.34 (m, 1H), 8.34-7.93 (m, 1H), 7.81-7.56
(m, 1H), 7.48 (d, J=8.0 Hz, 1H), 7.44-7.29 (m, 2H), 7.19 (t, J=7.4
Hz, 1H), 7.12 (t, J=7.4 Hz, 1H), 6.45 (ddd, J=21.8, 16.7, 10.0 Hz,
1H), 6.37-6.22 (m, 1H), 5.94-5.83 (m, 1H), 4.67-4.37 (m, 1H),
3.20-2.78 (m, 1H), 2.15-1.59 (m, 3H), 1.53 (qt, J=8.1, 4.5 Hz, 1H),
1.42 (d, J=6.5 Hz, 1H), 1.37-1.14 (m, 2H).
Example 6. Synthesis of
(E)-N-(6-(3-(5-bromo-4-(1H-indol-3-yl)pyrimidin-2-ylamino)piperidine-1-ca-
rbonyl)pyridin-3-yl)-4-(dimethylamino)but-2-enamide
(BSJ-02-058)
##STR00247##
[0433] To a cold solution (0.degree. C.) of
(R)-(5-aminopyridin-2-yl)(3-(5-bromo-4-(1H-indol-3-yl)pyrimidin-2-ylamino-
)piperidin-1-yl)methanone (17 mg, 0.035 mmol) and 0.1 mL of DIPEA
in 2.0 mL of anhydrous CH.sub.3CN was added a solution of
(E)-4-bromobut-2-enoyl chloride (6.34 mg, 0.035 mmol) in 1.0 mL of
DCM dropwise. After 0.5 h at 0.degree. C., a 2M solution of
dimethylamine in THF (1.0 mL) was added and the mixture was stirred
for 1 h at 0.degree. C. Then 1.5 mL of DMSO was added, followed by
removal of the low boiling point solvents under reduced pressure.
The residue was purified by prep-HPLC (MeOH/H.sub.2O, 0.05% TFA) to
give the title compound (12 mg, 61%) as a light yellow solid after
lyophilisation. LC-MS (m/z): 603 [M+H]. .sup.1H NMR (500 MHz,
DMSO-d6) .delta. 11.81 (dd, J=13.1, 3.1 Hz, 1H), 10.87-10.64 (m,
1H), 9.94 (s, 1H), 8.91-8.75 (m, 1H), 8.66-8.35 (m, 3H), 8.23 (dd,
J=8.5, 2.5 Hz, 1H), 8.17-7.91 (m, 1H), 7.76-7.61 (m, 2H), 7.44-7.24
(m, 2H), 7.21-7.02 (m, 2H), 6.80 (ddd, J=15.2, 12.7, 7.2 Hz, 1H),
6.47 (dd, J=24.4, 15.3 Hz, 1H), 4.54 (d, J=12.3 Hz, 1H), 3.22-2.90
(m, 2H), 2.81 (s, 6H), 2.17-1.84 (m, 2H), 1.77 (d, J=14.0 Hz, 1H),
1.70-1.46 (m, 2H), 1.32-1.14 (m, 1H).
Example 7. Synthesis of
(E)-N-(6-(3-(5-bromo-4-(1H-indol-3-yl)pyrimidin-2-ylamino)piperidine-1-ca-
rbonyl)pyridin-3-yl)-4-(dimethylamino)but-2-enamide
(BSJ-03-055)
##STR00248##
[0435] To a solution of
(R)-(5-aminopyridin-2-yl)(3-((5-chloro-4-(1H-indol-3-yl)pyrimidin-2-yl)am-
ino)piperidin-1-yl)methanone (16 mg, 0.035 mmol) and 0.1 mL of
DIPEA in 2.0 mL of anhydrous CH.sub.3CN was added acryloy chloride
(3.46 mg, 0.038 mmol) in 1.0 mL of DCM dropwise, and stirred for 1
h at 0.degree. C. The reaction mixture was then concentrated and
the residue was purified by prep-HPLC (MeOH/H.sub.2O, 0.05% TFA) to
give the title compound (17.2 mg, 90%) as a light yellow solid
after lyophilisation. LC-MS (m/z): 502 [M+H]. .sup.1H NMR (500 MHz,
DMSO-d6) .delta. 11.80 (s, 1H), 10.66 (s, 1H), 9.78 (s, 1H),
8.98-8.67 (m, 1H), 8.39-8.22 (m, 1H), 8.10 (d, J=8.6 Hz, 1H), 7.68
(d, J=8.5 Hz, 1H), 7.55-7.29 (m, 2H), 7.25-7.17 (m, 1H), 7.16-7.05
(m, 1H), 6.85-6.61 (m, 1H), 6.56-6.39 (m, 1H), 3.86 (d, J=9.0 Hz,
2H), 3.85-3.61 (m, 1H), 3.48 (s, 1H), 3.07 (s, 1H), 2.27-1.99 (m,
2H), 1.88-1.73 (m, 2H), 1.71-1.45 (m, 2H).
Example 8. Synthesis of
(R)-N-(4-(3-((5-chloro-4-(1H-indol-3-yl)pyrimidin-2-yl)amino)piperidin-1--
yl)phenyl)acrylamide (BSJ-02-139)
##STR00249##
[0436]
(R)-5-chloro-4-(1H-indol-3-yl)-N-(piperidin-3-yl)pyrimidin-2-amine
##STR00250##
[0438] To a solution of (R)-tert-butyl
3-(5-chloro-4-(1-(phenylsulfonyl)-1H-indol-3-yl)pyrimidin-2-ylamino)piper-
idine-1-carboxylate (100 mg, 0.18 mmol) in 5 mL of MeOH was treated
with 2.0 mL of 4N HCl in dioxane. The resulting mixture was stirred
for 4 h at room temperature before being evaporated to dryness. The
residue was then dissolved in 3 mL of dioxane, 3 mL of 1N aqueous
NaOH was added and the mixture was stirred for 2 h. Then 1N aqueous
HCl was added to adjust the pH to 7. The resulting mixture was
evaporated and the residue was purified by prep-HPLC
(MeOH/H.sub.2O, 0.05% TFA) to give the title compound (54 mg, 92%)
as a light yellow solid after lyophilisation. LC-MS (m/z): 328
[M+H].sup.+.
(R)-N-(1-(4-aminophenyl)piperidin-3-yl)-5-chloro-4-(1H-indol-3-yl)pyrimidi-
n-2-amine
##STR00251##
[0440] To a solution of
(R)-5-chloro-4-(1H-indol-3-yl)-N-(piperidin-3-yl)pyrimidin-2-amine
(54 mg, 0.17 mmol) in 3 mL of DMF was added 0.1 mL of DIPEA and
1-fluoro-4-nitrobenzene (24 mg, 0.17 mmol). The mixture was heated
to 70.degree. C. and kept stirring for 8 h. The reaction mixture
was then cooled to room temperature and the solvent was evaporated.
