U.S. patent application number 13/188031 was filed with the patent office on 2012-04-05 for method.
Invention is credited to Claus Lindvald JOHANSEN, Soren Kjaerulff, Susan Mampusta Madrid, Henrik Pedersen, Charlotte Horsmans Poulsen, Masoud Rajabi Zargahi.
Application Number | 20120083426 13/188031 |
Document ID | / |
Family ID | 46300192 |
Filed Date | 2012-04-05 |
United States Patent
Application |
20120083426 |
Kind Code |
A1 |
JOHANSEN; Claus Lindvald ;
et al. |
April 5, 2012 |
METHOD
Abstract
A method is described for releasing a soluble or membrane
associated intracellular protein of interest (POI) comprising the
steps of: providing a cell comprising a soluble or membrane
associated intracellular POI; contacting the cell with a membrane
extracting composition; and causing the POI to be released from the
cell under conditions sufficient for the specific release of the
POI and in a soluble form.
Inventors: |
JOHANSEN; Claus Lindvald;
(Hojbjerg, DK) ; Kjaerulff; Soren; (Hillerod,
DK) ; Madrid; Susan Mampusta; (Vedbaek, DK) ;
Pedersen; Henrik; (Ostbirk, DK) ; Poulsen; Charlotte
Horsmans; (Braband, DK) ; Zargahi; Masoud Rajabi;
(Abyhoj, DK) |
Family ID: |
46300192 |
Appl. No.: |
13/188031 |
Filed: |
July 21, 2011 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
12243364 |
Oct 1, 2008 |
|
|
|
13188031 |
|
|
|
|
10693234 |
Oct 24, 2003 |
7455990 |
|
|
12243364 |
|
|
|
|
09722938 |
Nov 27, 2000 |
|
|
|
10693234 |
|
|
|
|
PCT/IB00/01886 |
Nov 24, 2000 |
|
|
|
09722938 |
|
|
|
|
Current U.S.
Class: |
506/11 ;
252/182.12; 435/190; 435/232; 435/25; 435/29; 435/7.1; 435/7.4;
435/7.92; 530/350; 530/422; 530/423 |
Current CPC
Class: |
C12P 21/02 20130101;
C12N 15/81 20130101; C07K 14/39 20130101 |
Class at
Publication: |
506/11 ; 530/422;
435/7.92; 435/232; 435/190; 435/7.4; 530/350; 435/25; 435/7.1;
435/29; 530/423; 252/182.12 |
International
Class: |
C40B 30/08 20060101
C40B030/08; G01N 33/566 20060101 G01N033/566; C12N 9/88 20060101
C12N009/88; C09K 3/00 20060101 C09K003/00; G01N 33/573 20060101
G01N033/573; C07K 14/00 20060101 C07K014/00; C12Q 1/26 20060101
C12Q001/26; C12Q 1/02 20060101 C12Q001/02; C07K 1/14 20060101
C07K001/14; C12N 9/04 20060101 C12N009/04 |
Foreign Application Data
Date |
Code |
Application Number |
Nov 24, 1999 |
GB |
9927801.2 |
Claims
1. A method for extracting a soluble or membrane associated
intracellular recombinant protein of interest (POI) from a
bacterial, yeast or fungal cell comprising the steps of: (a)
providing a bacterial, yeast or fungal cell comprising a soluble or
membrane associated intracellular recombinant POI; (b) releasing
the recombinant POI from the cell by contacting the cell with a
membrane extracting composition comprising a quarternary ammonium
compound at a concentration of between 0.05% to 0.6% by weight,
under conditions sufficient for the release of the recombinant POI
and in a soluble form (c) recovering the recombinant POI from the
membrane extracting composition.
2. A method according to claim 1 in which the bacterial, yeast or
fungal cell is a transformed cell.
3. A method according to claim 1 in which the intracellular
recombinant POI is produced by recombinant DNA techniques.
4. A method according to claim 1, in which the cell is a yeast
cell.
