U.S. patent application number 16/098971 was filed with the patent office on 2019-05-09 for glp-1 receptor ligand moiety conjugated oligonucleotides and uses thereof.
The applicant listed for this patent is AstraZeneca AB, Ionis Pharmaceuticals, Inc.. Invention is credited to Eva Carina Ammala, Shalini Andersson, William John Drury III, Garth A. KINBERGER, Daniel Laurent Knerr, Richard Lee, Brett P. Monia, Maria Astrid Olwegard-Halvarsson, Thazha P. Prakash, Punit P. Seth, Eric Valeur.
Application Number | 20190134214 16/098971 |
Document ID | / |
Family ID | 60203364 |
Filed Date | 2019-05-09 |
![](/patent/app/20190134214/US20190134214A1-20190509-C00001.png)
![](/patent/app/20190134214/US20190134214A1-20190509-C00002.png)
![](/patent/app/20190134214/US20190134214A1-20190509-C00003.png)
![](/patent/app/20190134214/US20190134214A1-20190509-C00004.png)
![](/patent/app/20190134214/US20190134214A1-20190509-C00005.png)
![](/patent/app/20190134214/US20190134214A1-20190509-C00006.png)
![](/patent/app/20190134214/US20190134214A1-20190509-C00007.png)
![](/patent/app/20190134214/US20190134214A1-20190509-C00008.png)
![](/patent/app/20190134214/US20190134214A1-20190509-C00009.png)
![](/patent/app/20190134214/US20190134214A1-20190509-C00010.png)
![](/patent/app/20190134214/US20190134214A1-20190509-C00011.png)
View All Diagrams
United States Patent
Application |
20190134214 |
Kind Code |
A1 |
Monia; Brett P. ; et
al. |
May 9, 2019 |
GLP-1 Receptor Ligand Moiety Conjugated Oligonucleotides and Uses
Thereof
Abstract
The present embodiments provide compounds and methods for
targeting cells expressing GLP-1 receptor.
Inventors: |
Monia; Brett P.; (Encinitas,
CA) ; Prakash; Thazha P.; (Carlsbad, CA) ;
KINBERGER; Garth A.; (San Diego, CA) ; Lee;
Richard; (Oceanside, CA) ; Seth; Punit P.;
(Carlsbad, CA) ; Andersson; Shalini; (Sodertalje,
SE) ; Ammala; Eva Carina; (Molndal, SE) ;
Knerr; Daniel Laurent; (Molndal, SE) ;
Olwegard-Halvarsson; Maria Astrid; (Molndal, SE) ;
Valeur; Eric; (Molndal, SE) ; Drury III; William
John; (Molndal, SE) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
AstraZeneca AB
Ionis Pharmaceuticals, Inc. |
Sodertalje
Carlsbad |
CA |
SE
US |
|
|
Family ID: |
60203364 |
Appl. No.: |
16/098971 |
Filed: |
May 4, 2017 |
PCT Filed: |
May 4, 2017 |
PCT NO: |
PCT/US2017/031010 |
371 Date: |
November 5, 2018 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
62333080 |
May 6, 2016 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C12N 2310/11 20130101;
C12N 2310/322 20130101; C12N 15/111 20130101; A61K 47/6425
20170801; A61P 43/00 20180101; C12N 2310/3341 20130101; A61P 3/08
20180101; C12N 2310/3533 20130101; A61K 31/713 20130101; A61K
38/1796 20130101; C12N 2310/3231 20130101; C12N 2310/3525 20130101;
A61P 35/00 20180101; A61K 47/65 20170801; C12N 2310/315 20130101;
C12N 2310/321 20130101; C12N 2320/32 20130101; A61K 31/7125
20130101; C12N 2310/3513 20130101; A61K 47/549 20170801; C12N
2310/3521 20130101; C12N 2310/321 20130101; C12N 2310/3521
20130101; C12N 2310/321 20130101; C12N 2310/3525 20130101; C12N
2310/322 20130101; C12N 2310/3533 20130101 |
International
Class: |
A61K 47/64 20060101
A61K047/64; A61K 31/713 20060101 A61K031/713; A61K 38/17 20060101
A61K038/17; A61K 31/7125 20060101 A61K031/7125; A61K 47/54 20060101
A61K047/54; A61K 47/65 20060101 A61K047/65 |
Claims
1. A compound comprising a modified oligonucleotide, conjugate
linker, and GLP-1 receptor ligand conjugate moiety.
2. The compound of claim 1, wherein the conjugate linker links the
modified oligonucleotide to the GLP-1 receptor ligand conjugate
moiety.
3. The compound of claim 1 or 2, wherein the modified
oligonucleotide is 8 to 80 linked nucleosides in length.
4. The compound of claim 3, wherein the modified oligonucleotide is
10 to 30 linked nucleosides in length.
5. The compound of claim 3, wherein the modified oligonucleotide is
12 to 30 linked nucleosides in length.
6. The compound of claim 3, wherein the modified oligonucleotide is
15 to 30 linked nucleosides in length.
7. The compound of any of claims 1-6, wherein the modified
oligonucleotide comprises at least one modified internucleoside
linkage, at least one modified sugar, or at least one modified
nucleobase.
8. The compound of claim 7, wherein the modified internucleoside
linkage is a phosphorothioate internucleoside linkage.
9. The compound of claim 8, wherein each modified internucleoside
linkage of the modified oligonucleotide is a phosphorothioate
internucleoside linkage.
10. The compound of any of claims 7-9, wherein the modified sugar
is a bicyclic sugar.
11. The compound of claim 10, wherein the bicyclic sugar is
selected from the group consisting of: 4'-(CH.sub.2)--O-2' (LNA);
4'-(CH.sub.2).sub.2--O-2' (ENA); and 4'-CH(CH.sub.3)--O-2'
(cEt).
12. The compound of any of claims 7-9, wherein the modified sugar
is 2'-O-methoxyethyl, 2'-F, or 2'-OMe.
13. The compound of any of claims 7-12, wherein the modified
nucleobase is a 5-methylcytosine.
14. The compound of any of claims 1-13, wherein the modified
oligonucleotide comprises: a gap segment consisting of linked
deoxynucleosides; a 5' wing segment consisting of linked
nucleosides; and a 3' wing segment consisting of linked
nucleosides; wherein the gap segment is positioned immediately
adjacent to and between the 5' wing segment and the 3' wing segment
and wherein each nucleoside of each wing segment comprises a
modified sugar.
15. The compound of any of claims 1-14, wherein the modified
oligonucleotide is single-stranded.
16. The compound of claim 15, wherein the modified oligonucleotide
is an antisense oligonucleotide.
17. The compound of claim 15, wherein the modified oligonucleotide
is a miRNA antagonist or miRNA mimic.
18. The compound of any of claims 1-14, wherein the compound
comprises a double-stranded duplex.
19. The compound of claim 18, wherein the double-stranded duplex
comprises: a first strand comprising the modified oligonucleotide;
and a second strand complementary to the first strand.
20. The compound of claim 19, wherein the first strand comprising
the modified oligonucleotide is complementary to a RNA
transcript.
21. The compound of claim 19, wherein the second strand is
complementary to a RNA transcript.
22. The compound of claim 18, wherein the compound is a miRNA
mimic.
23. The compound of any of claims 1-22, wherein the compound
comprises ribonucleotides.
24. The compound of any of claims 1-22, wherein the compound
comprises deoxyribonucleotides.
25. The compound of any of claims 1-24, wherein the modified
oligonucleotide is complementary to a RNA transcript in a cell.
26. The compound of claim 25, wherein the cell is a pancreatic
cell.
27. The compound of claim 26, wherein the pancreatic cell is a
beta-islet cell.
28. The compound of any of claims 25-27, wherein the RNA transcript
is pre-mRNA, mRNA, non-coding RNA, or miRNA.
29. The compound of any of claims 1-28, wherein the GLP-1 receptor
ligand conjugate moiety is a peptide conjugate moiety, small
molecule conjugate moiety, aptamer conjugate moiety, or antibody
conjugate moiety targeted to GLP-1 receptor.
30. The compound of claim 29, wherein the peptide conjugate moiety
is a GLP-1 peptide conjugate moiety.
31. The compound of claim 30, wherein the GLP-1 peptide conjugate
moiety comprises an at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17,
18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or 31
contiguous amino acid portion at least 60%, at least 65%, at least
70%, at least 75%, at least 80%, at least 85%, at least 90%, at
least 95%, or 100% homologous to an equal length portion of the
amino acid sequence of any of SEQ ID NOs: 1-57.
32. The compound of claim 31, wherein the GLP-1 peptide conjugate
moiety comprises a conservative amino acid substitution, an amino
acid analog, or an amino acid derivative, wherein the conservative
amino acid substitution comprises replacement of an aliphatic amino
acid with another aliphatic amino acid; replacement of a serine
with a threonine or vice versa; replacement of an acidic residue
with another acidic residue; replacement of a residue bearing an
amide group with another residue bearing an amide group; exchange
of a basic residue with another basic residue; or, replacement of
an aromatic residue with another aromatic residue, or a combination
thereof, and the aliphatic residue comprises Alanine, Valine,
Leucine, Isoleucine or a synthetic equivalent thereof; the acidic
residue comprises Aspartic acid, Glutamic acid or a synthetic
equivalent thereof, the residue comprising an amide group comprises
Aspartic acid, Glutamic acid or a synthetic equivalent thereof; the
basic residue comprises Lysine, Arginine or a synthetic equivalent
thereof, or, the aromatic residue comprises Phenylalanine, Tyrosine
or a synthetic equivalent thereof.
33. The compound of claim 31, wherein the GLP-1 peptide conjugate
moiety comprises an at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17,
18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or 31
contiguous amino acid portion at least 60%, at least 65%, at least
70%, at least 75%, at least 80%, at least 85%, at least 90%, at
least 95%, or 100% identical to an equal length portion of the
amino acid sequence of any of SEQ ID NOs: 1-57.
34. The compound of claim 30, wherein the GLP-1 peptide conjugate
moiety is 8 to 50 amino acids in length and is at least 60%, at
least 65%, at least 70%, at least 75%, at least 80%, at least 85%,
at least 90%, at least 95%, or 100% homologous over its entire
length to the amino acid sequence of any of SEQ ID NOs: 1-57.
35. The compound of claim 34, wherein the GLP-1 peptide conjugate
moiety comprises a conservative amino acid substitution, an amino
acid analog, or an amino acid derivative.
36. The compound of claim 34, wherein the GLP-1 peptide conjugate
moiety is at least 60%, at least 65%, at least 70%, at least 75%,
at least 80%, at least 85%, at least 90%, at least 95%, or 100%
identical over its entire length to the amino acid sequence of any
of SEQ ID NOs: 1-57.
37. The compound of any of claims 30-36, wherein the GLP-1 peptide
conjugate moiety comprises the amino acid sequence of any of SEQ ID
NOs: 1-57.
38. The compound of claim 37, wherein the GLP-1 peptide conjugate
moiety consists of the amino acid sequence of any of SEQ ID NOs:
1-57.
39. The compound of any of claims 30-36, wherein the GLP-1 peptide
conjugate moiety comprises the amino acid sequence:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Cys (SEQ ID NO: 22), wherein Aib is aminoisobutyric
acid.
40. The compound of claim 39, wherein the GLP-1 peptide conjugate
moiety consists of the amino acid sequence:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Cys (SEQ ID NO: 22), wherein Aib is aminoisobutyric
acid.
41. The compound of any of claims 30-36, wherein the GLP-1 peptide
conjugate moiety comprises the amino acid sequence:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Pen (SEQ ID NO: 23), wherein Aib is aminoisobutyric acid
and Pen is penicillamine.
42. The compound of claim 41, wherein the GLP-1 peptide conjugate
moiety consists of the amino acid sequence:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Pen (SEQ ID NO: 23), wherein Aib is aminoisobutyric acid
and Pen is penicillamine.
43. The compound of any of claims 30-36, wherein the GLP-1 peptide
conjugate moiety comprises the amino acid sequence:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly (SEQ ID NO:
1).
44. The compound of claim 43, wherein the GLP-1 peptide conjugate
moiety consists of the amino acid sequence:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly (SEQ ID NO:
1).
45. The compound of any of claims 30-44, wherein the GLP-1 peptide
conjugate moiety is capable of binding to GLP-1 receptor.
46. The compound of claim 45, wherein the GLP-1 receptor is
expressed on the surface of a cell.
47. The compound of claim 46, wherein the cell is a pancreatic
cell.
48. The compound of claim 47, wherein the pancreatic cell is a
beta-islet cell.
49. The compound of any of claims 46-48, wherein the cell is in an
animal.
50. The compound of any of claims 1-49, wherein the compound
comprises at least one, at least two, at least three, at least
four, or at least five GLP-1 receptor ligand conjugate
moieties.
51. The compound of any of claims 1-50, wherein the conjugate
linker links the GLP-1 receptor ligand conjugate moiety to the 5'
end of the modified oligonucleotide.
52. The compound of any of claims 1-50, wherein the conjugate
linker links the GLP-1 receptor ligand conjugate moiety to the 3'
end of the modified oligonucleotide.
53. The compound of any of claims 1-52, wherein the conjugate
linker is cleavable.
54. The compound of any of claims 1-53, wherein the conjugate
linker comprises a disulfide linkage.
55. The compound of claim 54, wherein the disulfide linkage
comprises penicillamine.
56. The compound of claim 55, wherein the GLP-1 receptor ligand
conjugate moiety is the GLP-1 peptide conjugate moiety of any of
claims 30-44 and the disulfide linkage links the GLP-1 peptide
conjugate moiety to the modified oligonucleotide.
57. The compound of claim 56, wherein the disulfide linkage links
the C-terminus of the GLP-1 peptide conjugate moiety to the 5'end
or 3' end of the modified oligonucleotide.
58. The compound of any of claims 1-57, wherein the conjugate
linker comprises 1-5 linker-nucleosides.
59. The compound of claim 58, wherein the conjugate linker
comprises 3 linker-nucleosides.
60. The compound of claim 59, wherein the 3 linker-nucleosides have
a TCA motif.
61. The compound of claim 58, wherein 1-5 linker-nucleosides do not
comprise a TCA motif.
62. The compound of any of claims 1-61, wherein the conjugate
linker comprises a hexylamino group.
63. The compound of any of claims 1-62, wherein the conjugate
linker comprises a polyethylene glycol group.
64. The compound of any of claims 1-63, wherein the conjugate
linker comprises a triethylene glycol group.
65. The compound of any of claims 1-64, wherein the conjugate
linker comprises a phosphate group.
66. The compound of any of claims 1-65, wherein the conjugate
linker comprises: ##STR00103## wherein X directly or indirectly
attaches to the GLP-1 receptor ligand conjugate moiety; and Y
directly or indirectly attaches to the modified
oligonucleotide.
67. The compound of claim 66, wherein X comprises O.
68. The compound of claim 66 or 67, wherein Y comprises a phosphate
group.
69. The compound of any of claims 66-68, wherein X attaches to the
GLP-1 receptor ligand conjugate moiety by the disulfide linkage of
any of claims 54-57.
70. The compound of any of claims 1-69, wherein the conjugate
linker comprises: ##STR00104## wherein X directly or indirectly
attaches to the GLP-1 receptor ligand conjugate moiety; and wherein
T.sub.1 comprises the modified oligonucleotide; and Bx is a
modified or unmodified nucleobase.
71. The compound of claim 70, wherein X comprises the disulfide
linkage of any of claims 54-57.
72. The compound of any of claims 1-71, wherein the conjugate
linker comprises: ##STR00105## wherein: the phosphate group is
connected to the modified oligonucleotide and Y is connected to the
conjugate group; Y is a phosphodiester or amino (--NH--) group; Z
is a pyrrolidinyl group having the formula: ##STR00106## j is 0 or
1; n is from about 1 to about 10; p is from 1 to about 10; m is 0
or from 1 to 4; and when Y is amino then m is 1.
73. The compound of claim 72, wherein Y is amino (--NH--).
74. The compound of claim 72, wherein Y is a phosphodiester
group.
75. The compound of any of claims 72 to 74, wherein n is 3 and p is
3.
76. The compound of any of claims 72 to 74, wherein n is 6 and p is
6.
77. The compound of any of claims 72 to 74, wherein n is from 2 to
10 and p is from 2 to 10.
78. The compound of any of claims 72 to 74, wherein n and p are
different.
79. The compound of any of claims 72 to 74, wherein n and p are the
same.
80. The compound of any of claims 72 and 74 to 79, wherein m is
0.
81. The compound of any of claims 72 to 79, wherein m is 1.
82. The compound of any of claims 72 to 81, wherein j is 0.
83. The compound of any of claims 72 to 81, wherein j is 1 and Z
has the formula: ##STR00107##
84. The compound of claim 83, wherein n is 2 and p is 3.
85. The compound of claim 83, wherein n is 5 and p is 6.
86. The compound of any of claims 1-85, wherein the conjugate
linker comprises: ##STR00108##
87. The compound of any of claims 1-85, wherein the conjugate
linker comprises: ##STR00109##
88. The compound of any of claims 1-85, wherein the compound
comprising the conjugate linker comprises: ##STR00110## wherein
N--N.dbd.N represents an azido group of the GLP-1 receptor ligand
conjugate moiety and X directly or indirectly attaches to the
remainder of the GLP-1 receptor ligand conjugate moiety; and Y
directly or indirectly attaches to the oligonucleotide.
89. The compound of any of claims 1-85, wherein the compound
comprising the conjugate linker comprises: ##STR00111## wherein
N--N.dbd.N represents an azido group of the GLP-1 receptor ligand
conjugate moiety and X directly or indirectly attaches to the
remainder of the GLP-1 receptor ligand conjugate moiety; and Y
directly or indirectly attaches to the oligonucleotide.
90. The compound of any of claims 1-85, wherein the compound
comprising the conjugate linker comprises: ##STR00112## wherein
N--N.dbd.N represents an azido group of the GLP-1 receptor ligand
conjugate moiety and X directly or indirectly attaches to the
remainder of the GLP-1 receptor ligand conjugate moiety; and Y
directly or indirectly attaches to the oligonucleotide.
91. A method of modulating the expression of a nucleic acid target
in a cell comprising contacting the cell with the compound of any
of claims 1 to 90, thereby modulating expression of the nucleic
acid target in the cell.
92. The method of claim 91, wherein the cell is a pancreatic
cell.
93. The method of claim 92, wherein the pancreatic cell is a
beta-islet cell.
94. The method of any of claims 91-93, wherein the cell expresses
GLP-1 receptor on the surface of the cell.
95. The method of any of claims 91-94, wherein contacting the cell
with the compound inhibits expression of the nucleic acid
target.
96. The method of any of claims 91-95, wherein the nucleic acid
target is pre-mRNA, mRNA, non-coding RNA, or miRNA.
97. The method of any of claims 91-96, wherein the cell is in an
animal.
98. A method of preparing a compound, the method comprising
reacting: ##STR00113## with a GLP-1 peptide; wherein X.sub.1 is an
oligonucleotide and the compound is a GLP-1 peptide conjugated
oligonucleotide.
99. A method of preparing a GLP-1 peptide conjugated
oligonucleotide, the method comprising: reacting an oligonucleotide
comprising a hexamethyl linker and a terminal amine at the 5' end
of the oligonucleotide with 3-(2-Pyridyldithio propionic acid
N-hydroxysuccinimide ester) having the formula: ##STR00114##
thereby yielding Compound 2 having the formula: ##STR00115##
wherein X.sub.1 is the oligonucleotide; and reacting Compound 2
with GLP-1 peptide, thereby yielding the GLP-1 peptide conjugated
oligonucleotide having the formula: ##STR00116## wherein X.sub.1 is
the oligonucleotide and X.sub.2 is the GLP-1 peptide.
100. A method of preparing a GLP-1 peptide conjugated
oligonucleotide, the method comprising: mixing a solution
comprising an oligonucleotide comprising a hexamethyl linker and a
terminal amine at the 5' end of the oligonucleotide with a solution
comprising 3-(2-Pyridyldithio propionic acid N-hydroxysuccinimide
ester) having the formula: ##STR00117## thereby yielding Compound 2
having the formula: ##STR00118## wherein X.sub.1 is the
oligonucleotide; and mixing a solution comprising Compound 2 with a
solution comprising GLP-1 peptide, thereby yielding the GLP-1
peptide conjugated oligonucleotide having the formula: ##STR00119##
wherein X.sub.1 is the oligonucleotide and X.sub.2 is the GLP-1
peptide.
101. The method of claim 100, wherein the solution comprising the
oligonucleotide comprises sodium phosphate buffer and the solution
comprising 3-(2-Pyridyldithio propionic acid N-hydroxysuccinimide
ester) comprises dimethylformamide.
102. The method of claim 100 or 101, wherein the solutions are
mixed at room temperature.
103. The method of any of claims 100-102, wherein the solution
comprising Compound 2 further comprises acetonitrile and
NaHCO.sub.3 and has a pH of about 8.0.
104. The method of any of claims 100-103, wherein the solution
comprising GLP-1 peptide further comprises dimethylformamide.
105. The method of any of claims 98-104, wherein the GLP-1 peptide
comprises an at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or 31 contiguous amino
acid portion at least 60%, at least 65%, at least 70%, at least
75%, at least 80%, at least 85%, at least 90%, at least 95%, or
100% homologous to an equal length portion of the amino acid
sequence of any of SEQ ID NOs: 1-57.
106. The method of claim 105, wherein the GLP-1 peptide comprises
an at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21,
22, 23, 24, 25, 26, 27, 28, 29, 30, or 31 contiguous amino acid
portion at least 60%, at least 65%, at least 70%, at least 75%, at
least 80%, at least 85%, at least 90%, at least 95%, or 100%
identical to an equal length portion of the amino acid sequence of
any of SEQ ID NOs: 1-57.
107. The method of any of claims 98-104, wherein the GLP-1 peptide
is 8 to 50 amino acids in length and is at least 60%, at least 65%,
at least 70%, at least 75%, at least 80%, at least 85%, at least
90%, at least 95%, or 100% homologous over its entire length to the
amino acid sequence of any of SEQ ID NOs: 1-57.
108. The method of claim 107, wherein the GLP-1 peptide is at least
60%, at least 65%, at least 70%, at least 75%, at least 80%, at
least 85%, at least 90%, at least 95%, or 100% identical over its
entire length to the amino acid sequence of any of SEQ ID NOs:
1-57.
109. The method of any of claims 105-108, wherein the GLP-1 peptide
comprises the amino acid sequence of GLP-1(7-37) (SEQ ID NO:
1).
110. The method of claim 109, wherein the GLP-1 peptide consists of
the amino acid sequence of GLP-1(7-37) (SEQ ID NO: 1).
111. The method of any of claims 105-108, wherein the GLP-1 peptide
comprises the amino acid sequence:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Cys (SEQ ID NO: 22), wherein Aib is aminoisobutyric
acid.
112. The method of claim 111, wherein the GLP-1 peptide consists of
the amino acid sequence:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Cys (SEQ ID NO: 22), wherein Aib is aminoisobutyric
acid.
113. The method of any of claims 105-108, wherein the GLP-1 peptide
comprises the amino acid sequence:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Pen (SEQ ID NO: 23), wherein Aib is aminoisobutyric acid
and Pen is penicillamine.
114. The method of claim 113, wherein the GLP-1 peptide consists of
the amino acid sequence:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Pen (SEQ ID NO: 23), wherein Aib is aminoisobutyric acid
and Pen is penicillamine.
115. The method of any of claims 105-108, wherein the GLP-1 peptide
comprises the amino acid sequence:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly (SEQ ID NO:
1).
116. The method of claim 115, wherein the GLP-1 peptide consists of
the amino acid sequence:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly (SEQ ID NO:
1).
117. The method of any of claims 105-116, wherein the GLP-1 peptide
moiety comprises a reactive sulfur moiety.
118. The method of any of claims 105-117, wherein the GLP-1 peptide
comprises penicillamine.
119. The method of claim 118, wherein the penicillamine is linked
to the C-terminus of the GLP-1 peptide.
120. A pharmaceutical composition comprising at least one compound
of any one of claims 1 to 90 and a pharmaceutically acceptable
excipient.
121. The compound of any of claims 30-36, wherein the GLP-1 peptide
conjugate moiety comprises the amino acid sequence:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Zaa (SEQ ID NO: 56).
Description
SEQUENCE LISTING
[0001] The present application is being filed along with a Sequence
Listing in electronic format. The Sequence Listing is provided as a
file entitled BIOL0303WOSEQ_ST25.txt created Apr. 27, 2017, which
is 29 kb in size. The information in the electronic format of the
sequence listing is incorporated herein by reference in its
entirety.
FIELD
[0002] The present embodiments provide compounds and methods for
targeting cells expressing GLP-1 receptor.
BACKGROUND
[0003] The GLP-1 receptor is a class 2, G protein-coupled receptor
that couples to adenylate cyclase via a stimulatory G protein
receptor. Intestinal nutrient stimulation leads to release of
glucagon like peptide-1 into the circulation. Circulating GLP-1
binds to the GLP-1 receptor on the beta islet cells of the
pancreas. This activates the GLP-1 receptor which induces signaling
events that result in insulin exocytosis from beta islet cells.
Binding between GLP-1 and GLP-1 receptor leads to internalization
of the receptor into the cytoplasm and eventual sorting into
lysosomes (Kuna et al., 2013 Am J Physiol Endo Metab
305:E161-E170).
SUMMARY
[0004] Embodiments provided herein are directed to compounds and
methods for modulating the expression of a nucleic acid target in
cells expressing GLP-1 receptor. In certain embodiments, a compound
comprises an oligonucleotide and GLP-1 receptor ligand conjugate
moiety. In certain embodiments, a compound comprises an
oligonucleotide, conjugate linker, and GLP-1 receptor ligand
conjugate moiety. In certain embodiments, contacting a cell
expressing GLP-1 receptor, such as a pancreatic beta islet cell,
with a compound provided herein modulates expression of a nucleic
acid target in the cell. In certain embodiments, a compound
comprising a GLP-1 receptor ligand conjugate moiety selectively or
preferentially targets a cell expressing GLP-1 receptor compared to
a cell not expressing GLP-1 receptor. In certain embodiments, a
compound comprising a GLP-1 receptor ligand conjugate moiety
selectively or preferentially targets a cell expressing GLP-1
receptor compared to a compound not comprising a GLP-1 receptor
ligand conjugate moiety.
BRIEF DESCRIPTION OF THE DRAWINGS
[0005] FIG. 1 is a graph showing the percent FOXO1 mRNA (FIG. 1A)
and MALAT1 mRNA (FIG. 1B) relative to antisense oligonucleotide
(ASO) concentration in HEK293 cells treated with unconjugated
parent ASO (ISIS 776102 or ISIS 556089) or GLP1-conjugated ASO
(ISIS 913193 or ISIS 816385).
[0006] FIG. 2 is a graph showing MALAT1 mRNA levels relative to
antisense oligonucleotide (ASO) concentration in GLP1 receptor
overexpressing HEK293 cells (FIG. 2A), wild type HEK293 cells (FIG.
2B), or GRP40 overexpressing HEK293 cells (FIG. 2C) treated with
unconjugated parent MALAT1 ASO (ISIS 556089) or GLP1-conjugated
MALAT1 ASO (ISIS 816385).
[0007] FIG. 3 is a graph showing MALAT1 mRNA levels in dispersed
mouse islets treated with no ASO, unconjugated parent MALAT1 ASO
(ISIS 556089), or GLP1-conjugated MALAT1 ASO (ISIS 816385) (FIG.
3A); MALAT1 mRNA levels in intact mouse islets treated with no ASO,
unconjugated parent MALAT1 ASO (ISIS 556089), or GLP1-conjugated
MALAT1 ASO (ISIS 816385) (FIG. 3B); and FOXO1 mRNA levels in intact
mouse islets treated with no ASO, unconjugated parent FOXO1 ASO
(ISIS 776102), GLP1-conjugated scrambled FOXO1 ASO (ION 913195), or
GLP1-conjugated FOXO1 ASO (ION 913193) (FIG. 3C).
DETAILED DESCRIPTION
[0008] It is to be understood that both the foregoing general
description and the following detailed description are exemplary
and explanatory only and are not restrictive of the embodiments, as
claimed. Herein, the use of the singular includes the plural unless
specifically stated otherwise. As used herein, the use of "or"
means "and/or" unless stated otherwise. Furthermore, the use of the
term "including" as well as other forms, such as "includes" and
"included", is not limiting.
[0009] The section headings used herein are for organizational
purposes only and are not to be construed as limiting the subject
matter described. All documents, or portions of documents, cited in
this application, including, but not limited to, patents, patent
applications, articles, books, treatises, and GenBank and NCBI
reference sequence records are hereby expressly incorporated by
reference for the portions of the document discussed herein, as
well as in their entirety.
[0010] It is understood that the sequence set forth in each SEQ ID
NO of an oligonucleotide in the examples contained herein is
independent of any modification to a sugar moiety, an
internucleoside linkage, or a nucleobase. As such, oligonucleotides
defined by a SEQ ID NO may comprise, independently, one or more
modifications to a sugar moiety, an internucleoside linkage, or a
nucleobase. Oligonucleotides described by ISIS or ION number (ISIS
# or ION #) indicate a combination of nucleobase sequence, chemical
modification, and motif.
[0011] It is understood that throughout the specification, the
first letter in a peptide sequence is the first amino acid of the
peptide at the N-terminus and the last letter in a peptide sequence
is the last amino acid of the peptide at the C-terminus unless
indicated otherwise.
[0012] Unless otherwise indicated, the following terms have the
following meanings:
[0013] "2'-deoxynucleoside" means a nucleoside comprising 2'-H(H)
furanosyl sugar moiety, as found in naturally occurring
deoxyribonucleic acids (DNA). In certain embodiments, a
2'-deoxynucleoside may comprise a modified nucleobase or may
comprise an RNA nucleobase (uracil).
[0014] "2'-O-methoxyethyl" (also 2'-MOE and
2'-O(CH.sub.2).sub.2--OCH.sub.3) refers to an O-methoxy-ethyl
modification at the 2' position of a furanosyl ring. A
2'-O-methoxyethyl modified sugar is a modified sugar.
[0015] "2'-MOE nucleoside" (also 2'-O-methoxyethyl nucleoside)
means a nucleoside comprising a 2'-MOE modified sugar moiety.
[0016] "2'-substituted nucleoside" or "2-modified nucleoside" means
a nucleoside comprising a 2'-substituted or 2'-modified sugar
moiety. As used herein, "2'-substituted" or "2-modified" in
reference to a sugar moiety means a sugar moiety comprising at
least one 2'-substituent group other than H or OH.
[0017] "5-methylcytosine" means a cytosine with a methyl group
attached to the 5 position.
[0018] "About" means within .+-.10% of a value. For example, if it
is stated, "the compounds affected about 70% inhibition of a target
nucleic acid", it is implied that target nucleic acid levels are
inhibited within a range of 60% and 80%.
[0019] "Administration" or "administering" refers to routes of
introducing a compound or composition provided herein to an
individual to perform its intended function. An example of a route
of administration that can be used includes, but is not limited to
parenteral administration, such as subcutaneous, intravenous, or
intramuscular injection or infusion.
[0020] "Aminoisobutyric acid" or "Aib" means 2-aminoisobutryic acid
having the formula:
##STR00001##
unless stated otherwise.
[0021] "Animal" refers to a human or non-human animal, including,
but not limited to, mice, rats, rabbits, dogs, cats, pigs, and
non-human primates, including, but not limited to, monkeys and
chimpanzees.
[0022] "Antisense activity" means any detectable and/or measurable
activity attributable to the hybridization of an antisense compound
to its target nucleic acid. In certain embodiments, antisense
activity is a decrease in the amount or expression of a target
nucleic acid or protein encoded by such target nucleic acid
compared to target nucleic acid levels or target protein levels in
the absence of the antisense compound to the target.
[0023] "Antisense compound" means a compound comprising an
oligonucleotide and optionally one or more additional features,
such as a conjugate group or terminal group. Examples of antisense
compounds include single-stranded and double-stranded compounds,
such as, oligonucleotides, ribozymes, siRNAs, shRNAs, ssRNAs, and
occupancy-based compounds.
[0024] "Antisense inhibition" means reduction of target nucleic
acid levels in the presence of an antisense compound complementary
to a target nucleic acid compared to target nucleic acid levels in
the absence of the antisense compound.
[0025] "Antisense mechanisms" are all those mechanisms involving
hybridization of a compound with target nucleic acid, wherein the
outcome or effect of the hybridization is either target degradation
or target occupancy with concomitant stalling of the cellular
machinery involving, for example, transcription or splicing.
[0026] "Antisense oligonucleotide" means an oligonucleotide having
a nucleobase sequence that is complementary to a target nucleic
acid or region or segment thereof. In certain embodiments, an
antisense oligonucleotide is specifically hybridizable to a target
nucleic acid or region or segment thereof.
[0027] "Bicyclic nucleoside" or "BNA" means a nucleoside comprising
a bicyclic sugar moiety. "Bicyclic sugar" or "bicyclic sugar
moiety" means a modified sugar moiety comprising two rings, wherein
the second ring is formed via a bridge connecting two of the atoms
in the first ring thereby forming a bicyclic structure. In certain
embodiments, the first ring of the bicyclic sugar moiety is a
furanosyl moiety. In certain embodiments, the bicyclic sugar moiety
does not comprise a furanosyl moiety.
[0028] "Branching group" means a group of atoms having at least 3
positions that are capable of forming covalent linkages to at least
3 groups. In certain embodiments, a branching group provides a
plurality of reactive sites for connecting tethered ligands to an
oligonucleotide via a conjugate linker and/or a cleavable
moiety.
[0029] "Cell-targeting moiety" means a conjugate group or portion
of a conjugate group that is capable of binding to a particular
cell type or particular cell types.
[0030] "cEt" or "constrained ethyl" means a bicyclic furanosyl
sugar moiety comprising a bridge connecting the 4'-carbon and the
2'-carbon, wherein the bridge has the formula:
4'-CH(CH.sub.3)--O-2'.
[0031] "Chemical modification" in a compound describes the
substitutions or changes through chemical reaction, of any of the
units in the compound. "Modified nucleoside" means a nucleoside
having, independently, a modified sugar moiety and/or modified
nucleobase. "Modified oligonucleotide" means an oligonucleotide
comprising at least one modified internucleoside linkage, a
modified sugar, and/or a modified nucleobase.
[0032] "Chemically distinct region" refers to a region of a
compound that is in some way chemically different than another
region of the same compound. For example, a region having
2'-O-methoxyethyl nucleotides is chemically distinct from a region
having nucleotides without 2'-O-methoxyethyl modifications.
[0033] "Chimeric antisense compounds" means antisense compounds
that have at least 2 chemically distinct regions, each position
having a plurality of subunits.
[0034] "Cleavable bond" means any chemical bond capable of being
split. In certain embodiments, a cleavable bond is selected from
among: an amide, a polyamide, an ester, an ether, one or both
esters of a phosphodiester, a phosphate ester, a carbamate, a
di-sulfide, or a peptide.
[0035] "Cleavable moiety" means a bond or group of atoms that is
cleaved under physiological conditions, for example, inside a cell,
an animal, or a human.
[0036] "Complementary" in reference to an oligonucleotide means the
nucleobase sequence of such oligonucleotide or one or more regions
thereof matches the nucleobase sequence of another oligonucleotide
or nucleic acid or one or more regions thereof when the two
nucleobase sequences are aligned in opposing directions. Nucleobase
matches or complementary nucleobases, as described herein, are
limited to the following pairs: adenine (A) and thymine (T),
adenine (A) and uracil (U), cytosine (C) and guanine (G), and
5-methyl cytosine (mC) and guanine (G) unless otherwise specified.
Complementary oligonucleotides and/or nucleic acids need not have
nucleobase complementarity at each nucleoside and may include one
or more nucleobase mismatches. By contrast, "fully complementary"
or "100% complementary" in reference to oligonucleotides means that
such oligonucleotides have nucleobase matches at each nucleoside
without any nucleobase mismatches.
[0037] "Conjugate group" means a group of atoms that is attached to
an oligonucleotide. Conjugate groups include a conjugate moiety and
a conjugate linker that attaches the conjugate moiety to the
oligonucleotide.
[0038] "Conjugate linker" means a group of atoms comprising at
least one bond that connects a conjugate moiety to an
oligonucleotide.