The residue was re-dissolved in 5 mL of ethyl ester (4.0 mL) and
MeOH (1.0 mL), SnCl.sub.2 (340.0 mg, 1.8 mmol) was added. The
mixture was heated to 80.degree. C. and kept stirring for 2 h. Then
the reaction mixture was cooled to room temperature and diluted
with 100 mL of sat. NaHCO.sub.3, extracted with 200 mL of
CHCl.sub.3/i-PrOH (v/v=4:1), washed with brine (3.times.100 mL),
dried (anhydrous Na.sub.2SO.sub.4), filtered and concentrated under
reduced pressure. The residue was purified by prep-HPLC
(MeOH/H.sub.2O, 0.05% TFA) to give the title compound (59 mg, 85%)
as a grey solid after lyophilisation. LC-MS (m/z): 419
[M+H].sup.+.
(R)-N-(4-(3-((5-chloro-4-(1H-indol-3-yl)pyrimidin-2-yl)amino)piperidin-1-y-
l)phenyl)acrylamide
##STR00252##
[0442] To a solution of
(R)-N-(1-(4-aminophenyl)piperidin-3-yl)-5-chloro-4-(1H-indol-3-yl)pyrimid-
in-2-amine (15 mg, 0.035 mmol) and 0.1 mL of DIPEA in 2.0 mL of
anhydrous CH.sub.3CN was added acryloy chloride (3.46 mg, 0.038
mmol) in 1.0 mL of DCM dropwise, and stirred for 1 h at 0.degree.
C. The reaction mixture was then concentrated and the residue was
purified by prep-HPLC (MeOH/H.sub.2O, 0.05% TFA) to give the title
compound (15 mg, 91%) as a light yellow solid after lyophilisation.
LC-MS (m/z): 473 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d6)
.delta. 11.83 (s, 1H), 10.58 (s, 1H), 8.61-8.38 (m, 1H), 8.33-7.91
(m, 1H), 7.84-7.51 (m, 1H), 7.45 (d, J=8.0 Hz, 1H), 7.49-7.25 (m,
2H), 7.13 (t, J=7.2 Hz, 1H), 7.08 (t, J=7.2 Hz, 1H), 6.59-6.42 (m,
1H), 6.34-6.20 (m, 1H), 5.90-5.85 (m, 1H), 4.67-4.36 (m, 1H),
3.22-2.80 (m, 1H), 2.05-1.62 (m, 3H), 1.60-1.49 (m, 1H), 1.48 (d,
J=6.3 Hz, 1H), 1.38-1.16 (m, 2H).
Example 9. Synthesis of
(R,E)-N-(4-(3-((5-chloro-4-(1H-indol-3-yl)pyrimidin-2-yl)amino)piperidin--
1-yl)phenyl)-4-(dimethylamino)but-2-enamide (BSJ-02-109)
##STR00253##
[0443]
(R)-N-(1-(5-aminopyridin-2-yl)piperidin-3-yl)-5-chloro-4-(1H-indol--
3-yl)pyrimidin-2-amine
##STR00254##
[0445] To a solution of
(R)-5-chloro-4-(1H-indol-3-yl)-N-(piperidin-3-yl)pyrimidin-2-amine
(54 mg, 0.17 mmol) in 3 mL of DMF was added 0.1 mL of DIPEA and
2-fluoro-5-nitropyridine (24 mg, 0.17 mmol). The mixture was heated
to 70.degree. C. and kept stirring for 8 h. The reaction mixture
was then cooled to room temperature and the solvent was evaporated.
The residue was re-dissolved in 5 mL of ethyl ester (4.0 mL) and
MeOH (1.0 mL), SnCl.sub.2 (340.0 mg, 1.8 mmol) was added. The
mixture was heated to 80.degree. C. and kept stirring for 2 h. Then
the reaction mixture was cooled to room temperature and diluted
with 100 mL of sat. NaHCO.sub.3, extracted with 200 mL of
CHCl.sub.3/i-PrOH (v/v=4:1), washed with brine (3.times.100 mL),
dried (anhydrous Na.sub.2SO.sub.4), filtered and concentrated under
reduced pressure. The residue was purified by prep-HPLC
(MeOH/H.sub.2O, 0.05% TFA) to give the title compound (61 mg, 85%)
as a grey solid after lyophilisation. LC-MS (m/z): 420
[M+H].sup.+.
(R)-N-(6-(3-((5-chloro-4-(1H-indol-3-yl)pyrimidin-2-yl)amino)piperidin-1-y-
l)pyridin-3-yl)acrylamide
##STR00255##
[0447] To a solution of
(R)-N-(1-(5-aminopyridin-2-yl)piperidin-3-yl)-5-chloro-4-(1H-indol-3-yl)p-
yrimidin-2-amine (15 mg, 0.035 mmol) and 0.1 mL of DIPEA in 2.0 mL
of anhydrous CH.sub.3CN was added acryloy chloride (3.46 mg, 0.038
mmol) in 1.0 mL of DCM dropwise, and stirred for 1 h at 0.degree.
C. The reaction mixture was then concentrated and the residue was
purified by prep-HPLC (MeOH/H.sub.2O, 0.05% TFA) to give the title
compound (14 mg, 91%) as a light yellow solid after lyophilisation.
LC-MS (m/z): 474 [M+H].sup.+. .sup.1H NMR (500 MHz, DMSO-d.sub.6)
.delta. 11.87 (d, J=3.1 Hz, 1H), 10.25 (s, 1H), 8.48 (d, J=3.0 Hz,
1H), 8.39 (s, 2H), 8.32 (s, 1H), 7.85 (t, J=21.2 Hz, 1H), 7.46 (t,
J=8.6 Hz, 2H), 7.19 (s, 2H), 6.38 (dd, J=17.0, 10.1 Hz, 1H), 6.25
(dd, J=17.0, 2.0 Hz, 1H), 5.78 (dd, J=10.0, 2.0 Hz, 1H), 4.27 (s,
1H), 4.06 (d, J=13.4 Hz, 1H), 3.06 (dd, J=24.8, 13.0 Hz, 2H), 2.09
(s, 1H), 1.91 (s, 1H), 1.74-1.56 (m, 2H).