5. A method according to claim 1, in which the quarternary ammonium
compound is selected from the group consisting of Lauroyl Trimethyl
Ammonium Bromide (LTAB), Myristyl Trimethyl Ammonium Chloride
(MTAC), CetylTrimethyl Ammonium Chloride (CTAC), Cetrimide, Cetyl
Trimethyl Ammonium Bromide (CTAB), Stearoyl Trimethyl Ammonium
Chloride (STAC), Stearoyl Trimethyl Ammonium Bromide (STAB),
Benzalkonium Chloride (alkyldimethylbenzylammonium chloride),
N-Cetylpyridinium Bromide (N-Hexadecylpyridinium bromide),
N-Cetylpyridinium Chloride (N-Hexadecylpyridinium chloride), Benzyl
Dimethyl Tetradecyl Ammonium Chloride, Benzyl Dimethyl Hexadecyl
Ammonium Chloride and a combination of any two or more thereof.
6. A method according to claim 1 in which the bacterial yeast or
fungal cell is contacted with the membrane extracting composition
at temperatures from 4.degree. C. to 40.degree. C.
7. A method according to claim 1 in which the bacterial, yeast or
fungal cell is contacted with the membrane extracting composition
at a pH of from 2.0 to 11.0.
8. A method for screening for mutated cells or transformed cells
producing elevated levels of a soluble or membrane associated
intracellular recombinant POI comprising the steps of: (a) growing
the mutated cells at 30.degree. C.; (b) incubating the mutated
cells or transformed cells with the membrane extracting composition
in a method as defined in claim 1, (c) recovering the cell free
medium; (d) screening the cell free medium for elevated levels of
the intracellular recombinant POI; such that the presence of the
intracellular recombinant POI in the cell free medium is indicative
that the intracellular recombinant POI has been released, in which
the mutated or transformed cell is a bacterial, yeast or fungal
cell.
9. A method of using a membrane extracting composition comprising a
quaternary ammonium compound to extract a soluble or membrane
associated intracellular recombinant POI from a bacterial, yeast or
fungal cell, in which the membrane extracting composition comprises
a quaternary ammonium compound at a concentration of between 0.05%
to 0.6% by weight and is contacted with the bacterial, yeast or
fungal cell, and in which the released recombinant POI is recovered
from the membrane extracting composition.
10. A method for screening for mutated cells or transformed cells
producing elevated levels of a soluble or membrane associated
intracellular recombinant POI comprising the steps of: (a) growing
the mutated cells at 30.degree. C.; (b) incubating the mutated
cells or transformed cells with the membrane extracting composition
comprising a quaternary ammonium compound at a concentration of
between 0.05% to 0.6% by weight; (c) recovering the cell free
medium (d) screening the cell free medium for elevated levels of
the intracellular recombinant POI; such that the presence of the
intracellular recombinant POI in the cell free medium is indicative
that the intracellular recombinant POI has been released.
11. A membrane extracting composition suitable for releasing a
soluble or membrane associated intracellular recombinant POI,
wherein the composition is contacted with the cell under the
following conditions: (a) a percentage by weight of quaternary
ammonium compound from about 0.05% to about 0.6%; (b) a pH of from
about 2.0 to about 11.0 (c) a temperature of from about 4.degree.
C. to about 40.degree. C.; Such that the intracellular recombinant
POI substantially free of contaminating proteins is obtained.
12. A method of using a membrane extracting composition comprising
a quaternary ammonium compound to extract a soluble or membrane
associated intracellular recombinant POI from a bacterial, yeast or
fungal cell, the POI being released from the bacterial, yeast or
fungal cell, in which the membrane extracting composition comprises
a quaternary ammonium compound at a concentration of between 0.05%
to 0.6% by weight and is contacted with the bacterial, yeast or
fungal cell and in which the released recombinant POI is recovered
from the membrane extracting composition.
13. The method according to claim 1, in which the recombinant POI
is a glucan lyase.
14. The method according to claim 9, in which the recombinant POI
is a glucan lyase.