[0039] "Conjugate moiety" means a group of atoms that is attached
to an oligonucleotide via a conjugate linker.
[0040] "Designing" or "Designed to" refer to the process of
designing a compound that specifically hybridizes with a selected
nucleic acid molecule.
[0041] "Differently modified" means chemical modifications or
chemical substituents that are different from one another,
including absence of modifications. Thus, for example, a MOE
nucleoside and an unmodified DNA nucleoside are "differently
modified," even though the DNA nucleoside is unmodified. Likewise,
DNA and RNA are "differently modified," even though both are
naturally-occurring unmodified nucleosides. Nucleosides that are
the same but for comprising different nucleobases are not
differently modified. For example, a nucleoside comprising a 2'-OMe
modified sugar and an unmodified adenine nucleobase and a
nucleoside comprising a 2'-OMe modified sugar and an unmodified
thymine nucleobase are not differently modified.
[0042] "Double-stranded antisense compound" means an antisense
compound comprising two oligomeric compounds that are complementary
to each other and form a duplex, and wherein one of the two said
oligomeric compounds comprises an oligonucleotide.
[0043] "Expression" includes all the functions by which a gene's
coded information is converted into structures present and
operating in a cell. Such structures include, but are not limited
to, the products of transcription and translation.
[0044] "Gapmer" means an oligonucleotide comprising an internal
region having a plurality of nucleosides that support RNase H
cleavage positioned between external regions having one or more
nucleosides, wherein the nucleosides comprising the internal region
are chemically distinct from the nucleoside or nucleosides
comprising the external regions. The internal region may be
referred to as the "gap" and the external regions may be referred
to as the "wings."
[0045] "Hybridization" means the annealing of oligonucleotides
and/or nucleic acids. While not limited to a particular mechanism,
the most common mechanism of hybridization involves hydrogen
bonding, which may be Watson-Crick, Hoogsteen or reversed Hoogsteen
hydrogen bonding, between complementary nucleobases. In certain
embodiments, complementary nucleic acid molecules include, but are
not limited to, an antisense compound and a nucleic acid target. In
certain embodiments, complementary nucleic acid molecules include,
but are not limited to, an oligonucleotide and a nucleic acid
target.
[0046] "Inhibiting the expression or activity" refers to a
reduction or blockade of the expression or activity relative to the
expression of activity in an untreated or control sample and does
not necessarily indicate a total elimination of expression or
activity.
[0047] "Internucleoside linkage" means a group or bond that forms a
covalent linkage between adjacent nucleosides in an
oligonucleotide. "Modified internucleoside linkage" means any
internucleoside linkage other than a naturally occurring, phosphate
internucleoside linkage. Non-phosphate linkages are referred to
herein as modified internucleoside linkages.
[0048] "Linked nucleosides" means adjacent nucleosides linked
together by an internucleoside linkage.
[0049] "Linker-nucleoside" means a nucleoside that links an
oligonucleotide to a conjugate moiety. Linker-nucleosides are
located within the conjugate linker of a compound.
Linker-nucleosides are not considered part of the oligonucleotide
portion of a compound even if they are contiguous with the
oligonucleotide.
[0050] "Mismatch" or "non-complementary" means a nucleobase of a
first oligonucleotide that is not complementary to the
corresponding nucleobase of a second oligonucleotide or target
nucleic acid when the first and second oligonucleotides are
aligned. For example, nucleobases including but not limited to a
universal nucleobase, inosine, and hypoxanthine, are capable of
hybridizing with at least one nucleobase but are still mismatched
or non-complementary with respect to nucleobase to which it
hybridized. As another example, a nucleobase of a first
oligonucleotide that is not capable of hybridizing to the
corresponding nucleobase of a second oligonucleotide or target
nucleic acid when the first and second oligonucleotides are aligned
is a mismatch or non-complementary nucleobase.
[0051] "Modulating" refers to changing or adjusting a feature in a
cell, tissue, organ or organism. For example, modulating target
nucleic acid can mean to increase or decrease the level of target
nucleic acid in a cell, tissue, organ or organism. A "modulator"
effects the change in the cell, tissue, organ or organism. For
example, a compound can be a modulator that decreases the amount of
target nucleic acid in a cell, tissue, organ or organism.
[0052] "MOE" means methoxyethyl.
[0053] "Monomer" refers to a single unit of an oligomer. Monomers
include, but are not limited to, nucleosides and nucleotides.
[0054] "Motif" means the pattern of unmodified and/or modified
sugar moieties, nucleobases, and/or internucleoside linkages, in an
oligonucleotide.
[0055] "Natural" or "naturally occurring" means found in
nature.
[0056] "Non-bicyclic modified sugar" or "non-bicyclic modified
sugar moiety" means a modified sugar moiety that comprises a
modification, such as a substituent, that does not form a bridge
between two atoms of the sugar to form a second ring. "Nucleic
acid" refers to molecules composed of monomeric nucleotides. A
nucleic acid includes, but is not limited to, ribonucleic acids
(RNA), deoxyribonucleic acids (DNA), single-stranded nucleic acids,
and double-stranded nucleic acids.
[0057] "Nucleobase" means a heterocyclic moiety capable of pairing
with a base of another nucleic acid. As used herein a "naturally
occurring nucleobase" is adenine (A), thymine (T), cytosine (C),
uracil (U), and guanine (G). A "modified nucleobase" is a naturally
occurring nucleobase that is chemically modified. A "universal
base" or "universal nucleobase" is a nucleobase other than a
naturally occurring nucleobase and modified nucleobase, and is
capable of pairing with any nucleobase.
[0058] "Nucleobase sequence" means the order of contiguous
nucleobases in a nucleic acid or oligonucleotide independent of any
sugar or internucleoside linkage.
[0059] "Nucleoside" means a compound comprising a nucleobase and a
sugar moiety. The nucleobase and sugar moiety are each,
independently, unmodified or modified. "Modified nucleoside" means
a nucleoside comprising a modified nucleobase and/or a modified
sugar moiety. Modified nucleosides include abasic nucleosides,
which lack a nucleobase.
[0060] "Oligomeric compound" means a compound comprising a single
oligonucleotide and optionally one or more additional features,
such as a conjugate group or terminal group.
[0061] "Oligonucleotide" means a polymer of linked nucleosides each
of which can be modified or unmodified, independent one from
another. Unless otherwise indicated, oligonucleotides consist of
8-80 linked nucleosides. "Modified oligonucleotide" means an
oligonucleotide, wherein at least one sugar, nucleobase, or
internucleoside linkage is modified. "Unmodified oligonucleotide"
means an oligonucleotide that does not comprise any sugar,
nucleobase, or internucleoside modification.
[0062] "Parent oligonucleotide" means an oligonucleotide whose
sequence is used as the basis of design for more oligonucleotides
of similar sequence but with different lengths, motifs, and/or
chemistries. The newly designed oligonucleotides may have the same
or overlapping sequence as the parent oligonucleotide.
[0063] "Phosphorothioate linkage" means a modified phosphate
linkage in which one of the non-bridging oxygen atoms is replaced
with a sulfur atom. A phosphorothioate internucleoside linkage is a
modified internucleoside linkage.
[0064] "Phosphorus moiety" means a group of atoms comprising a
phosphorus atom. In certain embodiments, a phosphorus moiety
comprises a mono-, di-, or tri-phosphate, or phosphorothioate.
[0065] "Portion" means a defined number of contiguous (i.e.,
linked) nucleobases of a nucleic acid. In certain embodiments, a
portion is a defined number of contiguous nucleobases of a target
nucleic acid. In certain embodiments, a portion is a defined number
of contiguous nucleobases of an oligomeric compound.
[0066] "Reduce" means to bring down to a smaller extent, size,
amount, or number.
[0067] "RNAi compound" means an antisense compound that acts, at
least in part, through RISC or Ago2, but not through RNase H, to
modulate a target nucleic acid and/or protein encoded by a target
nucleic acid. RNAi compounds include, but are not limited to
double-stranded siRNA, single-stranded RNA (ssRNA), and microRNA,
including microRNA mimics.
[0068] "Segments" are defined as smaller or sub-portions of regions
within a nucleic acid.
[0069] "Selective" with respect to an effect refers to a greater
effect on one thing over another by any quantitative extent or
fold-difference. For example, a compound comprising a GLP-1
receptor conjugate ligand moiety that is "selective" for cells
expressing GLP-1 receptor or "selectively" targets cells expressing
GLP-1 receptor, targets cells expressing GLP-1 receptor to a
greater extent than a compound not comprising a GLP-1 receptor
conjugate ligand moiety. As another example, a compound comprising
a GLP-1 receptor conjugate ligand moiety that is "selective" for
cells expressing GLP-1 receptor or "selectively" targets cells
expressing GLP-1 receptor, targets cells expressing GLP-1 receptor
to a greater extent than cells that do not express or express
relatively lower levels of GLP-1 receptor. It will be understood
that the term "selective" does not require absolute all-or-none
selectivity.
[0070] "Single-stranded" in reference to a compound means the
compound has only one oligonucleotide. "Self-complementary" means
an oligonucleotide that at least partially hybridizes to itself. A
compound consisting of one oligonucleotide, wherein the
oligonucleotide of the compound is self-complementary, is a
single-stranded compound. A single-stranded compound may be capable
of binding to a complementary compound to form a duplex.
[0071] "Sites" are defined as unique nucleobase positions within a
target nucleic acid.
[0072] "Specifically hybridizable" refers to an oligonucleotide
having a sufficient degree of complementarity between the
oligonucleotide and a target nucleic acid to induce a desired
effect, while exhibiting minimal or no effects on non-target
nucleic acids. In certain embodiments, specific hybridization
occurs under physiological conditions.
[0073] "Specifically inhibit" with reference to a target nucleic
acid means to reduce or block expression of the target nucleic acid
while exhibiting fewer, minimal, or no effects on non-target
nucleic acids. Reduction does not necessarily indicate a total
elimination of the target nucleic acid's expression.
[0074] "Standard cell assay" means assay(s) described in the
Examples and reasonable variations thereof
[0075] "Standard in vivo experiment" means the procedure(s)
described in the Example(s) and reasonable variations thereof.
[0076] "Sugar moiety" means an unmodified sugar moiety or a
modified sugar moiety. "Unmodified sugar moiety" or "unmodified
sugar" means a 2'-OH(H) furanosyl moiety, as found in RNA (an
"unmodified RNA sugar moiety"), or a 2'-H(H) moiety, as found in
DNA (an "unmodified DNA sugar moiety"). Unmodified sugar moieties
have one hydrogen at each of the 1', 3', and 4' positions, an
oxygen at the 3' position, and two hydrogens at the 5' position.
"Modified sugar moiety" or "modified sugar" means a modified
furanosyl sugar moiety or a sugar surrogate. "Modified furanosyl
sugar moiety" means a furanosyl sugar comprising a non-hydrogen
substituent in place of at least one hydrogen of an unmodified
sugar moiety. In certain embodiments, a modified furanosyl sugar
moiety is a 2'-substituted sugar moiety. Such modified furanosyl
sugar moieties include bicyclic sugars and non-bicyclic sugars.
[0077] "Sugar surrogate" means a modified sugar moiety having other
than a furanosyl moiety that can link a nucleobase to another
group, such as an internucleoside linkage, conjugate group, or
terminal group in an oligonucleotide. Modified nucleosides
comprising sugar surrogates can be incorporated into one or more
positions within an oligonucleotide and such oligonucleotides are
capable of hybridizing to complementary compounds or nucleic
acids.
[0078] "Target gene" refers to a gene encoding a target.
[0079] "Targeting" with respect to a target nucleic acid means the
specific hybridization of an oligonucleotide to said target nucleic
acid in order to induce a desired effect. "Targeting" with respect
to a GLP-1 receptor means binding of a GLP-1 receptor ligand
conjugate moiety to GLP-1 receptor.
[0080] "Target nucleic acid," "target RNA," "target RNA transcript"
and "nucleic acid target" all mean a nucleic acid capable of being
targeted by compounds described herein.
[0081] "Target region" means a portion of a target nucleic acid to
which one or more compounds is targeted.
[0082] "Target segment" means the sequence of nucleotides of a
target nucleic acid to which a compound is targeted. "5' target
site" refers to the 5'-most nucleotide of a target segment. "3'
target site" refers to the 3'-most nucleotide of a target
segment.
[0083] "Terminal group" means a chemical group or group of atoms
that is covalently linked to a terminus of an oligonucleotide.
Certain Embodiments
[0084] In certain embodiments, a compound comprises an
oligonucleotide and GLP-1 receptor ligand conjugate moiety. In
certain embodiments, the oligonucleotide is a modified
oligonucleotide. In certain embodiments, the compound further
comprises a conjugate linker. In certain embodiments, the conjugate
linker links the oligonucleotide to the GLP-1 receptor ligand
conjugate moiety.
[0085] In certain embodiments, the oligonucleotide is 8 to 80
linked nucleosides in length, 10 to 30 linked nucleosides in
length, 12 to 30 linked nucleosides in length, or 15 to 30 linked
nucleosides in length.
[0086] In certain embodiments, the oligonucleotide is a modified
oligonucleotide comprising at least one modified internucleoside
linkage, at least one modified sugar, or at least one modified
nucleobase. In certain embodiments, the modified internucleoside
linkage is a phosphorothioate internucleoside linkage. In certain
embodiments, each modified internucleoside linkage of the modified
oligonucleotide is a phosphorothioate internucleoside linkage.
[0087] In certain embodiments, the modified sugar is a bicyclic
sugar, such as 4'-(CH2)-O-2' (LNA); 4'-(CH2)2-O-2' (ENA); or
4'-CH(CH3)-O-2' (cEt). In certain embodiments, the modified sugar
is 2'-O-methoxyethyl, 2'-F, or 2'-OMe.
[0088] In certain embodiments, the modified nucleobase is a
5-methylcytosine.
[0089] In certain embodiments, the modified oligonucleotide
comprises: [0090] a gap segment consisting of linked
deoxynucleosides; [0091] a 5' wing segment consisting of linked
nucleosides; and [0092] a 3' wing segment consisting of linked
nucleosides; wherein the gap segment is positioned immediately
adjacent to and between the 5' wing segment and the 3' wing segment
and wherein each nucleoside of each wing segment comprises a
modified sugar.
[0093] In certain embodiments, the oligonucleotide is
single-stranded.
[0094] In certain embodiments, the oligonucleotide is an antisense
oligonucleotide, miRNA antagonist or miRNA mimic.
[0095] In certain embodiments, the compound comprises a
double-stranded duplex. In certain embodiments, the double-stranded
duplex comprises a first strand comprising the modified
oligonucleotide and a second strand complementary to the first
strand. In certain embodiments, the first strand comprising the
modified oligonucleotide is complementary to a RNA transcript. In
certain embodiments, the second strand is complementary to a RNA
transcript. In certain embodiments, a compound comprises a
double-stranded duplex comprising (i) a first strand comprising the
modified oligonucleotide, optionally a conjugate linker, and the
GLP-1 receptor ligand conjugate moiety and (ii) a second strand
complementary to the first strand. In certain embodiments, a
compound comprises a double-stranded duplex comprising (i) a first
strand comprising the modified oligonucleotide, optionally a
conjugate linker, and the GLP-1 receptor ligand conjugate moiety
and (ii) a second strand complementary to the first strand; wherein
the first strand is complementary to a RNA transcript. In certain
embodiments, a compound comprises a double-stranded duplex
comprising (i) a first strand comprising the modified
oligonucleotide, optionally a conjugate linker, and the GLP-1
receptor ligand conjugate moiety and (ii) a second strand
complementary to the first strand; wherein the second strand is
complementary to a RNA transcript.
[0096] In certain embodiments, the compound is a miRNA mimic.
[0097] In certain embodiments, the compound comprises
ribonucleotides. In certain embodiments, the compound comprises
deoxyribonucleotides.
[0098] In certain embodiments, the oligonucleotide is complementary
to a RNA transcript in a cell, such as a pancreatic cell or a
pancreatic beta-islet cell.
[0099] In certain embodiments, the RNA transcript is pre-mRNA,
mRNA, non-coding RNA, or miRNA.
[0100] In certain embodiments, the GLP-1 receptor ligand conjugate
moiety is a peptide conjugate moiety, small molecule conjugate
moiety, aptamer conjugate moiety, or antibody conjugate moiety
targeted to GLP-1 receptor.
[0101] In certain embodiments, the peptide conjugate moiety is a
GLP-1 peptide conjugate moiety.
[0102] In certain embodiments, the GLP-1 peptide conjugate moiety
comprises an at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or 31 contiguous amino
acid portion at least 60%, at least 65%, at least 70%, at least
75%, at least 80%, at least 85%, at least 90%, at least 95%, at
least 96%, at least 97%, at least 98%, at least 99%, or 100%
homologous to an equal length portion of the amino acid sequence of
any of SEQ ID NOs: 1-57.
[0103] In certain embodiments, the GLP-1 peptide conjugate moiety
comprises an at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or 31 contiguous amino
acid portion at least 60%, at least 65%, at least 70%, at least
75%, at least 80%, at least 85%, at least 90%, at least 95%, at
least 96%, at least 97%, at least 98%, at least 99%, or 100%
identical to an equal length portion of the amino acid sequence of
any of SEQ ID NOs: 1-57.
[0104] In certain embodiments, the GLP-1 peptide conjugate moiety
is 8 to 50 amino acids in length and is at least 60%, at least 65%,
at least 70%, at least 75%, at least 80%, at least 85%, at least
90%, at least 95%, at least 96%, at least 97%, at least 98%, at
least 99%, or 100% homologous over its entire length to the amino
acid sequence of any of SEQ ID NOs: 1-57.
[0105] In certain embodiments, the GLP-1 peptide conjugate moiety
is at least 60%, at least 65%, at least 70%, at least 75%, at least
80%, at least 85%, at least 90%, at least 95%, at least 96%, at
least 97%, at least 98%, at least 99%, or 100% identical over its
entire length to the amino acid sequence of any of SEQ ID NOs:
1-57.
[0106] In certain embodiments, the GLP-1 peptide conjugate moiety
comprises an at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or 31 contiguous amino
acid portion at least 60%, at least 65%, at least 70%, at least
75%, at least 80%, at least 85%, at least 90%, at least 95%, at
least 96%, at least 97%, at least 98%, at least 99%, or 100%
homologous to an equal length portion of the amino acid sequence of
GLP-1(7-37): HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, which in conventional
three-letter code is:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-A-
la-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly (SEQ ID NO:
1).
[0107] In certain embodiments, the GLP-1 peptide conjugate moiety
comprises an at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or 31 contiguous amino
acid portion at least 60%, at least 65%, at least 70%, at least
75%, at least 80%, at least 85%, at least 90%, at least 95%, at
least 96%, at least 97%, at least 98%, at least 99%, or 100%
identical to an equal length portion of the amino acid sequence of
GLP-1(7-37).
[0108] In certain embodiments, the GLP-1 peptide conjugate moiety
is 8 to 50 amino acids in length and is at least 60%, at least 65%,
at least 70%, at least 75%, at least 80%, at least 85%, at least
90%, at least 95%, at least 96%, at least 97%, at least 98%, at
least 99%, or 100% homologous over its entire length to the amino
acid sequence of GLP-1(7-37) (SEQ ID NO: 1).
[0109] In certain embodiments, the GLP-1 peptide conjugate moiety
comprises a conservative amino acid substitution, an amino acid
analog, or an amino acid derivative.
[0110] In certain embodiments, the GLP-1 peptide conjugate moiety
is at least 60%, at least 65%, at least 70%, at least 75%, at least
80%, at least 85%, at least 90%, at least 95%, at least 96%, at
least 97%, at least 98%, at least 99%, or 100% identical over its
entire length to the amino acid sequence of GLP-1(7-37) (SEQ ID NO:
1).
[0111] In certain embodiments, the GLP-1 peptide conjugate moiety
comprises the amino acid sequence of GLP-1(7-37) (SEQ ID NO:
1).
[0112] In certain embodiments, the GLP-1 peptide conjugate moiety
consists of the amino acid sequence of GLP-1(7-37) (SEQ ID NO:
1).
[0113] In certain embodiments, the GLP-1 peptide conjugate moiety
comprises the amino acid sequence of GLP-1(7-36)amide:
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH.sub.2, which in conventional
three-letter code is:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH.sub.2 (SEQ ID NO:
2).
[0114] In certain embodiments, the GLP-1 peptide conjugate moiety
consists of the amino acid sequence of GLP-1(7-36)amide: which in
conventional three-letter code is:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH.sub.2 (SEQ ID NO:
2).
[0115] In certain embodiments, the GLP-1 peptide conjugate moiety
comprises or consists of the amino acid sequence of GLP-1(7-36):
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR, which in conventional three-letter
code is:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-A-
la-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg (SEQ ID NO:
2).
[0116] In certain embodiments, the GLP-1 peptide conjugate moiety
comprises the amino acid sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKG,
which in conventional three-letter code is:
Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-G-
lu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly (SEQ ID NO: 3).
[0117] In certain embodiments, the GLP-1 peptide conjugate moiety
consists of the amino acid sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKG,
which in conventional three-letter code is:
Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-G-
lu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly (SEQ ID NO: 3).
[0118] In certain embodiments, the GLP-1 peptide conjugate moiety
comprises the amino acid sequence: EGTFTSDVSSYLEEQAAKEFIAWLVKG,
which in conventional three-letter code is:
Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-G-
lu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly (SEQ ID NO: 4)
[0119] In certain embodiments, the GLP-1 peptide conjugate moiety
consists of the amino acid sequence: EGTFTSDVSSYLEEQAAKEFIAWLVKG,
which in conventional three-letter code is:
Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-G-
lu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly (SEQ ID NO: 4).
[0120] In certain embodiments, the GLP-1 peptide conjugate moiety
comprises the amino acid sequence of any of SEQ ID NOs: 1-57.
[0121] In certain embodiments, the GLP-1 peptide conjugate moiety
consists of the amino acid sequence of any of SEQ ID NOs: 1-57.
[0122] In certain embodiments, the GLP-1 peptide conjugate moiety
can be a C-terminal amide or acid of any of SEQ ID NOs: 1-57.
[0123] In certain embodiments, the GLP-1 peptide conjugate moiety
comprises the amino acid sequence:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Cys (SEQ ID NO: 22), wherein Aib is aminoisobutyric
acid.
[0124] In certain embodiments, the GLP-1 peptide conjugate moiety
consists of the amino acid sequence:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Cys (SEQ ID NO: 22), wherein Aib is aminoisobutyric
acid.
[0125] In certain embodiments, the GLP-1 peptide conjugate moiety
comprises the amino acid sequence:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Pen (SEQ ID NO: 23), wherein Aib is aminoisobutyric acid
and Pen is penicillamine.
[0126] In certain embodiments, the GLP-1 peptide conjugate moiety
consists of the amino acid sequence:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Pen (SEQ ID NO: 23), wherein Aib is aminoisobutyric acid
and Pen is penicillamine.
[0127] In certain embodiments, the GLP-1 peptide conjugate moiety
is capable of binding to GLP-1 receptor.
[0128] In certain embodiments, the GLP-1 receptor is expressed on
the surface of a cell.
[0129] In certain embodiments, the cell is a pancreatic cell, such
as a beta-islet cell.
[0130] In certain embodiments, the cell is in an animal.
[0131] In certain embodiments, the compound comprises at least one,
at least two, at least three, at least four, or at least five GLP-1
receptor ligand conjugate moieties.
[0132] In certain embodiments, the conjugate linker links the GLP-1
receptor ligand conjugate moiety to the 5' end of the
oligonucleotide.
[0133] In certain embodiments, the conjugate linker links the GLP-1
receptor ligand conjugate moiety to the 3' end of the
oligonucleotide.
[0134] In certain embodiments, the conjugate linker is
cleavable.
[0135] In certain embodiments, the conjugate linker comprises a
disulfide linkage.
[0136] In certain embodiments, the disulfide linkage links the
GLP-1 peptide conjugate moiety to the oligonucleotide.
[0137] In certain embodiments, the disulfide linkage links the
C-terminus of the GLP-1 peptide conjugate moiety to the 5'end of
the oligonucleotide.
[0138] In certain embodiments, the conjugate linker comprises 1-5
linker-nucleosides.
[0139] In certain embodiments, the conjugate linker comprises 3
linker-nucleosides.
[0140] In certain embodiments, the 3 linker-nucleosides have a TCA
motif.
[0141] In certain embodiments, 1-5 linker-nucleosides do not
comprise a TCA motif.
[0142] In certain embodiments, the conjugate linker comprises a
hexylamino group.
[0143] In certain embodiments, the conjugate linker comprises a
polyethylene glycol group.
[0144] In certain embodiments, the conjugate linker comprises a
triethylene glycol group.
[0145] In certain embodiments, the conjugate linker comprises a
phosphate group.
[0146] In certain embodiments, the conjugate linker comprises:
##STR00002##
wherein X directly or indirectly attaches to the GLP-1 receptor
ligand conjugate moiety; and Y directly or indirectly attaches to
the modified oligonucleotide. In certain embodiments, X comprises
O. In certain embodiments, Y comprises a phosphate group. In
certain embodiments, X attaches to the GLP-1 receptor ligand
conjugate moiety by a disulfide linkage.
[0147] In certain embodiments, the conjugate linker comprises:
##STR00003##
wherein X directly or indirectly attaches to the GLP-1 receptor
ligand conjugate moiety; and wherein T.sub.1 comprises the modified
oligonucleotide; and Bx is a modified or unmodified nucleobase. In
certain embodiments, X comprises a disulfide linkage.
[0148] In certain embodiments, the conjugate linker comprises:
##STR00004##
wherein:
[0149] the phosphate group is connected to the modified
oligonucleotide and Y is connected to the conjugate group;
[0150] Y is a phosphodiester or amino (--NH--) group;
[0151] Z is a pyrrolidinyl group having the formula:
##STR00005##
[0152] j is 0 or 1;
[0153] n is from about 1 to about 10;
[0154] p is from 1 to about 10;
[0155] m is 0 or from 1 to 4; and
[0156] when Y is amino then m is 1.
[0157] In certain embodiments, Y is amino (--NH--) or
phosphodiester group. In certain embodiments, n is 3 and p is 3. In
certain embodiments, n is 6 and p is 6. In certain embodiments, n
is from 2 to 10 and p is from 2 to 10. In certain embodiments, n
and p are different. In certain embodiments, n and p are the same.
In certain embodiments, m is 0 or 1. In certain embodiments, j is
0. In certain embodiments, j is 1 and Z has the formula:
##STR00006##
[0158] In certain embodiments, n is 2 and p is 3. In certain
embodiments, n is 5 and p is 6.
[0159] In certain embodiments, the conjugate linker comprises:
##STR00007##
[0160] In certain embodiments, the conjugate linker comprises:
##STR00008##
[0161] In certain embodiments, the compound comprising a conjugate
linker comprises:
##STR00009##
wherein
[0162] N--N.dbd.N represents an azido group of the GLP-1 receptor
ligand conjugate moiety and X directly or indirectly attaches to
the remainder of the GLP-1 receptor ligand conjugate moiety;
and
[0163] Y directly or indirectly attaches to the
oligonucleotide.
[0164] In certain embodiments, the compound comprising a conjugate
linker comprises:
##STR00010##
wherein
[0165] N--N.dbd.N represents an azido group of the GLP-1 receptor
ligand conjugate moiety and X directly or indirectly attaches to
the remainder of the GLP-1 receptor ligand conjugate moiety;
and
[0166] Y directly or indirectly attaches to the
oligonucleotide.
[0167] In certain embodiments, the compound comprising a conjugate
linker comprises:
##STR00011##
wherein
[0168] N--N.dbd.N represents an azido group of the GLP-1 receptor
ligand conjugate moiety and X directly or indirectly attaches to
the remainder of the GLP-1 receptor ligand conjugate moiety;
and
[0169] Y directly or indirectly attaches to the
oligonucleotide.
[0170] In certain embodiments, a composition comprises at least one
compound described herein. In certain embodiments, a pharmaceutical
composition comprises at least one compound described herein and a
pharmaceutically acceptable excipient.
[0171] In certain embodiments, a method of modulating the
expression of a nucleic acid target in a cell comprises contacting
the cell with the compound of any of the aforementioned
embodiments, thereby modulating expression of the nucleic acid
target in the cell. In certain embodiments, the cell expresses
GLP-1 receptor on the surface of the cell. In certain embodiments,
the cell is a pancreatic cell, such as a beta-islet cell. In
certain embodiments, the cell is a pituitary cell, leptomeninges
cell, central nervous system (CNS) cell, stomach cell, intestinal
cell, duodenum cell, ileum cell, colon cell, breast cell, lung
cell, heart cell, thyroid cell, or kidney cell. In certain
embodiments, the cell expressing GLP-1 receptor on its surface is a
cancer cell. In certain embodiments, the cancer is an endocrine
cancer including, but not limited to, pheochromocytoma,
paraganglioma, medullary thyroid carcinoma, adrenal cortical
adenoma, parathyroid carcinoma, and pituitary adenoma. In certain
embodiments, the cancer is a nervous system cancer including, but
not limited to, meningioma, astrocytoma, glioblastoma, ependymoma,
and schwannoma. In certain embodiments, the cancer is an embroyic
cancer including, but not limited to, medulloblastoma,
nephroblastoma, and neuroblastoma. In certain embodiments, the
cancer includes, but is not limited to, ovarian cancer, prostate
cancer, breast cancer, colorectal cancer, gastric cancer,
pancreatic cancer, cholangiocellular cancer, liver cancer, lung
cancer, and lymphoma. In certain embodiments, contacting the cell
with the compound of any of the aforementioned embodiments inhibits
expression of the nucleic acid target. In certain embodiments, the
nucleic acid target is pre-mRNA, mRNA, non-coding RNA, or miRNA. In
certain embodiments, the cell is in an animal.
[0172] In certain embodiments, a method of modulating the
expression of a nucleic acid target in an animal comprises
administering to the animal the compound of any of the
aforementioned embodiments, thereby modulating expression of the
nucleic acid target in the animal. In certain embodiments, the
expression of the nucleic acid target is modulated in a cell of the
animal that expresses GLP-1 receptor on the surface of the cell. In
certain embodiments, the expression of the nucleic acid target is
modulated in a pancreatic cell, such as a beta-islet cell, of the
animal. In certain embodiments, the cell is a pancreatic cell, such
as a beta-islet cell. In certain embodiments, the cell is a
pituitary cell, leptomeninges cell, duodenum cell, ileum cell,
colon cell, breast cell, lung cell, or kidney cell. In certain
embodiments, the cell expressing GLP-1 receptor on its surface is a
cancer cell. In certain embodiments, the cancer is an endocrine
cancer including, but not limited to, pheochromocytoma,
paraganglioma, medullary thyroid carcinoma, adrenal cortical
adenoma, parathyroid carcinoma, and pituitary adenoma. In certain
embodiments, the cancer is a nervous system cancer including, but
not limited to, meningioma, astrocytoma, glioblastoma, ependymoma,
and schwannoma. In certain embodiments, the cancer is an embroyic
cancer including, but not limited to, medulloblastoma,
nephroblastoma, and neuroblastoma. In certain embodiments, the
cancer includes, but is not limited to, ovarian cancer, prostate
cancer, breast cancer, colorectal cancer, gastric cancer,
pancreatic cancer, cholangiocellular cancer, liver cancer, lung
cancer, and lymphoma. In certain embodiments, administering the
compound inhibits expression of the nucleic acid target in the
animal. In certain embodiments, the nucleic acid target is
pre-mRNA, mRNA, non-coding RNA, or miRNA.
[0173] Also provided herewith is the use of a compound as described
herein for the manufacture of a medicament in the treatment of
cancer. Also provided herewith is a compound as described herein
for use in the treatment of cancer.
[0174] In certain embodiments, a method of preparing a compound
comprises reacting:
##STR00012##
[0175] with a GLP-1 peptide; wherein X.sub.1 is an oligonucleotide
and the compound is a GLP-1 peptide conjugated oligonucleotide.
[0176] In certain embodiments, a method of preparing a compound
comprises: [0177] reacting an oligonucleotide comprising a
hexamethyl linker and a terminal amine at the 5' end of the
oligonucleotide with 3-(2-Pyridyldithio propionic acid
N-hydroxysuccinimide ester) having the formula:
[0177] ##STR00013## [0178] thereby yielding Compound 2 having the
formula:
[0178] ##STR00014## [0179] wherein X.sub.1 is the oligonucleotide;
and [0180] reacting Compound 2 with GLP-1 peptide, thereby yielding
the GLP-1 peptide conjugated oligonucleotide having the
formula:
[0180] ##STR00015## [0181] wherein X.sub.1 is the oligonucleotide
and X.sub.2 is the GLP-1 peptide.
[0182] In certain embodments, a method of preparing a GLP-1 peptide
conjugated oligonucleotide comprises: [0183] mixing a solution
comprising an oligonucleotide comprising a hexamethyl linker and a
terminal amine at the 5' end of the oligonucleotide with a solution
comprising 3-(2-Pyridyldithio propionic acid N-hydroxysuccinimide
ester) having the formula:
[0183] ##STR00016## [0184] thereby yielding Compound 2 having the
formula:
[0184] ##STR00017## [0185] wherein X.sub.1 is the oligonucleotide;
and [0186] mixing a solution comprising Compound 2 with a solution
comprising GLP-1 peptide, thereby yielding the GLP-1 peptide
conjugated oligonucleotide having the formula:
[0186] ##STR00018## [0187] wherein X.sub.1 is the oligonucleotide
and X.sub.2 is the GLP-1 peptide.
[0188] In certain embodiments, the solution comprising the
oligonucleotide comprises sodium phosphate buffer and the solution
comprising 3-(2-Pyridyldithio propionic acid N-hydroxysuccinimide
ester) comprises dimethylformamide.
[0189] In certain embodiments, the solutions are mixed at room
temperature.
[0190] In certain embodiments, the solution comprising Compound 2
further comprises acetonitrile and NaHCO.sub.3 and has a pH of
about 8.0.
[0191] In certain embodiments, the solution comprising GLP-1
peptide further comprises dimethylformamide.
[0192] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
comprise an at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or 31 contiguous amino
acid portion at least 60%, at least 65%, at least 70%, at least
75%, at least 80%, at least 85%, at least 90%, at least 95%, or
100% homologous to an equal length portion of the amino acid
sequence of any of SEQ ID NOs: 1-57.
[0193] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
comprise an at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or 31 contiguous amino
acid portion at least 60%, at least 65%, at least 70%, at least
75%, at least 80%, at least 85%, at least 90%, at least 95%, or
100% identical to an equal length portion of the amino acid
sequence of any of SEQ ID NOs: 1-57.
[0194] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
be 8 to 50 amino acids in length and is at least 60%, at least 65%,
at least 70%, at least 75%, at least 80%, at least 85%, at least
90%, at least 95%, or 100% homologous over its entire length to the
amino acid sequence of any of SEQ ID NOs: 1-57.
[0195] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
be at least 60%, at least 65%, at least 70%, at least 75%, at least
80%, at least 85%, at least 90%, at least 95%, or 100% identical
over its entire length to the amino acid sequence of any of SEQ ID
NOs: 1-57.
[0196] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
comprise an at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or 31 contiguous amino
acid portion at least 60%, at least 65%, at least 70%, at least
75%, at least 80%, at least 85%, at least 90%, at least 95%, or
100% homologous to an equal length portion of the amino acid
sequence of GLP-1(7-37): HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, which in
conventional three-letter code is:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-A-
la-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly (SEQ ID NO:
1).
[0197] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
comprise an at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or 31 contiguous amino
acid portion at least 60%, at least 65%, at least 70%, at least
75%, at least 80%, at least 85%, at least 90%, at least 95%, or
100% identical to an equal length portion of the amino acid
sequence of GLP-1(7-37).
[0198] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
be 8 to 50 amino acids in length and is at least 60%, at least 65%,
at least 70%, at least 75%, at least 80%, at least 85%, at least
90%, at least 95%, or 100% homologous over its entire length to the
amino acid sequence of GLP-1(7-37) (SEQ ID NO: 1).
[0199] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
be at least 60%, at least 65%, at least 70%, at least 75%, at least
80%, at least 85%, at least 90%, at least 95%, or 100% identical
over its entire length to the amino acid sequence of GLP-1(7-37)
(SEQ ID NO: 1).
[0200] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
comprise the amino acid sequence of GLP-1(7-37) (SEQ ID NO: 1).