Example 10. Synthesis of
(R,E)-N-(6-(3-((5-chloro-4-(1H-indol-3-yl)pyrimidin-2-yl)amino)piperidin--
1-yl)pyridin-3-yl)-4-(dimethylamino)but-2-enamide (BSJ-02-108)
##STR00256##
[0449] To a cold solution (0.degree. C.) of
(R)-N-(1-(5-aminopyridin-2-yl)piperidin-3-yl)-5-chloro-4-(1H-indol-3-yl)p-
yrimidin-2-amine (15 mg, 0.035 mmol) and 0.1 mL of DIPEA in 2.0 mL
of anhydrous CH.sub.3CN was added a solution of
(E)-4-bromobut-2-enoyl chloride (6.34 mg, 0.035 mmol) in 1.0 mL of
DCM dropwise. After 0.5 h at 0.degree. C., a 2M solution of
dimethylamine in THF (1.0 mL) was added and the mixture was stirred
for 1 h at 0.degree. C. Then 1.5 mL of DMSO was added, followed by
removal of the low boiling point solvents under reduced pressure.
The residue was purified by prep-HPLC (MeOH/H.sub.2O, 0.05% TFA) to
give the title compound (16 mg, 86%) as a light yellow solid after
lyophilisation. LC-MS (m/z): 531 [M+H]. .sup.1H NMR (500 MHz,
DMSO-d.sub.6) .delta. 11.91 (s, 1H), 10.20 (s, 1H), 8.68 (d, J=3.0
Hz, 1H), 8.39 (s, 2H), 8.30 (s, 1H), 7.9-7.66 (m, 1H), 7.46 (t,
J=8.6 Hz, 2H), 7.11 (s, 2H), 6.45 (dd, J=17.0, 10.1 Hz, 1H),
6.22-6.03 (m, 1H), 5.78 (dd, J=10.0, 2.0 Hz, 1H), 4.27 (s, 1H),
4.16-3.99 (m, 3H), 3.26-3.08 (m, 2H), 2.84 (s, 6H), 2.19 (s, 1H),
1.90 (s, 1H), 1.76-1.51 (m, 2H).
Example 11. Synthesis of
(R)-N-(4-(3-((5-chloro-4-(1H-indol-3-yl)pyrimidin-2-yl)amino)piperidin-1--
yl)-5-fluoro-2-methylphenyl)acrylamide (BSJ-03-005)
##STR00257##
[0451] Example 11 was synthesized via a procedure similar to
Example 8. LC-MS (m/z): 505 [M+H]. .sup.1H NMR (500 MHz,
DMSO-d.sub.6) .delta. 11.87 (s, 1H), 9.38 (s, 1H), 8.49 (d, J=3.1
Hz, 1H), 8.28 (s, 1H), 7.47 (d, J=8.1 Hz, 1H), 7.35 (d, J=14.1 Hz,
2H), 7.19 (d, J=14.8 Hz, 1H), 6.92 (d, J=9.5 Hz, 1H), 6.52 (dd,
J=17.0, 10.2 Hz, 1H), 6.22 (dd, J=17.0, 2.1 Hz, 1H), 5.73 (dd,
J=10.2, 2.1 Hz, 1H), 3.31 (d, J=11.7 Hz, 1H), 2.76-2.57 (m, 2H),
2.22-1.93 (m, 4H), 1.92-1.62 (m, 2H), 1.55 (qd, J=11.9, 4.0 Hz,
1H).
Example 12.
(R)-N-(4-(3-((5-chloro-4-(1H-indol-3-yl)pyrimidin-2-yl)amino)piperidin-1--
yl)-5-methoxy-2-methylphenyl)acrylamide (BSJ-03-014)
##STR00258##
[0453] Example 12 was synthesized via a procedure similar to
Example 8. LC-MS (m/z): 517 [M+H].sup.+. .sup.1H NMR (500 MHz,
DMSO-d.sub.6) .delta. 11.86 (s, 1H), 9.41 (s, 1H), 8.48 (d, J=3.1
Hz, 1H), 8.29 (s, 1H), 7.48 (d, J=8.2 Hz, 1H), 7.22 (d, J=36.4 Hz,
3H), 6.52 (dd, J=17.0, 10.2 Hz, 1H), 6.22 (dd, J=17.0, 2.1 Hz, 1H),
5.72 (dd, J=10.3, 2.1 Hz, 1H), 3.14 (qd, J=7.4, 4.2 Hz, 2H), 2.11
(s, 3H), 1.96-1.51 (m, 3H), 1.26 (s, 7H).
Example 13.
N-(4-(((1R,3R)-3-((5-chloro-4-(1H-indol-3-yl)pyrimidin-2-yl)amino)cyclohe-
xyl)oxy)-3-fluorophenyl)acrylamide (BSJ-03-161)
##STR00259##
[0455] Example 13 was synthesized via a procedure similar to
Example 1. LC-MS (m/z): 506 [M+H]. .sup.1H NMR (500 MHz,
DMSO-d.sub.6) .delta. 11.88 (s, 1H), 10.18 (s, 1H), 8.67 (d, J=8.1
Hz, 1H), 8.52 (s, 1H), 8.26 (s, 1H), 7.69 (dd, J=13.5, 2.5 Hz, 1H),
7.49 (d, J=8.1 Hz, 1H), 7.34-7.25 (m, 1H), 7.25-7.17 (m, 2H), 7.11
(s, 1H), 6.38 (dd, J=16.9, 10.1 Hz, 1H), 6.24 (dd, J=17.0, 2.0 Hz,
1H), 5.75 (dd, J=10.1, 2.0 Hz, 1H), 4.78 (s, 1H), 3.17 (s, 1H),
2.17 (d, J=13.2 Hz, 1H), 1.81 (d, J=13.8 Hz, 3H), 1.67-1.46 (m,
2H), 1.46-1.20 (m, 1H).
Example 14.
(E)-N-(4-(((1R,3R)-3-((5-chloro-4-(1H-indol-3-yl)pyrimidin-2-yl)amino)cyc-
lohexyl)oxy)-3-fluorophenyl)-4-(dimethylamino)but-2-enamide
(BSJ-03-162)
##STR00260##
[0457] Example 14 was synthesized via a procedure similar to
Example 2. LC-MS (m/z): 563 [M+H].sup.+. .sup.1H NMR (500 MHz,
DMSO-d.sub.6) .delta. 11.86 (s, 1H), 10.37 (s, 1H), 9.80 (s, 1H),
8.66 (d, J=8.0 Hz, 1H), 8.50 (s, 1H), 8.25 (d, J=3.6 Hz, 1H), 7.69
(dd, J=13.3, 2.5 Hz, 1H), 7.48 (d, J=8.1 Hz, 1H), 7.33-7.09 (m,
4H), 6.73 (dt, J=14.8, 7.2 Hz, 1H), 6.49-6.33 (m, 1H), 4.79 (s,
1H), 3.97-3.91 (m, 2H), 2.80 (s, 6H), 2.17 (d, J=13.1 Hz, 1H), 1.81
(d, J=14.2 Hz, 3H), 1.68-1.48 (m, 2H), 1.48-1.18 (m, 1H).