15. The method according to claim 10, in which the recombinant POI
is a glucan lyase.
16. The method according to claim 12, in which the recombinant POI
is a glucan lyase.
17. The method according to claim 1, in which the recombinant POI
is an interleukin-1 receptor antagonist (IL-1ra).
18. The method according to claim 9, in which the recombinant POI
is an interleukin-1 receptor antagonist (IL-1ra).
19. The method according to claim 10, in which the recombinant POI
is an interleukin-1 receptor antagonist (IL-1ra).
20. The method according to claim 12, in which the recombinant POI
is an interleukin-1 receptor antagonist (IL-1ra).
21. The method according to claim 1, in which the recombinant POI
is hexose oxidase (HOX) enzyme.
22. The method according to claim 9, in which the recombinant POI
is hexose oxidase (HOX) enzyme.
23. The method according to claim 10, in which the recombinant POI
is hexose oxidase (HOX) enzyme.
24. The method according to claim 12, in which the recombinant POI
is hexose oxidase (HOX) enzyme.
25. The method according to claim 21, in which the hexose oxidase
(HOX) enzyme comprises the amino acid sequence set out in SEQ ID No
22.
26. The method according to claim 22, in which the hexose oxidase
(HOX) enzyme comprises the amino acid sequence set out in SEQ ID No
22.
27. The method according to claim 23, in which the hexose oxidase
(HOX) enzyme comprises the amino acid sequence set out in SEQ ID No
22.
28. The method according to claim 24, in which the hexose oxidase
(HOX) enzyme comprises the amino acid sequence set out in SEQ ID No
22.
29. The method according to claim 21, in which the hexose oxidase
(HOX) enzyme is encoded by a nucleotide sequence set out in SEQ ID
No 22.
30. The method according to claim 22, in which the hexose oxidase
(HOX) enzyme is encoded by a nucleotide sequence set out in SEQ ID
No 22.
31. The method according to claim 23, in which the hexose oxidase
(HOX) enzyme is encoded by a nucleotide sequence set out in SEQ ID
No 22.
32. The method according to claim 24, in which the hexose oxidase
(HOX) enzyme is encoded by a nucleotide sequence set out in SEQ ID
No 22.
33. The method according to claim 21, in which the hexose oxidase
(HOX) enzyme is encoded by a nucleotide sequence capable of
hybridising to the nucleotide sequence set out in SEQ ID No 22.
34. The method according to claim 22, in which the hexose oxidase
(HOX) enzyme is encoded by a nucleotide sequence capable of
hybridising to the nucleotide sequence set out in SEQ ID No 22.
35. The method according to claim 23, in which the hexose oxidase
(HOX) enzyme is encoded by a nucleotide sequence capable of
hybridising to the nucleotide sequence set out in SEQ ID No 22.
36. The method according to claim 24, in which the hexose oxidase
(HOX) enzyme is encoded by a nucleotide sequence capable of
hybridising to the nucleotide sequence set out in SEQ ID No 22.
37. A POI producible by a method according to claim 1 wherein said
POI is glucan lyase.
38. A POI producible by a method according to claim 1 wherein said
POI is interleukin-1 receptor antagonist.
39. A POI producible by a method according to claim 1 wherein said
POI is hexose oxidase (HOX).
40. A POI producible by the method according to claim 1 wherein
said POI is hexose oxidase enzyme and said HOX enzyme is encoded by
a nucleotide sequence, and wherein the nucleotide sequence set out
in SEQ ID NO: 22, or a sequence complementary to the hybridisable
sequence, and wherein the nucleotide sequence is synthesised by the
oligonucleotides as set out in SEQ ID NOs: 2-22.
41. A POI as defined in claim 1, wherein the POI is released in a
substantially non-glycosylated form from a eukaryotic host
organism.
42. A substantially non-glycosylated POI released from a eukaryotic
host organism.
43. A substantially non-glycosylated POI released from a eukaryotic
host organism, wherein the POI is released by the method of claim
1.