[0201] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
consist of the amino acid sequence of GLP-1(7-37) (SEQ ID NO:
1).
[0202] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
comprise the amino acid sequence of GLP-1(7-36)amide:
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH.sub.2, which in conventional
three-letter code is:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH.sub.2 (SEQ ID NO:
2).
[0203] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
consist of the amino acid sequence of GLP-1(7-36)amide (SEQ ID NO:
2).
[0204] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
comprise the amino acid sequence of GLP-1(7-36):
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR, which in conventional three-letter
code is:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg (SEQ ID NO: 2).
[0205] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
comprise the amino acid sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKG,
which in conventional three-letter code is:
Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-G-
lu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly (SEQ ID NO: 3).
[0206] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
consist of the amino acid sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKG,
which in conventional three-letter code is:
Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-G-
lu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly (SEQ ID NO: 3).
[0207] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
comprise the amino acid sequence: EGTFTSDVSSYLEEQAAKEFIAWLVKG,
Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-G-
lu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly (SEQ ID NO: 4).
[0208] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
consist of the amino acid sequence: EGTFTSDVSSYLEEQAAKEFIAWLVKG,
Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-G-
lu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly (SEQ ID NO: 4).
[0209] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
comprise the amino acid sequence of any of SEQ ID NOs: 1-57.
[0210] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
consist of the amino acid sequence of any of SEQ ID NOs: 1-57.
[0211] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
comprise the amino acid sequence:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Cys (SEQ ID NO: 22), wherein Aib is aminoisobutyric
acid.
[0212] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
consist of the amino acid sequence:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Cys (SEQ ID NO: 22), wherein Aib is aminoisobutyric
acid.
[0213] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
comprise the amino acid sequence:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Pen (SEQ ID NO: 23), wherein Aib is aminoisobutyric acid
and Pen is penicillamine.
[0214] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
consist of the amino acid sequence:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Pen (SEQ ID NO: 23), wherein Aib is aminoisobutyric acid
and Pen is penicillamine.
[0215] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
comprise a reactive sulfur moiety.
[0216] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the GLP-1 peptide can
comprise penicillamine.
[0217] In any of the aforementioned methods of preparing a compound
or GLP-1 peptide conjugated oligonucleotide, the penicillamine can
be linked to the C-terminus of the GLP-1 peptide.
Certain Compounds Comprising an Oligonucleotide
[0218] In certain embodiments, compounds described herein can be
antisense compounds. In certain embodiments, the antisense compound
comprises or consists of an oligomeric compound. In certain
embodiments, the oligomeric compound comprises a oligonucleotide,
such as a modified oligonucleotide. In certain embodiments, the
modified oligonucleotide has a nucleobase sequence complementary to
that of a target nucleic acid.
[0219] In certain embodiments, a compound described herein
comprises or consists of a modified oligonucleotide. In certain
embodiments, the modified oligonucleotide has a nucleobase sequence
complementary to that of a target nucleic acid.
[0220] In certain embodiments, a compound or antisense compound is
single-stranded. Such a single-stranded compound or antisense
compound comprises or consists of an oligomeric compound. In
certain embodiments, such an oligomeric compound comprises or
consists of an oligonucleotide and optionally a conjugate group. In
certain embodiments, the oligonucleotide is an antisense
oligonucleotide. In certain embodiments, the oligonucleotide is
modified. In certain embodiments, the oligonucleotide of a
single-stranded antisense compound or oligomeric compound comprises
a self-complementary nucleobase sequence.
[0221] In certain embodiments, compounds are double-stranded. Such
double-stranded compounds comprise a first modified oligonucleotide
having a region complementary to a target nucleic acid and a second
modified oligonucleotide having a region complementary to the first
modified oligonucleotide. In certain embodiments, the modified
oligonucleotide is an RNA oligonucleotide. In such embodiments, the
thymine nucleobase in the modified oligonucleotide is replaced by a
uracil nucleobase. In certain embodiments, compound comprises a
conjugate group. In certain embodiments, one of the modified
oligonucleotides is conjugated. In certain embodiments, both the
modified oligonucleotides are conjugated. In certain embodiments,
the first modified oligonucleotide is conjugated. In certain
embodiments, the second modified oligonucleotide is conjugated. In
certain embodiments, the first modified oligonucleotide is 12-30
linked nucleosides in length and the second modified
oligonucleotide is 12-30 linked nucleosides in length. In certain
embodiments, antisense compounds are double-stranded. Such
double-stranded antisense compounds comprise a first oligomeric
compound having a region complementary to a target nucleic acid and
a second oligomeric compound having a region complementary to the
first oligomeric compound. The first oligomeric compound of such
double stranded antisense compounds typically comprises or consists
of a modified oligonucleotide and optionally a conjugate group. The
oligonucleotide of the second oligomeric compound of such
double-stranded antisense compound may be modified or unmodified.
Either or both oligomeric compounds of a double-stranded antisense
compound may comprise a conjugate group. The oligomeric compounds
of double-stranded antisense compounds may include
non-complementary overhanging nucleosides.
[0222] In certain embodiments, a compound comprises a
double-stranded duplex comprising (i) a first strand comprising a
modified oligonucleotide, optionally a conjugate linker, and a
GLP-1 receptor ligand conjugate moiety, and (ii) a second strand
complementary to the first strand. In certain embodiments, a
compound comprises a double-stranded duplex comprising (i) a first
strand comprising the modified oligonucleotide, optionally a
conjugate linker, and a GLP-1 receptor ligand conjugate moiety, and
(ii) a second strand complementary to the first strand; wherein the
first strand is complementary to a RNA transcript. In certain
embodiments, a compound comprises a double-stranded duplex
comprising (i) a first strand comprising a modified
oligonucleotide, optionally a conjugate linker, and a GLP-1
receptor ligand conjugate moiety, and (ii) a second strand
complementary to the first strand; wherein the second strand is
complementary to a RNA transcript.
[0223] Examples of single-stranded and double-stranded compounds
include but are not limited to oligonucleotides, siRNAs, microRNA
targeting oligonucleotides, and single-stranded RNAi compounds,
such as small hairpin RNAs (shRNAs), single-stranded siRNAs
(ssRNAs), and microRNA mimics.
[0224] In certain embodiments, a compound described herein has a
nucleobase sequence that, when written in the 5' to 3' direction,
comprises the reverse complement of the target segment of a target
nucleic acid to which it is targeted.
[0225] In certain embodiments, a compound described herein
comprises an oligonucleotide 10 to 30 linked subunits in length. In
certain embodiments, a compound described herein comprises an
oligonucleotide 12 to 30 linked subunits in length. In certain
embodiments, a compound described herein comprises an
oligonucleotide 12 to 22 linked subunits in length. In certain
embodiments, compound described herein comprises an oligonucleotide
14 to 30 linked subunits in length. In certain embodiments,
compound described herein comprises an oligonucleotide 14 to 20
linked subunits in length. In certain embodiments, a compound
described herein comprises an oligonucleotide 15 to 30 linked
subunits in length. In certain embodiments, a compound described
herein comprises an oligonucleotide 15 to 20 linked subunits in
length. In certain embodiments, a compound described herein
comprises an oligonucleotide 16 to 30 linked subunits in length. In
certain embodiments, a compound described herein comprises an
oligonucleotide 16 to 20 linked subunits in length. In certain
embodiments, a compound described herein comprises an
oligonucleotide 17 to 30 linked subunits in length. In certain
embodiments, a compound described herein comprises an
oligonucleotide 17 to 20 linked subunits in length. In certain
embodiments, a compound described herein comprises an
oligonucleotide 18 to 30 linked subunits in length. In certain
embodiments, a compound described herein comprises an
oligonucleotide 18 to 21 linked subunits in length. In certain
embodiments, a compound described herein comprises an
oligonucleotide 18 to 20 linked subunits in length. In certain
embodiments, a compound described herein comprises an
oligonucleotide 20 to 30 linked subunits in length. In other words,
such oligonucleotides are 12 to 30 linked subunits, 14 to 30 linked
subunits, 14 to 20 subunits, 15 to 30 subunits, 15 to 20 subunits,
16 to 30 subunits, 16 to 20 subunits, 17 to 30 subunits, 17 to 20
subunits, 18 to 30 subunits, 18 to 20 subunits, 18 to 21 subunits,
20 to 30 subunits, or 12 to 22 linked subunits in length,
respectively. In certain embodiments, a compound described herein
comprises an oligonucleotide 14 linked subunits in length. In
certain embodiments, a compound described herein comprises an
oligonucleotide 16 linked subunits in length. In certain
embodiments, a compound described herein comprises an
oligonucleotide 17 linked subunits in length. In certain
embodiments, compound described herein comprises an oligonucleotide
18 linked subunits in length. In certain embodiments, a compound
described herein comprises an oligonucleotide 19 linked subunits in
length. In certain embodiments, a compound described herein
comprises an oligonucleotide 20 linked subunits in length. In other
embodiments, a compound described herein comprises an
oligonucleotide 8 to 80, 12 to 50, 13 to 30, 13 to 50, 14 to 30, 14
to 50, 15 to 30, 15 to 50, 16 to 30, 16 to 50, 17 to 30, 17 to 50,
18 to 22, 18 to 24, 18 to 30, 18 to 50, 19 to 22, 19 to 30, 19 to
50, or 20 to 30 linked subunits. In certain such embodiments, the
compound described herein comprises an oligonucleotide 8, 9, 10,
11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27,
28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44,
45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61,
62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78,
79, or 80 linked subunits in length, or a range defined by any two
of the above values. In some embodiments the linked subunits are
nucleotides, nucleosides, or nucleobases.
[0226] In certain embodiments, the compound may further comprise
additional features or elements, such as a conjugate group, that
are attached to the oligonucleotide. In certain embodiments, such
compounds are antisense compounds. In certain embodiments, such
compounds are oligomeric compounds. In embodiments where a
conjugate group comprises a nucleoside (i.e. a nucleoside that
links the conjugate group to the oligonucleotide), the nucleoside
of the conjugate group is not counted in the length of the
oligonucleotide.
[0227] In certain embodiments, compounds may be shortened or
truncated. For example, a single subunit may be deleted from the 5'
end (5' truncation), or alternatively from the 3' end (3'
truncation). A shortened or truncated compound targeted to a
nucleic acid may have two subunits deleted from the 5' end, or
alternatively may have two subunits deleted from the 3' end, of the
compound. Alternatively, the deleted nucleosides may be dispersed
throughout the compound.
[0228] When a single additional subunit is present in a lengthened
compound, the additional subunit may be located at the 5' or 3' end
of the compound. When two or more additional subunits are present,
the added subunits may be adjacent to each other, for example, in a
compound having two subunits added to the 5' end (5' addition), or
alternatively to the 3' end (3' addition), of the compound.
Alternatively, the added subunits may be dispersed throughout the
compound.
[0229] It is possible to increase or decrease the length of a
compound, such as an oligonucleotide, and/or introduce mismatch
bases without eliminating activity (Woolf et al. (Proc. Natl. Acad.
Sci. USA 89:7305-7309, 1992; Gautschi et al. J. Natl. Cancer Inst.
93:463-471, March 2001; Maher and Dolnick Nuc. Acid. Res.
16:3341-3358, 1988). However, seemingly small changes in
oligonucleotide sequence, chemistry and motif can make large
differences in one or more of the many properties required for
clinical development (Seth et al. J. Med. Chem. 2009, 52, 10; Egli
et al. J. Am. Chem. Soc. 2011, 133, 16642).
[0230] In certain embodiments, compounds described herein are
interfering RNA compounds (RNAi), which include double-stranded RNA
compounds (also referred to as short-interfering RNA or siRNA) and
single-stranded RNAi compounds (or ssRNA). Such compounds work at
least in part through the RISC pathway to degrade and/or sequester
a target nucleic acid (thus, include microRNA/microRNA-mimic
compounds). As used herein, the term siRNA is meant to be
equivalent to other terms used to describe nucleic acid molecules
that are capable of mediating sequence specific RNAi, for example
short interfering RNA (siRNA), double-stranded RNA (dsRNA),
micro-RNA (miRNA), short hairpin RNA (shRNA), short interfering
oligonucleotide, short interfering nucleic acid, short interfering
modified oligonucleotide, chemically modified siRNA,
post-transcriptional gene silencing RNA (ptgsRNA), and others. In
addition, as used herein, the term "RNAi" is meant to be equivalent
to other terms used to describe sequence specific RNA interference,
such as post transcriptional gene silencing, translational
inhibition, or epigenetics.
[0231] In certain embodiments, the first strand of the compound is
an siRNA guide strand and the second strand of the compound is an
siRNA passenger strand. In certain embodiments, the second strand
of the compound is complementary to the first strand. In certain
embodiments, each strand of the compound is 16, 17, 18, 19, 20, 21,
22, or 23 linked nucleosides in length. In certain embodiments, the
first or second strand of the compound can comprise a conjugate
group.
[0232] In certain embodiments, compounds described herein comprise
modified oligonucleotides. Certain modified oligonucleotides have
one or more asymmetric center and thus give rise to enantiomers,
diastereomers, and other stereoisomeric configurations that may be
defined, in terms of absolute stereochemistry, as (R) or (S), as a
or 13 such as for sugar anomers, or as (D) or (L) such as for amino
acids etc. Included in the modified oligonucleotides provided
herein are all such possible isomers, including their racemic and
optically pure forms, unless specified otherwise. Likewise, all
cis- and trans-isomers and tautomeric forms are also included.
[0233] The compounds described herein include variations in which
one or more atoms are replaced with a non-radioactive isotope or
radioactive isotope of the indicated element. For example,
compounds herein that comprise hydrogen atoms encompass all
possible deuterium substitutions for each of the .sup.1H hydrogen
atoms. Isotopic substitutions encompassed by the compounds herein
include but are not limited to: .sup.2H or .sup.3H in place of
.sup.1H, .sup.13C or .sup.14C in place of .sup.15N in place of
.sup.14N, .sup.17O or .sup.18O in place of .sup.16O, and .sup.33S,
.sup.34S, .sup.35S, or .sup.36S in place of .sup.32S. In certain
embodiments, non-radioactive isotopic substitutions may impart new
properties on the compound that are beneficial for use as a
therapeutic or research tool. In certain embodiments, radioactive
isotopic substitutions may make the compound suitable for research
or diagnostic purposes, such as an imaging assay.
Certain Mechanisms
[0234] In certain embodiments, compounds described herein comprise
or consist of modified oligonucleotides. In certain embodiments,
compounds described herein are antisense compounds. In certain
embodiments, compounds comprise oligomeric compounds. In certain
embodiments, compounds described herein are capable of hybridizing
to a target nucleic acid, resulting in at least one antisense
activity. In certain embodiments, compounds described herein
selectively affect one or more target nucleic acid. Such compounds
comprise a nucleobase sequence that hybridizes to one or more
target nucleic acid, resulting in one or more desired antisense
activity and does not hybridize to one or more non-target nucleic
acid or does not hybridize to one or more non-target nucleic acid
in such a way that results in a significant undesired antisense
activity.
[0235] In certain antisense activities, hybridization of a compound
described herein to a target nucleic acid results in recruitment of
a protein that cleaves the target nucleic acid. For example,
certain compounds described herein result in RNase H mediated
cleavage of the target nucleic acid. RNase H is a cellular
endonuclease that cleaves the RNA strand of an RNA:DNA duplex. The
DNA in such an RNA:DNA duplex need not be unmodified DNA. In
certain embodiments, compounds described herein are sufficiently
"DNA-like" to elicit RNase H activity. Further, in certain
embodiments, one or more non-DNA-like nucleoside in the gap of a
gapmer is tolerated.
[0236] In certain antisense activities, compounds described herein
or a portion of the compound is loaded into an RNA-induced
silencing complex (RISC), ultimately resulting in cleavage of the
target nucleic acid. For example, certain compounds described
herein result in cleavage of the target nucleic acid by Argonaute.
Compounds that are loaded into RISC are RNAi compounds. RNAi
compounds may be double-stranded (siRNA) or single-stranded
(ssRNA).
[0237] In certain embodiments, hybridization of compounds described
herein to a target nucleic acid does not result in recruitment of a
protein that cleaves that target nucleic acid. In certain such
embodiments, hybridization of the compound to the target nucleic
acid results in alteration of splicing of the target nucleic acid.
In certain embodiments, hybridization of the compound to a target
nucleic acid results in inhibition of a binding interaction between
the target nucleic acid and a protein or other nucleic acid. In
certain such embodiments, hybridization of the compound to a target
nucleic acid results in alteration of translation of the target
nucleic acid.
[0238] Antisense activities may be observed directly or indirectly.
In certain embodiments, observation or detection of an antisense
activity involves observation or detection of a change in an amount
of a target nucleic acid or protein encoded by such target nucleic
acid, a change in the ratio of splice variants of a nucleic acid or
protein, and/or a phenotypic change in a cell or animal.
Target Nucleic Acids, Target Regions and Nucleotide Sequences
[0239] In certain embodiments, compounds described herein comprise
or consist of an oligonucleotide comprising a region that is
complementary to a target nucleic acid. In certain embodiments, the
target nucleic acid is an endogenous RNA molecule. In certain
embodiments, the target nucleic acid is a non-coding RNA. In
certain embodiments, the target nucleic acid encodes a protein. In
certain such embodiments, the target nucleic acid is selected from:
an mRNA and a pre-mRNA, including intronic, exonic and untranslated
regions. In certain embodiments, the target RNA is an mRNA. In
certain embodiments, the target nucleic acid is a pre-mRNA. In
certain such embodiments, the target region is entirely within an
intron. In certain embodiments, the target region spans an
intron/exon junction. In certain embodiments, the target region is
at least 50% within an intron. In certain embodiments, the target
nucleic acid is in a cell expressing GLP-1 receptor. In certain
embodiments, the GLP-1 receptor expressing cell is a pancreatic
cell, such as a beta islet cell.
Hybridization
[0240] In some embodiments, hybridization occurs between a compound
disclosed herein and a target nucleic acid. The most common
mechanism of hybridization involves hydrogen bonding (e.g.,
Watson-Crick, Hoogsteen or reversed Hoogsteen hydrogen bonding)
between complementary nucleobases of the nucleic acid
molecules.
[0241] Hybridization can occur under varying conditions.
Hybridization conditions are sequence-dependent and are determined
by the nature and composition of the nucleic acid molecules to be
hybridized.
[0242] Methods of determining whether a sequence is specifically
hybridizable to a target nucleic acid are well known in the art. In
certain embodiments, the compounds provided herein are specifically
hybridizable with a target nucleic acid.
Complementarity
[0243] An oligonucleotide is said to be complementary to another
nucleic acid when the nucleobase sequence of such oligonucleotide
or one or more regions thereof matches the nucleobase sequence of
another oligonucleotide or nucleic acid or one or more regions
thereof when the two nucleobase sequences are aligned in opposing
directions. Nucleobase matches or complementary nucleobases, as
described herein, are limited to the following pairs: adenine (A)
and thymine (T), adenine (A) and uracil (U), cytosine (C) and
guanine (G), and 5-methyl cytosine (mC) and guanine (G) unless
otherwise specified. Complementary oligonucleotides and/or nucleic
acids need not have nucleobase complementarity at each nucleoside
and may include one or more nucleobase mismatches. An
oligonucleotide is fully complementary or 100% complementary when
such oligonucleotides have nucleobase matches at each nucleoside
without any nucleobase mismatches.
[0244] In certain embodiments, compounds described herein comprise
or consist of modified oligonucleotides. In certain embodiments,
compounds described herein are antisense compounds. In certain
embodiments, compounds comprise oligomeric compounds.
Non-complementary nucleobases between a compound and a target
nucleic acid may be tolerated provided that the compound remains
able to specifically hybridize to a target nucleic acid. Moreover,
a compound may hybridize over one or more segments of a target
nucleic acid such that intervening or adjacent segments are not
involved in the hybridization event (e.g., a loop structure,
mismatch or hairpin structure).
[0245] In certain embodiments, the compounds provided herein, or a
specified portion thereof, are, are at least, or are up to 70%,
80%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%, 98%, 99%, or 100% complementary to a target nucleic acid, a
target region, target segment, or specified portion thereof. In
certain embodiments, the compounds provided herein, or a specified
portion thereof, are 70% to 75%, 75% to 80%, 80% to 85%, 85% to
90%, 90% to 95%, 95% to 100%, or any number in between these
ranges, complementary to a target nucleic acid, a target region,
target segment, or specified portion thereof. Percent
complementarity of a compound with a target nucleic acid can be
determined using routine methods.
[0246] For example, a compound in which 18 of 20 nucleobases of the
compound are complementary to a target region, and would therefore
specifically hybridize, would represent 90 percent complementarity.
In this example, the remaining non-complementary nucleobases may be
clustered or interspersed with complementary nucleobases and need
not be contiguous to each other or to complementary nucleobases. As
such, a compound which is 18 nucleobases in length having four
non-complementary nucleobases which are flanked by two regions of
complete complementarity with the target nucleic acid would have
77.8% overall complementarity with the target nucleic acid. Percent
complementarity of a compound with a region of a target nucleic
acid can be determined routinely using BLAST programs (basic local
alignment search tools) and PowerBLAST programs known in the art
(Altschul et al., J. Mol. Biol., 1990, 215, 403 410; Zhang and
Madden, Genome Res., 1997, 7, 649 656). Percent homology, sequence
identity or complementarity, can be determined by, for example, the
Gap program (Wisconsin Sequence Analysis Package, Version 8 for
Unix, Genetics Computer Group, University Research Park, Madison
Wis.), using default settings, which uses the algorithm of Smith
and Waterman (Adv. Appl. Math., 1981, 2, 482 489).
[0247] In certain embodiments, compounds described herein, or
specified portions thereof, are fully complementary (i.e. 100%
complementary) to a target nucleic acid, or specified portion
thereof. For example, a compound may be fully complementary to a
target nucleic acid, or a target region, or a target segment or
target sequence thereof. As used herein, "fully complementary"
means each nucleobase of a compound is complementary to the
corresponding nucleobase of a target nucleic acid. For example, a
20 nucleobase compound is fully complementary to a target sequence
that is 400 nucleobases long, so long as there is a corresponding
20 nucleobase portion of the target nucleic acid that is fully
complementary to the compound. Fully complementary can also be used
in reference to a specified portion of the first and/or the second
nucleic acid. For example, a 20 nucleobase portion of a 30
nucleobase compound can be "fully complementary" to a target
sequence that is 400 nucleobases long. The 20 nucleobase portion of
the 30 nucleobase compound is fully complementary to the target
sequence if the target sequence has a corresponding 20 nucleobase
portion wherein each nucleobase is complementary to the 20
nucleobase portion of the compound. At the same time, the entire 30
nucleobase compound may or may not be fully complementary to the
target sequence, depending on whether the remaining 10 nucleobases
of the compound are also complementary to the target sequence.
[0248] In certain embodiments, compounds described herein comprise
one or more mismatched nucleobases relative to the target nucleic
acid. In certain such embodiments, antisense activity against the
target is reduced by such mismatch, but activity against a
non-target is reduced by a greater amount. Thus, in certain such
embodiments selectivity of the compound is improved. In certain
embodiments, the mismatch is specifically positioned within an
oligonucleotide having a gapmer motif. In certain such embodiments,
the mismatch is at position 1, 2, 3, 4, 5, 6, 7, or 8 from the
5'-end of the gap region. In certain such embodiments, the mismatch
is at position 9, 8, 7, 6, 5, 4, 3, 2, 1 from the 3'-end of the gap
region. In certain such embodiments, the mismatch is at position 1,
2, 3, or 4 from the 5'-end of the wing region. In certain such
embodiments, the mismatch is at position 4, 3, 2, or 1 from the
3'-end of the wing region. In certain embodiments, the mismatch is
specifically positioned within an oligonucleotide not having a
gapmer motif. In certain such embodiments, the mismatch is at
position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 from the 5'-end
of the oligonucleotide. In certain such embodiments, the mismatch
is at position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 from the
3'-end of the oligonucleotide.
[0249] The location of a non-complementary nucleobase may be at the
5' end or 3' end of the compound. Alternatively, the
non-complementary nucleobase or nucleobases may be at an internal
position of the compound. When two or more non-complementary
nucleobases are present, they may be contiguous (i.e. linked) or
non-contiguous. In one embodiment, a non-complementary nucleobase
is located in the wing segment of a gapmer oligonucleotide.
[0250] In certain embodiments, compounds described herein that are,
or are up to 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 nucleobases
in length comprise no more than 4, no more than 3, no more than 2,
or no more than 1 non-complementary nucleobase(s) relative to a
target nucleic acid, such as a target nucleic acid, or specified
portion thereof.
[0251] In certain embodiments, compounds described herein that are,
or are up to 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23,
24, 25, 26, 27, 28, 29, or 30 nucleobases in length comprise no
more than 6, no more than 5, no more than 4, no more than 3, no
more than 2, or no more than 1 non-complementary nucleobase(s)
relative to a target nucleic acid, such as a target nucleic acid,
or specified portion thereof.
[0252] In certain embodiments, compounds described herein also
include those which are complementary to a portion of a target
nucleic acid. As used herein, "portion" refers to a defined number
of contiguous (i.e. linked) nucleobases within a region or segment
of a target nucleic acid. A "portion" can also refer to a defined
number of contiguous nucleobases of a compound. In certain
embodiments, the compounds, are complementary to at least an 8
nucleobase portion of a target segment. In certain embodiments, the
compounds are complementary to at least a 9 nucleobase portion of a
target segment. In certain embodiments, the compounds are
complementary to at least a 10 nucleobase portion of a target
segment. In certain embodiments, the compounds are complementary to
at least an 11 nucleobase portion of a target segment. In certain
embodiments, the compounds are complementary to at least a 12
nucleobase portion of a target segment. In certain embodiments, the
compounds are complementary to at least a 13 nucleobase portion of
a target segment. In certain embodiments, the compounds are
complementary to at least a 14 nucleobase portion of a target
segment. In certain embodiments, the compounds are complementary to
at least a 15 nucleobase portion of a target segment. In certain
embodiments, the compounds are complementary to at least a 16
nucleobase portion of a target segment. Also contemplated are
compounds that are complementary to at least a 9, 10, 11, 12, 13,
14, 15, 16, 17, 18, 19, 20, or more nucleobase portion of a target
segment, or a range defined by any two of these values.
Identity
[0253] The compounds provided herein may also have a defined
percent identity to a particular nucleotide sequence, SEQ ID NO, or
compound represented by a specific ISIS or ION number, or portion
thereof. In certain embodiments, compounds described herein are
antisense compounds or oligomeric compounds. In certain
embodiments, compounds described herein are modified
oligonucleotides. As used herein, a compound is identical to the
sequence disclosed herein if it has the same nucleobase pairing
ability. For example, a RNA which contains uracil in place of
thymidine in a disclosed DNA sequence would be considered identical
to the DNA sequence since both uracil and thymidine pair with
adenine. Shortened and lengthened versions of the compounds
described herein as well as compounds having non-identical bases
relative to the compounds provided herein also are contemplated.
The non-identical bases may be adjacent to each other or dispersed
throughout the compound. Percent identity of an compound is
calculated according to the number of bases that have identical
base pairing relative to the sequence to which it is being
compared.
[0254] In certain embodiments, compounds described herein, or
portions thereof, are, are at least, or are up to 70%, 75%, 80%,
85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100%
identical to one or more of the compounds or SEQ ID NOs, or a
portion thereof, disclosed herein. In certain embodiments,
compounds described herein are about 70%, 75%, 80%, 85%, 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical, or any
percentage between such values, to a particular nucleotide
sequence, SEQ ID NO, or compound represented by a specific ISIS or
ION number, or portion thereof, in which the compounds comprise an
oligonucleotide having one or more mismatched nucleobases. In
certain such embodiments, the mismatch is at position 1, 2, 3, 4,
5, 6, 7, 8, 9, 10, 11, or 12 from the 5'-end of the
oligonucleotide. In certain such embodiments, the mismatch is at
position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 from the 3'-end
of the oligonucleotide.
[0255] In certain embodiments, compounds described herein comprise
or consist of antisense compounds. In certain embodiments, a
portion of the antisense compound is compared to an equal length
portion of the target nucleic acid. In certain embodiments, an 8,
9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or
25 nucleobase portion is compared to an equal length portion of the
target nucleic acid.
[0256] In certain embodiments, compounds described herein comprise
or consist of oligonucleotides. In certain embodiments, a portion
of the oligonucleotide is compared to an equal length portion of
the target nucleic acid. In certain embodiments, an 8, 9, 10, 11,
12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25
nucleobase portion is compared to an equal length portion of the
target nucleic acid.
Certain Modified Compounds
[0257] In certain embodiments, compounds described herein comprise
or consist of oligonucleotides consisting of linked nucleosides.
Oligonucleotides may be unmodified oligonucleotides (RNA or DNA) or
may be modified oligonucleotides. Modified oligonucleotides
comprise at least one modification relative to unmodified RNA or
DNA (i.e., comprise at least one modified nucleoside (comprising a
modified sugar moiety and/or a modified nucleobase) and/or at least
one modified internucleoside linkage).
[0258] A. Modified Nucleosides
[0259] Modified nucleosides comprise a modified sugar moiety or a
modified nucleobase or both a modified sugar moiety and a modified
nucleobase.
[0260] 1. Modified Sugar Moieties
[0261] In certain embodiments, sugar moieties are non-bicyclic
modified sugar moieties. In certain embodiments, modified sugar
moieties are bicyclic or tricyclic sugar moieties. In certain
embodiments, modified sugar moieties are sugar surrogates. Such
sugar surrogates may comprise one or more substitutions
corresponding to those of other types of modified sugar
moieties.
[0262] In certain embodiments, modified sugar moieties are
non-bicyclic modified sugar moieties comprising a furanosyl ring
with one or more acyclic substituent, including but not limited to
substituents at the 2', 4', and/or 5' positions. In certain
embodiments one or more acyclic substituent of non-bicyclic
modified sugar moieties is branched. Examples of 2'-substituent
groups suitable for non-bicyclic modified sugar moieties include
but are not limited to: 2'-F, 2'-OCH.sub.3("OMe" or "O-methyl"),
and 2'-O(CH.sub.2).sub.2OCH.sub.3 ("MOE"). In certain embodiments,
2'-substituent groups are selected from among: halo, allyl, amino,
azido, SH, CN, OCN, CF.sub.3, OCF.sub.3, O--C.sub.1-C.sub.10
alkoxy, O--C.sub.1-C.sub.10 substituted alkoxy, O--C.sub.1-C.sub.10
alkyl, O--C.sub.1-C.sub.10 substituted alkyl, S-alkyl,
N(R.sub.m)-alkyl, O-alkenyl, S-alkenyl, N(R.sub.m)-alkenyl,
O-alkynyl, S-alkynyl, N(R.sub.m)-alkynyl, O-alkylenyl-O-alkyl,
alkynyl, alkaryl, aralkyl, O-alkaryl, O-aralkyl,
O(CH.sub.2).sub.2SCH.sub.3, O(CH.sub.2).sub.2ON(R.sub.m)(R.sub.n)
or OCH.sub.2C(.dbd.O)--N(R.sub.m)(R.sub.n), where each R.sub.m and
R.sub.n is, independently, H, an amino protecting group, or
substituted or unsubstituted C.sub.1-C.sub.10 alkyl, and the
2'-substituent groups described in Cook et al., U.S. Pat. No.
6,531,584; Cook et al., U.S. Pat. No. 5,859,221; and Cook et al.,
U.S. Pat. No. 6,005,087. Certain embodiments of these
2'-substituent groups can be further substituted with one or more
substituent groups independently selected from among: hydroxyl,
amino, alkoxy, carboxy, benzyl, phenyl, nitro (NO.sub.2), thiol,
thioalkoxy, thioalkyl, halogen, alkyl, aryl, alkenyl and alkynyl.
Examples of 4'-substituent groups suitable for linearlynon-bicyclic
modified sugar moieties include but are not limited to alkoxy
(e.g., methoxy), alkyl, and those described in Manoharan et al., WO
2015/106128. Examples of 5'-substituent groups suitable for
non-bicyclic modified sugar moieties include but are not limited
to: 5'-methyl (R or S), 5'-vinyl, and 5'-methoxy. In certain
embodiments, non-bicyclic modified sugars comprise more than one
non-bridging sugar substituent, for example, 2'-F-5'-methyl sugar
moieties and the modified sugar moieties and modified nucleosides
described in Migawa et al., WO 2008/101157 and Rajeev et al.,
US2013/0203836.
[0263] In certain embodiments, a 2'-substituted nucleoside or
2'-non-bicyclic modified nucleoside comprises a sugar moiety
comprising a linear 2'-substituent group selected from: F,
NH.sub.2, N.sub.3, OCF.sub.3, OCH.sub.3, O(CH.sub.2).sub.3NH.sub.2,
CH.sub.2CH.dbd.CH.sub.2, OCH.sub.2CH.dbd.CH.sub.2,
OCH.sub.2CH.sub.2OCH.sub.3, O(CH.sub.2).sub.2SCH.sub.3,
O(CH.sub.2).sub.2ON(R.sub.m)(R.sub.n),
O(CH.sub.2).sub.2O(CH.sub.2).sub.2N(CH.sub.3).sub.2, and
N-substituted acetamide (OCH.sub.2C(.dbd.O)--N(R.sub.m)(R.sub.n)),
where each R.sub.m and R.sub.n is, independently, H, an amino
protecting group, or substituted or unsubstituted C.sub.1-C.sub.10
alkyl.
[0264] In certain embodiments, a 2'-substituted nucleoside or
2'-non-bicyclic modified nucleoside comprises a sugar moiety
comprising a linear 2'-substituent group selected from: F,
OCF.sub.3, OCH.sub.3, OCH.sub.2CH.sub.2OCH.sub.3,
O(CH.sub.2).sub.2SCH.sub.3, O(CH.sub.2).sub.2ON(CH.sub.3).sub.2,
O(CH.sub.2).sub.2O(CH.sub.2).sub.2N(CH.sub.3).sub.2, and
OCH.sub.2C(.dbd.O)--N(H)CH.sub.3 ("NMA").
[0265] In certain embodiments, a 2'-substituted nucleoside or
2'-non-bicyclic modified nucleoside comprises a sugar moiety
comprising a linear 2'-substituent group selected from: F,
OCH.sub.3, and OCH.sub.2CH.sub.2OCH.sub.3.
[0266] Nucleosides comprising modified sugar moieties, such as
non-bicyclic modified sugar moieties, are referred to by the
position(s) of the substitution(s) on the sugar moiety of the
nucleoside. For example, nucleosides comprising 2'-substituted or
2-modified sugar moieties are referred to as 2'-substituted
nucleosides or 2-modified nucleosides.
[0267] Certain modified sugar moieties comprise a bridging sugar
substituent that forms a second ring resulting in a bicyclic sugar
moiety. In certain such embodiments, the bicyclic sugar moiety
comprises a bridge between the 4' and the 2' furanose ring atoms.
Examples of such 4' to 2' bridging sugar substituents include but
are not limited to: 4'-CH.sub.2-2', 4'-(CH.sub.2).sub.2-2',
4'-(CH.sub.2).sub.3-2', 4'-CH.sub.2-O-2' ("LNA"),
4'-CH.sub.2--S-2', 4'-(CH.sub.2).sub.2--O-2' ("ENA"),
4'-CH(CH.sub.3)--O-2' (referred to as "constrained ethyl" or "cEt"
when in the S configuration), 4'-CH.sub.2--O--CH.sub.2-2',
4'-CH.sub.2--N(R)-2', 4'-CH(CH.sub.2OCH.sub.3)--O-2' ("constrained
MOE" or "cMOE") and analogs thereof (see, e.g., Seth et al., U.S.
Pat. No. 7,399,845, Bhat et al., U.S. Pat. No. 7,569,686, Swayze et
al., U.S. Pat. No. 7,741,457, and Swayze et al., U.S. Pat. No.
8,022,193), 4'-C(CH.sub.3)(CH.sub.3)--O-2' and analogs thereof
(see, e.g., Seth et al., U.S. Pat. No. 8,278,283),
4'-CH.sub.2--N(OCH.sub.3)-2' and analogs thereof (see, e.g.,
Prakash et al., U.S. Pat. No. 8,278,425),
4'-CH.sub.2--O--N(CH.sub.3)-2' (see, e.g., Allerson et al., U.S.