Example 15.
(R)-N-(4-(3-(5-chloro-4-(1H-indol-3-yl)pyrimidin-2-ylamino)piperidin-1-yl-
)-2-methylphenyl)acrylamide (BSJ-03-012)
##STR00261##
[0459] Example 15 was synthesized via a procedure similar to
Example 8. LC-MS (m/z): 487 [M+H].sup.+.
Example 16.
(R)-N-(4-(3-(5-chloro-4-(1H-indol-3-yl)pyrimidin-2-ylamino)piperidin-1-yl-
)-3-fluorophenyl)acrylamide (BSJ-03-018)
##STR00262##
[0461] Example 16 was synthesized via a procedure similar to
Example 8. LC-MS (m/z): 491 [M+H].sup.+.
Example 17
(E)-N-(4-(((1S,3R)-3-((5-chloro-4-(1H-indol-3-yl)pyrimidin-2-yl-
)amino)cyclohexyl)oxy)phenyl)-4-(dimethylamino)but-2-enamide
(BSJ-03-149)
##STR00263##
[0463] Example 17 was synthesized via a procedure similar to
Example 2, LC-Mz (m/z) 546 [M+H].sup.+.
EQUIVALENTS AND SCOPE
[0464] In the claims articles such as "a," "an," and "the" may mean
one or more than one unless indicated to the contrary or otherwise
evident from the context. Claims or descriptions that include "or"
between one or more members of a group are considered satisfied if
one, more than one, or all of the group members are present in,
employed in, or otherwise relevant to a given product or process
unless indicated to the contrary or otherwise evident from the
context. The invention includes embodiments in which exactly one
member of the group is present in, employed in, or otherwise
relevant to a given product or process. The invention includes
embodiments in which more than one, or all of the group members are
present in, employed in, or otherwise relevant to a given product
or process.
[0465] Furthermore, the invention encompasses all variations,
combinations, and permutations in which one or more limitations,
elements, clauses, and descriptive terms from one or more of the
listed claims is introduced into another claim. For example, any
claim that is dependent on another claim can be modified to include
one or more limitations found in any other claim that is dependent
on the same base claim. Where elements are presented as lists,
e.g., in Markush group format, each subgroup of the elements is
also disclosed, and any element(s) can be removed from the group.
It should it be understood that, in general, where the invention,
or aspects of the invention, is/are referred to as comprising
particular elements and/or features, certain embodiments of the
invention or aspects of the invention consist, or consist
essentially of, such elements and/or features. For purposes of
simplicity, those embodiments have not been specifically set forth
in haec verba herein. It is also noted that the terms "comprising"
and "containing" are intended to be open and permits the inclusion
of additional elements or steps. Where ranges are given, endpoints
are included. Furthermore, unless otherwise indicated or otherwise
evident from the context and understanding of one of ordinary skill
in the art, values that are expressed as ranges can assume any
specific value or sub-range within the stated ranges in different
embodiments of the invention, to the tenth of the unit of the lower
limit of the range, unless the context clearly dictates
otherwise.
[0466] This application refers to various issued patents, published
patent applications, journal articles, and other publications, all
of which are incorporated herein by reference. If there is a
conflict between any of the incorporated references and the instant
specification, the specification shall control. In addition, any
particular embodiment of the present invention that falls within
the prior art may be explicitly excluded from any one or more of
the claims. Because such embodiments are deemed to be known to one
of ordinary skill in the art, they may be excluded even if the
exclusion is not set forth explicitly herein. Any particular
embodiment of the invention can be excluded from any claim, for any
reason, whether or not related to the existence of prior art.
[0467] Those skilled in the art will recognize or be able to
ascertain using no more than routine experimentation many
equivalents to the specific embodiments described herein. The scope