Description
[0001] This application is a continuation of U.S. application Ser.
No. 10/693,234 filed Oct. 24, 2003 as a continuation-in-part of
U.S. application Ser. No. 09/722,938 filed Nov. 27, 2000, which is
a continuation of International Application No. PCT/IB00/01886,
filed Nov. 24, 2000, designating the US, and published as WO
01/38544 on May 31, 2001 (inventors: JOHANSEN, KJAERULFF, MADRID,
PEDERSEN, POULSEN, ZARGAHI; Atty Docket No. P006775WOJCTH), which
claims priority from Great Britain Application no. 9927801.2, filed
Nov. 24, 1999.
[0002] Each of the foregoing applications, patents and publications
and all documents cited or referenced therein ("application cited
documents") and all documents cited or referenced in this
specification ("herein cited documents") and all documents
referenced or cited in herein cited documents and in application
cited documents, including during the prosecution of any of the
application cited documents, are hereby incorporated by
reference.
FIELD OF THE INVENTION
[0003] The present invention relates to a method for releasing an
intracellular protein of interest (POI).
[0004] In particular, the present invention relates to a method for
releasing a soluble or membrane associated intracellular protein of
interest (POI) using a membrane extracting composition which
assists in the release of the POI.
BACKGROUND OF THE INVENTION
[0005] The traditional way for recovering an intracellular POI,
such as an enzyme, has been to use a mechanical disruption method
(Naglak et al 1990) such as a bead mill or a cell homogenizer
operating with a french press principle. However, these mechanical
disruption methods suffer from the disadvantage that they are
energy consuming methods with a low capacity and the cell
homogenizers or similar equipment required for mechanical
disruption are expensive to purchase. In addition, mechanical
methods expose the cells, and hence the extracted POI to very harsh
conditions, especially as most proteins will be denatured by the
heat generated unless the mechanical device and/or homogenate is
efficiently cooled.
[0006] Furthermore, some cells, such as yeast cells (such as those
from Hansenula) are difficult to disrupt mechanically and more than
one passage through a cell homogenizer is needed. The cell
homogenate may also contain cell wall fragments and DNA, which
results in a high viscosity. This means that the separation of cell
debris from the POI can prove to be a difficult operation. In
addition, the resulting cell free homogenate may contain not only
the intracellular POI but also a large number (sometimes several
thousand) of different intracellular proteins and enzymes
associated with the general cell metabolism. This means that the
resultant cell free homogenate may be not only difficult to
concentrate by ultrafiltration but may also provide problems with
respect to obtaining the right commercial concentration of a given
POI.
[0007] In order to minimise the potential detrimental effect of
some mechanical disruption methods, chemical methods using, for
example, detergents have been developed to permeabilize yeast
cells. By way of example, the non-ionic detergent, polyethoxylated
octylphenols, commercially available as Triton X-100, has been used
either alone or in combination with freeze thaw cycles (referenced
in Naglak et al 1990). In addition, U.S. Pat. No. 5,124,256 (Crahay
et al 1992) discloses a method whereby proteins were extracted from
Saccharomyces yeast by means of treating the yeasts in an aqueous
medium with a neutral water-soluble mineral salt and a non-ionic
water-soluble polyethoxylated alkylphenol surfactant having a
Hydrophilic Lipophilic Balance (HLB) of between 8 and 15.
[0008] However, these non-ionic water-soluble polyethoxylated
alkylphenol surfactants which include polyethoxylated octylphenols,
nonylphenols and tributylphenols, (particularly those commercially
available under the trade marks TritonX-100, Nonidet P-40 and
Sapogenat T-080) suffer from the drawbacks that (i) they may not
have a significant extracting effect when used alone and (ii) these
surfactants can interfere with subsequent measurements of the
enzymatic activity of the POI.
[0009] Several organic solvents have also been used to both
permeabilize yeast cells in in situ enzymatic assays and for
removing proteins from yeast cells. Examples of such solvents
include but are not limited to toluene, ethyl acetate, dimethyl
sulfoxide, and benzene combined with glycerol (Naglak et al 1990).