Pat. No. 7,696,345 and Allerson et al., U.S. Pat. No. 8,124,745),
4'-CH.sub.2--C(H)(CH.sub.3)-2' (see, e.g., Zhou, et al., J. Org.
Chem., 2009, 74, 118-134), 4'-CH.sub.2--C(.dbd.CH.sub.2)-2' and
analogs thereof (see e.g., Seth et al., U.S. Pat. No. 8,278,426),
4'-C(R.sub.aR.sub.b)--N(R)--O-2', 4'-C(R.sub.aR.sub.b)--O--N(R)-2',
4'-CH.sub.2--O--N(R)-2', and 4'-CH.sub.2--N(R)--O-2', wherein each
R, R.sub.a, and R.sub.b is, independently, H, a protecting group,
or C.sub.1-C.sub.12 alkyl (see, e.g. Imanishi et al., U.S. Pat. No.
7,427,672).
[0268] In certain embodiments, such 4' to 2' bridges independently
comprise from 1 to 4 linked groups independently selected from:
--[C(R.sub.a)(R.sub.b)].sub.n--,
--[C(R.sub.a)(R.sub.b)].sub.n--O--, --C(R.sub.a).dbd.C(R.sub.b)--,
--C(R.sub.a).dbd.N--, --C(.dbd.NR.sub.a)--, --C(.dbd.O)--,
--C(.dbd.S)--, --O--, --Si(R.sub.a).sub.2--, --S(.dbd.O).sub.x--,
and --N(R.sub.a)--;
[0269] wherein:
[0270] x is 0, 1, or 2;
[0271] n is 1, 2, 3, or 4;
[0272] each R.sub.a and R.sub.b is, independently, H, a protecting
group, hydroxyl, C.sub.1-C.sub.12 alkyl, substituted
C.sub.1-C.sub.12 alkyl, C.sub.2-C.sub.12 alkenyl, substituted
C.sub.2-C.sub.12 alkenyl, C.sub.2-C.sub.12 alkynyl, substituted
C.sub.2-C.sub.12 alkynyl, C.sub.5-C.sub.20 aryl, substituted
C.sub.5-C.sub.20 aryl, heterocycle radical, substituted heterocycle
radical, heteroaryl, substituted heteroaryl, C.sub.5-C.sub.7
alicyclic radical, substituted C.sub.5-C.sub.7 alicyclic radical,
halogen, OJ.sub.1, NJ.sub.1J.sub.2, SJ.sub.1, N.sub.3, COOJ.sub.1,
acyl (C(.dbd.O)--H), substituted acyl, CN, sulfonyl
(S(.dbd.O).sub.2-J.sub.1), or sulfoxyl (S(.dbd.O)-J.sub.1); and
each J.sub.1 and J.sub.2 is, independently, H, C.sub.1-C.sub.12
alkyl, substituted C.sub.1-C.sub.12 alkyl, C.sub.2-C.sub.12
alkenyl, substituted C.sub.2-C.sub.12 alkenyl, C.sub.2-C.sub.12
alkynyl, substituted C.sub.2-C.sub.12 alkynyl, C.sub.5-C.sub.20
aryl, substituted C.sub.5-C.sub.20 aryl, acyl (C(.dbd.O)--H),
substituted acyl, a heterocycle radical, a substituted heterocycle
radical, C.sub.1-C.sub.12 aminoalkyl, substituted C.sub.1-C.sub.12
aminoalkyl, or a protecting group.
[0273] Additional bicyclic sugar moieties are known in the art,
see, for example: Freier et al., Nucleic Acids Research, 1997,
25(22), 4429-4443, Albaek et al., J. Org. Chem., 2006, 71,
7731-7740, Singh et al., Chem. Commun., 1998, 4, 455-456; Koshkin
et al., Tetrahedron, 1998, 54, 3607-3630; Wahlestedt et al., Proc.
Natl. Acad. Sci. U.S.A., 2000, 97, 5633-5638; Kumar et al., Bioorg.
Med. Chem. Lett., 1998, 8, 2219-2222; Singh et al., J. Org. Chem.,
1998, 63, 10035-10039; Srivastava et al., J. Am. Chem. Soc., 20017,
129, 8362-8379; Elayadi et al., Curr. Opinion Invens. Drugs, 2001,
2, 558-561; Braasch et al., Chem. Biol., 2001, 8, 1-7; Orum et al.,
Curr. Opinion Mol. Ther., 2001, 3, 239-243; Wengel et al., U.S.
Pat. No. 7,053,207, Imanishi et al., U.S. Pat. No. 6,268,490,
Imanishi et al. U.S. Pat. No. 6,770,748, Imanishi et al., U.S. Pat.
No. RE44,779; Wengel et al., U.S. Pat. No. 6,794,499, Wengel et
al., U.S. Pat. No. 6,670,461; Wengel et al., U.S. Pat. No.
7,034,133, Wengel et al., U.S. Pat. No. 8,080,644; Wengel et al.,
U.S. Pat. No. 8,034,909; Wengel et al., U.S. Pat. No. 8,153,365;
Wengel et al., U.S. Pat. No. 7,572,582; and Ramasamy et al., U.S.
Pat. No. 6,525,191, Torsten et al., WO 2004/106356, Wengel et al.,
WO 91999/014226; Seth et al., WO 2007/134181; Seth et al., U.S.
Pat. No. 7,547,684; Seth et al., U.S. Pat. No. 7,666,854; Seth et
al., U.S. Pat. No. 8,088,746; Seth et al., U.S. Pat. No. 7,750,131;
Seth et al., U.S. Pat. No. 8,030,467; Seth et al., U.S. Pat. No.
8,268,980; Seth et al., U.S. Pat. No. 8,546,556; Seth et al., U.S.
Pat. No. 8,530,640; Migawa et al., U.S. Pat. No. 9,012,421; Seth et
al., U.S. Pat. No. 8,501,805; and U.S. Patent Publication Nos.
Allerson et al., US2008/0039618 and Migawa et al.,
US2015/0191727.
[0274] In certain embodiments, bicyclic sugar moieties and
nucleosides incorporating such bicyclic sugar moieties are further
defined by isomeric configuration. For example, an LNA nucleoside
(described herein) may be in the .alpha.-L configuration or in the
.beta.-D configuration.
##STR00019##
.alpha.-L-methyleneoxy (4'-CH.sub.2--O-2') or .alpha.-L-LNA
bicyclic nucleosides have been incorporated into oligonucleotides
that showed antisense activity (Frieden et al., Nucleic Acids
Research, 2003, 21, 6365-6372). Herein, general descriptions of
bicyclic nucleosides include both isomeric configurations. When the
positions of specific bicyclic nucleosides (e.g., LNA or cEt) are
identified in exemplified embodiments herein, they are in the
.beta.-D configuration, unless otherwise specified.
[0275] In certain embodiments, modified sugar moieties comprise one
or more non-bridging sugar substituent and one or more bridging
sugar substituent (e.g., 5'-substituted and 4'-2' bridged
sugars).
[0276] In certain embodiments, modified sugar moieties are sugar
surrogates. In certain such embodiments, the oxygen atom of the
sugar moiety is replaced, e.g., with a sulfur, carbon or nitrogen
atom. In certain such embodiments, such modified sugar moieties
also comprise bridging and/or non-bridging substituents as
described herein. For example, certain sugar surrogates comprise a
4'-sulfur atom and a substitution at the 2'-position (see, e.g.,
Bhat et al., U.S. Pat. No. 7,875,733 and Bhat et al., U.S. Pat. No.
7,939,677) and/or the 5' position.
[0277] In certain embodiments, sugar surrogates comprise rings
having other than 5 atoms. For example, in certain embodiments, a
sugar surrogate comprises a six-membered tetrahydropyran ("THP").
Such tetrahydropyrans may be further modified or substituted.
Nucleosides comprising such modified tetrahydropyrans include but
are not limited to hexitol nucleic acid ("HNA"), anitol nucleic
acid ("ANA"), manitol nucleic acid ("MNA") (see e.g., Leumann, C J.
Bioorg. & Med. Chem. 2002, 10, 841-854), fluoro HNA:
##STR00020##
("F-HNA", see e.g., Swayze et al., U.S. Pat. No. 8,088,904; Swayze
et al., U.S. Pat. No. 8,440,803; Swayze et al., U.S.; and Swayze et
al., U.S. Pat. No. 9,005,906, F-HNA can also be referred to as a
F-THP or 3'-fluoro tetrahydropyran), and nucleosides comprising
additional modified THP compounds having the formula:
##STR00021##
wherein, independently, for each of said modified THP
nucleoside:
[0278] Bx is a nucleobase moiety;
[0279] T.sub.3 and T.sub.4 are each, independently, an
internucleoside linking group linking the modified THP nucleoside
to the remainder of an oligonucleotide or one of T.sub.3 and
T.sub.4 is an internucleoside linking group linking the modified
THP nucleoside to the remainder of an oligonucleotide and the other
of T.sub.3 and T.sub.4 is H, a hydroxyl protecting group, a linked
conjugate group, or a 5' or 3'-terminal group; q.sub.1, q.sub.2,
q.sub.3, q.sub.4, q.sub.5, q.sub.6 and q.sub.7 are each,
independently, H, C.sub.1-C.sub.6 alkyl, substituted
C.sub.1-C.sub.6 alkyl, C.sub.2-C.sub.6 alkenyl, substituted
C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, or substituted
C.sub.2-C.sub.6 alkynyl; and each of R.sub.1 and R.sub.2 is
independently selected from among: hydrogen, halogen, substituted
or unsubstituted alkoxy, NJ.sub.1J.sub.2, SJ.sub.1, N.sub.3,
OC(.dbd.X)J.sub.1, OC(.dbd.X)NJ.sub.1J.sub.2,
NJ.sub.3C(.dbd.X)NJ.sub.1J.sub.2, and CN, wherein X is O, S or
NJ.sub.1, and each J.sub.1, J.sub.2, and J.sub.3 is, independently,
H or C.sub.1-C.sub.6 alkyl.
[0280] In certain embodiments, modified THP nucleosides are
provided wherein q.sub.1, q.sub.2, q.sub.3, q.sub.4, q.sub.5,
q.sub.6 and are each H. In certain embodiments, at least one of
q.sub.1, q.sub.2, q.sub.3, q.sub.4, q.sub.5, q.sub.6 and q.sub.7 is
other than H. In certain embodiments, at least one of q.sub.1,
q.sub.2, q.sub.3, q.sub.4, q.sub.5, q.sub.6 and q.sub.7 is methyl.
In certain embodiments, modified THP nucleosides are provided
wherein one of R.sub.1 and R.sub.2 is F. In certain embodiments,
R.sub.1 is F and R.sub.2 is H, in certain embodiments, R.sub.1 is
methoxy and R.sub.2 is H, and in certain embodiments, R.sub.1 is
methoxyethoxy and R.sub.2 is H.
[0281] In certain embodiments, sugar surrogates comprise rings
having more than 5 atoms and more than one heteroatom. For example,
nucleosides comprising morpholino sugar moieties and their use in
oligonucleotides have been reported (see, e.g., Braasch et al.,
Biochemistry, 2002, 41, 4503-4510 and Summerton et al., U.S. Pat.
No. 5,698,685; Summerton et al., U.S. Pat. No. 5,166,315; Summerton
et al., U.S. Pat. No. 5,185,444; and Summerton et al., U.S. Pat.
No. 5,034,506). As used here, the term "morpholino" means a sugar
surrogate having the following structure:
##STR00022##
In certain embodiments, morpholinos may be modified, for example by
adding or altering various substituent groups from the above
morpholino structure. Such sugar surrogates are referred to herein
as "modified morpholinos."
[0282] In certain embodiments, sugar surrogates comprise acyclic
moieties. Examples of nucleosides and oligonucleotides comprising
such acyclic sugar surrogates include but are not limited to:
peptide nucleic acid ("PNA"), acyclic butyl nucleic acid (see,
e.g., Kumar et al., Org. Biomol. Chem., 2013, 11, 5853-5865), and
nucleosides and oligonucleotides described in Manoharan et al.,
WO2011/133876.
[0283] Many other bicyclic and tricyclic sugar and sugar surrogate
ring systems are known in the art that can be used in modified
nucleosides.
[0284] 2. Modified Nucleobases
[0285] Nucleobase (or base) modifications or substitutions are
structurally distinguishable from, yet functionally interchangeable
with, naturally occurring or synthetic unmodified nucleobases. Both
natural and modified nucleobases are capable of participating in
hydrogen bonding. Such nucleobase modifications can impart nuclease
stability, binding affinity or some other beneficial biological
property to antisense compounds.
[0286] In certain embodiments, compounds described herein comprise
modified oligonucleotides. In certain embodiments, modified
oligonucleotides comprise one or more nucleoside comprising an
unmodified nucleobase. In certain embodiments, modified
oligonucleotides comprise one or more nucleoside comprising a
modified nucleobase. In certain embodiments, modified
oligonucleotides comprise one or more nucleoside that does not
comprise a nucleobase, referred to as an abasic nucleoside.
[0287] In certain embodiments, modified nucleobases are selected
from: 5-substituted pyrimidines, 6-azapyrimidines, alkyl or alkynyl
substituted pyrimidines, alkyl substituted purines, and N-2, N-6
and 0-6 substituted purines. In certain embodiments, modified
nucleobases are selected from: 2-aminopropyladenine,
5-hydroxymethyl cytosine, 5-methylcytosine, xanthine, hypoxanthine,
2-aminoadenine, 6-N-methylguanine, 6-N-methyladenine,
2-propyladenine, 2-thiouracil, 2-thiothymine and 2-thiocytosine,
5-propynyl (C.ident.C--CH3) uracil, 5-propynylcytosine,
6-azouracil, 6-azocytosine, 6-azothymine, 5-ribosyluracil
(pseudouracil), 4-thiouracil, 8-halo, 8-amino, 8-thiol,
8-thioalkyl, 8-hydroxyl, 8-aza and other 8-substituted purines,
5-halo, particularly 5-bromo, 5-trifluoromethyl, 5-halouracil, and
5-halocytosine, 7-methylguanine, 7-methyladenine, 2-F-adenine,
2-aminoadenine, 7-deazaguanine, 7-deazaadenine, 3-deazaguanine,
3-deazaadenine, 6-N-benzoyladenine, 2-N-isobutyrylguanine,
4-N-benzoylcytosine, 4-N-benzoyluracil, 5-methyl
4-N-benzoylcytosine, 5-methyl 4-N-benzoyluracil, universal bases,
hydrophobic bases, promiscuous bases, size-expanded bases, and
fluorinated bases. Further modified nucleobases include tricyclic
pyrimidines, such as 1,3-diazaphenoxazine-2-one,
1,3-diazaphenothiazine-2-one and
9-(2-aminoethoxy)-1,3-diazaphenoxazine-2-one (G-clamp). Modified
nucleobases may also include those in which the purine or
pyrimidine base is replaced with other heterocycles, for example
7-deaza-adenine, 7-deazaguanosine, 2-aminopyridine and 2-pyridone.
Further nucleobases include those disclosed in Merigan et al., U.S.
Pat. No. 3,687,808, those disclosed in The Concise Encyclopedia Of
Polymer Science And Engineering, Kroschwitz, J. I., Ed., John Wiley
& Sons, 1990, 858-859; Englisch et al., Angewandte Chemie,
International Edition, 1991, 30, 613; Sanghvi, Y. S., Chapter 15,
Antisense Research and Applications, Crooke, S. T. and Lebleu, B.,
Eds., CRC Press, 1993, 273-288; and those disclosed in Chapters 6
and 15, Antisense Drug Technology, Crooke S. T., Ed., CRC Press,
2008, 163-166 and 442-443.
[0288] Publications that teach the preparation of certain of the
above noted modified nucleobases as well as other modified
nucleobases include without limitation, Manoharan et al.,
US2003/0158403, Manoharan et al., US2003/0175906; Dinh et al., U.S.
Pat. No. 4,845,205; Spielvogel et al., U.S. Pat. No. 5,130,302;
Rogers et al., U.S. Pat. No. 5,134,066; Bischofberger et al., U.S.
Pat. No. 5,175,273; Urdea et al., U.S. Pat. No. 5,367,066; Benner
et al., U.S. Pat. No. 5,432,272; Matteucci et al., U.S. Pat. No.
5,434,257; Gmeiner et al., U.S. Pat. No. 5,457,187; Cook et al.,
U.S. Pat. No. 5,459,255; Froehler et al., U.S. Pat. No. 5,484,908;
Matteucci et al., U.S. Pat. No. 5,502,177; Hawkins et al., U.S.
Pat. No. 5,525,711; Haralambidis et al., U.S. Pat. No. 5,552,540;
Cook et al., U.S. Pat. No. 5,587,469; Froehler et al., U.S. Pat.
No. 5,594,121; Switzer et al., U.S. Pat. No. 5,596,091; Cook et
al., U.S. Pat. No. 5,614,617; Froehler et al., U.S. Pat. No.
5,645,985; Cook et al., U.S. Pat. No. 5,681,941; Cook et al., U.S.
Pat. No. 5,811,534; Cook et al., U.S. Pat. No. 5,750,692; Cook et
al., U.S. Pat. No. 5,948,903; Cook et al., U.S. Pat. No. 5,587,470;
Cook et al., U.S. Pat. No. 5,457,191; Matteucci et al., U.S. Pat.
No. 5,763,588; Froehler et al., U.S. Pat. No. 5,830,653; Cook et
al., U.S. Pat. No. 5,808,027; Cook et al., U.S. Pat. No. 6,166,199;
and Matteucci et al., U.S. Pat. No. 6,005,096.
[0289] In certain embodiments, compounds targeted to a target
nucleic acid comprise one or more modified nucleobases. In certain
embodiments, the modified nucleobase is 5-methylcytosine. In
certain embodiments, each cytosine is a 5-methylcytosine.
[0290] 3. Modified Internucleoside Linkages
[0291] The naturally occurring internucleoside linkage of RNA and
DNA is a 3' to 5' phosphodiester linkage In certain embodiments,
compounds described herein having one or more modified, i.e.
non-naturally occurring, internucleoside linkages are often
selected over compounds having naturally occurring internucleoside
linkages because of desirable properties such as, for example,
enhanced cellular uptake, enhanced affinity for target nucleic
acids, and increased stability in the presence of nucleases.
[0292] In certain embodiments, compounds targeted to a target
nucleic acid comprise one or more modified internucleoside
linkages. In certain embodiments, the modified internucleoside
linkages are phosphorothioate linkages. In certain embodiments,
each internucleoside linkage of an antisense compound is a
phosphorothioate internucleoside linkage.
[0293] In certain embodiments, compounds described herein comprise
oligonucleotides. Oligonucleotides having modified internucleoside
linkages include internucleoside linkages that retain a phosphorus
atom as well as internucleoside linkages that do not have a
phosphorus atom. Representative phosphorus containing
internucleoside linkages include, but are not limited to,
phosphodiesters, phosphotriesters, methylphosphonates,
phosphoramidate, and phosphorothioates. Methods of preparation of
phosphorous-containing and non-phosphorous-containing linkages are
well known.
[0294] In certain embodiments, nucleosides of modified
oligonucleotides may be linked together using any internucleoside
linkage. The two main classes of internucleoside linking groups are
defined by the presence or absence of a phosphorus atom.
Representative phosphorus-containing internucleoside linkages
include but are not limited to phosphates, which contain a
phosphodiester bond ("P.dbd.O") (also referred to as unmodified or
naturally occurring linkages), phosphotriesters,
methylphosphonates, phosphoramidates, and phosphorothioates
("P.dbd.S"), and phosphorodithioates ("HS--P.dbd.S").
Representative non-phosphorus containing internucleoside linking
groups include but are not limited to methylenemethylimino
(--CH2-N(CH3)-O--CH2-), thiodiester, thionocarbamate
(--O--C(.dbd.O)(NH)--S--); siloxane (--O--SiH2-O--); and
N,N'-dimethylhydrazine (--CH2-N(CH3)-N(CH3)-). Modified
internucleoside linkages, compared to naturally occurring phosphate
linkages, can be used to alter, typically increase, nuclease
resistance of the oligonucleotide. In certain embodiments,
internucleoside linkages having a chiral atom can be prepared as a
racemic mixture, or as separate enantiomers. Representative chiral
internucleoside linkages include but are not limited to
alkylphosphonates and phosphorothioates. Methods of preparation of
phosphorous-containing and non-phosphorous-containing
internucleoside linkages are well known to those skilled in the
art.
[0295] Neutral internucleoside linkages include, without
limitation, phosphotriesters, methylphosphonates, MMI
(3'-CH2-N(CH3)-O-5'), amide-3 (3'-CH2-C(.dbd.O)--N(H)-5'), amide-4
(3'-CH2-N(H)--C(.dbd.O)-5'), formacetal (3'-O--CH2-O-5),
methoxypropyl, and thioformacetal (3'-S--CH2-O-5'). Further neutral
internucleoside linkages include nonionic linkages comprising
siloxane (dialkylsiloxane), carboxylate ester, carboxamide,
sulfide, sulfonate ester and amides (See for example: Carbohydrate
Modifications in Antisense Research; Y. S. Sanghvi and P. D. Cook,
Eds., ACS Symposium Series 580; Chapters 3 and 4, 40-65). Further
neutral internucleoside linkages include nonionic linkages
comprising mixed N, O, S and CH2 component parts.
[0296] In certain embodiments, oligonucleotides comprise modified
internucleoside linkages arranged along the oligonucleotide or
region thereof in a defined pattern or modified internucleoside
linkage motif. In certain embodiments, internucleoside linkages are
arranged in a gapped motif. In such embodiments, the
internucleoside linkages in each of two wing regions are different
from the internucleoside linkages in the gap region. In certain
embodiments the internucleoside linkages in the wings are
phosphodiester and the internucleoside linkages in the gap are
phosphorothioate. The nucleoside motif is independently selected,
so such oligonucleotides having a gapped internucleoside linkage
motif may or may not have a gapped nucleoside motif and if it does
have a gapped nucleoside motif, the wing and gap lengths may or may
not be the same.
[0297] In certain embodiments, oligonucleotides comprise a region
having an alternating internucleoside linkage motif. In certain
embodiments, oligonucleotides comprise a region of uniformly
modified internucleoside linkages. In certain such embodiments, the
oligonucleotide comprises a region that is uniformly linked by
phosphorothioate internucleoside linkages. In certain embodiments,
the oligonucleotide is uniformly linked by phosphorothioate. In
certain embodiments, each internucleoside linkage of the
oligonucleotide is selected from phosphodiester and
phosphorothioate. In certain embodiments, each internucleoside
linkage of the oligonucleotide is selected from phosphodiester and
phosphorothioate and at least one internucleoside linkage is
phosphorothioate.
[0298] In certain embodiments, the oligonucleotide comprises at
least 6 phosphorothioate internucleoside linkages. In certain
embodiments, the oligonucleotide comprises at least 8
phosphorothioate internucleoside linkages. In certain embodiments,
the oligonucleotide comprises at least 10 phosphorothioate
internucleoside linkages. In certain embodiments, the
oligonucleotide comprises at least one block of at least 6
consecutive phosphorothioate internucleoside linkages. In certain
embodiments, the oligonucleotide comprises at least one block of at
least 8 consecutive phosphorothioate internucleoside linkages. In
certain embodiments, the oligonucleotide comprises at least one
block of at least 10 consecutive phosphorothioate internucleoside
linkages. In certain embodiments, the oligonucleotide comprises at
least block of at least one 12 consecutive phosphorothioate
internucleoside linkages. In certain such embodiments, at least one
such block is located at the 3' end of the oligonucleotide. In
certain such embodiments, at least one such block is located within
3 nucleosides of the 3' end of the oligonucleotide.
[0299] In certain embodiments, oligonucleotides comprise one or
more methylphosponate linkages. In certain embodiments,
oligonucleotides having a gapmer nucleoside motif comprise a
linkage motif comprising all phosphorothioate linkages except for
one or two methylphosponate linkages. In certain embodiments, one
methylphosponate linkage is in the central gap of an
oligonucleotide having a gapmer nucleoside motif.
[0300] In certain embodiments, it is desirable to arrange the
number of phosphorothioate internucleoside linkages and
phosphodiester internucleoside linkages to maintain nuclease
resistance. In certain embodiments, it is desirable to arrange the
number and position of phosphorothioate internucleoside linkages
and the number and position of phosphodiester internucleoside
linkages to maintain nuclease resistance. In certain embodiments,
the number of phosphorothioate internucleoside linkages may be
decreased and the number of phosphodiester internucleoside linkages
may be increased. In certain embodiments, the number of
phosphorothioate internucleoside linkages may be decreased and the
number of phosphodiester internucleoside linkages may be increased
while still maintaining nuclease resistance. In certain embodiments
it is desirable to decrease the number of phosphorothioate
internucleoside linkages while retaining nuclease resistance. In
certain embodiments it is desirable to increase the number of
phosphodiester internucleoside linkages while retaining nuclease
resistance.
[0301] 4. Certain Motifs
[0302] In certain embodiments, compounds described herein comprise
oligonucleotides. Oligonucleotides can have a motif, e.g. a pattern
of unmodified and/or modified sugar moieties, nucleobases, and/or
internucleoside linkages. In certain embodiments, modified
oligonucleotides comprise one or more modified nucleoside
comprising a modified sugar. In certain embodiments, modified
oligonucleotides comprise one or more modified nucleosides
comprising a modified nucleobase. In certain embodiments, modified
oligonucleotides comprise one or more modified internucleoside
linkage. In such embodiments, the modified, unmodified, and
differently modified sugar moieties, nucleobases, and/or
internucleoside linkages of a modified oligonucleotide define a
pattern or motif. In certain embodiments, the patterns of sugar
moieties, nucleobases, and internucleoside linkages are each
independent of one another. Thus, a modified oligonucleotide may be
described by its sugar motif, nucleobase motif and/or
internucleoside linkage motif (as used herein, nucleobase motif
describes the modifications to the nucleobases independent ofthe
sequence of nucleobases).
[0303] 1. Certain Sugar Motifs
[0304] In certain embodiments, compounds described herein comprise
oligonucleotides. In certain embodiments, oligonucleotides comprise
one or more type of modified sugar and/or unmodified sugar moiety
arranged along the oligonucleotide or region thereof in a defined
pattern or sugar motif. In certain instances, such sugar motifs
include but are not limited to any of the sugar modifications
discussed herein.
[0305] In certain embodiments, modified oligonucleotides comprise
or consist of a region having a gapmer motif, which comprises two
external regions or "wings" and a central or internal region or
"gap." The three regions of a gapmer motif (the 5'-wing, the gap,
and the 3'-wing) form a contiguous sequence of nucleosides wherein
at least some of the sugar moieties of the nucleosides of each of
the wings differ from at least some of the sugar moieties of the
nucleosides of the gap. Specifically, at least the sugar moieties
of the nucleosides of each wing that are closest to the gap (the
3'-most nucleoside of the 5'-wing and the 5'-most nucleoside of the
3'-wing) differ from the sugar moiety of the neighboring gap
nucleosides, thus defining the boundary between the wings and the
gap (i.e., the wing/gap junction). In certain embodiments, the
sugar moieties within the gap are the same as one another. In
certain embodiments, the gap includes one or more nucleoside having
a sugar moiety that differs from the sugar moiety of one or more
other nucleosides of the gap. In certain embodiments, the sugar
motifs of the two wings are the same as one another (symmetric
gapmer). In certain embodiments, the sugar motif of the 5'-wing
differs from the sugar motif of the 3'-wing (asymmetric
gapmer).
[0306] In certain embodiments, the wings of a gapmer comprise 1-5
nucleosides. In certain embodiments, the wings of a gapmer comprise
2-5 nucleosides. In certain embodiments, the wings of a gapmer
comprise 3-5 nucleosides. In certain embodiments, the nucleosides
of a gapmer are all modified nucleosides.
[0307] In certain embodiments, the gap of a gapmer comprises 7-12
nucleosides. In certain embodiments, the gap of a gapmer comprises
7-10 nucleosides. In certain embodiments, the gap of a gapmer
comprises 8-10 nucleosides. In certain embodiments, the gap of a
gapmer comprises 10 nucleosides. In certain embodiment, each
nucleoside of the gap of a gapmer is an unmodified 2'-deoxy
nucleoside.
[0308] In certain embodiments, the gapmer is a deoxy gapmer. In
such embodiments, the nucleosides on the gap side of each wing/gap
junction are unmodified 2'-deoxy nucleosides and the nucleosides on
the wing sides of each wing/gap junction are modified nucleosides.
In certain such embodiments, each nucleoside of the gap is an
unmodified 2'-deoxy nucleoside. In certain such embodiments, each
nucleoside of each wing is a modified nucleoside.
[0309] In certain embodiments, a modified oligonucleotide has a
fully modified sugar motif wherein each nucleoside of the modified
oligonucleotide comprises a modified sugar moiety. In certain
embodiments, modified oligonucleotides comprise or consist of a
region having a fully modified sugar motif wherein each nucleoside
of the region comprises a modified sugar moiety. In certain
embodiments, modified oligonucleotides comprise or consist of a
region having a fully modified sugar motif, wherein each nucleoside
within the fully modified region comprises the same modified sugar
moiety, referred to herein as a uniformly modified sugar motif. In
certain embodiments, a fully modified oligonucleotide is a
uniformly modified oligonucleotide. In certain embodiments, each
nucleoside of a uniformly modified comprises the same
2'-modification.
[0310] 2. Certain Nucleobase Motifs
[0311] In certain embodiments, compounds described herein comprise
oligonucleotides. In certain embodiments, oligonucleotides comprise
modified and/or unmodified nucleobases arranged along the
oligonucleotide or region thereof in a defined pattern or motif. In
certain embodiments, each nucleobase is modified. In certain
embodiments, none of the nucleobases are modified. In certain
embodiments, each purine or each pyrimidine is modified. In certain
embodiments, each adenine is modified. In certain embodiments, each
guanine is modified. In certain embodiments, each thymine is
modified. In certain embodiments, each uracil is modified. In
certain embodiments, each cytosine is modified. In certain
embodiments, some or all of the cytosine nucleobases in a modified
oligonucleotide are 5-methylcytosines.
[0312] In certain embodiments, modified oligonucleotides comprise a
block of modified nucleobases. In certain such embodiments, the
block is at the 3'-end of the oligonucleotide. In certain
embodiments the block is within 3 nucleosides of the 3'-end of the
oligonucleotide. In certain embodiments, the block is at the 5'-end
of the oligonucleotide. In certain embodiments the block is within
3 nucleosides of the 5'-end of the oligonucleotide.
[0313] In certain embodiments, oligonucleotides having a gapmer
motif comprise a nucleoside comprising a modified nucleobase. In
certain such embodiments, one nucleoside comprising a modified
nucleobase is in the central gap of an oligonucleotide having a
gapmer motif. In certain such embodiments, the sugar moiety of said
nucleoside is a 2'-deoxyribosyl moiety. In certain embodiments, the
modified nucleobase is selected from: a 2-thiopyrimidine and a
5-propynepyrimidine.
[0314] 3. Certain Internucleoside Linkage Motifs
[0315] In certain embodiments, compounds described herein comprise
oligonucleotides. In certain embodiments, oligonucleotides comprise
modified and/or unmodified internucleoside linkages arranged along
the oligonucleotide or region thereof in a defined pattern or
motif. In certain embodiments, essentially each internucleoside
linking group is a phosphate internucleoside linkage (P.dbd.O). In
certain embodiments, each internucleoside linking group of a
modified oligonucleotide is a phosphorothioate (P.dbd.S). In
certain embodiments, each internucleoside linking group of a
modified oligonucleotide is independently selected from a
phosphorothioate and phosphate internucleoside linkage. In certain
embodiments, the sugar motif of a modified oligonucleotide is a
gapmer and the internucleoside linkages within the gap are all
modified. In certain such embodiments, some or all of the
internucleoside linkages in the wings are unmodified phosphate
linkages. In certain embodiments, the terminal internucleoside
linkages are modified.
[0316] 5. Certain Modified Oligonucleotides
[0317] In certain embodiments, compounds described herein comprise
modified oligonucleotides. In certain embodiments, the above
modifications (sugar, nucleobase, internucleoside linkage) are
incorporated into a modified oligonucleotide. In certain
embodiments, modified oligonucleotides are characterized by their
modification, motifs, and overall lengths. In certain embodiments,
such parameters are each independent of one another. Thus, unless
otherwise indicated, each internucleoside linkage of an
oligonucleotide having a gapmer sugar motif may be modified or
unmodified and may or may not follow the gapmer modification
pattern of the sugar modifications. For example, the
internucleoside linkages within the wing regions of a sugar gapmer
may be the same or different from one another and may be the same
or different from the internucleoside linkages of the gap region of
the sugar motif. Likewise, such gapmer oligonucleotides may
comprise one or more modified nucleobase independent of the gapmer
pattern of the sugar modifications. Furthermore, in certain
instances, an oligonucleotide is described by an overall length or
range and by lengths or length ranges of two or more regions (e.g.,
a regions of nucleosides having specified sugar modifications), in
such circumstances it may be possible to select numbers for each
range that result in an oligonucleotide having an overall length
falling outside the specified range. In such circumstances, both
elements must be satisfied. For example, in certain embodiments, a
modified oligonucleotide consists of 15-20 linked nucleosides and
has a sugar motif consisting of three regions, A, B, and C, wherein
region A consists of 2-6 linked nucleosides having a specified
sugar motif, region B consists of 6-10 linked nucleosides having a
specified sugar motif, and region C consists of 2-6 linked
nucleosides having a specified sugar motif. Such embodiments do not
include modified oligonucleotides where A and C each consist of 6
linked nucleosides and B consists of 10 linked nucleosides (even
though those numbers of nucleosides are permitted within the
requirements for A, B, and C) because the overall length of such
oligonucleotide is 22, which exceeds the upper limit of the overall
length of the modified oligonucleotide (20). Herein, if a
description of an oligonucleotide is silent with respect to one or
more parameter, such parameter is not limited. Thus, a modified
oligonucleotide described only as having a gapmer sugar motif
without further description may have any length, internucleoside
linkage motif, and nucleobase motif. Unless otherwise indicated,
all modifications are independent of nucleobase sequence.
Certain Conjugated Compounds
[0318] In certain embodiments, the compounds described herein
comprise or consist of an oligonucleotide (modified or unmodified)
and optionally one or more conjugate groups and/or terminal groups.
Conjugate groups consist of one or more conjugate moiety and a
conjugate linker which links the conjugate moiety to the
oligonucleotide. Conjugate groups may be attached to either or both
ends of an oligonucleotide and/or at any internal position. In
certain embodiments, conjugate groups are attached to the
2'-position of a nucleoside of a modified oligonucleotide. In
certain embodiments, conjugate groups that are attached to either
or both ends of an oligonucleotide are terminal groups. In certain
such embodiments, conjugate groups or terminal groups are attached
at the 3' and/or 5'-end of oligonucleotides. In certain such
embodiments, conjugate groups (or terminal groups) are attached at
the 3'-end of oligonucleotides. In certain embodiments, conjugate
groups are attached near the 3'-end of oligonucleotides. In certain
embodiments, conjugate groups (or terminal groups) are attached at
the 5'-end of oligonucleotides. In certain embodiments, conjugate
groups are attached near the 5'-end of oligonucleotides.
[0319] Examples of terminal groups include but are not limited to
conjugate groups, capping groups, phosphate moieties, protecting
groups, modified or unmodified nucleosides, and two or more
nucleosides that are independently modified or unmodified.
GLP-1 Receptor Ligand Conjugate Moieties
[0320] In certain embodiments, a compound comprises an
oligonucleotide and GLP-1 receptor ligand conjugate moiety. In
certain embodiments, a compound comprises an oligonucleotide,
conjugate linker, and GLP-1 receptor ligand conjugate moiety. In
certain embodiments, the conjugate linker links the GLP-1 receptor
ligand conjugate moiety to the oligonucleotide. In certain
embodiments, the oligonucleotide is a modified oligonucleotide. In
certain embodiments, the GLP-1 receptor ligand conjugate moiety
comprises a small molecule, aptamer, antibody, or peptide.
[0321] 1. Certain GLP-1 Receptor Small Molecule Conjugate
Moieties
[0322] In certain embodiments, a compound comprises an
oligonucleotide and a small molecule conjugate moiety capable of
binding to GLP-1 receptor. In certain embodiments, a compound
comprises an oligonucleotide, conjugate linker, and small molecule
conjugate moiety capable of binding to GLP-1 receptor. In certain
embodiments, the oligonucleotide is a modified oligonucleotide.