of the present embodiments described herein is not intended to be
limited to the above Description, but rather is as set forth in the
appended claims. Those of ordinary skill in the art will appreciate
that various changes and modifications to this description may be
made without departing from the spirit or scope of the present
invention, as defined in the following claims.
Sequence CWU 1
1
31346PRTArtificial SequenceSynthetic polypeptide 1Met Ala Leu Asp
Val Lys Ser Arg Ala Lys Arg Tyr Glu Lys Leu Asp1 5 10 15Phe Leu Gly
Glu Gly Gln Phe Ala Thr Val Tyr Lys Ala Arg Asp Lys 20 25 30Asn Thr
Asn Gln Ile Val Ala Ile Lys Lys Ile Lys Leu Gly His Arg 35 40 45Ser
Glu Ala Lys Asp Gly Ile Asn Arg Thr Ala Leu Arg Glu Ile Lys 50 55
60Leu Leu Gln Glu Leu Ser His Pro Asn Ile Ile Gly Leu Leu Asp Ala65
70 75 80Phe Gly His Lys Ser Asn Ile Ser Leu Val Phe Asp Phe Met Glu
Thr 85 90 95Asp Leu Glu Val Ile Ile Lys Asp Asn Ser Leu Val Leu Thr
Pro Ser 100 105 110His Ile Lys Ala Tyr Met Leu Met Thr Leu Gln Gly
Leu Glu Tyr Leu 115 120 125His Gln His Trp Ile Leu His Arg Asp Leu
Lys Pro Asn Asn Leu Leu 130 135 140Leu Asp Glu Asn Gly Val Leu Lys
Leu Ala Asp Phe Gly Leu Ala Lys145 150 155 160Ser Phe Gly Ser Pro
Asn Arg Ala Tyr Thr His Gln Val Val Thr Arg 165 170 175Trp Tyr Arg
Ala Pro Glu Leu Leu Phe Gly Ala Arg Met Tyr Gly Val 180 185 190Gly
Val Asp Met Trp Ala Val Gly Cys Ile Leu Ala Glu Leu Leu Leu 195 200
205Arg Val Pro Phe Leu Pro Gly Asp Ser Asp Leu Asp Gln Leu Thr Arg
210 215 220Ile Phe Glu Thr Leu Gly Thr Pro Thr Glu Glu Gln Trp Pro
Asp Met225 230 235 240Cys Ser Leu Pro Asp Tyr Val Thr Phe Lys Ser
Phe Pro Gly Ile Pro 245 250 255Leu His His Ile Phe Ser Ala Ala Gly
Asp Asp Leu Leu Asp Leu Ile 260 265 270Gln Gly Leu Phe Leu Phe Asn
Pro Cys Ala Arg Ile Thr Ala Thr Gln 275 280 285Ala Leu Lys Met Lys
Tyr Phe Ser Asn Arg Pro Gly Pro Thr Pro Gly 290 295 300Cys Gln Leu
Pro Arg Pro Asn Cys Pro Val Glu Thr Leu Lys Glu Gln305 310 315
320Ser Asn Pro Ala Leu Ala Ile Lys Arg Lys Arg Thr Glu Ala Leu Glu
325 330 335Gln Gly Gly Leu Pro Lys Lys Leu Ile Phe 340
34521490PRTArtificial SequenceSynthetic polypeptide 2Met Pro Asn
Ser Glu Arg His Gly Gly Lys Lys Asp Gly Ser Gly Gly1 5 10 15Ala Ser
Gly Thr Leu Gln Pro Ser Ser Gly Gly Gly Ser Ser Asn Ser 20 25 30Arg
Glu Arg His Arg Leu Val Ser Lys His Lys Arg His Lys Ser Lys 35 40
45His Ser Lys Asp Met Gly Leu Val Thr Pro Glu Ala Ala Ser Leu Gly
50 55 60Thr Val Ile Lys Pro Leu Val Glu Tyr Asp Asp Ile Ser Ser Asp
Ser65 70 75 80Asp Thr Phe Ser Asp Asp Met Ala Phe Lys Leu Asp Arg
Arg Glu Asn 85 90 95Asp Glu Arg Arg Gly Ser Asp Arg Ser Asp Arg Leu
His Lys His Arg 100 105 110His His Gln His Arg Arg Ser Arg Asp Leu
Leu Lys Ala Lys Gln Thr 115 120 125Glu Lys Glu Lys Ser Gln Glu Val
Ser Ser Lys Ser Gly Ser Met Lys 130 135 140Asp Arg Ile Ser Gly Ser
Ser Lys Arg Ser Asn Glu Glu Thr Asp Asp145 150 155 160Tyr Gly Lys
Ala Gln Val Ala Lys Ser Ser Ser Lys Glu Ser Arg Ser 165 170 175Ser
Lys Leu His Lys Glu Lys Thr Arg Lys Glu Arg Glu Leu Lys Ser 180 185
190Gly His Lys Asp Arg Ser Lys Ser His Arg Lys Arg Glu Thr Pro Lys
195 200 205Ser Tyr Lys Thr Val Asp Ser Pro Lys Arg Arg Ser Arg Ser
Pro His 210 215 220Arg Lys Trp Ser Asp Ser Ser Lys Gln Asp Asp Ser
Pro Ser Gly Ala225 230 235 240Ser Tyr Gly Gln Asp Tyr Asp Leu Ser
Pro Ser Arg Ser His Thr Ser 245 250 255Ser Asn Tyr Asp Ser Tyr Lys
Lys Ser Pro Gly Ser Thr Ser Arg Arg 260 265 270Gln Ser Val Ser Pro
Pro Tyr Lys Glu Pro Ser Ala Tyr Gln Ser Ser 275 280 285Thr Arg Ser
Pro Ser Pro Tyr Ser Arg Arg Gln Arg Ser Val Ser Pro 290 295 300Tyr
Ser Arg Arg Arg Ser Ser Ser Tyr Glu Arg Ser Gly Ser Tyr Ser305 310
315 320Gly Arg Ser Pro Ser Pro Tyr Gly Arg Arg Arg Ser Ser Ser Pro
Phe 325 330 335Leu Ser Lys Arg Ser Leu Ser Arg Ser Pro Leu Pro Ser
Arg Lys Ser 340 345 350Met Lys Ser Arg Ser Arg Ser Pro Ala Tyr Ser
Arg His Ser Ser Ser 355 360 365His Ser Lys Lys Lys Arg Ser Ser Ser
Arg Ser Arg His Ser Ser Ile 370 375 380Ser Pro Val Arg Leu Pro Leu
Asn Ser Ser Leu Gly Ala Glu Leu Ser385 390 395 400Arg Lys Lys Lys
Glu Arg Ala Ala Ala Ala Ala Ala Ala Lys Met Asp 405 410 415Gly Lys
Glu Ser Lys Gly Ser Pro Val Phe Leu Pro Arg Lys Glu Asn 420 425