However, these solvents are unattractive to use in industrial scale
production when fermentor volumes of up to 200 m.sup.3 are
required.
[0010] Digitonin and other naturally occurring saponins have also
been shown to permeabilize a number of eukaryotic cells (see Joshi
et al 1989). Although the exact mechanism of digitonin
permeabilization is not known, it is believed that digitonin forms
a complex with the cholesterol present in the cell membrane and
renders the membrane leaky. Digitonin permeabilization of yeast
cells may also be due to the complexing of ergosterols of the yeast
membrane. Joshi et al (1989) used digitonin (0.1%) to permeabilize
the yeast Kluyveromyces which facilitated the intracellular
catalysis of lactose to glucose and galactose. The non-ionic
detergent saponin, from Quillaja Bark, is another cholesterol
complexing agent, which is known to permeabilise at least mammalian
cells (Naglak et al 1990). Again, like the non-ionic detergents as
outlined above, the use of digitonin and other naturally occurring
saponins may suffer from the drawback that when used alone, they
may not have a significant extracting effect.
[0011] U.S. Pat. No. 5,240,834 (Frankel et al) describes a protein
extraction using the detergent Sarkosyl (N-lauryl sarcosine), see
Example 1 (paragraphs 3 to 4) as well as lines 67 of column 3 to
line 2 of column 4. U.S. Pat. No. 6,251,626 (Stougaard et al)
describes extraction of HOX from yeast or bacterial cells, but the
protein is released by mechanical disruption in a French press. The
yeast cells are exposed to enormous pressure (to 20,000 p.s.i.) in
order to disrupt them and to release the recombinant HOX enzyme
(lines 25 to 31 of column 40).
[0012] Chaotropic agents have also been used to facilitate the
extraction of intracellular enzymes. By way of example, U.S. Pat.
No. 3,801,461 (Miyake and Shiosaka 1974) discloses a process for
extracting intracellular enzymes produced in the mycelia or cells
of fungi or bacteria using a chaotrophic solution such as a urea
solution. U.S. Pat. No. 4,683,293 (Craig 1987) also discloses a
method for selective extraction of lipophilic proteins from
transformed cells of the genus Pichia by cell lysis in the presence
of chaotrophic salts such as sodium thiocyanate, sodium iodide,
sodium hypochlorite, lithium bromide, guanidium hydrochloride and
urea. However, chaotrophic agents suffer from the disadvantage that
exposure of the POI to a chaotrophic agent, such as urea can result
in an actual loss of enzyme activity through denaturation of the
POI.
[0013] In addition to the drawbacks cited above, the above cited
prior art only relates to the permeabilisation of host cells to low
molecular weight molecules while the POI remains unchanged within
the cell. In particular, none of the above cited prior art relates
to the extraction of a membrane associated intracellular POI under
conditions which do not affect the nature and/or activity of the
POI. More in particular, none of the above cited prior art relates
to a method for assisting in the release of a membrane associated
intracellular POI which is trapped and is incapable of being
secreted from a host cell.
[0014] The present invention thus seeks to overcome the problems
associated with the extraction methods of the prior art.
[0015] The present invention thus provides a method for releasing a
soluble or membrane associated intracellular protein of interest
(POI) from a host organism.