[0323] Any small molecule conjugate moiety capable of binding to
GLP-1 receptor known in the art can be used in several embodiments.
For example, in certain embodiments the small molecule conjugate
moiety capable of binding to GLP-1 receptor is a small molecule
GLP-1 receptor antagonist described in Willard et al., "Small
Molecule Drug Discovery at the Glucagon-like Peptide-1 Receptor,"
Experimental Diabetes Research Vol. 2012 pgs. 1-9; Sloop et al.,
"Novel Small Molecule Glucagon-Like Peptide-1 Receptor Agonist
Stimulates Insulin Secretion in Rodents and From Human Islets,"
Diabetes Vol, 59, 2010 pgs. 3099-3107; Knudsen et al.,
"Small-molecule agonists for the glucagon-like peptide 1 receptor,"
PNAS 2007 Jan. 16; 104(3):937-42; or Wang et al., "Non-peptidic
glucose-like peptide-1 receptor agonists: aftermath of a
serendipitous discovery," Acta Pharmacologica Sinica (2010) 31:
1026-1030; which are incorporated by reference herein in their
entireties.
[0324] In certain embodiments, the small molecule conjugate moiety
capable of binding to GLP-1 receptor has any of the following
formulas:
##STR00023## ##STR00024## ##STR00025## ##STR00026##
[0325] 2. Certain GLP-1 Receptor Antibody Conjugate Moieties
[0326] In certain embodiments, a compound comprises an
oligonucleotide and an antibody or fragment thereof capable of
binding to GLP-1 receptor. In certain embodiments, a compound
comprises an oligonucleotide, conjugate linker, and an antibody or
fragment thereof capable of binding to GLP-1 receptor. In certain
embodiments, the oligonucleotide is a modified oligonucleotide. Any
antibody or fragment thereof capable of binding to GLP-1 receptor
known in the art can be used in several embodiments. In certain
embodiments, a compound comprises an oligonucleotide and an
antibody or fragment thereof capable of binding to GLP-1 receptor
described in WO 2005018536, US 20060275288, U.S. Pat. No.
8,389,689, or WO2011056644, which are incorporated by reference
herein in their entireties. In certain embodiments, a compound
comprises an oligonucleotide, a conjugate linker, and an antibody
or fragment thereof capable of binding to GLP-1 receptor described
in WO 2005018536, US 20060275288, U.S. Pat. No. 8,389,689, or
WO2011056644, which are incorporated by reference herein in their
entireties.
[0327] 3. Certain GLP-1 Peptide Conjugate Moieties
[0328] In certain embodiments, a compound comprises an
oligonucleotide and a GLP-1 peptide or fragment or mutant thereof.
In certain embodiments, a compound comprises an oligonucleotide,
conjugate linker, and GLP-1 peptide or fragment or mutant thereof.
In certain embodiments, the oligonucleotide is a modified
oligonucleotide. Any GLP-1 peptide or fragment or mutant thereof
known in the art can be used in several embodiments. In certain
embodiments, a compound comprises an oligonucleotide and a GLP-1
peptide described in US 20140206607; U.S. Pat. Nos. 9,187,522;
8,329,419; or WO 2007/124461, which are incorporated by reference
herein in their entireties. In certain embodiments, a compound
comprises an oligonucleotide, conjugate linker, and GLP-1 peptide
described in US 20140206607; U.S. Pat. Nos. 9,187,522; 8,329,419;
or WO 2007/124461, which are incorporated by reference herein in
their entireties.
[0329] In certain embodiments, a compound comprises an
oligonucleotide and a GLP-1 peptide conjugate moiety comprising an
at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22,
23, 24, 25, 26, 27, 28, 29, 30, or 31 contiguous amino acid portion
at least 60%, at least 65%, at least 70%, at least 75%, at least
80%, at least 85%, at least 90%, at least 95%, or 100% homologous
to an equal length portion of the amino acid sequence of
GLP-1(7-37): HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, which in conventional
three-letter code is:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly (SEQ ID NO: 1).
In certain embodiments, a compound comprises an oligonucleotide and
a GLP-1 peptide conjugate moiety comprising an at least 8, 9, 10,
11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27,
28, 29, 30, or 31 contiguous amino acid portion at least 60%, at
least 65%, at least 70%, at least 75%, at least 80%, at least 85%,
at least 90%, at least 95%, or 100% homologous to an equal length
portion of the amino acid sequence of GLP-1(7-37):
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH.sub.2 (SEQ ID NO: 1), wherein
NH.sub.2 indicates the C-terminal amide.
[0330] In certain embodiments, a compound comprises an
oligonucleotide, conjugate linker, and a GLP-1 peptide conjugate
moiety comprising an at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17,
18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or 31
contiguous amino acid portion at least 60%, at least 65%, at least
70%, at least 75%, at least 80%, at least 85%, at least 90%, at
least 95%, or 100% homologous to an equal length portion of the
amino acid sequence of GLP-1(7-37):
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, which in conventional three-letter
code is:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly (SEQ ID NO: 1).
In certain embodiments, a compound comprises an oligonucleotide,
conjugate linker, and a GLP-1 peptide conjugate moiety comprising
an at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21,
22, 23, 24, 25, 26, 27, 28, 29, 30, or 31 contiguous amino acid
portion at least 60%, at least 65%, at least 70%, at least 75%, at
least 80%, at least 85%, at least 90%, at least 95%, or 100%
homologous to an equal length portion of the amino acid sequence of
GLP-1(7-37): HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH.sub.2 (SEQ ID NO:
1), wherein NH.sub.2 indicates the C-terminal amide.
[0331] In certain embodiments, a compound comprises an
oligonucleotide and a GLP-1 peptide conjugate moiety comprising an
at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22,
23, 24, 25, 26, 27, 28, 29, 30, or 31 contiguous amino acid portion
at least 60%, at least 65%, at least 70%, at least 75%, at least
80%, at least 85%, at least 90%, at least 95%, or 100% identical to
an equal length portion of the amino acid sequence of GLP-1(7-37).
In certain embodiments, a compound comprises an oligonucleotide,
conjugate linker, and a GLP-1 peptide conjugate moiety comprising
an at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21,
22, 23, 24, 25, 26, 27, 28, 29, 30, or 31 contiguous amino acid
portion at least 60%, at least 65%, at least 70%, at least 75%, at
least 80%, at least 85%, at least 90%, at least 95%, or 100%
identical to an equal length portion of the amino acid sequence of
GLP-1(7-37).
[0332] In certain embodiments, a compound comprises an
oligonucleotide and a GLP-1 peptide conjugate moiety 8 to 50 amino
acids in length that is at least 60%, at least 65%, at least 70%,
at least 75%, at least 80%, at least 85%, at least 90%, at least
95%, or 100% homologous over its entire length to the amino acid
sequence of GLP-1(7-37) (SEQ ID NO: 1). In certain embodiments, a
compound comprises an oligonucleotide, conjugate linker, and a
GLP-1 peptide conjugate moiety 8 to 50 amino acids in length that
is at least 60%, at least 65%, at least 70%, at least 75%, at least
80%, at least 85%, at least 90%, at least 95%, or 100% homologous
over its entire length to the amino acid sequence of GLP-1(7-37)
(SEQ ID NO: 1).
[0333] In certain embodiments, a compound comprises an
oligonucleotide and a GLP-1 peptide conjugate moiety 8 to 50 amino
acids in length that is at least 60%, at least 65%, at least 70%,
at least 75%, at least 80%, at least 85%, at least 90%, at least
95%, or 100% identical over its entire length to the amino acid
sequence of GLP-1(7-37) (SEQ ID NO: 1). In certain embodiments, a
compound comprises an oligonucleotide, conjugate linker, and a
GLP-1 peptide conjugate moiety 8 to 50 amino acids in length that
is at least 60%, at least 65%, at least 70%, at least 75%, at least
80%, at least 85%, at least 90%, at least 95%, or 100% identical
over its entire length to the amino acid sequence of GLP-1(7-37)
(SEQ ID NO: 1).
[0334] In certain embodiments, a compound comprises an
oligonucleotide and a GLP-1 peptide conjugate moiety comprising the
amino acid sequence of GLP-1(7-37) (SEQ ID NO: 1). In certain
embodiments, a compound comprises an oligonucleotide, conjugate
linker, and a GLP-1 peptide conjugate moiety comprising the amino
acid sequence of GLP-1(7-37) (SEQ ID NO: 1).
[0335] In certain embodiments, a compound comprises an
oligonucleotide and a GLP-1 peptide conjugate moiety consisting of
the amino acid sequence of GLP-1(7-37) (SEQ ID NO: 1). In certain
embodiments, a compound comprises an oligonucleotide, conjugate
linker, and a GLP-1 peptide conjugate moiety consisting of the
amino acid sequence of GLP-1(7-37) (SEQ ID NO: 1).
[0336] In certain embodiments, a compound comprises an
oligonucleotide and a GLP-1 peptide conjugate moiety comprising the
amino acid sequence of GLP-1(7-36)amide:
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH.sub.2, which in conventional
three-letter code is:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH.sub.2 (SEQ ID NO:
2). In certain embodiments, a compound comprises an
oligonucleotide, conjugate linker, and a GLP-1 peptide conjugate
moiety comprising the amino acid sequence of GLP-1(7-36)amide:
HAEGTFTSDV SSYLEGQAAKEFIAWLVKGR-NH.sub.2, which in conventional
three-letter code is:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH.sub.2 (SEQ ID NO:
2). In certain embodiments, a compound comprises an oligonucleotide
and a GLP-1 peptide conjugate moiety comprising the amino acid
sequence of GLP-1(7-36): HAEGTFTSDV SSYLEGQAAKEFIAWLVKGR, which in
conventional three-letter code is:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg (SEQ ID NO: 2). In
certain embodiments, a compound comprises an oligonucleotide,
conjugate linker, and a GLP-1 peptide conjugate moiety comprising
the amino acid sequence of GLP-1(7-36): HAEGTFTSDV
SSYLEGQAAKEFIAWLVKGR, which in conventional three-letter code is:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg (SEQ ID NO: 2).
[0337] In certain embodiments, a compound comprises an
oligonucleotide and a GLP-1 peptide conjugate moiety consisting of
the amino acid sequence of GLP-1(7-36)amide (SEQ ID NO: 2). In
certain embodiments, a compound comprises an oligonucleotide,
conjugate linker, and a GLP-1 peptide conjugate moiety consisting
of the amino acid sequence of GLP-1(7-36)amide (SEQ ID NO: 2). In
certain embodiments, a compound comprises an oligonucleotide and a
GLP-1 peptide conjugate moiety consisting of the amino acid
sequence of GLP-1(7-36) (SEQ ID NO: 2). In certain embodiments, a
compound comprises an oligonucleotide, conjugate linker, and a
GLP-1 peptide conjugate moiety consisting of the amino acid
sequence of GLP-1(7-36) (SEQ ID NO: 2).
[0338] In certain embodiments, a compound comprises an
oligonucleotide and a GLP-1 peptide conjugate moiety comprising the
amino acid sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKG, which in
conventional three-letter code is:
Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-G-
lu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly (SEQ ID NO: 3). In certain
embodiments, a compound comprises an oligonucleotide and a GLP-1
peptide conjugate moiety comprising the amino acid sequence:
EGTFTSDVSSYLEGQAAKEFIAWLVKG-NH.sub.2 (SEQ ID NO: 3), wherein
NH.sub.2 indicates the C-terminal amide. In certain embodiments, a
compound comprises an oligonucleotide, conjugate linker, and a
GLP-1 peptide conjugate moiety comprising the amino acid sequence:
EGTFTSDVSSYLEGQAAKEFIAWLVKG, which in conventional three-letter
code is:
Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-G-
lu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly (SEQ ID NO: 3). In certain
embodiments, a compound comprises an oligonucleotide, conjugate
linker, and a GLP-1 peptide conjugate moiety comprising the amino
acid sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKG-NH.sub.2 (SEQ ID NO: 3),
wherein NH.sub.2 indicates the C-terminal amide.
[0339] In certain embodiments, a compound comprises an
oligonucleotide and a GLP-1 peptide conjugate moiety consisting of
the amino acid sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKG, which in
conventional three-letter code is:
Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-G-
lu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly (SEQ ID NO: 3). In certain
embodiments, a compound comprises an oligonucleotide and a GLP-1
peptide conjugate moiety consisting of the amino acid sequence:
EGTFTSDVSSYLEGQAAKEFIAWLVKG-NH.sub.2 (SEQ ID NO: 3), wherein
NH.sub.2 indicates the C-terminal amide. In certain embodiments, a
compound comprises an oligonucleotide, conjugate linker, and a
GLP-1 peptide conjugate moiety consisting of the amino acid
sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKG, which in conventional
three-letter code is:
Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-G-
lu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly (SEQ ID NO: 3). In certain
embodiments, a compound comprises an oligonucleotide, conjugate
linker, and a GLP-1 peptide conjugate moiety consisting of the
amino acid sequence: EGTFTSDVSSYLEGQAAKEFIAWLVKG-NH.sub.2 (SEQ ID
NO: 3), wherein NH.sub.2 indicates the C-terminal amide.
[0340] In certain embodiments, a compound comprises an
oligonucleotide and a GLP-1 peptide conjugate moiety comprising the
amino acid sequence: EGTFTSDVSSYLEEQAAKEFIAWLVKG, which in
conventional three-letter code is:
Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-G-
lu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly (SEQ ID NO: 4). In certain
embodiments, a compound comprises an oligonucleotide and a GLP-1
peptide conjugate moiety comprising the amino acid sequence:
EGTFTSDVSSYLEEQAAKEFIAWLVKG-NH.sub.2 (SEQ ID NO: 4), wherein
NH.sub.2 indicates the C-terminal amide. In certain embodiments, a
compound comprises an oligonucleotide, conjugate linker, and a
GLP-1 peptide conjugate moiety comprising the amino acid sequence:
EGTFTSDVSSYLEEQAAKEFIAWLVKG, which in conventional three-letter
code is:
Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-G-
lu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly (SEQ ID NO: 4). In certain
embodiments, a compound comprises an oligonucleotide, conjugate
linker, and a GLP-1 peptide conjugate moiety comprising the amino
acid sequence: EGTFTSDVSSYLEEQAAKEFIAWLVKG-NH.sub.2 (SEQ ID NO: 4),
wherein NH.sub.2 indicates the C-terminal amide.
[0341] In certain embodiments, a compound comprises an
oligonucleotide and a GLP-1 peptide conjugate moiety consisting of
the amino acid sequence: EGTFTSDVSSYLEEQAAKEFIAWLVKG, which in
conventional three-letter code is:
Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-G-
lu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly (SEQ ID NO: 4). In certain
embodiments, a compound comprises an oligonucleotide and a GLP-1
peptide conjugate moiety consisting of the amino acid sequence:
EGTFTSDVSSYLEEQAAKEFIAWLVKG-NH.sub.2 (SEQ ID NO: 4), wherein
NH.sub.2 indicates the C-terminal amide. In certain embodiments, a
compound comprises an oligonucleotide, conjugate linker, and a
GLP-1 peptide conjugate moiety consisting of the amino acid
sequence: EGTFTSDVSSYLEEQAAKEFIAWLVKG, which in conventional
three-letter code is:
Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-G-
lu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly (SEQ ID NO: 4). In certain
embodiments, a compound comprises an oligonucleotide, conjugate
linker, and a GLP-1 peptide conjugate moiety consisting of the
amino acid sequence: EGTFTSDVSSYLEEQAAKEFIAWLVKG-NH.sub.2 (SEQ ID
NO: 4), wherein NH.sub.2 indicates the C-terminal amide.
[0342] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and an analog of
GLP-1 peptide conjugate moiety including, but not limited to,
liraglutide (VICTOZA.RTM. from Novo Nordisk); albiglutide
(SYNCRIA.RTM. from GlaxoSmithKline); taspoglutide (Hoffman
La-Roche); LY2189265 (Eli Lilly and Company); LY2428757 (Eli Lilly
and Company);
desamino-His7,Arg26,Lys34-((n.epsilon.(.gamma.-Glu(N-.alpha.-hexadecanoyl-
)))-GLP-1(7-37);
desamino-His7,Arg26,Lys34(n.epsilon.-octanoyl)-GLP-1(7-37);
Arg26,34,Lys38(N.epsilon.-(.OMEGA.-carboxypentadecanoyl)-GLP-1(7-38);
Arg26,34,Lys36(N.epsilon.-(.gamma.-Glu(N-.alpha.-hexadecanoyl)))-GLP-1(7--
36); Aib8.35,Arg26,34, Phe31-GLP-1 (7-36)) (SEQ ID NO: 5);
HXaa8EGTFTSDVSSYLEXaa22Xaa23AAKEFIXaa30WLXaa33Xaa34G Xaa36Xaa37;
wherein Xaa8 is A, V, or G; Xaa22 is G, K, or E; Xaa23 is Q or K;
Xaa30 is A or E; Xaa33 is V or K; Xaa34 is K, N, or R; Xaa36 is R
or G; and Xaa37 is G, H, P, or absent (SEQ ID NO: 6); Arg34-GLP-1
(7-37) (SEQ ID NO: 7); Glu30-GLP-1 (7-37) (SEQ ID NO: 8);
Lys22-GLP-1 (7-37) (SEQ ID NO: 9); Gly8.36,Glu22-GLP-1 (7-37) (SEQ
ID NO: 10); Val8,Glu22,Gly36-GLP-1 (7-37) (SEQ ID NO: 11);
Gly8.36,Glu22,Lys33,Asn34-GLP-1(7-37) (SEQ ID NO: 12);
Val8,Glu22,Lys33,Asn34,Gly36-GLP-1 (7-37) (SEQ ID NO: 13);
Gly8.36,Glu22,Pro37-GLP-1 (7-37) (SEQ ID NO: 14);
Val8,Glu22,Gly36Pro37-GLP-1(7-37) (SEQ ID NO: 15);
Gly8.36,Glu22,Lys33, Asn34,Pro37-GLP-1(7-37) (SEQ ID NO: 16);
Val8,Glu22,Lys33,Asn34,Gly36Pro37-GLP-1(7-37) (SEQ ID NO: 17);
Gly8.36,Glu22-GLP-1(7-36) (SEQ ID NO: 18);
Val8,Glu22,Gly36-GLP-1(7-36) (SEQ ID NO: 19);
Val8,Glu22,Asn34,Gly36-GLP-1 (7-36) (SEQ ID NO: 20);
Gly8.36,Glu22,Asn34-GLP-1(7-36) (SEQ ID NO: 21). Any of the
foregoing analogs may optionally be amidated.
[0343] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and an analog of
GLP-1 peptide conjugate moiety including, but not limited to,
iraglutide, taspoglutide, exenatide, lixisenatide, semaglutide.
These analogs are described in Lorenz M et al., "Recent progress
and future options in the development of GLP-1 receptor agonists
for the treatment of diabesity," Bioorg Med Chem Lett. 2013 Jul.
15; 23(14):4011-8, which is incorporated by reference herein in its
entirety.
[0344] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: H-AibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAPPPSC-NH.sub.2 (SEQ
ID NO: 22), wherein Aib is aminoisobutyric acid and NH.sub.2
indicates the C-terminal amide. In certain embodiments, a compound
comprises an oligonucleotide, optionally a conjugate linker, and a
GLP-1 peptide conjugate moiety comprising or consisting of the
amino acid sequence:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Cys (SEQ ID NO: 22) wherein Aib is aminoisobutyric
acid.
[0345] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: H-AibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAPPPSX-NH.sub.2 (SEQ
ID NO: 23), wherein Aib is aminoisobutyric acid, X is
penicillamine, and NH.sub.2 indicates the C-terminal amide. In
certain embodiments, a compound comprises an oligonucleotide,
optionally a conjugate linker, and a GLP-1 peptide conjugate moiety
comprising or consisting of the amino acid sequence:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-
-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-A-
la-Pro-Pro-Pro-Ser-Pen (SEQ ID NO: 23), wherein Aib is
aminoisobutyric acid and Pen is penicillamine.
[0346] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRC, which in conventional
three-letter code is:
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-A-
la-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Cys (SEQ ID NO:
24). In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRC-NH.sub.2 (SEQ ID NO: 24),
wherein NH.sub.2 indicates the C-terminal amide.
[0347] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS (SEQ ID NO: 25).
In certain embodiments, a compound comprises an oligonucleotide,
optionally a conjugate linker, and a GLP-1 peptide conjugate moiety
comprising or consisting of the amino acid sequence:
H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-
-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-P-
ro-Pro-Ser-NH.sub.2 (SEQ ID NO: 25), wherein H indicates the
N-terminus and NH.sub.2 indicates the C-terminal amide.
[0348] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: AGEGTF TSDVSSYLEGQAAKEAIAWLVKGGPSSGAPPPSC, which in
conventional three-letter code is:
Ala-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly--
Gln-Ala-Ala-Lys-Glu-Ala-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Al-
a-Pro-Pro-Pro-Ser-Cys (SEQ ID NO: 26). In certain embodiments, a
compound comprises an oligonucleotide, optionally a conjugate
linker, and a GLP-1 peptide conjugate moiety comprising or
consisting of the amino acid sequence: AGEGTF
TSDVSSYLEGQAAKEAIAWLVKGGPSSGAPPPSC-NH.sub.2 (SEQ ID NO: 26),
wherein NH.sub.2 indicates the C-terminal amide.
[0349] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: AGEGTF TSDVSSYLEGQAAKEAIAWLVKGGPSSGAPPPSX, wherein X is
penicillamine, which in conventional three-letter code is:
Ala-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-A-
la-Lys-Glu-Ala-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Pen wherein Pen is penacillamine (SEQ ID NO: 27). In
certain embodiments, a compound comprises an oligonucleotide,
optionally a conjugate linker, and a GLP-1 peptide conjugate moiety
comprising or consisting of the amino acid sequence:
AGEGTFTSDVSSYLEGQAAKEAIAWLVKGGPSSGAPPPSX-NH.sub.2 (SEQ ID NO: 27),
wherein X is penicillamine and NH.sub.2 indicates the C-terminal
amide.
[0350] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLV, which in conventional
three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-A-
la-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val (SEQ ID NO: 28), wherein Aib
is aminoisobutyric acid. In certain embodiments, a compound
comprises an oligonucleotide, optionally a conjugate linker, and a
GLP-1 peptide conjugate moiety comprising or consisting of the
amino acid sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLV-NH.sub.2 (SEQ ID
NO: 28), wherein Aib is aminoisobutyric acid and NH.sub.2 indicates
the C-terminal amide.
[0351] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVK, which in conventional
three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-A-
la-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys (SEQ ID NO: 29), wherein
Aib is aminoisobutyric acid. In certain embodiments, a compound
comprises an oligonucleotide, optionally a conjugate linker, and a
GLP-1 peptide conjugate moiety comprising or consisting of the
amino acid sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVK-NH.sub.2 (SEQ
ID NO: 29), wherein Aib is aminoisobutyric acid and NH.sub.2
indicates the C-terminal amide.
[0352] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVKG, which in conventional
three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-A-
la-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly (SEQ ID NO: 30),
wherein Aib is aminoisobutyric acid. In certain embodiments, a
compound comprises an oligonucleotide, optionally a conjugate
linker, and a GLP-1 peptide conjugate moiety comprising or
consisting of the amino acid sequence:
HAibEGTFTSDVSSYLEEQAAKEFIAWLVKG-NH.sub.2 (SEQ ID NO: 30), wherein
Aib is aminoisobutyric acid and NH.sub.2 indicates the C-terminal
amide.
[0353] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGG, which in conventional
three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-A-
la-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly (SEQ ID NO: 31),
wherein Aib is aminoisobutyric acid. In certain embodiments, a
compound comprises an oligonucleotide, optionally a conjugate
linker, and a GLP-1 peptide conjugate moiety comprising or
consisting of the amino acid sequence:
HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGG-NH.sub.2 (SEQ ID NO: 31), wherein
Aib is aminoisobutyric acid and NH.sub.2 indicates the C-terminal
amide.
[0354] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGP, which in conventional
three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu--
Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro (SEQ ID
NO: 32), wherein Aib is aminoisobutyric acid. In certain
embodiments, a compound comprises an oligonucleotide, optionally a
conjugate linker, and a GLP-1 peptide conjugate moiety comprising
or consisting of the amino acid sequence:
HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGP-NH.sub.2, (SEQ ID NO: 32),
wherein Aib is aminoisobutyric acid and NH.sub.2 indicates the
C-terminal amide.
[0355] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPS, which in conventional
three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu--
Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser
(SEQ ID NO: 33), wherein Aib is aminoisobutyric acid. In certain
embodiments, a compound comprises an oligonucleotide, optionally a
conjugate linker, and a GLP-1 peptide conjugate moiety comprising
or consisting of the amino acid sequence:
HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPS-NH.sub.2 (SEQ ID NO: 33),
wherein Aib is aminoisobutyric acid and NH.sub.2 indicates the
C-terminal amide.
[0356] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPSS, which in
conventional three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu--
Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser
(SEQ ID NO: 34), wherein Aib is aminoisobutyric acid. In certain
embodiments, a compound comprises an oligonucleotide, optionally a
conjugate linker, and a GLP-1 peptide conjugate moiety comprising
or consisting of the amino acid sequence:
HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPSS-NH.sub.2 (SEQ ID NO: 34),
wherein Aib is aminoisobutyric acid and NH.sub.2 indicates the
C-terminal amide.
[0357] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPS SG, which in
conventional three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu--
Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly
(SEQ ID NO: 35), wherein Aib is aminoisobutyric acid. In certain
embodiments, a compound comprises an oligonucleotide, optionally a
conjugate linker, and a GLP-1 peptide conjugate moiety comprising
or consisting of the amino acid sequence:
HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSG-NH.sub.2 (SEQ ID NO: 35),
wherein Aib is aminoisobutyric acid and NH.sub.2 indicates the
C-terminal amide.
[0358] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGA, which in
conventional three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu--
Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Al-
a (SEQ ID NO: 36), wherein Aib is aminoisobutyric acid. In certain
embodiments, a compound comprises an oligonucleotide, optionally a
conjugate linker, and a GLP-peptide conjugate moiety comprising or
consisting of the amino acid sequence:
HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGA-NH.sub.2 (SEQ ID NO: 36),
wherein Aib is aminoisobutyric acid and NH.sub.2 indicates the
C-terminal amide.
[0359] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAP, which in
conventional three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro
(SEQ ID NO: 37), wherein Aib is aminoisobutyric acid. In certain
embodiments, a compound comprises an oligonucleotide, optionally a
conjugate linker, and a GLP-1 peptide conjugate moiety comprising
or consisting of the amino acid sequence:
HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAP-NH.sub.2 (SEQ ID NO: 37),
wherein Aib is aminoisobutyric acid and NH.sub.2 indicates the
C-terminal amide.
[0360] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSZ, which in
conventional three-letter code is:
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-V-
al-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Zaa (SEQ ID NO: 38), wherein Z or Zaa is 4-azidonorleucine
comprising:
##STR00027##
[0361] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSZ-NH.sub.2 (SEQ ID
NO: 38), wherein NH.sub.2 indicates the C-terminal amide and Z or
Zaa is 4-azidonorleucine comprising:
##STR00028##
[0362] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEGQAAKEFIAWLVRGRGZ, which in conventional
three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly--
Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly-Zaa
(SEQ ID NO: 39), wherein Aib is aminoisobutyric acid and Z or Zaa
is 4-azidonorleucine comprising:
##STR00029##
[0363] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEGQAAKEFIAWLVRGRGZ-NH.sub.2 (SEQ ID NO:
39), wherein Aib is aminoisobutyric acid, NH.sub.2 indicates the
C-terminal amide, and Z or Zaa is 4-azidonorleucine comprising:
##STR00030##
[0364] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEGQAANXEFIAWLVRGRG, which in conventional
three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly--
Gln-Ala-Ala-Asn-Xaa-Glu-Phe-Ile-Ala-Trp-Leu-Val-Arg-Gly-Arg-Gly
(SEQ ID NO: 40), wherein Aib is aminoisobutyric acid and X or Xaa
is Lysine (5 azido pentanoic acid amide) having the formula:
##STR00031##
[0365] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEGQAANXEFIAWLVRGRG-NH.sub.2 (SEQ ID NO:
40), wherein Aib is aminoisobutyric acid, NH.sub.2 indicates the
C-terminal amide, and X or Xaa is Lysine (5 azido pentanoic acid
amide) having the formula:
##STR00032##
[0366] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEGQAAKEFIAWLVK-AibRZ, which in
conventional three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly--
Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Aib-Arg-Zaa (SEQ ID
NO: 41), wherein Aib is aminoisobutyric acid and Z or Zaa is
4-azidonorleucine comprising:
##STR00033##
[0367] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEGQAAKEFIAWLVK-AibRZ-NH.sub.2 (SEQ ID NO:
41), wherein Aib is aminoisobutyric acid, NH.sub.2 indicates the
C-terminal amide, and Z or Zaa is 4-azidonorleucine comprising:
##STR00034##
[0368] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HSEGTFTSDVSSYLEGQAAKEFIAWLVKGRZ, which in conventional
three-letter code is:
His-Ser-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-A-
la-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Zaa (SEQ ID NO:
42), wherein Z or Zaa is 4-azidonorleucine comprising:
##STR00035##
[0369] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HSEGTFTSDVSSYLEGQAAKEFIAWLVKGRZ-NH.sub.2 (SEQ ID NO: 42),
wherein NH.sub.2 indicates the C-terminal amide and Z or Zaa is
4-azidonorleucine comprising:
##STR00036##
[0370] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAPPZ, which in
conventional three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Zaa (SEQ ID NO: 43), wherein Aib is aminoisobutyric acid and Z or
Zaa is 4-azidonorleucine comprising:
##STR00037##
[0371] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAPPZ-NH.sub.2 (SEQ ID
NO: 43), wherein Aib is aminoisobutyric acid, NH.sub.2 indicates
the C-terminal amide, and Z or Zaa is 4-azidonorleucine
comprising:
##STR00038##
[0372] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSZ, which in
conventional three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu--
Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Zaa
(SEQ ID NO: 44), wherein Aib is aminoisobutyric acid and Z or Zaa
is 4-azidonorleucine comprising:
##STR00039##
[0373] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSZ-NH.sub.2 (SEQ ID NO:
44), wherein Aib is aminoisobutyric acid, NH.sub.2 indicates the
C-terminal amide, and Z or Zaa is 4-azidonorleucine comprising:
##STR00040##
[0374] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVKZ, which in conventional
three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-A-
la-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Zaa (SEQ ID NO: 45),
wherein Aib is aminoisobutyric acid and Z or Zaa is
4-azidonorleucine comprising:
##STR00041##
[0375] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVKZ-NH.sub.2 (SEQ ID NO: 45),
wherein Aib is aminoisobutyric acid, NH.sub.2 indicates the
C-terminal amide, and Z or Zaa is 4-azidonorleucine comprising:
##STR00042##
[0376] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVZ, which in conventional
three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-A-
la-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Zaa (SEQ ID NO: 46), wherein
Aib is aminoisobutyric acid and Z or Zaa is 4-azidonorleucine
comprising:
##STR00043##
[0377] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVZ-NH.sub.2 (SEQ ID NO: 46),
wherein Aib is aminoisobutyric acid, NH.sub.2 indicates the
C-terminal amide, and Z or Zaa is 4-azidonorleucine comprising:
##STR00044##
[0378] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVC, which in conventional
three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-A-
la-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Cys (SEQ ID NO: 47), wherein
Aib is aminoisobutyric acid.
[0379] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVC-NH.sub.2 (SEQ ID NO: 47),
wherein Aib is aminoisobutyric acid and NH.sub.2 indicates the
C-terminal amide.
[0380] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLZ, which in conventional
three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-A-
la-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Zaa (SEQ ID NO: 48), wherein Aib
is aminoisobutyric acid and Z or Zaa is 4-azidonorleucine
comprising:
##STR00045##
[0381] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLZ-NH.sub.2 (SEQ ID NO: 48),
wherein Aib is aminoisobutyric acid, NH.sub.2 indicates the
C-terminal amide, and Z or Zaa is 4-azidonorleucine comprising:
##STR00046##
[0382] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWZ, which in conventional
three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Zaa (SEQ ID NO: 49), wherein Aib is
aminoisobutyric acid and Z or Zaa is 4-azidonorleucine
comprising:
##STR00047##
[0383] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWZ-NH.sub.2 (SEQ ID NO: 49),
wherein Aib is aminoisobutyric acid, NH.sub.2 indicates the
C-terminal amide, and Z or Zaa is 4-azidonorleucine comprising:
##STR00048##
[0384] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAZ, which in conventional
three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Zaa (SEQ ID NO: 50), wherein Aib is aminoisobutyric acid and Z
or Zaa is 4-azidonorleucine comprising:
##STR00049##
[0385] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAZ-NH.sub.2 (SEQ ID NO: 50), wherein
Aib is aminoisobutyric acid, NH.sub.2 indicates the C-terminal
amide, and Z or Zaa is 4-azidonorleucine comprising:
##STR00050##
[0386] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGZ, which in conventional
three-letter code is:
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-A-
la-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Zaa (SEQ ID NO: 51),
wherein Z or Zaa is 4-azidonorleucine comprising:
##STR00051##
[0387] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGZ-NH.sub.2 (SEQ ID NO: 51),
wherein NH.sub.2 indicates the C-terminal amide, and Z or Zaa is
4-azidonorleucine comprising:
##STR00052##
[0388] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNZ, which in conventional
three-letter code is:
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-A-
la-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Zaa (SEQ ID NO: 52),
wherein Z or Zaa is 4-azidonorleucine comprising:
##STR00053##
[0389] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNZ-NH.sub.2 (SEQ ID NO: 52),
wherein NH.sub.2 indicates the C-terminal amide and Z or Zaa is
4-azidonorleucine comprising:
##STR00054##
[0390] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKZ, which in conventional
three-letter code is:
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-V-
al-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Zaa (SEQ ID NO: 53), wherein Z
or Zaa is 4-azidonorleucine comprising:
##STR00055##
[0391] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKZ-NH.sub.2 (SEQ ID NO: 53),
wherein NH.sub.2 indicates the C-terminal amide and Z or Zaa is
4-azidonorleucine comprising:
##STR00056##
[0392] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLZ, which in conventional
three-letter code is:
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-V-
al-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Zaa (SEQ ID NO: 54), wherein Z or
Zaa is 4-azidonorleucine comprising:
##STR00057##
[0393] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLZ-NH.sub.2 (SEQ ID NO: 54),
wherein NH.sub.2 indicates the C-terminal amide and Z or Zaa is
4-azidonorleucine comprising:
##STR00058##
[0394] In certain embodiments, a compound comprises an
oligonucleotide and a GLP-1 peptide conjugate moiety comprising or
consisting of the amino acid sequence: HGEGTFTSDLSKQMEEEAVRLFIEWZ,
which in conventional three-letter code is:
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-V-
al-Arg-Leu-Phe-Ile-Glu-Trp-Zaa (SEQ ID NO: 55), wherein Z or Zaa is
4-azidonorleucine comprising:
##STR00059##
[0395] In certain embodiments, a compound comprises an
oligonucleotide and a GLP-1 peptide conjugate moiety comprising or
consisting of the amino acid sequence:
HGEGTFTSDLSKQMEEEAVRLFIEWZ-NH.sub.2 (SEQ ID NO: 55), wherein
NH.sub.2 indicates the C-terminal amide and Z or Zaa is
4-azidonorleucine comprising:
##STR00060##
[0396] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAPPPSZ, which in
conventional three-letter code is:
His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-A-
la-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-
-Pro-Ser-Zaa (SEQ ID NO: 56), wherein Aib is aminoisobutyric acid
and Z or Zaa is 4-azidonorleucine comprising:
##STR00061##
[0397] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAPPPSZ-NH.sub.2 (SEQ
ID NO: 56), wherein Aib is aminoisobutyric acid, NH.sub.2 indicates
the C-terminal amide, and Z or Zaa is 4-azidonorleucine
comprising:
##STR00062##
[0398] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSC, which in
conventional three-letter code is:
TABLE-US-00001 (SEQ ID NO: 57)
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-
Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-
Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-
Pro-Pro-Ser-Cys.
[0399] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of the amino acid
sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSC-NH.sub.2 (SEQ ID
NO: 57), wherein NH.sub.2 indicates the C-terminal amide.