430Ser Ser Val Glu Ala Lys Asp Ser Gly Leu Glu Ser Lys Lys Leu Pro
435 440 445Arg Ser Val Lys Leu Glu Lys Ser Ala Pro Asp Thr Glu Leu
Val Asn 450 455 460Val Thr His Leu Asn Thr Glu Val Lys Asn Ser Ser
Asp Thr Gly Lys465 470 475 480Val Lys Leu Asp Glu Asn Ser Glu Lys
His Leu Val Lys Asp Leu Lys 485 490 495Ala Gln Gly Thr Arg Asp Ser
Lys Pro Ile Ala Leu Lys Glu Glu Ile 500 505 510Val Thr Pro Lys Glu
Thr Glu Thr Ser Glu Lys Glu Thr Pro Pro Pro 515 520 525Leu Pro Thr
Ile Ala Ser Pro Pro Pro Pro Leu Pro Thr Thr Thr Pro 530 535 540Pro
Pro Gln Thr Pro Pro Leu Pro Pro Leu Pro Pro Ile Pro Ala Leu545 550
555 560Pro Gln Gln Pro Pro Leu Pro Pro Ser Gln Pro Ala Phe Ser Gln
Val 565 570 575Pro Ala Ser Ser Thr Ser Thr Leu Pro Pro Ser Thr His
Ser Lys Thr 580 585 590Ser Ala Val Ser Ser Gln Ala Asn Ser Gln Pro
Pro Val Gln Val Ser 595 600 605Val Lys Thr Gln Val Ser Val Thr Ala
Ala Ile Pro His Leu Lys Thr 610 615 620Ser Thr Leu Pro Pro Leu Pro
Leu Pro Pro Leu Leu Pro Gly Asp Asp625 630 635 640Asp Met Asp Ser
Pro Lys Glu Thr Leu Pro Ser Lys Pro Val Lys Lys 645 650 655Glu Lys
Glu Gln Arg Thr Arg His Leu Leu Thr Asp Leu Pro Leu Pro 660 665
670Pro Glu Leu Pro Gly Gly Asp Leu Ser Pro Pro Asp Ser Pro Glu Pro
675 680 685Lys Ala Ile Thr Pro Pro Gln Gln Pro Tyr Lys Lys Arg Pro
Lys Ile 690 695 700Cys Cys Pro Arg Tyr Gly Glu Arg Arg Gln Thr Glu
Ser Asp Trp Gly705 710 715 720Lys Arg Cys Val Asp Lys Phe Asp Ile
Ile Gly Ile Ile Gly Glu Gly 725 730 735Thr Tyr Gly Gln Val Tyr Lys
Ala Lys Asp Lys Asp Thr Gly Glu Leu 740 745 750Val Ala Leu Lys Lys
Val Arg Leu Asp Asn Glu Lys Glu Gly Phe Pro 755 760 765Ile Thr Ala
Ile Arg Glu Ile Lys Ile Leu Arg Gln Leu Ile His Arg 770 775 780Ser
Val Val Asn Met Lys Glu Ile Val Thr Asp Lys Gln Asp Ala Leu785 790
795 800Asp Phe Lys Lys Asp Lys Gly Ala Phe Tyr Leu Val Phe Glu Tyr
Met 805 810 815Asp His Asp Leu Met Gly Leu Leu Glu Ser Gly Leu Val
His Phe Ser 820 825 830Glu Asp His Ile Lys Ser Phe Met Lys Gln Leu
Met Glu Gly Leu Glu 835 840 845Tyr Cys His Lys Lys Asn Phe Leu His
Arg Asp Ile Lys Cys Ser Asn 850 855 860Ile Leu Leu Asn Asn Ser Gly
Gln Ile Lys Leu Ala Asp Phe Gly Leu865 870 875 880Ala Arg Leu Tyr
Asn Ser Glu Glu Ser Arg Pro Tyr Thr Asn Lys Val 885 890 895Ile Thr
Leu Trp Tyr Arg Pro Pro Glu Leu Leu Leu Gly Glu Glu Arg 900 905
910Tyr Thr Pro Ala Ile Asp Val Trp Ser Cys Gly Cys Ile Leu Gly Glu
915 920 925Leu Phe Thr Lys Lys Pro Ile Phe Gln Ala Asn Leu Glu Leu
Ala Gln 930 935 940Leu Glu Leu Ile Ser Arg Leu Cys Gly Ser Pro Cys
Pro Ala Val Trp945 950 955 960Pro Asp Val Ile Lys Leu Pro Tyr Phe
Asn Thr Met Lys Pro Lys Lys 965 970 975Gln Tyr Arg Arg Arg Leu Arg
Glu Glu Phe Ser Phe Ile Pro Ser Ala 980 985 990Ala Leu Asp Leu Leu
Asp His Met Leu Thr Leu Asp Pro Ser Lys Arg 995 1000 1005Cys Thr
Ala Glu Gln Thr Leu Gln Ser Asp Phe Leu Lys Asp Val 1010 1015
1020Glu Leu Ser Lys Met Ala Pro Pro Asp Leu Pro His Trp Gln Asp
1025 1030 1035Cys His Glu Leu Trp Ser Lys Lys Arg Arg Arg Gln Arg
Gln Ser 1040 1045 1050Gly Val Val Val Glu Glu Pro Pro Pro Ser Lys
Thr Ser Arg Lys 1055 1060 1065Glu Thr Thr Ser Gly Thr Ser Thr Glu
Pro Val Lys Asn Ser Ser 1070 1075 1080Pro Ala Pro Pro Gln Pro Ala
Pro Gly Lys Val Glu Ser Gly Ala 1085 1090 1095Gly Asp Ala Ile Gly
Leu Ala Asp Ile Thr Gln Gln Leu Asn Gln 1100 1105 1110Ser Glu Leu
Ala Val Leu Leu Asn Leu Leu Gln Ser Gln Thr Asp 1115 1120 1125Leu
Ser Ile Pro Gln Met Ala Gln Leu Leu Asn Ile His Ser Asn 1130 1135
1140Pro Glu Met Gln Gln Gln Leu Glu Ala Leu Asn Gln Ser Ile Ser
1145 1150 1155Ala Leu Thr Glu Ala Thr Ser Gln Gln Gln Asp Ser Glu
Thr Met 1160 1165 1170Ala Pro Glu Glu Ser Leu Lys Glu Ala Pro Ser
Ala Pro Val Ile 1175 1180 1185Leu Pro Ser Ala Glu Gln Thr Thr Leu
Glu Ala Ser Ser Thr Pro 1190 1195 1200Ala Asp Met Gln Asn Ile Leu
Ala Val Leu Leu Ser Gln Leu Met 1205 1210 1215Lys Thr Gln Glu Pro
Ala Gly Ser Leu Glu Glu Asn Asn Ser Asp 1220 1225 1230Lys Asn Ser
Gly Pro Gln Gly Pro Arg Arg Thr Pro Thr Met Pro 1235 1240 1245Gln
Glu Glu Ala Ala Ala Cys Pro Pro His Ile Leu Pro Pro Glu 1250 1255
1260Lys Arg Pro Pro Glu Pro Pro Gly Pro Pro Pro Pro Pro Pro Pro
1265 1270 1275Pro Pro Leu Val Glu Gly Asp Leu Ser Ser Ala Pro Gln
Glu Leu 1280 1285 1290Asn Pro Ala Val Thr Ala Ala Leu Leu Gln Leu