SUMMARY OF THE INVENTION
[0016] The present invention relates to a method for assisting in
the release of a soluble or membrane associated intracellular POI
which is trapped and/or is incapable of being secreted from a host
cell. The extraction of an intracellular POI using the method of
the present invention was compared with a traditional cell
disruption method and with extraction procedures using other
ionic/non ionic detergents and emulsifiers. Combinations of
detergents with protease and salts were also investigated. The
results of the present invention indicate that the extraction of a
soluble or membrane associated intracellular POI using the method
of the present invention is advantageous because:
[0017] (i) traditional cell disruption techniques can be
avoided;
[0018] (ii) the intracellular POI may be recovered free from
contaminating DNA and cell wall fragments;
[0019] (iii) the intracellular POI may be recovered from a
eukaryotic host organism, such as yeast, before glycosylation takes
place. Overglycosylation of secreted proteins is a well known
problem especially in eukaryotic host organisms such as yeast. This
drawback associated with yeast expression systems has led to a
reluctance to use yeast as a production system even though yeast
expression vectors are capable of producing proteins at high levels
of expression with a large amounts of biomass, and additionally,
yeast has approved use in food. By expressing the POI
intracellularly and then extracting the POI with the method of the
present invention, the POI will be non-glycosylated, because the
POI has not passed through the secretion pathway where
glycosylation takes place;
[0020] (iv) the fermentation procedure that precedes the method of
the present invention can be carried out at any pH that is suitable
for the host cell. It is well known in the art that a secreted POI
may be affected by the pH of its extracellular growth medium. Up
until now, it was often necessary to maintain the pH of a host
organism growth medium at an approximately neutral pH because
fermentations at such a pH were deemed necessary to maintain the
stability of a secreted POI even though they usually increased the
risk of bacterial contamination. With the method of the present
invention, the POI is not secreted. Thus, the pH of the host
organism growth medium is irrelevant as the intracellular pH
remains constant irrespective of the media pH. Accordingly, the
present invention permits the growth of a host organism (such as
yeast) at a lower pH (such as pH 4.0) which reduces the risk of
bacterial contamination without affecting either biomass or POI
production; and
[0021] (v) the method of the present invention can be used to
prevent contact of the intracellular POI with the extracellular
growth medium. This is advantageous if the POI is unstable in the
extracellular media, because of, for example, protease sensitivity.
By expressing the protein intracellularly and then extracting with
the method of the present invention contact with the extracellular
media is avoided.
SUMMARY ASPECTS OF THE INVENTION
[0022] In one broad aspect, the present invention relates to a
method for releasing a protein of interest (POI) from a cell. The
method comprises the steps of: providing a cell comprising a
soluble or membrane associated intracellular POI; contacting the
cell with a membrane extracting composition, preferably comprising
a quaternary ammonium compound; and causing the POI to be released
from the cell under conditions sufficient for the release of the
POI and in a soluble form.
[0023] We show that the method described here is of general
utility, and may be used to release a number of proteins. In
particular, the POI may be an hexose oxidase (D-hexose:
O.sub.2-oxidoreductase, EC 1.1.3.5). The POI may be an IL1-ra
protein. The POI may comprise a glucan lyase protein. Accordingly,
the POI may be an intracellular protein of interest.
DETAILED ASPECTS OF THE INVENTION
[0024] According to a first aspect of the present invention, we
provide a method for releasing a soluble or membrane associated
intracellular protein of interest (POI) from a cell comprising the
steps of: (a) providing a cell comprising a soluble or membrane
associated intracellular POI; (b) contacting the cell with a
membrane extracting composition comprising a quarternary ammonium
compound (c) causing the POI to be released from the cell under
conditions sufficient for the specific release of the POI and in a
soluble form.
[0025] The quarternary ammonium compound is preferably selected
from the group consisting of Lauroyl Trimethyl Ammonium Bromide
(LTAB), Myristyl Trimethyl Ammonium Chloride (MTAC), Cetyl
Trimethyl Ammonium Chloride (CTAC), Cetrimide, Cetyl Trimethyl
Ammonium Bromide (CTAB), Stearoyl Trimethyl Ammonium Chloride
(STAC), Stearoyl Trimethyl Ammonium Bromide (STAB), Benzalkonium
Chloride (alkyldimethylbenzylammonium chloride), N-Cetylpyridinium
Bromide (N-Hexadecylpyridinium bromide), N-Cetylpyridinium Chloride
(N-Hexadecylpyridinium chloride), Benzyl Dimethyl Tetradecyl
Ammonium Chloride, Benzyl Dimethyl Hexadecyl Ammonium Chloride and
a combination of any two or more thereof.