[0400] In certain embodiments, a compound comprises an
oligonucleotide and a GLP-1 peptide conjugate moiety comprising an
at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22,
23, 24, 25, 26, 27, 28, 29, 30, or 31 contiguous amino acid portion
at least 60%, at least 65%, at least 70%, at least 75%, at least
80%, at least 85%, at least 90%, at least 95%, or 100% identical to
an equal length portion of the amino acid sequence of any one of
SEQ ID NOs: 1-57. In certain embodiments, a compound comprises an
oligonucleotide, conjugate linker, and a GLP-1 peptide conjugate
moiety comprising an at least 8, 9, 10, 11, 12, 13, 14, 15, 16, 17,
18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or 31
contiguous amino acid portion at least 60%, at least 65%, at least
70%, at least 75%, at least 80%, at least 85%, at least 90%, at
least 95%, or 100% identical to an equal length portion of the
amino acid sequence of any one of SEQ ID NOs: 1-57.
[0401] In certain embodiments, a compound comprises an
oligonucleotide and a GLP-1 peptide conjugate moiety 8 to 50 amino
acids in length that is at least 60%, at least 65%, at least 70%,
at least 75%, at least 80%, at least 85%, at least 90%, at least
95%, or 100% homologous over its entire length to the amino acid
sequence of any one of SEQ ID NOs: 1-57. In certain embodiments, a
compound comprises an oligonucleotide, conjugate linker, and a
GLP-1 peptide conjugate moiety 8 to 50 amino acids in length that
is at least 60%, at least 65%, at least 70%, at least 75%, at least
80%, at least 85%, at least 90%, at least 95%, or 100% homologous
over its entire length to the amino acid sequence of any one of SEQ
ID NOs: 1-57.
[0402] In certain embodiments, a compound comprises an
oligonucleotide and a GLP-1 peptide conjugate moiety 8 to 50 amino
acids in length that is at least 60%, at least 65%, at least 70%,
at least 75%, at least 80%, at least 85%, at least 90%, at least
95%, or 100% identical over its entire length to the amino acid
sequence of any one of SEQ ID NOs: 1-57. In certain embodiments, a
compound comprises an oligonucleotide, conjugate linker, and a
GLP-1 peptide conjugate moiety 8 to 50 amino acids in length that
is at least 60%, at least 65%, at least 70%, at least 75%, at least
80%, at least 85%, at least 90%, at least 95%, or 100% identical
over its entire length to the amino acid sequence of any one of SEQ
ID NOs: 1-57.
[0403] In certain embodiments, a compound comprises an
oligonucleotide and a GLP-1 peptide conjugate moiety comprising an
amino acid sequence with 1, 2, 3, 4, 5, 6, 7 or 8 amino acid
substitutions, insertions, deletions, or a combination of two or
more thereof, when compared to the amino acid sequence of
GLP-1(7-37) (SEQ ID NO: 1). In certain embodiments, a compound
comprises an oligonucleotide, conjugate linker, and a GLP-1 peptide
conjugate moiety comprising an amino acid sequence with 1, 2, 3, 4,
5, 6, 7 or 8 amino acid substitutions, insertions, deletions, or a
combination of two or more thereof, when compared to the amino acid
sequence of GLP-1(7-37) (SEQ ID NO: 1).
[0404] In certain embodiments, a compound comprises an
oligonucleotide, optionally a conjugate linker, and a GLP-1 peptide
conjugate moiety comprising or consisting of an amino acid sequence
of any of SEQ ID NOs: 1-57. In certain embodiments, a compound
comprises an oligonucleotide and a GLP-1 peptide conjugate moiety
comprising an amino acid sequence with 1, 2, 3, 4, 5, 6, 7 or 8
amino acid substitutions, insertions, deletions, or a combination
of two or more thereof, when compared to the amino acid sequence of
any of SEQ ID NOs: 1-57. In certain embodiments, a compound
comprises an oligonucleotide, conjugate linker, and a GLP-1 peptide
conjugate moiety comprising an amino acid sequence with 1, 2, 3, 4,
5, 6, 7 or 8 amino acid substitutions, insertions, deletions, or a
combination of two or more thereof, when compared to the amino acid
sequence of any of SEQ ID NOs: 1-57.
[0405] In any of the embodiments above, the GLP-1 peptide conjugate
moiety may comprise a conservative amino acid substitution, an
amino acid analog, or an amino acid derivative. In certain
embodiments, the conservative amino acid substitution comprises
replacement of an aliphatic amino acid with another aliphatic amino
acid; replacement of a serine with a threonine or vice versa;
replacement of an acidic residue with another acidic residue;
replacement of a residue bearing an amide group with another
residue bearing an amide group; exchange of a basic residue with
another basic residue; or, replacement of an aromatic residue with
another aromatic residue, or a combination thereof, and the
aliphatic residue comprises Alanine, Valine, Leucine, Isoleucine or
a synthetic equivalent thereof; the acidic residue comprises
Aspartic acid, Glutamic acid or a synthetic equivalent thereof; the
residue comprising an amide group comprises Aspartic acid, Glutamic
acid or a synthetic equivalent thereof; the basic residue comprises
Lysine, Arginine or a synthetic equivalent thereof; or, the
aromatic residue comprises Phenylalanine, Tyrosine or a synthetic
equivalent thereof.
[0406] Additional GLP-1 peptide conjugate moieties or analogs that
may be used in embodiments provided herein are described in US
20140206607; U.S. Pat. No. 9,187,522; WO 2007/124461; WO
2014/096179; WO 2009/030738; WO 2016/055610; and U.S. Pat. No.
8,329,419, which are all incorporated by reference herein in their
entireties.
Conjugate Linkers
[0407] In certain embodiments, a conjugate linker links a GLP-1
receptor ligand conjugate moiety to an oligonucleotide. In certain
compounds, a GLP-1 receptor ligand conjugate moiety is attached to
an oligonucleotide via a conjugate linker through a single bond. In
certain embodiments, the conjugate linker comprises a chain
structure, such as a hydrocarbyl chain, or an oligomer of repeating
units such as ethylene glycol, nucleosides, or amino acid
units.
[0408] In certain embodiments, a conjugate linker comprises one or
more groups selected from alkyl, amino, oxo, amide, disulfide,
polyethylene glycol, ether, thioether, and hydroxylamino. In
certain such embodiments, the conjugate linker comprises groups
selected from alkyl, amino, oxo, amide and ether groups. In certain
embodiments, the conjugate linker comprises groups selected from
alkyl and amide groups. In certain embodiments, the conjugate
linker comprises groups selected from alkyl and ether groups. In
certain embodiments, the conjugate linker comprises at least one
phosphorus moiety. In certain embodiments, the conjugate linker
comprises at least one phosphate group. In certain embodiments, the
conjugate linker includes at least one neutral linking group.
[0409] In certain embodiments, conjugate linkers, including the
conjugate linkers described above, are bifunctional linking
moieties, e.g., those known in the art to be useful for attaching
conjugate groups to parent compounds, such as the oligonucleotides
provided herein. In general, a bifunctional linking moiety
comprises at least two functional groups. One of the functional
groups is selected to bind to a particular site on a compound and
the other is selected to bind to a conjugate group. Examples of
functional groups used in a bifunctional linking moiety include but
are not limited to electrophiles for reacting with nucleophilic
groups and nucleophiles for reacting with electrophilic groups. In
certain embodiments, bifunctional linking moieties comprise one or
more groups selected from amino, hydroxyl, carboxylic acid, thiol,
alkyl, alkenyl, and alkynyl.
[0410] Examples of conjugate linkers include but are not limited to
pyrrolidine, 8-amino-3,6-dioxaoctanoic acid (ADO), succinimidyl
4-(N-maleimidomethyl) cyclohexane-1-carboxylate (SMCC) and
6-aminohexanoic acid (AHEX or AHA). Other conjugate linkers include
but are not limited to substituted or unsubstituted
C.sub.1-C.sub.10 alkyl, substituted or unsubstituted
C.sub.2-C.sub.10 alkenyl or substituted or unsubstituted
C.sub.2-C.sub.10 alkynyl, wherein a nonlimiting list of preferred
substituent groups includes hydroxyl, amino, alkoxy, carboxy,
benzyl, phenyl, nitro, thiol, thioalkoxy, halogen, alkyl, aryl,
alkenyl and alkynyl.
[0411] In certain embodiments, conjugate linkers comprise 1-10
linker-nucleosides. In certain embodiments, such linker-nucleosides
are modified nucleosides. In certain embodiments such
linker-nucleosides comprise a modified sugar moiety. In certain
embodiments, linker-nucleosides are unmodified. In certain
embodiments, linker-nucleosides comprise an optionally protected
heterocyclic base selected from a purine, substituted purine,
pyrimidine or substituted pyrimidine. In certain embodiments, a
cleavable moiety is a nucleoside selected from uracil, thymine,
cytosine, 4-N-benzoylcytosine, 5-methylcytosine,
4-N-benzoyl-5-methylcytosine, adenine, 6-N-benzoyladenine, guanine
and 2-N-isobutyrylguanine. It is typically desirable for
linker-nucleosides to be cleaved from the compound after it reaches
a target tissue. Accordingly, linker-nucleosides are typically
linked to one another and to the remainder of the compound through
cleavable bonds. In certain embodiments, such cleavable bonds are
phosphodiester bonds.
[0412] Herein, linker-nucleosides are not considered to be part of
the oligonucleotide. Accordingly, in embodiments in which a
compound comprises an oligonucleotide consisting of a specified
number or range of linked nucleosides and/or a specified percent
complementarity to a reference nucleic acid and the compound also
comprises a conjugate group comprising a conjugate linker
comprising linker-nucleosides, those linker-nucleosides are not
counted toward the length of the oligonucleotide and are not used
in determining the percent complementarity of the oligonucleotide
for the reference nucleic acid. For example, a compound may
comprise (1) a modified oligonucleotide consisting of 8-30
nucleosides and (2) a conjugate group comprising 1-10
linker-nucleosides that are contiguous with the nucleosides of the
modified oligonucleotide. The total number of contiguous linked
nucleosides in such a compound is more than 30. Alternatively, an
compound may comprise a modified oligonucleotide consisting of 8-30
nucleosides and no conjugate group. The total number of contiguous
linked nucleosides in such a compound is no more than 30. Unless
otherwise indicated conjugate linkers comprise no more than 10
linker-nucleosides. In certain embodiments, conjugate linkers
comprise no more than 5 linker-nucleosides. In certain embodiments,
conjugate linkers comprise no more than 3 linker-nucleosides. In
certain embodiments, conjugate linkers comprise no more than 2
linker-nucleosides. In certain embodiments, conjugate linkers
comprise no more than 1 linker-nucleoside.
[0413] In certain embodiments, it is desirable for a conjugate
group to be cleaved from the oligonucleotide. For example, in
certain circumstances compounds comprising a particular conjugate
moiety are better taken up by a particular cell type, but once the
compound has been taken up, it is desirable that the conjugate
group be cleaved to release the unconjugated or parent
oligonucleotide. Thus, certain conjugate may comprise one or more
cleavable moieties, typically within the conjugate linker. In
certain embodiments, a cleavable moiety is a cleavable bond. In
certain embodiments, a cleavable moiety is a group of atoms
comprising at least one cleavable bond. In certain embodiments, a
cleavable moiety comprises a group of atoms having one, two, three,
four, or more than four cleavable bonds. In certain embodiments, a
cleavable moiety is selectively cleaved inside a cell or
subcellular compartment, such as a lysosome. In certain
embodiments, a cleavable moiety is selectively cleaved by
endogenous enzymes, such as nucleases.
[0414] In certain embodiments, a cleavable bond is selected from
among: an amide, an ester, an ether, one or both esters of a
phosphodiester, a phosphate ester, a carbamate, or a disulfide. In
certain embodiments, a cleavable bond is one or both of the esters
of a phosphodiester. In certain embodiments, a cleavable moiety
comprises a phosphate or phosphodiester. In certain embodiments,
the cleavable moiety is a phosphate linkage between an
oligonucleotide and a conjugate moiety or conjugate group.
[0415] In certain embodiments, a cleavable moiety comprises or
consists of one or more linker-nucleosides. In certain such
embodiments, one or more linker-nucleosides are linked to one
another and/or to the remainder of the compound through cleavable
bonds. In certain embodiments, such cleavable bonds are unmodified
phosphodiester bonds. In certain embodiments, a cleavable moiety is
2'-deoxy nucleoside that is attached to either the 3' or
5'-terminal nucleoside of an oligonucleotide by a phosphate
internucleoside linkage and covalently attached to the remainder of
the conjugate linker or conjugate moiety by a phosphate or
phosphorothioate linkage. In certain such embodiments, the
cleavable moiety is 2'-deoxyadenosine.
[0416] 1. Certain Hexylamino Linkers
[0417] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker selected from the following structures:
##STR00063##
[0418] wherein each n is independently selected from 0, 1, 2, 3, 4,
5, 6, or 7.
[0419] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker selected from the following structures:
##STR00064## ##STR00065## ##STR00066##
[0420] wherein each n is, independently from 1 to 20; and p is from
1 to 6.
[0421] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker selected from the following structures:
##STR00067## ##STR00068##
[0422] wherein each n is, independently, from 1 to 20.
[0423] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker selected from the following structures:
##STR00069## ##STR00070##
[0424] wherein each n is, independently, from 1 to 20.
[0425] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker selected from the following structures:
##STR00071## ##STR00072## ##STR00073##
[0426] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker selected from the following structures:
##STR00074## ##STR00075##
[0427] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker selected from the following structures:
##STR00076##
[0428] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker having the following structure:
##STR00077##
[0429] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker having the following structure:
##STR00078##
wherein X directly or indirectly attaches to the GLP-1 receptor
ligand conjugate moiety; and Y directly or indirectly attaches to
the modified oligonucleotide.
[0430] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by any conjugate linker described in WO 2014/179620, which is
incorporated by reference herein in its entirety.
[0431] 2. Certain Alkyl Phosphate Linkers
[0432] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker having the following structure:
##STR00079##
[0433] wherein:
[0434] the phosphate group is connected to the modified
oligonucleotide and Y is connected to the conjugate group;
[0435] Y is a phosphodiester or amino (--NH--) group;
[0436] Z is a pyrrolidinyl group having the formula:
##STR00080##
[0437] j is 0 or 1;
[0438] n is from about 1 to about 10;
[0439] p is from 1 to about 10;
[0440] m is 0 or from 1 to 4; and
[0441] when Y is amino then m is 1.
[0442] In certain embodiments, Y is amino (--NH--). In certain
embodiments, Y is a phosphodiester group. In certain embodiments, n
is 3 and p is 3. In certain embodiments, n is 6 and p is 6. In
certain embodiments, n is from 2 to 10 and p is from 2 to 10. In
certain embodiments, n and p are different. In certain embodiments,
n and p are the same. In certain embodiments, m is 0. In certain
embodiments, m is 1. In certain embodiments, j is 0. In certain
embodiments, j is 1 and Z has the formula:
##STR00081##
[0443] In certain embodiments, wherein n is 2 and p is 3. In
certain embodiments, n is 5 and p is 6.
[0444] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker having the following structure:
##STR00082##
wherein X directly or indirectly attaches to the GLP-1 receptor
ligand conjugate moiety; and wherein T.sub.1 comprises the modified
oligonucleotide; and Bx is a modified or unmodified nucleobase.
[0445] 3. Certain Click Chemistry Linkers
[0446] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker, wherein the conjugate linker is prepared
using Click chemistry known in the art. Compounds have been
prepared using Click chemistry wherein alkynyl phosphonate
internucleoside linkages on an oligomeric compound attached to a
solid support are converted into the 1,2,3-triazolylphosphonate
internucleoside linkages and then cleaved from the solid support
(Krishna et al., J. Am. Chem. Soc. 2012, 134(28), 11618-11631),
which is incorporated by reference herein in its entirety.
Additional linkers suitable for use in several embodiments can be
prepared by Click chemistry described in "Click Chemistry for
Biotechnology and Materials Science" Ed. Joerg Laham, Wiley 2009,
which is incorporated by reference herein in its entirety.
[0447] In certain embodiments, a Click reaction can be used to link
a GLP-1 receptor ligand conjugate moiety and an oligonucleotide by
reacting:
##STR00083##
with an oligonucleotide having a terminal amine, including but not
limited to the following compound:
##STR00084##
wherein Y is directly or indirectly attached to the
oligonucleotide, to yield:
##STR00085##
which can be reacted with a GLP-1 receptor ligand conjugate moiety
having an azide to yield:
##STR00086##
wherein N--N.dbd.N represents an azido group of the GLP-1 receptor
ligand conjugate moiety and X is directly or indirectly attached to
the remainder of the GLP-1 receptor ligand conjugate moiety.
[0448] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker, wherein the conjugate linker is prepared
from the following compound:
##STR00087##
[0449] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker, wherein the conjugate linker comprises:
##STR00088##
[0450] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker, wherein the conjugate linker comprises:
##STR00089##
[0451] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker, wherein the compound comprises:
##STR00090##
[0452] wherein N--N.dbd.N represents an azido group of the GLP-1
receptor ligand conjugate moiety and X directly or indirectly
attaches to the remainder of the GLP-1 receptor ligand conjugate
moiety; and
[0453] Y directly or indirectly attaches to the
oligonucleotide.
[0454] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker, wherein the compound comprises:
##STR00091##
[0455] wherein N--N.dbd.N represents an azido group of the GLP-1
receptor ligand conjugate moiety and X directly or indirectly
attaches to the remainder of the GLP-1 receptor ligand conjugate
moiety; and
[0456] Y directly or indirectly attaches to the
oligonucleotide.
[0457] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker, wherein the compound comprises:
##STR00092##
[0458] wherein N--N.dbd.N represents an azido group of the GLP-1
receptor ligand conjugate moiety and X directly or indirectly
attaches to the remainder of the GLP-1 receptor ligand conjugate
moiety; and
[0459] Y directly or indirectly attaches to the
oligonucleotide.
[0460] 4. Certain Maleimide Linkers
[0461] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker, wherein the conjugate linker comprises:
##STR00093##
[0462] X directly or indirectly attaches to the GLP-1 receptor
ligand conjugate moiety; and
[0463] Y directly or indirectly attaches to the
oligonucleotide.
[0464] In certain embodiments, the above conjugate linker can link
a peptide to an oligonucleotide. In certain embodiments, a compound
comprises an oligonucleotide linked to a peptide by a conjugate
linker, wherein the conjugate linker comprises:
##STR00094##
[0465] X directly or indirectly attaches to the peptide; and
[0466] Y directly or indirectly attaches to the
oligonucleotide.
[0467] 5. Certain Disulfide Linkages
[0468] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker, wherein the conjugate linker comprises a
disulfide linkage. In certain embodiments, oligonucleotides
comprise activated disulfides which form a disulfide linkage with a
GLP-1 peptide conjugate moiety. In certain embodiments, a compound
comprises an oligonucleotide comprising an activated disulfide
moiety capable of forming a cleavable or reversible bond with a
GLP-1 peptide conjugate moiety. In certain embodiments, a compound
comprises an oligonucleotide directly attached to a GLP-1 peptide
conjugate moiety by a disulfide bond without a conjugate
linker.
[0469] In certain embodiments, a compound comprises a linker
between an oligonucleotide and activated disulfide moiety. In
another embodiment, the activated disulfide moiety has the formula
--S--S(O)2-substituted or unsubstituted C1-C12 alkyl or
--S--S--C(O)O-substituted or unsubstituted C1-C12 alkyl. Preferred
activated disulfide moieties are methane thiosulfonate and
dithiocarbomethoxy. In further embodiments, the activated disulfide
is substituted or unsubstituted dithiopyridyl, substituted or
unsubstituted dithiobenzothiazolyl, or substituted or unsubstituted
dithiotetrazolyl. Preferred activated disulfides are
2-dithiopyridyl, 2-dithio-3-nitropyridyl, 2-dithio-5-nitropyridyl,
2-dithiobenzothiazolyl, N--(C1-C12 alkyl)-2-dithiopyridyl,
2-dithiopyridyl-N-oxide, or 2-dithio-1-methyl-1H-tetrazolyl.
[0470] In some embodiments, the activated disulfide moiety has the
formula --S--S(O).sub.n--R.sub.1, wherein [0471] n is 0, 1, or 2;
and [0472] R.sub.1 is selected from substituted or unsubstituted
heterocyclic, substituted or unsubstituted aliphatic, or
--C(O)O--R.sub.2, wherein R.sub.2 is substituted or unsubstituted
aliphatic.
[0473] In another embodiment, the activated disulfide moiety has
the formula --S--S(O).sub.2-substituted or unsubstituted
C.sub.1-C.sub.12 alkyl or --S--S--C(O)O-substituted or
unsubstituted C.sub.1-C.sub.12 alkyl. In certain embodiments,
activated disulfide moieties include methane thiosulfonate and
dithiocarbomethoxy. In further embodiments, the activated disulfide
can be substituted or unsubstituted dithiopyridyl, substituted or
unsubstituted dithiobenzothiazolyl, or substituted or unsubstituted
dithiotetrazolyl. Further examples of activated disulfides include
but are not limited to 2-dithiopyridyl, 2-dithio-3-nitropyridyl,
2-dithio-5-nitropyridyl, 2-dithiobenzothiazolyl,
N--(C.sub.1-C.sub.12 alkyl)-2-dithiopyridyl,
2-dithiopyridyl-N-oxide, and 2-dithio-1-methyl-1H-tetrazolyl.
[0474] In some embodiments, the bivalent linking group is a
bivalent substituted or unsubstituted aliphatic group. In another
embodiment, the bivalent linking group has the formula
-Q.sub.1-G-Q.sub.2-, wherein
[0475] Q.sub.1 and Q.sub.2 are independently absent or selected
from substituted or unsubstituted C.sub.1-C.sub.12 alkylene,
substituted or unsubstituted alkarylene or
--(CH.sub.2).sub.m--O--(CH.sub.2).sub.p--, wherein
[0476] each m and p are, independently, an integer from 1 to about
10;
[0477] G is --NH--C(O)--, --C(O)--NH--, --NH--C(O)--NH--,
--NH--C(S)--NH--, --NH--O--, NH--C(O)--O--, or
--O--CH.sub.2--C(O)--NH--.
[0478] Examples of bivalent linking groups include but are not
limited to:
##STR00095## ##STR00096##
[0479] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 peptide conjugate moiety by a
disulfide linkage described in U.S. Pat. No. 7,713,944, which is
incorporated by reference herein in its entirety. In certain
embodiments, a compound comprises an oligonucleotide linked to a
GLP-1 peptide conjugate moiety wherein the oligonucleotide
comprises an activated disulfide described in U.S. Pat. No.
7,713,944, which is incorporated by reference herein in its
entirety.
[0480] In certain embodiments, any of the above compounds
comprising an oligonucleotide linked to a GLP-1 peptide conjugate
moiety by a disulfide linkage, whether directly or by a conjugate
linker described herein, can comprise a disulfide linkage between a
cysteine, penicillamine, homocysteine, mercaptopropionic acid, or
.beta.-Mercapto-.beta.,.beta.,-cyclopentamethylene propionic acid
moiety of the GLP-1 peptide conjugate moiety and the
oligonucleotide or conjugate linker. In certain embodiments, a
compound comprises an oligonucleotide directly linked to a GLP-1
peptide conjugate moiety by a disulfide linkage. In certain
embodiments a compound comprises an oligonucleotide directly linked
to a GLP-1 peptide conjugate moiety by a disulfide linkage, wherein
the disulfide linkage is between the oligonucleotide and a a
cysteine, penicillamine, homocysteine, mercaptopropionic acid, or
.beta.-Mercapto-.beta.,.beta.,-cyclopentamethylene propionic acid
moiety of the GLP-1 peptide conjugate moiety. In certain
embodiments, a compound comprises an oligonucleotide, conjugate
linker, and GLP-1 peptide conjugate moiety wherein a disulfide
linkage links the conjugate linker and the GLP-1 peptide conjugate
moiety, and the oligonucleotide is attached to the conjugate
linker. In certain embodiments, a compound comprises an
oligonucleotide, conjugate linker, and GLP-1 peptide conjugate
moiety wherein a disulfide linkage links the conjugate linker to a
cysteine, penicillamine, homocysteine, mercaptopropionic acid, or
.beta.-Mercapto-.beta.,.beta.,-cyclopentamethylene propionic acid
moiety of the GLP-1 peptide conjugate moiety, and the
oligonucleotide is attached to the conjugate linker. In certain
embodiments, the cysteine, penicillamine, homocysteine,
mercaptopropionic acid, or
.beta.-Mercapto-.beta.,.beta.,-cyclopentamethylene propionic acid
moiety is at the N-terminus, C-terminus, side chain, or internal
amino acid position of the GLP-1 peptide conjugate moiety.
[0481] 6. Certain Enzyme Cleavable Linkages
[0482] In certain embodiments, a compound comprises an
oligonucleotide linked to a GLP-1 receptor ligand conjugate moiety
by a conjugate linker, wherein the conjugate linker comprises an
enzyme cleavable moiety. In certain embodiments, the GLP-1 receptor
ligand conjugate moiety is a GLP-1 peptide conjugate moiety. In
certain embodiments, the enzyme cleavable moiety is a peptide, such
as a dipeptide.
[0483] Enzymes known in the art for use in activating prodrugs can
be used to cleave an enzyme cleavable moiety provided in certain
embodiments. In certain embodiments, an enzyme cleavable moiety can
be cleaved by DT diaphorase, plasmin, carboxypeptidase G2,
thymidine kinase (viral), cytosine deaminase, glucose oxidase,
xanthine oxidase, carboxypeptidase A, .alpha.-galactosidase,
.beta.-glucosidase, azoreductase, .gamma.-glutamyltransferase,
.beta.-glucuronidase, .beta.-lactamase, alkaline phosphatase,
aminopeptidase, penicillin amidase or nitroreductase.
[0484] In certain embodiments, the enzyme cleavable moiety is
cleavable by a protease or peptidase. In certain embodiments, the
enzyme cleavable moiety is cleavable by a protease or peptidase
selected from: gastricsin, memapsin-2, chymosin, renin, renin-2,
cathepsin D, cathepsin E, penicillopepsin, rhizopuspepsin,
mucorpepsin, barrierpepsin, aspergillopepsin I, endothiapepsin,
saccharopepsin, phytepsin, plasmepsin-1, plasmepsin-2, yapsin-1,
yapsin-2, nepenthesin, memapsin-1, napsin A, HIV-1 retropepsin,
HIV-2 retropepsin, simian immunodeficiency virus retropepsin,
equine infectious anaemia virus retropepsin, feline
immunodeficiency virus retropepsin, murine leukemia virus-type
retropepsin, Mason-Pfizer leukemia virus retropepsin, human
endogenous retrovirus K retropepsin, retropepsin (human T-cell
leukemia virus), bovine leukemia virus retropepsin, Rous sarcoma
virus retropepsin, scytalidoglutamic peptidase, aspergilloglutamic
peptidase, thermopsin, signal peptidase II, spumapepsin, type 4
prepilin peptidase 1, omptin, plasminogen activator Pla, papain,
chymopapain, caricain, glycyl endopeptidase, stem bromelain,
ficain, actinidain, cathepsin V, vignain, cathepsin X, zingipain,
cathepsin F, ananain, fruit bromelain, cathepsin L, cathepsin L1
(Fasciola sp.), cathepsin S, cathepsin K, cathepsin H, aleurain,
histolysain, cathepsin B, dipeptidyl-peptidase I, peptidase 1
(mite), CPB peptidase, cruzipain, V-cath peptidase, bleomycin
hydrolase (animal), bleomycin hydrolase (yeast), aminopeptidase C,
CPC peptidase, calpain-1, calpain-2, calpain-3, Tpr peptidase
(Porphyromonas gingivalis), poliovirus-type picornain 3C, hepatitis
A virus-type picornain 3C, human rhinovirus 2-type picornain 3C,
foot-and-mouth disease virus picornain 3C, enterovirus picornain
2A, rhinovirus picornain 2A, nuclear-inclusion-a peptidase (plum
pox virus), tobacco etch virus NIa peptidase, adenain, potato virus
Y-type helper component peptidase, sindbis virus-type nsP2
peptidase, streptopain, clostripain, ubiquitinyl hydrolase-L1,
ubiquitinyl hydrolase-L3, legumain (plant beta form), legumain,
animal-type, caspase-1, caspase-3, caspase-7, caspase-6, caspase-8,
caspase-9, pyroglutamyl-peptidase I (prokaryote),
pyroglutamyl-peptidase I (chordate), murine hepatitis coronavirus
papain-like peptidase 1, ubiquitin-specific peptidase 5, tymovirus
peptidase, rabbit hemorrhagic disease virus 3C-like peptidase,
gingipain RgpA, gingipain Kgp, gamma-glutamyl hydrolase,
foot-and-mouth disease virus L-peptidase, porcine transmissible
gastroenteritis virus-type main peptidase, calicivirin, staphopain
A, Ulpl peptidase, separase (yeast-type), YopJ protein, Pfpl
peptidase, sortase A (Staphylococcus-type), aminopeptidase N, lysyl
aminopeptidase (bacteria), aminopeptidase A, leukotriene A4
hydrolase, pyroglutamyl-peptidase II, cytosol alanyl
aminopeptidase, cystinyl aminopeptidase, aminopeptidase B,
aminopeptidase Ey, angiotensin-converting enzyme peptidase unit 1,
peptidyl-dipeptidase Acer, angiotensin-converting enzyme peptidase
unit 2, angiotensin-converting enzyme-2, thimet oligopeptidase,
neurolysin, saccharolysin, oligopeptidase A, peptidyl-dipeptidase
Dcp, mitochondrial intermediate peptidase, oligopeptidase F,
thermolysin, vibriolysin, pseudolysin, coccolysin, aureolysin,
stearolysin, mycolysin, snapalysin, leishmanolysin, bacterial
collagenase V, bacterial collagenase G/A, matrix
metallopeptidase-1, matrix metallopeptidase-8, matrix
metallopeptidase-2, matrix metallopeptidase-9, matrix
metallopeptidase-3, matrix metallopeptidase-10 (Homo sapiens-type),
matrix metallopeptidase-11, matrix metallopeptidase-7, matrix
metallopeptidase-12, envelysin, matrix metallopeptidase-13,
membrane-type matrix metallopeptidase-1, membrane-type matrix
metallopeptidase-2, matrix metallopeptidase-20, fragilysin, matrix
metallopeptidase-26, serralysin, aeruginolysin, gametolysin,
astacin, meprin alpha subunit, procollagen C-peptidase, choriolysin
L, choriolysin H, flavastacin, fibrolase, jararhagin, adamalysin,
atrolysin A, atrolysin B, atrolysin C, atrolysin E, atroxase,
russellysin, ADAM1 peptidase, ADAMS peptidase, ADAM10 peptidase,
Kuzbanian peptidase (non-mammalian), ADAM12 peptidase, ADAM17
peptidase, ADAMTS4 peptidase, ADAMTS1 peptidase, ADAMTS5 peptidase,
ADAMTS13 peptidase, procollagen I N-peptidase, neprilysin,
endothelin-converting enzyme 1, oligopeptidase 01, neprilysin-2,
PHEX peptidase, carboxypeptidase A1, carboxypeptidase A2,
carboxypeptidase B, carboxypeptidase N, carboxypeptidase E,
carboxypeptidase M, carboxypeptidase T, carboxypeptidase B2,
carboxypeptidase A3, metallocarboxypeptidase D peptidase unit 1,
metallocarboxypeptidase D peptidase unit 2, zinc D-Ala-D-Ala
carboxypeptidase (Streptomyces-type), vanY D-Ala-D-Ala
carboxypeptidase, vanX D-Ala-D-Ala dipeptidase, pitrilysin,
insulysin, mitochondrial processing peptidase beta-subunit,
nardilysin, leucine aminopeptidase 3, leucyl aminopeptidase
(plant-type), aminopeptidase I, aspartyl aminopeptidase, membrane
dipeptidase, glutamate carboxypeptidase, peptidase T,
carboxypeptidase Ss1, beta-lytic metallopeptidase, staphylolysin,
lysostaphin, methionyl aminopeptidase 1 (Escherichia-type),
methionyl aminopeptidase 2, Xaa-Pro dipeptidase (bacteria-type),
aminopeptidase P (bacteria), aminopeptidase P2, Xaa-Pro dipeptidase
(eukaryote), IgA1-specific metallopeptidase, tentoxilysin,
bontoxilysin, aminopeptidase Y, aminopeptidase Apl, aminopeptidase
S (Streptomyces-type), glutamate carboxypeptidase II,
carboxypeptidase Taq, anthrax lethal factor, deuterolysin,
peptidyl-Lys metallopeptidase, FtsH peptidase, m-AAA peptidase,
i-AAA peptidase, AtFtsH2 peptidase, pappalysin-1, Ste24 peptidase,
dipeptidyl-peptidase III, site 2 peptidase, sporulation factor
SpoIVFB, HybD peptidase, gpr peptidase, chymotrypsin A
(cattle-type), granzyme B (Homo sapiens-type), factor
VII-activating peptidase, trypsin (Streptomyces griseus-type),
hypodermin C, elastase-2, cathepsin G, myeloblastin, granzyme A,
granzyme M, chymase (Homo sapiens-type), mast cell peptidase 1
(Rattus-type), duodenase, tryptase alpha, granzyme K, mast cell
peptidase 5 (mouse numbering), trypsin 1, chymotrypsin B,
elastase-1, pancreatic endopeptidase E, pancreatic elastase II,
enteropeptidase, chymotrypsin C, prostasin, kallikrein 1,
kallikrein-related peptidase 2, kallikrein-related peptidase 3,
kallikrein 1 (Mus musculus), kallikrein 1-related peptidase b3,
kallikrein 1-related peptidase c2 (Rattus norvegicus), kallikrein
13 (Mus musculus), ancrod, bothrombin, complement factor D,
complement component activated C1r, complement component activated
C1s, complement factor Bb, mannan-binding lectin-associated serine
peptidase 1, complement factor I, coagulation factor XIIa, plasma
kallikrein, coagulation factor XIa, coagulation factor IXa,
coagulation factor VIIa, coagulation factor Xa, thrombin, protein C
(activated), coagulation factor C (Limulus, Tachypleus), activated,
coagulation factor B (Limulus, Tachypleus), activated, clotting
enzyme (Tachypleus-type), acrosin, hepsin, mannan-binding
lectin-associated serine peptidase 2, urokinase-type plasminogen
activator, t-plasminogen activator, plasmin, kallikrein-related
peptidase 6, plasminogen activator (Desmodus-type),
kallikrein-related peptidase 8, kallikrein-related peptidase 4,
streptogrisin A, streptogrisin B, streptogrisin E, alpha-lytic
endopeptidase, glutamyl peptidase I, DegP peptidase, HtrA2
peptidase, lysyl endopeptidase (bacteria), kallikrein-related
peptidase 7, matriptase, togavirin, IgA1-specific serine peptidase
(Neisseria-type), flavivirin, subtilisin Carlsberg, subtilisin
lentus, thermitase, subtilisin Ak1, lactocepin I, C5a peptidase,
dentilisin, subtilisin BPN', subtilisin E, aqualysin 1, cerevisin,
oryzin, endopeptidase K, thermomycolin, site-1 peptidase, kexin,
furin, PCSK1 peptidase, PCSK2 peptidase, PCSK4 peptidase, PCSK6
peptidase, PCSK5 peptidase, PCSK7 peptidase, tripeptidyl-peptidase
II, cucumisin, prolyl oligopeptidase, dipeptidyl-peptidase IV
(eukaryote), acylaminoacyl-peptidase, fibroblast activation protein
alpha subunit, oligopeptidase B, carboxypeptidase Y, serine
carboxypeptidase A, serine carboxypeptidase C, serine
carboxypeptidase D, kex carboxypeptidase, D-Ala-D-Ala
carboxypeptidase A, K15-type DD-transpeptidase, D-Ala-D-Ala
carboxypeptidase B, aminopeptidase DmpB, D-Ala-D-Ala peptidase C,
peptidase Clp (type 1), Xaa-Pro dipeptidyl-peptidase, Lon-A
peptidase, PIM1 peptidase, assemblin, cytomegalovirus assemblin,
herpesvirus 8-type assemblin, repressor LexA, UmuD protein, signal
peptidase I, mitochondrial inner membrane peptidase 1, signal
peptidase SipS, signalase (animal) 21 kDa component, lysosomal
Pro-Xaa carboxypeptidase, dipeptidyl-peptidase II, hepacivirin,
potyvirus P1 peptidase, pestivirus NS3 polyprotein peptidase,
equine arteritis virus serine peptidase, prolyl aminopeptidase,
C-terminal processing peptidase-1, C-terminal processing
peptidase-2, tricorn core peptidase (archaea), signal peptide
peptidase A, infectious pancreatic necrosis birnavirus Vp4
peptidase, dipeptidase E, sedolisin, sedolisin-B,
tripeptidyl-peptidase I, kumamolisin, physarolisin, SpoIVB
peptidase, archaean proteasome, beta component, bacterial
proteasome, beta component, HslV component of HslUV peptidase,
constitutive proteasome catalytic subunit 1, constitutive
proteasome catalytic subunit 2, constitutive proteasome catalytic
subunit 3, gamma-glutamyltransferase 1 (bacterial-type), murein
tetrapeptidase LD-carboxypeptidase (Escherichia-type), PepA
aminopeptidase, presenilin 1, polyporopepsin, canditropsin,
candidapepsin SAP2, caspase-2, caspase DRONC (Drosophila
melanogaster)-type peptidase, ubiquitin-specific peptidase 7, human
coronavirus 229E main peptidase, SARS coronavirus picornain 3C-like
peptidase, AvrPphB peptidase, sortase B, psychrophilic alkaline
metallopeptidase (Pseudomonas sp.), acutolysin A, aminopeptidase S
(Staphylococcus-type), carboxypeptidase Pfu, isoaspartyl
dipeptidase (metallo-type), D-aminopeptidase DppA, and murein
endopeptidase. In certain embodiments, the enzyme cleavable moiety
is cleavable by a cathepsin protease or peptidase.