Leu Ser Gln Pro 1295 1300 1305Glu Ala Glu Pro Pro Gly His Leu Pro
His Glu His Gln Ala Leu 1310 1315 1320Arg Pro Met Glu Tyr Ser Thr
Arg Pro Arg Pro Asn Arg Thr Tyr 1325 1330 1335Gly Asn Thr Asp Gly
Pro Glu Thr Gly Phe Ser Ala Ile Asp Thr 1340 1345 1350Asp Glu Arg
Asn Ser Gly Pro Ala Leu Thr Glu Ser Leu Val Gln 1355 1360 1365Thr
Leu Val Lys Asn Arg Thr Phe Ser Gly Ser Leu Ser His Leu 1370 1375
1380Gly Glu Ser Ser Ser Tyr Gln Gly Thr Gly Ser Val Gln Phe Pro
1385 1390 1395Gly Asp Gln Asp Leu Arg Phe Ala Arg Val Pro Leu Ala
Leu His 1400 1405 1410Pro Val Val Gly Gln Pro Phe Leu Lys Ala Glu
Gly Ser Ser Asn 1415 1420 1425Ser Val Val His Ala Glu Thr Lys Leu
Gln Asn Tyr Gly Glu Leu 1430 1435 1440Gly Pro Gly Thr Thr Gly Ala
Ser Ser Ser Gly Ala Gly Leu His 1445 1450 1455Trp Gly Gly Pro Thr
Gln Ser Ser Ala Tyr Gly Lys Leu Tyr Arg 1460 1465 1470Gly Pro Thr
Arg Val Pro Pro Arg Gly Gly Arg Gly Arg Gly Val 1475 1480 1485Pro
Tyr 149031512PRTArtificial SequenceSynthetic polypeptide 3Met Pro
Ser Ser Ser Asp Thr Ala Leu Gly Gly Gly Gly Gly Leu Ser1 5 10 15Trp
Ala Glu Lys Lys Leu Glu Glu Arg Arg Lys Arg Arg Arg Phe Leu 20 25
30Ser Pro Gln Gln Pro Pro Leu Leu Leu Pro Leu Leu Gln Pro Gln Leu
35 40 45Leu Gln Pro Pro Pro Pro Pro Pro Pro Leu Leu Phe Leu Ala Ala
Pro 50 55 60Gly Thr Ala Ala Ala Ala Ala Ala Ala Ala Ala Ala Ser Ser
Ser Cys65 70 75 80Phe Ser Pro Gly Pro Pro Leu Glu Val Lys Arg Leu
Ala Arg Gly Lys 85 90 95Arg Arg Ala Gly Gly Arg Gln Lys Arg Arg Arg
Gly Pro Arg Ala Gly 100 105 110Gln Glu Ala Glu Lys Arg Arg Val Phe
Ser Leu Pro Gln Pro Gln Gln 115 120 125Asp Gly Gly Gly Gly Ala Ser
Ser Gly Gly Gly Val Thr Pro Leu Val 130 135 140Glu Tyr Glu Asp Val
Ser Ser Gln Ser Glu Gln Gly Leu Leu Leu Gly145 150 155 160Gly Ala
Ser Ala Ala Thr Ala Ala Thr Ala Ala Gly Gly Thr Gly Gly 165 170
175Ser Gly Gly Ser Pro Ala Ser Ser Ser Gly Thr Gln Arg Arg Gly Glu
180 185 190Gly Ser Glu Arg Arg Pro Arg Arg Asp Arg Arg Ser Ser Ser
Gly Arg 195 200 205Ser Lys Glu Arg His Arg Glu His Arg Arg Arg Asp
Gly Gln Arg Gly 210 215 220Gly Ser Glu Ala Ser Lys Ser Arg Ser Arg
His Ser His Ser Gly Glu225 230 235 240Glu Arg Ala Glu Val Ala Lys
Ser Gly Ser Ser Ser Ser Ser Gly Gly 245 250 255Arg Arg Lys Ser Ala
Ser Ala Thr Ser Ser Ser Ser Ser Ser Arg Lys 260 265 270Asp Arg Asp
Ser Lys Ala His Arg Ser Arg Thr Lys Ser Ser Lys Glu 275 280 285Pro
Pro Ser Ala Tyr Lys Glu Pro Pro Lys Ala Tyr Arg Glu Asp Lys 290 295
300Thr Glu Pro Lys Ala Tyr Arg Arg Arg Arg Ser Leu Ser Pro Leu
Gly305 310 315 320Gly Arg Asp Asp Ser Pro Val Ser His Arg Ala Ser
Gln Ser Leu Arg 325 330 335Ser Arg Lys Ser Pro Ser Pro Ala Gly Gly
Gly Ser Ser Pro Tyr Ser 340 345 350Arg Arg Leu Pro Arg Ser Pro Ser
Pro Tyr Ser Arg Arg Arg Ser Pro 355 360 365Ser Tyr Ser Arg His Ser
Ser Tyr Glu Arg Gly Gly Asp Val Ser Pro 370 375 380Ser Pro Tyr Ser
Ser Ser Ser Trp Arg Arg Ser Arg Ser Pro Tyr Ser385 390 395 400Pro
Val Leu Arg Arg Ser Gly Lys Ser Arg Ser Arg Ser Pro Tyr Ser 405 410
415Ser Arg His Ser Arg Ser Arg Ser Arg His Arg Leu Ser Arg Ser Arg
420 425 430Ser Arg His Ser Ser Ile Ser Pro Ser Thr Leu Thr Leu Lys
Ser Ser 435 440 445Leu Ala Ala Glu Leu Asn Lys Asn Lys Lys Ala Arg
Ala Ala Glu Ala 450 455 460Ala Arg Ala Ala Glu Ala Ala Lys Ala Ala
Glu Ala Thr Lys Ala Ala465 470 475 480Glu Ala Ala Ala Lys Ala Ala
Lys Ala Ser Asn Thr Ser Thr Pro Thr 485 490 495Lys Gly Asn Thr Glu
Thr Ser Ala Ser Ala Ser Gln Thr Asn His Val 500 505 510Lys Asp Val
Lys Lys Ile Lys Ile Glu His Ala Pro Ser Pro Ser Ser 515 520 525Gly
Gly Thr Leu Lys Asn Asp Lys Ala Lys Thr Lys Pro Pro Leu Gln 530 535
540Val Thr Lys Val Glu Asn Asn Leu Ile Val Asp Lys Ala Thr Lys
Lys545 550 555 560Ala Val Ile Val Gly Lys Glu Ser Lys Ser Ala Ala
Thr Lys Glu Glu 565 570 575Ser Val Ser Leu Lys Glu Lys Thr Lys Pro
Leu Thr Pro Ser Ile Gly 580 585 590Ala Lys Glu Lys Glu Gln His Val
Ala Leu Val Thr Ser Thr Leu Pro 595 600
605Pro Leu Pro Leu Pro Pro Met Leu Pro Glu Asp Lys Glu Ala Asp Ser
610 615 620Leu Arg Gly Asn Ile Ser Val Lys Ala Val Lys Lys Glu Val
Glu Lys625 630 635 640Lys Leu Arg Cys Leu Leu Ala Asp Leu Pro Leu
Pro Pro Glu Leu Pro 645 650 655Gly Gly Asp Asp Leu Ser Lys Ser Pro
Glu Glu Lys Lys Thr Ala Thr 660 665 670Gln Leu His Ser Lys Arg Arg
Pro Lys Ile Cys Gly Pro Arg Tyr Gly 675 680 685Glu Thr Lys Glu Lys
Asp Ile Asp Trp Gly Lys Arg Cys Val Asp Lys 690 695 700Phe Asp Ile
Ile Gly Ile Ile Gly Glu Gly Thr Tyr Gly Gln Val Tyr705 710 715
720Lys Ala Arg Asp Lys Asp Thr Gly Glu Met Val Ala Leu Lys Lys Val
725 730 735Arg Leu Asp Asn Glu Lys Glu Gly Phe Pro Ile Thr Ala Ile
Arg Glu 740 745 750Ile Lys Ile Leu Arg Gln Leu Thr His Gln Ser Ile
Ile Asn Met Lys 755 760 765Glu Ile Val Thr Asp Lys Glu Asp Ala Leu
Asp Phe Lys Lys Asp Lys 770 775 780Gly Ala Phe Tyr Leu Val Phe Glu
Tyr Met Asp His Asp Leu Met Gly785 790 795 800Leu Leu Glu Ser Gly
Leu Val His Phe Asn Glu Asn His Ile Lys Ser 805 810 815Phe Met Arg
Gln Leu Met Glu Gly Leu Asp Tyr Cys His Lys Lys Asn 820 825 830Phe
Leu His Arg Asp Ile Lys Cys Ser Asn Ile Leu Leu Asn Asn Arg 835 840
845Gly Gln Ile Lys Leu Ala Asp Phe Gly Leu Ala Arg Leu Tyr Ser Ser
850 855 860Glu Glu Ser Arg Pro Tyr Thr Asn Lys Val Ile Thr Leu Trp
Tyr Arg865 870 875 880Pro Pro Glu Leu Leu Leu Gly Glu Glu Arg Tyr
Thr Pro Ala Ile Asp 885 890 895Val Trp Ser Cys Gly Cys Ile Leu Gly
Glu Leu Phe Thr Lys Lys Pro 900 905 910Ile Phe Gln Ala Asn Gln Glu
Leu Ala Gln Leu Glu Leu Ile Ser Arg 915 920 925Ile Cys Gly Ser Pro
Cys Pro Ala Val Trp Pro Asp Val Ile Lys Leu 930 935 940Pro Tyr Phe
Asn Thr Met Lys Pro Lys Lys Gln Tyr Arg Arg Lys Leu945 950 955
960Arg Glu Glu Phe Val Phe Ile Pro Ala Ala Ala Leu Asp Leu Phe Asp
965 970 975Tyr Met Leu Ala Leu Asp Pro Ser Lys Arg Cys Thr Ala Glu
Gln Ala 980 985 990Leu Gln Cys Glu Phe Leu Arg Asp Val Glu Pro Ser
Lys Met Pro Pro 995 1000 1005Pro Asp Leu Pro Leu Trp Gln Asp Cys
His Glu Leu Trp Ser Lys 1010 1015 1020Lys Arg Arg Arg Gln Lys Gln
Met Gly Met Thr Asp Asp Val Ser 1025 1030 1035Thr Ile Lys Ala Pro
Arg Lys Asp Leu Ser Leu Gly Leu Asp Asp 1040 1045 1050Ser Arg Thr
Asn Thr Pro Gln Gly Val Leu Pro Ser Ser Gln Leu 1055 1060 1065Lys
Ser Gln Gly Ser Ser Asn Val Ala Pro Val Lys Thr Gly Pro 1070 1075
1080Gly Gln His Leu Asn His Ser Glu Leu Ala Ile Leu Leu Asn Leu
1085 1090 1095Leu Gln Ser Lys Thr Ser Val Asn Met Ala Asp Phe Val
Gln Val 1100 1105 1110Leu Asn Ile Lys Val Asn Ser Glu Thr Gln Gln
Gln Leu Asn Lys 1115 1120 1125Ile Asn Leu Pro Ala Gly Ile Leu Ala
Thr Gly Glu Lys Gln Thr 1130 1135 1140Asp Pro Ser Thr Pro Gln Gln
Glu Ser Ser Lys Pro Leu Gly Gly 1145 1150 1155Ile Gln Pro Ser Ser
Gln Thr Ile Gln Pro Lys Val Glu Thr Asp 1160 1165 1170Ala Ala Gln
Ala Ala Val Gln Ser Ala Phe Ala Val Leu Leu Thr 1175 1180 1185Gln
Leu Ile Lys Ala Gln Gln Ser Lys Gln Lys Asp Val Leu Leu 1190 1195
1200Glu Glu Arg Glu Asn Gly Ser Gly His Glu Ala Ser Leu Gln Leu
1205 1210 1215Arg Pro Pro Pro Glu Pro Ser Thr Pro Val Ser Gly Gln
Asp Asp 1220 1225 1230Leu Ile Gln His Gln Asp Met Arg Ile Leu Glu
Leu Thr Pro Glu 1235 1240 1245Pro Asp Arg Pro Arg Ile Leu Pro Pro
Asp Gln Arg Pro Pro Glu 1250 1255 1260Pro Pro Glu Pro Pro Pro Val
Thr Glu Glu Asp Leu Asp Tyr Arg 1265 1270 1275Thr Glu Asn Gln His
Val Pro Thr Thr Ser Ser Ser Leu Thr Asp 1280 1285 1290Pro His Ala
Gly Val Lys Ala Ala Leu Leu Gln Leu Leu Ala Gln 1295 1300 1305His
Gln Pro Gln Asp Asp Pro Lys Arg Glu Gly Gly Ile Asp Tyr 1310 1315
1320Gln Ala Gly Asp Thr Tyr Val Ser Thr Ser Asp Tyr Lys Asp Asn
1325 1330 1335Phe Gly Ser Ser Ser Phe Ser Ser Ala Pro Tyr Val Ser
Asn Asp 1340 1345 1350Gly Leu Gly Ser Ser Ser Ala Pro Pro Leu Glu
Arg Arg Ser Phe 1355 1360 1365Ile Gly Asn Ser Asp Ile Gln Ser Leu
Asp Asn Tyr Ser Thr Ala 1370 1375 1380Ser Ser His Ser Gly Gly Pro
Pro Gln Pro Ser Ala Phe Ser Glu 1385 1390 1395Ser Phe Pro Ser Ser
Val Ala Gly Tyr Gly Asp Ile Tyr Leu Asn 1400 1405 1410Ala Gly Pro
Met Leu Phe Ser Gly Asp Lys Asp His Arg Phe Glu 1415 1420 1425Tyr
Ser His Gly Pro Ile Ala Val Leu Ala Asn Ser Ser Asp Pro 1430 1435
1440Ser Thr Gly Pro Glu Ser Thr His Pro Leu Pro Ala Lys Met His
1445 1450 1455Asn Tyr Asn Tyr Gly Gly Asn Leu Gln Glu Asn Pro Ser
Gly Pro 1460 1465 1470Ser Leu Met His Gly Gln Thr Trp Thr Ser Pro
Ala Gln Gly Pro 1475 1480 1485Gly Tyr Ser Gln Gly Tyr Arg Gly His
Ile Ser Thr Ser Thr Gly 1490 1495 1500Arg Gly Arg Gly Arg Gly Leu
Pro Tyr 1505 1510
* * * * *