Compositions and Methods for Formulating Pharmaceutical
Compositions
[0485] Compounds described herein may be admixed with
pharmaceutically acceptable active or inert substances for the
preparation of pharmaceutical compositions or formulations.
Compositions and methods for the formulation of pharmaceutical
compositions are dependent upon a number of criteria, including,
but not limited to, route of administration, extent of disease, or
dose to be administered.
[0486] Certain embodiments provide pharmaceutical compositions
comprising one or more compounds or a salt thereof. In certain
embodiments, a pharmaceutical composition comprises a compound
described herein and a pharmaceutically acceptable diluent or
carrier. In certain embodiments, a pharmaceutical composition
comprises a sterile saline solution and one or more compound
described herein. In certain embodiments, such pharmaceutical
composition consists of a sterile saline solution and one or more
compound. In certain embodiments, the sterile saline is
pharmaceutical grade saline. In certain embodiments, a
pharmaceutical composition comprises one or more compound described
herein and sterile water. In certain embodiments, a pharmaceutical
composition consists of one compound described herein and sterile
water. In certain embodiments, the sterile water is pharmaceutical
grade water. In certain embodiments, a pharmaceutical composition
comprises one or more compound described herein and
phosphate-buffered saline (PBS). In certain embodiments, a
pharmaceutical composition consists of one or more compound
described herein and sterile PBS. In certain embodiments, the
sterile PBS is pharmaceutical grade PBS.
[0487] Pharmaceutical compositions comprising compounds described
herein encompass any pharmaceutically acceptable salts, esters, or
salts of such esters, or any other oligonucleotide which, upon
administration to an animal, including a human, is capable of
providing (directly or indirectly) the biologically active
metabolite or residue thereof. Certain embodiments are drawn to
pharmaceutically acceptable salts of compounds, prodrugs,
pharmaceutically acceptable salts of such prodrugs, and other
bioequivalents. Suitable pharmaceutically acceptable salts include,
but are not limited to, sodium and potassium salts.
Non-Limiting Disclosure and Incorporation by Reference
[0488] While certain compounds, compositions and methods described
herein have been described with specificity in accordance with
certain embodiments, the following examples serve only to
illustrate the compounds described herein and are not intended to
limit the same.
[0489] Each reference recited herein, including but not limited to
scientific literature, patent publications, GenBank accession
numbers, and the like is incorporated by reference in its
entirety.
[0490] Although the sequence listing accompanying this filing
identifies each sequence as either "RNA" or "DNA" as required, in
reality, those sequences may be modified with any combination of
chemical modifications. One of skill in the art will readily
appreciate that such designation as "RNA" or "DNA" to describe
modified oligonucleotides is, in certain instances, arbitrary. For
example, an oligonucleotide comprising a nucleoside comprising a
2'-OH sugar moiety and a thymine base could be described as a DNA
having a modified sugar (2'-OH in place of one 2'-H of DNA) or as
an RNA having a modified base (thymine (methylated uracil) in place
of a uracil of RNA). Accordingly, nucleic acid sequences provided
herein, including, but not limited to those in the sequence
listing, are intended to encompass nucleic acids containing any
combination of natural or modified RNA and/or DNA, including, but
not limited to such nucleic acids having modified nucleobases. By
way of further example and without limitation, an oligomeric
compound having the nucleobase sequence "ATCGATCG" encompasses any
oligomeric compounds having such nucleobase sequence, whether
modified or unmodified, including, but not limited to, such
compounds comprising RNA bases, such as those having sequence
"AUCGAUCG" and those having some DNA bases and some RNA bases such
as "AUCGATCG" and oligomeric compounds having other modified
nucleobases, such as "ATmCGAUCG," wherein mC indicates a cytosine
base comprising a methyl group at the 5-position.
[0491] Compounds described herein include (R) or (S), as .alpha. or
.beta. such as for sugar anomers, or as (D) or (L) such as for
amino acids etc. Included in the compounds provided herein are all
such possible isomers, including their racemic and optically pure
forms, unless specified otherwise. Likewise, all cis- and
trans-isomers and tautomeric forms are also included. Compounds
described herein include chirally pure or enriched mixtures as well
as racemic mixtures. For example, oligonucleotides having a
plurality of phosphorothioate internucleoside linkages include such
compounds in which chirality of the phosphorothioate
internucleoside linkages is controlled or is random.
[0492] Unless otherwise indicated, any compound, including
oligomeric compounds, described herein includes a pharmaceutically
acceptable salt thereof.
[0493] Compounds described herein include variations in which one
or more atoms are replaced with a non-radioactive isotope or
radioactive isotope of the indicated element. For example,
compounds herein that comprise hydrogen atoms encompass all
possible deuterium substitutions for each of the .sup.1H hydrogen
atoms. Isotopic substitutions encompassed by the compounds herein
include but are not limited to: .sup.2H or .sup.3H in place of
.sup.1H, .sup.13C or .sup.14C in place of .sup.12C, .sup.15N in
place of .sup.14N, .sup.17O or .sup.18O in place of .sup.16O, and
.sup.33S, .sup.34S, .sup.35S, or .sup.36S in place of .sup.32S.
EXAMPLES
Example 1: Preparation of Antisense Oligonucleotide (ASO) Targeted
to MALAT1 Conjugated with GLP-1 Peptide
[0494] Method for the preparation of conjugated modified
oligonucleotides comprising GLP-1 at the 5' position conjugated via
a 3-mercaptopropionate linker.
[0495] Unless otherwise stated, all reagents and solutions used for
the synthesis of oligomeric compounds are purchased from commercial
sources. Standard phosphoramidite building blocks and solid support
are used for incorporation of nucleoside residues which include for
example T, A, G, and mC residues. A 0.1 M solution of
phosphoramidite in anhydrous acetonitrile was used for
2'-deoxyribonucleoside, cEt BNA nucleosides, and suitably protected
6-amino-hexanol.
##STR00097## ##STR00098##
[0496] A 5'-hexylamino modified oligonucleotide (ISIS 786434)
(nucleobase sequence: TCAGCATTCTAATAGCAGC (SEQ ID NO: 38) was
synthesized and purified using standard solid-phase oligonucleotide
procedures. The 5' end of the modified oligonucleotide comprises a
hexamethylene linker and a terminal amine. Compound 1
(3-(2-Pyridyldithio propionic acid N-hydroxysuccinimide ester) was
obtained from Chem-Impex (cat #11566). Modified oligonucleotide
(.about.6 .mu.mop was dissolved in 125 .mu.L sodium phosphate
buffer, pH 8 and 12 .mu.mol of compound 1 was dissolved in DMF. The
solution of compound 1 was added dropwise to the modified
oligonucleotide solution and allowed to react at room temperature.
Reaction was complete after 2-3 hours and the product 2 was
purified by HPLC on source 30Q resin with buffer A 100 mM
NH.sub.4OAc/30% ACN/H.sub.2O and buffer B 100 mM NH.sub.4OAc/30%
ACN/H.sub.2O+1.5M NaBr, and deslated by HPLC on a reverse phase
column. Product fractions were concentrated and stored at
-20.degree. C.
[0497] Compound 2 was used as the starting material for reaction
with the GLP-1 peptide
HisAibGluGlyThrPheThrSerAspValSerSerTyrLeuGluGluGlnAlaAlaLysGluPheIleAlaT-
rpLeuValLysGlyGlyProSerSerAlaProProProSerCys-NH.sub.2 (SEQ ID NO:
22), which was synthesized via standard solid phase peptide
synthesis. Aib is 2-aminoisobutyric acid. Compound 2 was dissolved
in degassed water and 0.1M NaHCO.sub.3 was added to adjust the pH
to .about.8.0. GLP-1 peptide was dissolved in 50/50 0.1 M
NaHCO.sub.3 (pH 8):DMF (dimethylformamide). Peptide solution was
added to compound 2 in small portions (30% of total volume each
time) in 5 min intervals. After .about.1 hr, the reaction mixture
was diluted with water (5 fold of reaction solution volume V/V) and
products were purified by HPLC on source 30Q resin with buffer A
100 mM NH.sub.4OAc/30% ACN/H.sub.2O and buffer B 100 mM
NH.sub.4OAc/30% ACN/H.sub.2O+1.5M NaBr. Product fractions were
deslated by HPLC on a reverse phase column to yield ISIS
816385.
Example 2: Preparation of Antisense Oligonucleotide (ASO) Targeted
to MALAT1 Conjugated with GLP-1 Peptide
[0498] Method for the preparation of conjugated modified
oligonucleotides comprising GLP-1 at the 5' position conjugated via
a 3-mercaptopropionate linker to C-terminal penicillamine.
##STR00099## ##STR00100##
[0499] Compound 2 was synthesized as in Example 1 and was used as
the starting material for reaction with the GLP-1 peptide:
HisAibGluGlyThrPheThrSerAspValSerSerTyrLeuGluGluGlnAlaAlaLysGluPheIleAlaT-
rpLeuValLysGlyGlyProSerSerAlaProProProSerPen-NH.sub.2 (SEQ ID NO:
23), which was synthesized via standard solid phase peptide
synthesis. Aib is 2-aminoisobutyric acid and Pen is penicillamine.
Compound 2 was dissolved in degassed water and 0.1M NaHCO.sub.3 was
added to adjust the pH to .about.8.0. GLP-1 peptide was dissolved
in degassed water. The solution of compound 2 and the peptide
solution were mixed with gentle vortexing and pH was checked. 0.1M
NaHCO.sub.3 was added to adjust the pH to .about.7.5. After
.about.2 hr, additional peptide was added and NaHCO.sub.3 was added
to adjust the pH up. Reaction was transferred to 4.degree. C. for
.about.65 hours and the product was purified by HPLC as described
in Example 1.
Example 3: Preparation of Antisense Oligonucleotide (ASO) Targeted
to FOXO1 Conjugated with GLP-1 Peptide
[0500] Method for the preparation of conjugated modified
oligonucleotides comprising GLP-1 at the 5' position conjugated via
a 3-mercaptopropionate linker.
[0501] ION 913193, a 5'-GLP-1 peptide conjugated ASO targeted to
FOXO1, was prepared according to the procedure of Example 1
starting with a 5'-hexylamino modified oligonucleotide (ION 913192)
(nucleobase sequence: TCATCTTCTTAAAATACCC (SEQ ID NO: 59) having
the chemical modifications: Tdo mCdo Ado Tks mCks Tds Tds mCds Tds
Tds Ads Ads Ads Aks Tes Aks mCes mCks mCk (k=cEt; d=2'-deoxy;
e=2'-MOE; mC=5-methylcytosine; o=phosphodiester; and
s=phosphorothioate).
[0502] ION 913195, a control 5'-GLP-1 peptide conjugated ASO having
a nucleobase sequence mismatched to FOXO1, was prepared according
to the procedure of Example 1 starting with a 5'-hexylamino
modified oligonucleotide (ION 913194) (nucleobase sequence:
TCAGGCCAATACGCCGTCA (SEQ ID NO: 60) having the chemical
modifications: Tdo mCdo Ado Gks Gks mCks mCds Ads Ads Tds Ads mCds
Gds mCds mCds Gds Tks mCks Ak (k=cEt; d=2'-deoxy; e=2'-MOE;
mC=5-methylcytosine; o=phosphodiester; and s=phosphorothioate).
Example 4: Preparation of Antisense Oligonucleotide (ASO) Targeted
to Insulin Conjugated with GLP-1 Peptide
[0503] Method for the preparation of conjugated modified
oligonucleotides comprising GLP-1 at the 5' position conjugated via
a mercaptoproprionate linker.
[0504] ION 919553, a 5'-GLP-1 peptide conjugated ASO targeted to
insulin, was prepared according to the procedure of Example 1
starting with a 5'-hexylamino modified oligonucleotide (ION 919553)
(nucleobase sequence: TCAGCCAAGGTCTGAAGGTCACC (SEQ ID NO: 61)
having the chemical modifications: Tdo mCdo Ado Ges mCes mCes Aes
Aes Gds Gds Tds mCds Tds Gds Ads Ads Gds Gds Tes mCes Aes mCes mCe
(k=cEt; d=2'-deoxy; e=2'-MOE; mC=5-methylcytosine;
o=phosphodiester; and s=phosphorothioate).
Example 5: Preparation of Antisense Oligonucleotide (ASO) Duplex
Targeted to MALAT1 Conjugated with GLP-1 Peptide
[0505] ION 951976 (nucleobase sequence: GCTGCTATTAGAATGC (SEQ ID
NO: 62) having the chemical modifications: Ges mCeo Tdo Gdo mCdo
Tdo Ado Tdo Tdo Ado Gdo Ado Ado Tds Ges mCe (d=2'-deoxy; e=2'-MOE;
mC=5-methylcytosine; o=phosphodiester; and s=phosphorothioate), was
synthesized and purified using standard solid-phase oligonucleotide
procedures. ISIS 816385 described in Example 1 was hybrized with
ION 951976, generating a duplex of the two oligonucleotides.
Example 6: Specific Targeting of Pancreatic Beta Islet Cells In
Vivo by GLP-1 Peptide Conjugated ASOs
Study 1
[0506] To determine if conjugation of GLP-1 peptide to ASO
increases ASO delivery to the pancreas, male C57BL/6 mice fed a
chow diet received 2 intravenous injections of either a 3-10-3 cEt
ASO targeting murine MALAT1 (ISIS 556089) (nucleobase sequence:
GCATTCTAATAGCAGC) (SEQ ID NO: 63) or a GLP-1 conjugated MALAT1 ASO
(ISIS 816385) described in Example 1 at concentrations of 1.8, 0.6,
or 0.2 .mu.mol/kg. Tissues were collected 72 hours after the final
injection to assess delivery and potency of the compounds.
[0507] MALAT1 expression was detected using the QuantiGene ViewRNA
tissue assay (Affymetrix, cat. No. QVT0011). Species-specific
MALAT1 probes were purchased from Affymetrix (cat. No.
VB-11110-01/mouse; VF1-13963/monkey). In brief, mouse tissues were
fixed in 10% neutral-buffered formalin and embedded into paraffin
and sectioned into 4-mm sections. After deparaffinization, the
tissue slides were boiled in Affymetrix pretreatment solution for
10-30 minutes followed by treatment with protease at 40.degree. C.
for 10 to 40 minutes depending on tissue. The MALAT1 RNA probe was
used at a 1:40 dilution and was incubated with sample at 40.degree.
C. for 120 minutes. After washing, the MALAT1 RNA/probe complex was
hybridized with preamplifier, amplifier, and AP-oligonucleotides at
40.degree. C. for 25, 15, and 15 minutes, respectively. After
removal of free AP oligonucleotide by washing in PBS, the slide was
incubated with Fast Red substrate at room temperature for 30
minutes. The tissue images were acquired using an Aperio scanner.
Hung et al., 2013 Nuc Acid Ther. 369-78.
[0508] In situ hybridization analysis indicated that GLP-1 peptide
conjugation reduced MALAT1 staining in beta islet cells, but not
acinar cells, of the pancreas. ASO staining of pancreatic sections
demonstrated the GLP-1 conjugate improved potency by increasing ASO
delivery to the tissue. Mice treated with GLP-1 conjugated MALAT1
ASO (ISIS 816385), but not mice treated with unconjugated MALAT1
ASO (ISIS 556089), exhibited reduced MALAT1 expression in
pancreatic beta islet cells. Mice treated with various doses of
ISIS 816385 exhibited reduced MALAT1 expression in pancreatic beta
islet cells. Mice treated with GLP-1 conjugated MALAT1 ASO (ISIS
816385), but not mice treated with unconjugated MALAT1 ASO (ISIS
556089), exhibited ASO accumulation in pancreatic beta islet cells.
GLP-1 conjugated MALAT1 ASO (ISIS 816385) accumulated in a dose
dependent manner in pancreatic beta islet cells of treated
mice.
Study 2
[0509] To determine a dose response of a GLP-1 conjugated MALAT1
ASO (ISIS 816385) described in Example 1 on pancreatic MALAT1
expression, male C57BL/6 mice fed a chow diet received a single
intravenous injection of ISIS 816385 or an unconjugated MALAT1 ASO
(ISIS 556089) described above at concentrations of 0.2, 0.06, and
0.02 .mu.mol/kg.
[0510] MALAT1 expression was detected using the QuantiGene ViewRNA
tissue assay described above.
[0511] In situ hybridization analysis indicated that GLP-1 peptide
conjugation reduced MALAT1 staining in beta islet cells of the
pancreas at the 0.2 mol/kg dose and 0.06 mol/kg dose. No observable
effect of ISIS 816385 or ISIS 556089 was observed in liver for any
of the doses.
Example 7: Antisense Inhibition of MALAT1 and FOXO1 with GLP-1
Peptide Conjugated Antisense Oligonucleotides in HEK293 Cells
Overexpressing the Human GLP-1 Receptor
[0512] Antisense oligonucleotides designed to target MALAT1 and
FOXO1 were conjugated to a Glucagon Like Peptide 1 receptor peptide
agonist (GLP-1 peptide) and tested for their effect on human target
gene expression using a HEK293 cell line with stable constitutive
expression of the human GLP-1 receptor (hGLP1R-HEK).
[0513] The hGLP1R-HEK cell line was generated by expressing hGLP1R
in Flp-IN.TM. 293 cells. Cultured hGLP1R-HEK cells were seeded at a
density 30,000 cells per well in 96 well plates and saline, 100 nM
or 10 .mu.M of unconjugated parent antisense oligonucleotide ISIS
556089 targeted to MALAT1 described above or ISIS 776102
(nucleobase sequence: TCTTCTTAAAATACCC) (SEQ ID NO: 64) targeted to
FOXO1, or corresponding GLP-1 peptide conjugated antisense
oligonucleotides (ISIS 816385 targeted to MALAT1 described above or
ION 913193 targeted to FOXO1 described above) for approximately 24
hrs. After the treatment period, cells were harvested, the mRNA
isolated and adjusted to total RNA content as measured by nanadrop
UV-Vis spectrophotometer. MALAT1 or FOXO1 mRNA levels were measured
by quantitative real-time PCR and normalized to the mRNA levels of
the house keeping gene (RPLP0) in the same samples. Human MALAT1
mRNA levels were measured using gene expression assays HS00273907
and FOXO1 mRNA levels were measured using assay Hs01054576 (Applied
Biosystems). The mRNA level of the house keeping gene RPLP0 was
measured using a primer probe set with forward sequence
CCATTCTATCATCAACGGGTACAA (SEQ ID NO: 66), reverse sequence
AGCAAGTGGGAAGGTGTAATCC (SEQ ID NO: 67).
[0514] Data is presented as percent inhibition of MALAT1 or FOXO1
mRNA relative to untreated control cells. Open symbols represent
treatment with parent antisense oligonucleotides whereas closed
symbols represent treatment with antisense nucleotides conjugated
to a GLP-1 peptide. As illustrated in FIG. 1, in the hGLP1R-HEK
cell line antisense oligonucleotides were more potent inhibiting
MALAT1 or FOXO1 mRNA when conjugated to GLP-1 peptide compared to
parent antisense oligonucleotides.
Example 8: Dose Dependent Antisense Inhibition of MALAT1 Following
Treatment with Unconjugated Parent or GLP-1 Peptide Conjugated
Antisense Oligonucleotides in Wild Type, and HEK293 Cells
Overexpressing Human GPR40 or GLP-1 Receptors
[0515] The MALAT1 antisense oligonucleotides from Example 7 were
further tested at various concentrations in wild type, hGPR40 and
hGLP1R-HEK cells.
[0516] Cultured hGLP1R-HEK, wild type HEK293 (WT HEK293) cells or
cells expressing hGPR40 receptor were seeded at a density 30,000
cells per well in 96 well plates and treated with 0.001, 0.003,
0.01, 0.03, 0.1, 0.3, 1, 3, 10 or 30 .mu.M of antisense
oligonucleotide, concentrations as indicated in FIG. 2, for
approximately 24 hrs. After the treatment period cells were
harvested, mRNA isolated and MALAT1 mRNA levels measured by
quantitative real-time PCR using the primer probe set as described
herein (Example 7). Data is presented as MALAT1 mRNA levels
normalized relative to a house keeping gene (RPLP0). Open symbols
represent treatment with parent antisense oligonucleotide targeting
MALAT1 (ISIS 556089) whereas closed symbols represent treatment
with the same antisense nucleotide conjugated to a GLP-1 peptide
(ISIS 816385).
[0517] The half maximal inhibitory concentration (IC50) of each
oligonucleotide is presented in the table below.
TABLE-US-00002 TABLE 1 Treatment hGLP1R-HEK cells WT HEK293 cells
ISIS 556089 IC50 = 0.87 .mu.M IC50 = 0.74 .mu.M ISIS 816385 IC50 =
0.02 .mu.M IC50 = 2.21 .mu.M
[0518] The antisense oligonucleotide was 40 times more potent
inhibiting MALAT1 gene expression when conjugated to GLP-1 peptide
agonist in the hGLP1R-HEK cell line (FIG. 2A) and not WT HEK293
(FIG. 2B) or hGPR40-HEK cell lines (FIG. 2C).
Example 9: Antisense Inhibition of MALAT1 and FOXO1 in Mouse
Primary Islets of Langerhans Following Treatment with Unconjugated
Parent or GLP-1 Peptide Conjugated Antisense Oligonucleotides
[0519] Antisense oligonucleotides targeting MALAT1 and FOXO1 were
further tested in mouse primary islets of Langerhans for ability to
reduce gene expression.
[0520] Pancreatic islets were isolated by collagenase digestion
from pancreas collected from exsanguinated 12 to 15 weeks old
female C57BL/6Crl mice. Islets were maintained in tissue culture
until use. Islet were dissociated into single cells by shaking in
media containing a low extracellular calcium concentration. 10 to
20 intact or dissociated islets were plated on plastic Petri Dishes
and treated with 10 .mu.M of antisense oligonucleotides for
approximately 24 hrs. After the treatment period cells were
harvested, RNA isolated, adjusted to total RNA content, as measured
by RIBOGREEN.RTM.. MALAT1 or FOXO1 mRNA levels measured by
quantitative real-time PCR. Mouse Malat1 mRNA levels was measured
using gene expression assay Mm01227912_s 1 from Applied Biosystems,
whereas mouse FOXO1 mRNA levels was measured using a primer probe
set with forward sequence CAGTCACATACGGCCAATCC (SEQ ID NO: 68),
reverse sequence CGTAACTTGATTTGCTGTCCTGAA (SEQ ID NO: 69) and probe
sequence TGAGCCCTTTGCCCCAGATGCCTAT (SEQ ID NO: 70). All data was
normalized to the mRNA level of the house keeping gene (RPLP0) in
the same sample, measured using a primer probe set with forward
sequence GAGGAATCAGATGAGGATATGGGA (SEQ ID NO: 71), reverse sequence
AAGCAGGCTGACTTGGTTGC (SEQ ID NO: 72) and probe sequence
TCGGTCTCTTCGACTAATCCCGCCAA (SEQ ID NO: 73).
[0521] Data is presented in FIG. 3 as levels of MALAT1 or FOXO1
mRNA relative to the house keeping gene (RPLP0). Star symbols
represents no treatment, open circles treatment with parent
unconjugated antisense oligonucleotides (ISIS 556089 targeted to
MALAT1 or ISIS 776102 targeted to FOXO1), open square treatment
with scrambled FOXO1 antisense oligonucleotide sequence conjugated
to the GLP1 peptide (ION 913195), whereas closed symbols represent
treatment with GLP1 peptide conjugated antisense oligonucleotides
against MALAT1 (ISIS 816385) or FOXO1 (ISIS 919193).
Example 10: Antisense Inhibition of FOXO1 and Reduction in Foxo1
Protein in Mouse Primary Islets of Langerhans Following Treatment
with Unconjugated Parent and GLP-1 Peptide Conjugated Antisense
Oligonucleotides
[0522] Antisense oligonucleotides targeting FOXO1 were tested in
mouse primary islets of Langerhans for ability to reduce protein
levels.
[0523] Pancreatic islets were isolated by collagenase digestion
from pancreas collected from euthanized 12 to 15 weeks old female
B6.Cg-Lepob/J mice and maintained in tissue culture until use. 150
intact islets were placed in plastic Petri Dishes and treated with
1 .mu.M of antisense oligonucleotides for 3 hrs every 24 hrs and
harvested after approximately 24 hrs, 48 hrs or 96 hrs total
treatment time respectively. After the treatment period, islets
were harvested, and half of the islets were used to measure FOXO1
mRNA levels as described herein (Example 9). Half of the islets
were homogenized in M-PER protein extraction reagent (Thermo
Scientific) containing a protease inhibitor cocktail (Complete Mini
and phosphoSTOP, Roche Diagnostics). The protein content of lysates
were quantitated using BCA Assay Reagent (Pierce). FoxO1 protein
was detected by Western Blot analysis using the primary antibodies
C29H4 against FoxO1 (Cell Signalling, #2880). .alpha.-tubulin was
measured as a control for sample loading on gel, using a primary
antibody from Sigma (#T6074). For the anti-FoxO1 antibody, the
secondary antibody was HRP-conjugated polyclonal goat anti-Rabbit
P0448 (DAKO) and for the anti-.alpha.-tubulin antibody, the
secondary antibody was HRP-conjugated polyclonal goat anti-mouse
P0447 (DAKO) Enhanced chemiluminescence reagents (Pierce) were used
for detection.
[0524] Inhibition of FOXO1 mRNA is presented as FOXO1 mRNA relative
to the house keeping gene, expressed as percent of untreated cells
in the table below and shows a marginal reduction in mRNA with
unconjugated antisense oligonucleotide (ISIS 776102) and more than
70% reduction with GLP-1 conjugated antisense oligonucleotide (ION
913193).
TABLE-US-00003 TABLE 2 Islet FOXO1 mRNA levels relative to control
(RPLP0) Treatment 24 hours 48 hours 96 hours Vehicle 100% 100% 100%
ISIS 776102 82% 86% 92% ION 913193 31% 30% 25%
[0525] The Western Blot showed a reduction in FoxO1 protein levels
measured in islets treated with vehicle or antisense
oligonucleotide for 96 hours. Protein levels were quantified by
measuring the intensity of the bands on the gel normalized to the
intensity of .alpha.-tubulin, and expressed as percent of vehicle
treated islets. FoxO1 protein levels were set to 100% in vehicle
treated islets. By contrast, FoxO1 protein levels were 5% in
GLP-1-FOXO1 ASO treated islets.
Example 11: Uptake of Antisense Oligonucleotides in Islet of
Langerhans In Situ in Pancreas after Administration of Unconjugated
Parent or GLP-1 Peptide Conjugated Antisense Oligonucleotides
Targeting MALAT1 to C57BL/6Crl Mice
[0526] Unconjugated parent and GLP-1 peptide conjugated antisense
oligonucleotides targeted to MALAT1 were further tested in vivo to
evaluate the uptake of antisense oligonucleotides in pancreatic
islets after either intravenous or subcutaneous administration of
treatments.
[0527] Female C57BL/6Crl mice were assigned to five treatment
groups. Two groups received either vehicle (saline) or 2 .mu.mol/kg
GLP-1 conjugated antisense oligonucleotide (ISIS 816385) by tail
vein injection. Three groups received either saline, 2 .mu.mol/kg
unconjugated parent antisense oligonucleotide (ISIS 556089) or 2
.mu.mol/kg GLP-1 conjugated antisense oligonucleotide (ISIS 816385)
by subcutaneous administration twice a week for two weeks. All
animals were sacrificed approximately 72 hrs after last dose, and
pancreas harvested for ex vivo analysis of uptake of antisense
oligonucleotides by immunohistochemistry.
[0528] All tissues were fixed in 10% neutral buffered formalin for
32 hours at room temperature. After fixation samples were
dehydrated using standard ethanol series followed by xylene and
embedded in paraffin. Tissue sections were cut at 4 am thickness
and mounted on Superfrost.RTM.Plus slides, then baked in a dry oven
for 1 hour at 60.degree. C. Immunohistochemistry for detection of
antisense oligonucleotide was carried out in the Ventana Discovery
XT immunostainer (Ventana Medical System, Inc) according to
manufactures recommendation and all reagents were Ventana products
(Roche Diagnostics, Basel, Switzerland). Protease 1 was used as
enzyme antigen retrieval, with incubation for 8 minutes. Antibody
blocker was added for reduction of background for 4 minutes,
followed by addition of rabbit Anti-ASO 2.5 for 1 hour at
37.degree. C. (dilution 1:5000, Ionis Pharmaceuticals). For
secondary detection, OmiMap anti-rabbit HRP was incubated for 16
minutes, followed by chromogenic detection with DISCOVERY ChromoMap
DAB Kit (RUO). Slides were counterstained with hematoxylin for 4
minutes followed with bluing for 4 minutes. Stained slides were
analyzed under a standard bright-field microscope.
[0529] Antisense oligonucleotide was detected in the pancreatic
islet of Langerhans from animals treated with ISIS 816385, dosed by
either subcutanous or intravenous administration. No antinsense
oligonucleotide was detected in the islets of Langerhans in animals
treated subcutaneously with ISIS 556089.
Example 12: Antisense Inhibition of MALAT1 in Islet of Langerhans
In Situ in Pancreas after Administration of Unconjugated Parent or
GLP-1 Peptide Conjugated Antisense Oligonucleotides in C57BL/6Crl
Mice
[0530] Unconjugated parent and GLP-1 peptide conjugated antisense
oligonucleotides against MALAT1 were further tested in vivo to
evaluate the antisense inhibition of MALAT1 in pancreas after
intravenous or subcutaneous administration of treatments.
[0531] Female C57BL/6Crl mice were assigned to five treatment
groups as described herein (Example 11) All animals were sacrificed
approximately 72 hrs after last dose, and pancreas harvested for ex
vivo analysis of MALAT1 expression by in situ hybridization.
[0532] Tissues were prepared as described herein, Example 11. The
in situ mRNA amplification and labelling process was performed on
the Ventana Discovery ULTRA, an Automated ISH platform (Ventana
Medical System, Inc) using the RNAscope.RTM. VS Assay based on
Advanced Cell Diagnostics (ACD). Customized probes were obtained
from ACD for the detection of MALAT1 mRNA, and various parameters
were tested to optimize the novel RNAscope method for ISH. The
signal was amplified using multiple steps, followed by labeled
probes and detected using the RNAscope.RTM. 2.5 VS Reagent Kit-RED.
Stained slides were analyzed under a standard bright-field
microscope.
[0533] MALAT1 expression was reduced in the pancreatic islet of
Langerhans but not in the exocrine tissue from animals
subcutanously or intravenously treated with GLP-1 peptide
conjugated antisense oligonucleotide (ISIS 816385). MALAT1
expression was not reduced in animals treated subcutaneously with
unconjugated parent antisense oligonucleotide (ISIS 556089).
Example 13: Uptake of Antisense Oligonucleotides in Liver 72 after
Administration of Unconjugated Parent or GLP-1 Peptide Conjugated
Antisense Oligonucleotides Targeting MALAT1 to C57BL/6Crl Mice
[0534] Unconjugated parent and GLP-1 peptide conjugated antisense
oligonucleotides against MALAT1 were further tested in vivo to
evaluate the uptake of antisense oligonucleotides in liver by
either intravenous or subcutaneous route of administration.
[0535] Animals were assigned to treatment as described herein,
Example 11. All animals were sacrificed approximately 72 hrs after
last dose, and liver harvested for ex vivo analysis of uptake of
antisense oligonucleotides by immunohistochemistry.
[0536] Tissues were prepared and immunohistochemistry performed as
described herein, Example 12.
[0537] Antisense oligonucleotide was detected in hepatocytes and
Kupffer cells in the liver from animals treated with both ISIS
816385 and ISIS 556089, dosed by either subcutanous or intravenous
administration as indicated.
Example 14: Antisense Inhibition of MALAT1 in Liver after
Administration of Unconjugated Parent or GLP-1 Peptide Conjugated
Antisense Oligonucleotides in C57BL/6Crl Mice
[0538] Unconjugated parent (ISIS 556089) and GLP-1 peptide
conjugated antisense oligonucleotides against MALAT1 were further
tested in vivo to evaluate the antisense inhibition of MALAT1 in
liver by intravenous and subcutaneous route of administration.
[0539] Female C57BL/6Crl mice were assigned to five treatment
groups as described herein (Example 13). All animals were
sacrificed approximately 72 hrs after last, and liver harvested for
ex vivo analysis of MALAT1 expression by in situ hybridization.
[0540] Tissues were prepared, and in situ hybridization performed,
as described herein, Example 12.
[0541] Liver MALAT1 expression was reduced in hepatocytes of
animals treated with ISIS 816385 to a greater extent than in
hepatocytes of animals treated with ISIS 556089 dosed by
subcutanous administration. Liver MALAT1 was also reduced compared
to vehicle control in animals dosed with ISIS 816385 by intravenous
administration.
Example 15: Dose Dependent Antisense Inhibition of MALAT1 in
Isolated Islet of Langerhans and Liver 72 hrs after Administration
of a Single Dose of Unconjugated Parent and GLP-1 Peptide
Conjugated Antisense Oligonucleotides in C57BL/6Crl Mice
[0542] Unconjugated parent and GLP-1 peptide conjugated antisense
oligonucleotides were further tested in vivo to evaluate the
potency of antisense inhibition of MALAT1 in isolated pancreatic
islets of Langerhans relative to liver 72 hours after single
subcutaneous administration.
[0543] Female C57BL/6Crl mice were assigned to eight treatment
groups, receiving a single subcutaneous injection of either
vehicle, 0.01 .mu.mol/kg, 0.03 .mu.mol/kg, 0.1 .mu.mol/kg or 1
.mu.mol/kg ISIS 816385, another three treatment groups received
0.01 .mu.mol/kg, 0.1 .mu.mol/kg or 1 .mu.mol/kg ISIS 556089. All
animals were sacrificed 72 hrs after last dose. Liver samples were
collected and pancreatic islets isolated, as described herein
(Example 9), for mRNA analysis. MALAT1 mRNA levels were quantified
as described herein (Example 9) and expressed as percentage of
vehicle treated animals (control).
[0544] No significant antisense inhibition of MALAT1 was observed
in the liver in any of the treatment groups, or in islet of
Langerhans from animals treated with parent antisense
oligonucleotide (ISIS 556089). The GLP-1 peptide conjugated
antisense oligonucleotide dose dependently inhibited MALAT1 mRNA
levels with an estimated ED50 of 0.07 .mu.mol/kg.
Example 16: Dose Dependent Antisense Inhibition of FOXO1 in
Isolated Islet of Langerhans and Liver 72 hrs after Administration
of a Single Dose of Unconjugated Parent and GLP-1 Peptide
Conjugated Antisense Oligonucleotides in C57BL/6Crl Mice
[0545] Unconjugated parent and GLP-1 peptide conjugated antisense
oligonucleotides were further tested in vivo to evaluate the
potency of antisense inhibition of FOXO1 in isolated pancreatic
islets of Langerhans relative to liver 72 hours after subcutaneous
administration of a single dose.
[0546] Female C57BL/6Crl mice were assigned to seven treatment
groups, receiving a single subcutaneous injection of either
vehicle, 0.01 .mu.mol/kg, 0.03 .mu.mol/kg, 0.1 .mu.mol/kg or 1
.mu.mol/kg ION 913193, with two treatment groups receiving 0.01
.mu.mol/kg or 1 .mu.mol/kg ISIS 776102. All animals were sacrificed
72 hrs after last dose. Liver samples were collected and pancreatic
islets isolated, as described herein (Example 9), for mRNA
analysis. FOXO1 mRNA levels were quantified as described herein
(Example 9) and expressed as percentage of vehicle treated animals
(control).
[0547] No significant antisense inhibition of FOXO1 was observed in
the liver in any of the treatment groups, or in islet of Langerhans
treated with parent antisense oligonucleotide (ISIS 776102). The
GLP-1 peptide conjugated antisense oligonucleotide dose dependently
inhibited FOXO1 mRNA levels with an estimated ED50 of 0.04
.mu.mol/kg.
Example 17: Antisense Inhibition of FOXO1 in Isolated Islet of
Langerhans and Liver after 6 Weeks Repeated Administration of
Unconjugated Parent or GLP-1 Peptide Conjugated Antisense
Oligonucleotides to ob/ob Mice
[0548] Unconjugated parent and GLP-1 peptide conjugated antisense
oligonucleotides were further tested in vivo to evaluate the
potency of antisense inhibition of FOXO1 in isolated pancreatic
islets of Langerhans relative to liver after 6 weeks of
treatment.
[0549] Male ob/ob mice (B6.V-Lepob/OlaHsd, Harlan) were assigned to
five treatment groups receiving either vehicle, 0.1 .mu.mol/kg ISIS
776102, 0.1 .mu.mol/kg ION 913195, 0.03 ION 913193 or 1 .mu.mol/kg
ION 913193. All animals were treated once weekly for 6 weeks.
Approximately 120 hrs after last dose all animals were sacrificed,
liver samples collected and pancreatic islets isolated, as
described herein (Example 9), for mRNA analysis. FOXO1 mRNA levels
were quantified as described herein (Example 9) and mRNA levels
expressed relative to housekeeping gene in each sample (RPLP0).
[0550] No significant antisense inhibition of FOXO1 in the liver in
any of the treatment groups, or in islet of Langerhans treated with
parent antisense oligonucleotide (ISIS 776102) or scrambled FOXO1
antisense oligonucleotides sequence conjugated to GLP-1 peptide was
observed (ION 913195). The GLP-1 peptide conjugated antisense
oligonucleotide (ION 913193) treated animals had reduced FOXO1 mRNA
levels in isolated islets of Langerhans at both dose levels tested
(42% average FOXO1 mRNA reduction at 0.03 among and 72% average
FOXO1 mRNA reduction at 0.1 .mu.mol/kg), indicating that GLP-1
peptide conjugation enhances antisense inhibition in pancreatic
islets of Langerhans in vivo.
Example 18: Reduction of FoxO1 Protein Levels in Islets of
Langerhans Isolated from ob/ob Mice Treated for 6 Weeks with
Unconjugated Parent or GLP-1 Peptide Conjugated Antisense
Oligonucleotide
[0551] Unconjugated parent and GLP-1 peptide conjugated antisense
oligonucleotides were further tested for the ability to reduce
FoxO1 protein levels in pancreatic mouse islets of Langerhans
isolated from ob/ob mice treated for 6 weeks.
[0552] Male ob/ob mice were assigned to five treatment groups as
described herein (Example 17) Approximately 120 hrs after last dose
all animals were sacrificed and pancreatic islets isolated for
FoxO1 protein analysis as described herein (Example 10). Random
samples were selected from each treatment group and loaded on each
gel such that at least one sample from each treatment group was
analysed on the same gels. FoxO1 protein levels were measured by
quantifying the intensity and normalized against the .alpha.-tublin
levels in the same sample. All samples within individual gels were
expressed as percentage of the levels measured in islets of animals
receiving ION 913195.
[0553] Foxo1 protein levels were reduced in animals treated with
ION 913193; relative to ION 913195 by 57% and 81% in animals
receiving 0.03 .mu.mol/kg and 0.1 .mu.mol/kg respectively, and 64%
and 36% relative to animals treated with 0.1 .mu.mol/kg ISIS
776102.
Example 19: Preparation of GLP-1 Peptide Conjugated Antisense
Oligonucleotide Targeted to MALAT1
[0554] ION 962963, a 5'-GLP-1 peptide conjugated ASO targeted to
MALAT1, was prepared according to the procedure of Example 1
starting with a 5'-hexylamino modified oligonucleotide (ISIS
722061) (nucleobase sequence: GCATTCTAATAGCAGC (SEQ ID NO: 65)
having the chemical modifications Gks mCks Aks Tds Tds mCds Tds Ads
Ads Tds Ads Gds mCds Aks Gks mCk (k=cEt; d=2'-deoxy; e=2'-MOE;
mC=5-methylcytosine; o=phosphodiester; and s=phosphorothioate).
Example 20: Preparation of Antisense Oligonucleotide Targeted to
MALAT1 Conjugated to GLP-1 Peptide Via a Click Linker
[0555] Method for the preparation of conjugated modified
oligonucleotides comprising GLP-1 at the 5' position conjugated via
a click linker.
Preparation of 5'-BCN MALAT-1 Targeted Oligonucleotide ISIS
791173:
[0556] A 5'-hexylamino modified oligonucleotide (ISIS 786434)
(nucleobase sequence: TCAGCATTCTAATAGCAGC (SEQ ID NO: 58) was
synthesized and purified using standard solid-phase oligonucleotide
procedures. The 5' end of the modified oligonucleotide comprises a
hexamethylene linker and a terminal amine. BCN--NHS ester (Mol. Wt
291.11 g/mol, 7441R,8S,9s)-Bicyclo(6.1.0)non-4-yn-9-ylmethyl
N-succinimidyl carbonate) was obtained from Aldrich. Modified
oligonucleotide (.about.1 g) was dissolved in 5 mL sodium
tetraborate buffer, pH 8.5. 13.4 mg of BCN--NHS ester was dissolved
in 10 mL DMSO, added to the ASO solution, and stirred at room
temperature for 4 hours. Reaction mixture was diluted with 1 M NaCl
solution and desalted by HPLC on a reverse phase column.
Preparation of GLP-1 Click-Conjugated ASO (ION 1071996)
[0557] 12 mg modified oligonucleotide ISIS 791173 was dissolved in
1 mL of 0.1M sodium tetraborate, pH 8.5 (ASO solution), and 12 mg
of N-terminal azido-GLP-1 peptide was dissolved in 400 .mu.L DMF
(peptide solution). The peptide solution was added to the ASO
solution and stirred at RT for 18 hr. At 18 hr, a precipitate was
observed and 1 mL of additional DMF was added. The reaction was
allowed to proceed for an additional 5 hr. The product was purified
by HPLC on a SAX column with buffer A 100 mM NH.sub.4OAc/30%
ACN/H.sub.2O and buffer B 1.5M NaBr/NH.sub.4OAc/30% ACN/H.sub.2O,
and desalted by HPLC ona reverse phase column. Product fractions
were collected and lypohylized to yield expected conjugated ASO,
ION 1071996.
##STR00101##
Example 21: Antisense Inhibition of MALAT1 in Mouse Primary Islets
of Langerhans Following Treatment with Unconjugated Parent or GLP-1
Peptide-Conjugated ASO with Various Linkers
[0558] To determine if the chemistry of conjugation of GLP-1
peptide to ASO affects ASO delivery into the pancreas, male C57BL/6
mice received an intravenous injection of 0.6 .mu.mol/kg/week once
a week for three weeks of vehicle (saline), ISIS 556089 (parent
unconjugated ASO), ISIS 816395 (GLP-1 conjugated ASO with a
disulfide linker and 5' TCA linker), ION 962963 (GLP-1 conjugated
ASO with a disulfide linker and no 5' nucleotide spacer), or ION
1071996 (GLP-1 conjugated ASO conjugated via a click linker).
Tissues were collected 72 hours after the final injection to assess
delivery and potency of the compounds.
[0559] MALAT1 expression was detected as in Example 6. In situ
hybridization analysis indicated that MALAT1 expression in beta
islet cells was reduced in mice treated with GLP-1 conjugated ASOs
(ISIS 816385, ION 962963, and ION 1071996) compared to saline
control, but not in mice treated with the unconjugated parent ASO
(ISIS 556089).
Example 22: Dose-Dependent Reduction of MALAT-1 Expression in
LVX-GLP1R Cells
[0560] HEK cells stably expressing FLAG-tagged GLP1R were generated
by infecting HEK 293 cells with FLAG-tagged GLP1R containing
lentivirus produced by transfection of 293T cells with
pLVX-IRES-Puro (Clontech Laboratories Inc., Mountainview, Calif.)
harboring the FLAG-GLP1R insert. Infected cells were selected with
puromycin (2 .mu.g/ml) and then analyzed for receptor expression by
western blot and immunofluorescence. Cultured GLP1R cells were
plated at a density of 10,000 cells per well and treated with 0.3,
1, 3, 9, 27, 82, 247, 741, 2,222, 6,667, and 20,000 nM modified
oligonucleotide for approximately 24 hours. After the treatment
period, total RNA was prepared using an RNeasy mini kit (Qiagen,
Valencia, Calif., USA) and qRT-PCR was performed using the primer
probe set RTS2739 (forward sequence: AGGCGTTGTGCGTAGAGGAT (SEQ ID
NO: 74), reverse sequence: AAAGGTTACCATAAGTAAGTTCCAGAAAA (SEQ ID
NO: 75), probe sequence: AGTGGTTGGTAAAAATCCGTGAGGTCGGX (SEQ ID NO:
76). Briefly, .about.50 ng total RNA in 5 .mu.l water was mixed
with 0.3 .mu.l primer probe sets containing forward and reverse
primers (10 .mu.M of each) and fluorescently labeled probe (3
.mu.M), 0.3 .mu.l RT enzyme mix (Qiagen), 4.4 .mu.l RNase-free
water, and 10 .mu.l of 2.times.PCR reaction buffer in a 20 .mu.l
reaction. Reverse transcription was performed at 48.degree. C. for
10 min, 40 cycles of PCR were conducted at 94.degree. C. for 20 s,
and 60.degree. C. for 20 s within each cycle, using StepOne Plus
RT-PCR system (Applied Biosystems, Phoenix, Ariz., USA). The mRNA
levels were normalized to the amount of total RNA present in each
reaction as determined by Ribogreen assay (Life Technologies) and
normalized to the saline control (100% expression). Results are
shown in the table below and indicate increased dose-dependent
inhibition of MALAT-1 with GLP-1 complexed ASOs with (816385) or
without (962963) a TCA linker.
TABLE-US-00004 TABLE 3 Percent Inhibition of MALAT-1 expression in
GLP1R HEK cells [ASO] ISIS ISIS ION (nM) 556089 816385 962963 0.3
102 102 94 1 98 102 106 3 94 97 85 9 103 86 87 27 88 74 74 82 85 64
71 247 79 48 56 741 65 36 47 2222 65 28 30 6667 45 15 10 20000 27
7.7 0.7 IC50 (.mu.M) 3.97 0.26 0.35
Example 23: Effect of Peptide Length and Conjugation Position on In
Vitro Activity of GLP-1 Conjugated ASO Targeting MALAT1
[0561] In order to evaluate the effect of exact peptide sequence,
peptide length, and conjugation position on the in vitro activity
of a GLP-1 conjugated ASO complementary to MALAT1, a series of
modified oligonucleotides were synthesized via click chemistry with
variations in the peptide sequence. All peptides represent the
C-terminal amide. ION 1083582 was synthesized from ION 791173 via a
click reaction with a 5-azidopentanoic acid-modified lysine residue
(X), as shown below. The other compounds were synthesized from ION
791173 via a click reaction with a C-terminal azidonorleucine (Z)
as shown in Example 20 above.
##STR00102##
[0562] LVX-GLP1R cells (as described in Example 22) were plated at
a density of 10,000 cells/well and incubated with 7 doses of
peptide-conjugated ASOs in a 4-fold dilution series. After the
treatment period, total RNA was prepared and analyzed as in Example
22 above. IC50s are shown in the table below.
TABLE-US-00005 TABLE 4 Effect of peptide composition and
attachement point on peptide-conjugated ASO activity Attachment ION
# Peptide Sequence IC50 site 556089 n/a 3.82 n/a 816385
HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSG 0.35 C-terminal C APPPSC
1083540 HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGA 4.60 C-terminal Z PPPSZ
1083541 HAibEGTFTSDVSSYLEGQAAKEFIAWLVRGRGZ 0.75 C-terminal Z
1083542 HAibEGTFTSDVSSYLEGQAAKEFIAWLVK(Aib)RZ 0.29 C-terminal Z
1083569 HSEGTFTSDVSSYLEGQAAKEFIAWLVKGRZ 2.02 C-terminal Z 1085429
HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSG 2.34 C-terminal Z APPZ 1085430
HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSZ 1.24 C-terminal Z 1085431
HAibEGTFTSDVSSYLEEQAAKEFIAWLVKZ 0.97 C-terminal Z 1085432
HAibEGTFTSDVSSYLEEQAAKEFIAWLVZ 0.25 C-terminal Z 1085433
HAibEGTFTSDVSSYLEEQAAKEFIAWLZ 0.38 C-terminal Z 1085435
HAibEGTFTSDVSSYLEEQAAKEFIAWZ 1.35 C-terminal Z 1085441
HAibEGTFTSDVSSYLEEQAAZ 2.63 C-terminal Z 1085470
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGZ 4.08 C-terminal Z 1085471
HGEGTFTSDLSKQMEEEAVRLFIEWLKNZ 2.37 C-terminal Z 1085472
HGEGTFTSDLSKQMEEEAVRLFIEWLKZ 1.34 C-terminal Z 1085473
HGEGTFTSDLSKQMEEEAVRLFIEWLZ 1.26 C-terminal Z 1085478
HGEGTFTSDLSKQMEEEAVRLFIEWZ 6.08 C-terminal Z 1083582
HAibEGTFTSDVSSYLEGQAANXEFIAWLVRGRG 1.20 Sidechain X
Example 24: Preparation of a GLP-1 Conjugated siRNA Targeted to
PTEN
[0563] Method for the Preparation of siRNA Nucleotide Duplexes
Targeted to PTEN
[0564] ISIS 522247 (nucleobase sequence TTATCTATAATGATCAGGTAA (SEQ
ID NO: 77) having the chemical modifications Txs Ufs Amo Ufs Cmo
Ufs Amo Ufs Amo Afs Umo Gfs Amo Ufs Cms Afs Gms Gfs Ums Aes Ae
(Tx=5'-(E)-vinylP-2'-O-methoxyethyl-thymine,
f=2'-.alpha.-fluoro-2'deoxyribose, m=2'-O-methylribose,
e=2'O-methoxyethylribose, o=phosphodiester; and s=phosphorothioate)
and ISIS 790973 (nucleobase sequence ACCTGATCATTATAGATAA (SEQ ID
NO: 78) having the chemical modifications Afs Cms Cfo Umo Gfo Amo
Ufo Cmo Afo Umo Ufo Amo Ufo Amo Gfo Amo Ufs Ams Af (as above)) were
synthesized and purified using standard solid-phase oligonucleotide
procedures.
[0565] GLP-1 conjugated ION 1055394 was prepared according to the
procedure of Example 1 starting with a 5'-hexylamino modified
oligonucleotide (ION 1055395) (nucleobase sequence
ACCTGATCATTATAGATAA (SEQ ID NO: 78) having the chemical
modifications Afs Cms Cfo Umo Gfo Amo Ufo Cmo Afo Umo Ufo Amo Ufo
Amo Gfo Amo Ufs Ams Af (as above)) conjugated to a GLP-1 peptide
with the sequence
HisAibGluGlyThrPheThrSerAspValSerSerTyrLeuGluGluGlnAlaAlaLysGluPheIleAlaT-
rpLeuValLysGlyGlyProSerSerGlyAlaProProProSerCys comprising a free
N-terminal amine and a C-terminal amide.
[0566] ISIS 522247 was hybridized with 790973, generating a duplex
of the two oligonucleotides. ISIS 522247 was hybridized with
1055394, generating a duplex of the two oligonucleotides.
Example 25: Preparation of a GLP-1 Antagonist Conjugated
Oligonucleotide
[0567] Method for the synthesis of GLP-1 antagonist conjugated
oligonucleotide,
DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSC-S--S-Propionoyl-HA-o-TdomCdoAdoGksmCksAk-
s TdsTdsmCdsTdsAdsAdsTdsAdsGdsmCdsAksGksmCk (ION 998975).
[0568] 38 mg of linker-ISIS 786434 (compound 2) described in
Example 1 was dissolved 1.5 mL H.sub.2O and 0.5 mL of 0.1M
NaHCO.sub.3/H.sub.2O was added to adjust pH to .about.7.5-8.0 (ASO
solution).
[0569] 27.7 mg of peptide DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSC-NH.sub.2
(SEQ ID NO: 79) was dissolved in 2 mL of DMF: 0.1M NaHCO.sub.3
(1:1) (peptide solution). The peptide solution was added to the ASO
solution slowly and stirred at room temperature for 30 minutes. The
reaction was monitored by LCMS and the stirring was continued for
an additional 1 hour. The major fraction was found to be the
expected product. The product was diluted with water and kept at
4.degree. C. until it was purified by HPLC on a strong anion
exchange column (Buffer A=100 mM ammonium acetate in 30% aqueous
acetonitrile; Buffer B: 1.5 M NaBr in A, 0 to 60% B in 28 column
volume). Fractions containing full length ASO were pooled together,
diluted to get concentration of acetonitrile to 10%, and desalted
by HPLC on a reverse phase column (Buffer A 0.1 M sodium chloride,
B=water, C=50% acetonitrile in water). Fractions pooled together
and evaporated to yield the expected product confirmed by LCMS.
Example 26: Method for the Preparation of Conjugated Modified
Oligonucleotides Comprising GLP-1 at the 5' Position Conjugated Via
a Maleimide Linker
[0570] A 5' hexylamino modified oligonucleotide targeting MALAT1
(ISIS 786434) was synthesized and purified as previously described
herein. ISIS 786434 was reacted with 5 eq. of N-Succinimidyl
3-maleimidopropionate (MW 266.21 g/mol) in sodium tetraborate
buffer at pH7, RT to yield 5'-(3-Maleimdyl)propionyl-C6 MALAT1 ASO.
GLP-1 peptide containing a C-terminal cysteine amide ("GLP-1
peptide-cysteinamide",
HAibEGTFTSDVSSYLEEQAAKEFIAWLVKGGPSSGAPPPSC-NH2) was dissolved in
0.1M sodium phosphate, pH 8.5/DMF and added to a solution of
5'-(3-Maleimdyl)propionyl-C6 MALAT1 ASO with stirring at room
temperature. Product (ION 1086699) was formed.
Sequence CWU 1
1
79131PRTArtificial sequenceSynthetic peptide 1His Ala Glu Gly Thr
Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly1 5 10 15Gln Ala Ala Lys
Glu Phe Ile Ala Trp Leu Val Lys Gly Arg Gly 20 25
30230PRTArtificial sequenceSynthetic peptide 2His Ala Glu Gly Thr
Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly1 5 10 15Gln Ala Ala Lys
Glu Phe Ile Ala Trp Leu Val Lys Gly Arg 20 25 30327PRTArtificial
sequenceSynthetic peptide 3Glu Gly Thr Phe Thr Ser Asp Val Ser Ser
Tyr Leu Glu Gly Gln Ala1 5 10 15Ala Lys Glu Phe Ile Ala Trp Leu Val
Lys Gly 20 25427PRTArtificial sequenceSynthetic peptide 4Glu Gly
Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu Gln Ala1 5 10 15Ala
Lys Glu Phe Ile Ala Trp Leu Val Lys Gly 20 25530PRTArtificial
SequenceSynthetic peptideMOD_RES(2)..(2)AibMOD_RES(29)..(29)Aib
5His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly1 5
10 15Gln Ala Ala Arg Glu Phe Ile Ala Phe Leu Val Arg Xaa Arg 20 25
30631PRTArtificial SequenceSynthetic peptideMOD_RES(2)..(2)Ala,
Val, or GlyMOD_RES(16)..(16)Gly, Lys, or GluMOD_RES(17)..(17)Gln or
LysMOD_RES(24)..(24)Ala or GluMOD_RES(27)..(27)Val or
LysMOD_RES(28)..(28)Lys, Asn, or ArgMOD_RES(30)..(30)Arg or
GlyMOD_RES(31)..(31)Gly, His, Pro, or not present 6His Xaa Glu Gly
Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Xaa1 5 10 15Xaa Ala Ala
Lys Glu Phe Ile Xaa Trp Leu Xaa Xaa Gly Xaa Xaa 20 25
30731PRTArtificial SequenceSynthetic peptide 7His Ala Glu Gly Thr
Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly1 5 10 15Gln Ala Ala Lys
Glu Phe Ile Ala Trp Leu Val Arg Gly Arg Gly 20 25
30831PRTArtificial SequenceSynthetic peptide 8His Ala Glu Gly Thr
Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly1 5 10 15Gln Ala Ala Lys
Glu Phe Ile Glu Trp Leu Val Lys Gly Arg Gly 20 25
30931PRTArtificial SequenceSynthetic peptide 9His Ala Glu Gly Thr
Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Lys1 5 10 15Gln Ala Ala Lys
Glu Phe Ile Ala Trp Leu Val Lys Gly Arg Gly 20 25
301031PRTArtificial SequenceSynthetic peptide 10His Gly Glu Gly Thr
Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1 5 10 15Gln Ala Ala Lys
Glu Phe Ile Ala Trp Leu Val Lys Gly Gly Gly 20 25
301131PRTArtificial SequenceSynthetic peptide 11His Val Glu Gly Thr
Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1 5 10 15Gln Ala Ala Lys
Glu Phe Ile Ala Trp Leu Val Lys Gly Gly Gly 20 25
301231PRTArtificial SequenceSynthetic peptide 12His Gly Glu Gly Thr
Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1 5 10 15Gln Ala Ala Lys
Glu Phe Ile Ala Trp Leu Lys Asn Gly Gly Gly 20 25
301331PRTArtificial SequenceSynthetic peptide 13His Val Glu Gly Thr
Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1 5 10 15Gln Ala Ala Lys
Glu Phe Ile Ala Trp Leu Lys Asn Gly Gly Gly 20 25
301431PRTArtificial SequenceSynthetic peptide 14His Gly Glu Gly Thr
Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1 5 10 15Gln Ala Ala Lys
Glu Phe Ile Ala Trp Leu Val Lys Gly Gly Pro 20 25
301531PRTArtificial SequenceSynthetic peptide 15His Val Glu Gly Thr
Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1 5 10 15Gln Ala Ala Lys
Glu Phe Ile Ala Trp Leu Val Lys Gly Gly Pro 20 25
301631PRTArtificial SequenceSynthetic peptide 16His Gly Glu Gly Thr
Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1 5 10 15Gln Ala Ala Lys
Glu Phe Ile Ala Trp Leu Lys Asn Gly Gly Pro 20 25
301731PRTArtificial SequenceSynthetic peptide 17His Val Glu Gly Thr
Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1 5 10 15Gln Ala Ala Lys
Glu Phe Ile Ala Trp Leu Lys Asn Gly Gly Pro 20 25
301830PRTArtificial SequenceSynthetic peptide 18His Gly Glu Gly Thr
Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1 5 10 15Gln Ala Ala Lys
Glu Phe Ile Ala Trp Leu Val Lys Gly Gly 20 25 301930PRTArtificial
SequenceSynthetic peptide 19His Val Glu Gly Thr Phe Thr Ser Asp Val
Ser Ser Tyr Leu Glu Glu1 5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp
Leu Val Lys Gly Gly 20 25 302030PRTArtificial SequenceSynthetic
peptide 20His Val Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu
Glu Glu1 5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Asn Gly
Gly 20 25 302130PRTArtificial SequenceSynthetic peptide 21His Gly
Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1 5 10 15Gln
Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Asn Gly Gly 20 25
302240PRTArtificial sequenceSynthetic peptideMOD_RES(2)..(2)Aib
22His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1
5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Gly Pro
Ser 20 25 30Ser Gly Ala Pro Pro Pro Ser Cys 35 402340PRTArtificial
sequenceSynthetic
peptideMOD_RES(2)..(2)Aibmisc_feature(40)..(40)Xaa is Penicillamine
(Pen) 23His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu
Glu1 5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Gly
Pro Ser 20 25 30Ser Gly Ala Pro Pro Pro Ser Xaa 35
402431PRTArtificial sequenceSynthetic peptide 24His Ala Glu Gly Thr
Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly1 5 10 15Gln Ala Ala Lys
Glu Phe Ile Ala Trp Leu Val Lys Gly Arg Cys 20 25
302539PRTArtificial sequenceSynthetic peptide 25His Gly Glu Gly Thr
Phe Thr Ser Asp Leu Ser Lys Gln Met Glu Glu1 5 10 15Glu Ala Val Arg
Leu Phe Ile Glu Trp Leu Lys Asn Gly Gly Pro Ser 20 25 30Ser Gly Ala
Pro Pro Pro Ser 352640PRTArtificial sequenceSynthetic peptide 26Ala
Gly Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly1 5 10
15Gln Ala Ala Lys Glu Ala Ile Ala Trp Leu Val Lys Gly Gly Pro Ser
20 25 30Ser Gly Ala Pro Pro Pro Ser Cys 35 402740PRTArtificial
sequenceSynthetic peptidemisc_feature(40)..(40)Xaa is Penicillamine
(Pen) 27Ala Gly Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu
Gly1 5 10 15Gln Ala Ala Lys Glu Ala Ile Ala Trp Leu Val Lys Gly Gly
Pro Ser 20 25 30Ser Gly Ala Pro Pro Pro Ser Xaa 35
402827PRTArtificial sequenceSynthetic peptideMOD_RES(2)..(2)Aib
28His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1
5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val 20
252928PRTArtificial sequenceSynthetic peptideMOD_RES(2)..(2)Aib
29His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1
5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys 20
253029PRTArtificial sequenceSynthetic peptideMOD_RES(2)..(2)Aib
30His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1
5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly 20
253130PRTArtificial sequenceSynthetic peptideMOD_RES(2)..(2)Aib
31His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1
5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Gly 20
25 303231PRTArtificial sequenceSynthetic peptideMOD_RES(2)..(2)Aib
32His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1
5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Gly Pro
20 25 303332PRTArtificial sequenceSynthetic
peptideMOD_RES(2)..(2)Aib 33His Xaa Glu Gly Thr Phe Thr Ser Asp Val
Ser Ser Tyr Leu Glu Glu1 5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp
Leu Val Lys Gly Gly Pro Ser 20 25 303433PRTArtificial
sequenceSynthetic peptideMOD_RES(2)..(2)Aib 34His Xaa Glu Gly Thr
Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1 5 10 15Gln Ala Ala Lys
Glu Phe Ile Ala Trp Leu Val Lys Gly Gly Pro Ser 20 25
30Ser3534PRTArtificial sequenceSynthetic peptideMOD_RES(2)..(2)Aib
35His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1
5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Gly Pro
Ser 20 25 30Ser Gly3635PRTArtificial sequenceSynthetic
peptideMOD_RES(2)..(2)Aib 36His Xaa Glu Gly Thr Phe Thr Ser Asp Val
Ser Ser Tyr Leu Glu Glu1 5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp
Leu Val Lys Gly Gly Pro Ser 20 25 30Ser Gly Ala 353736PRTArtificial
sequenceSynthetic peptideMOD_RES(2)..(2)Aib 37His Xaa Glu Gly Thr
Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1 5 10 15Gln Ala Ala Lys
Glu Phe Ile Ala Trp Leu Val Lys Gly Gly Pro Ser 20 25 30Ser Gly Ala
Pro 353840PRTArtificial sequenceSynthetic
peptideMOD_RES(40)..(40)Xaa is 4-azidonorleucine 38His Gly Glu Gly
Thr Phe Thr Ser Asp Leu Ser Lys Gln Met Glu Glu1 5 10 15Glu Ala Val
Arg Leu Phe Ile Glu Trp Leu Lys Asn Gly Gly Pro Ser 20 25 30Ser Gly
Ala Pro Pro Pro Ser Xaa 35 403932PRTArtificial sequenceSynthetic
peptideMOD_RES(2)..(2)AibMOD_RES(32)..(32)Xaa is 4-azidonorleucine
39His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly1
5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Arg Gly Arg Gly
Xaa 20 25 304032PRTArtificial sequenceSynthetic
peptideMOD_RES(2)..(2)AibMOD_RES(21)..(21)Xaa is Lysine (5 azido
pentanoic acid amide) 40His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser
Ser Tyr Leu Glu Gly1 5 10 15Gln Ala Ala Asn Xaa Glu Phe Ile Ala Trp
Leu Val Arg Gly Arg Gly 20 25 304131PRTArtificial sequenceSynthetic
peptideMOD_RES(2)..(2)AibMOD_RES(29)..(29)AibMOD_RES(31)..(31)Xaa
is 4-azidonorleucine 41His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser
Ser Tyr Leu Glu Gly1 5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu
Val Lys Xaa Arg Xaa 20 25 304231PRTArtificial sequenceSynthetic
peptideMOD_RES(31)..(31)Xaa is 4-azidonorleucine 42His Ser Glu Gly
Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly1 5 10 15Gln Ala Ala
Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Arg Xaa 20 25
304338PRTArtificial sequenceSynthetic
peptideMOD_RES(2)..(2)AibMOD_RES(38)..(38)Xaa is 4-azidonorleucine
43His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1
5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Gly Pro
Ser 20 25 30Ser Gly Ala Pro Pro Xaa 354434PRTArtificial
sequenceSynthetic peptideMOD_RES(2)..(2)AibMOD_RES(44)..(44)Xaa is
4-azidonorleucine 44His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser
Tyr Leu Glu Glu1 5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val
Lys Gly Gly Pro Ser 20 25 30Ser Xaa4529PRTArtificial
sequenceSynthetic peptideMOD_RES(2)..(2)AibMOD_RES(29)..(29)Xaa is
4-azidonorleucine 45His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser
Tyr Leu Glu Glu1 5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val
Lys Xaa 20 254628PRTArtificial sequenceSynthetic
peptideMOD_RES(2)..(2)AibMOD_RES(28)..(28)Xaa is 4-azidonorleucine
46His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1
5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Xaa 20
254728PRTArtificial sequenceSynthetic peptideMOD_RES(2)..(2)Aib
47His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1
5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Cys 20
254827PRTArtificial sequenceSynthetic
peptideMOD_RES(2)..(2)AibMOD_RES(27)..(27)Xaa is 4-azidonorleucine
48His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1
5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Xaa 20
254926PRTArtificial sequenceSynthetic
peptideMOD_RES(2)..(2)AibMOD_RES(26)..(26)Xaa is 4-azidonorleucine
49His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1
5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Xaa 20
255020PRTArtificial sequenceSynthetic
peptideMOD_RES(2)..(2)AibMOD_RES(20)..(20)Xaa is 4-azidonorleucine
50His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1
5 10 15Gln Ala Ala Xaa 205130PRTArtificial sequenceSynthetic
peptideMOD_RES(30)..(30)Xaa is 4-azidonorleucine 51His Gly Glu Gly
Thr Phe Thr Ser Asp Leu Ser Lys Gln Met Glu Glu1 5 10 15Glu Ala Val
Arg Leu Phe Ile Glu Trp Leu Lys Asn Gly Xaa 20 25
305229PRTArtificial sequenceSynthetic peptideMOD_RES(29)..(29)Xaa
is 4-azidonorleucine 52His Gly Glu Gly Thr Phe Thr Ser Asp Leu Ser
Lys Gln Met Glu Glu1 5 10 15Glu Ala Val Arg Leu Phe Ile Glu Trp Leu
Lys Asn Xaa 20 255328PRTArtificial sequenceSynthetic
peptideMOD_RES(28)..(28)Xaa is 4-azidonorleucine 53His Gly Glu Gly
Thr Phe Thr Ser Asp Leu Ser Lys Gln Met Glu Glu1 5 10 15Glu Ala Val
Arg Leu Phe Ile Glu Trp Leu Lys Xaa 20 255427PRTArtificial
sequenceSynthetic peptideMOD_RES(27)..(27)Xaa is 4-azidonorleucine
54His Gly Glu Gly Thr Phe Thr Ser Asp Leu Ser Lys Gln Met Glu Glu1
5 10 15Glu Ala Val Arg Leu Phe Ile Glu Trp Leu Xaa 20
255526PRTArtificial sequenceSynthetic peptideMOD_RES(26)..(26)Xaa
is 4-azidonorleucine 55His Gly Glu Gly Thr Phe Thr Ser Asp Leu Ser
Lys Gln Met Glu Glu1 5 10 15Glu Ala Val Arg Leu Phe Ile Glu Trp Xaa
20 255640PRTArtificial sequenceSynthetic
peptideMOD_RES(2)..(2)AibMOD_RES(40)..(40)Xaa is 4-azidonorleucine
56His Xaa Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Glu1
5 10 15Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Gly Pro
Ser 20 25 30Ser Gly Ala Pro Pro Pro Ser Xaa 35 405740PRTArtificial
sequenceSynthetic peptide 57His Gly Glu Gly Thr Phe Thr Ser Asp Leu
Ser Lys Gln Met Glu Glu1 5 10 15Glu Ala Val Arg Leu Phe Ile Glu Trp
Leu Lys Asn Gly Gly Pro Ser 20 25
30Ser Gly Ala Pro Pro Pro Ser Cys 35 405819DNAArtificial
sequenceSynthetic oligonucleotide 58tcagcattct aatagcagc
195919DNAArtificial sequenceSynthetic oligonucleotide 59tcatcttctt
aaaataccc 196019DNAArtificial sequenceSynthetic oligonucleotide
60tcaggccaat acgccgtca 196123DNAArtificial sequenceSynthetic
oligonucleotide 61tcagccaagg tctgaaggtc acc 236216DNAArtificial
sequenceSynthetic oligonucleotide 62gctgctatta gaatgc
166316DNAArtificial sequenceSynthetic oligonucleotide 63gcattctaat
agcagc 166416DNAArtificial sequenceSynthetic oligonucleotide
64tcttcttaaa ataccc 166516DNAArtificial sequenceSynthetic
oligonucleotide 65gcattctaat agcagc 166624DNAArtificial
sequencePrimer 66ccattctatc atcaacgggt acaa 246722DNAArtificial
sequencePrimer 67agcaagtggg aaggtgtaat cc 226820DNAArtificial
sequencePrimer 68cagtcacata cggccaatcc 206924DNAArtificial
sequencePrimer 69cgtaacttga tttgctgtcc tgaa 247025DNAArtificial
sequenceProbe 70tgagcccttt gccccagatg cctat 257124DNAArtificial
sequencePrimer 71gaggaatcag atgaggatat ggga 247220DNAArtificial
sequencePrimer 72aagcaggctg acttggttgc 207326DNAArtificial
sequenceProbe 73tcggtctctt cgactaatcc cgccaa 267420DNAArtificial
sequencePrimer 74aggcgttgtg cgtagaggat 207529DNAArtificial
sequencePrimer 75aaaggttacc ataagtaagt tccagaaaa
297628DNAArtificial sequenceProbe 76agtggttggt aaaaatccgt gaggtcgg
287721DNAArtificial sequencesiRNA 77ttatctataa tgatcaggta a
217819DNAArtificial sequencesiRNA 78acctgatcat tatagataa
197932PRTArtificial sequenceSynthetic peptide 79Asp Leu Ser Lys Gln
Met Glu Glu Glu Ala Val Arg Leu Phe Ile Glu1 5 10 15Trp Leu Lys Asn
Gly Gly Pro Ser Ser Gly Ala Pro Pro Pro Ser Cys 20 25 30
* * * * *