[0026] The membrane extracting composition may in particular
comprise from about 0.05% to about 0.6% by weight of the
quarternary ammonium compound, preferably from about 0.1% to about
0.5% by weight of the quarternary ammonium compound, preferably
from about 0.2% to about 0.45% by weight of the quarternary
ammonium compound, more preferably about 0.4% by weight of the
quarternary ammonium compound.
[0027] Preferably, the cell is contacted with the membrane
extracting composition at temperatures from about 4.degree. C. to
40.degree. C., preferably from about 20.degree. C. to about
30.degree. C., more preferably about 25.degree. C.
[0028] The cell may be contacted with the membrane extracting
composition at a pH optima of from about 2.0 to about 11.0 (more
especially from about to 5.0 to about 7.0, more especially about
6.3).
[0029] Preferably, the cell is selected from the group consisting
of yeast cells, fungal cells and bacterial cells, preferably from
yeast and fungal cells.
[0030] In preferred embodiments, the cell is a transformed cell.
Furthermore, the cell may be transformed with a nucleic acid
encoding the POI. Preferably, the intracellular POI is produced by
recombinant DNA techniques.
[0031] In one embodiment, the POI is an IL-1ra enzyme.
[0032] In another embodiment, the POI is a glucan lyase enzyme. In
preferred embodiments, the yield of glucan lyase is 1 g/litre or
more. In highly preferred embodiments, the yield of glucan lyase is
3.5 g/litre or more.
[0033] In a further embodiment, the POI is a HOX enzyme. The HOX
enzyme may comprise the amino acid sequence set out in SEQ ID No 22
or a variant, homologue, derivative or fragment thereof.
Preferably, the HOX enzyme is encoded by a nucleotide sequence set
out in SEQ ID No 22 or a variant, homologue, derivative or fragment
thereof.
[0034] Preferably, the HOX enzyme is encoded by a nucleotide
sequence capable of hybridising to the nucleotide sequence set out
in SEQ ID No 22 or a variant, homologue, derivative or fragment
thereof or a sequence complementary to the hybridisable
sequence.
[0035] There is provided, according to a second aspect of the
present invention, method for screening for mutated cells or
transformed cells producing elevated levels of a soluble or
membrane associated intracellular POI comprising the steps of: (a)
growing the mutated cells at 30.degree. C.; (b) incubating the
mutated cells or transformed cells with the membrane extracting
composition comprising a quarternary ammonium compound; (c)
recovering the cell free medium; (d) screening the cell free medium
for elevated levels of the intracellular POI that the presence of
the intracellular POI in the cell free medium is indicative that
the intracellular POI has been released.
[0036] We provide, according to a third aspect of the present
invention, a membrane extracting composition suitable for
specifically releasing a soluble or membrane associated
intracellular POI, in which the composition is contacted with the
cell under the following conditions: (a) a percentage by weight of
quarternary ammonium compound from about 0.05% to about 0.6% (more
especially from about 0.1% to about 0.5%, more especially from
about 0.2% to about 0.45%, more especially about 0.4%); (b) a pH
optima of from about 2.0 to about 11.0 (more especially from about
to 5.0 to about 7.0, more especially about 6.3); (c) a temperature
optima of from about 4.degree. C. to about 40.degree. C., (more
especially from about 20.degree. C. to about 30.degree. C., more
especially about 25.degree. C.) that the intracellular POI
substantially free of contaminating proteins is obtained.
[0037] As a fourth aspect of the present invention, there is
provided use of a membrane extracting composition comprising a
quarternary ammonium compound to selectively release a soluble or
membrane associated intracellular POI.
[0038] We provide, according to a fifth aspect of the present
invention, a HOX enzyme producible by a method as specified, in
which the HOX enzyme is encoded by a nucleotide sequence as defined
above, in which the nucleotide sequence is synthesised by the
oligonucleotides as set out in SEQ ID Nos 2-22.
[0039] Preferably, the POI is released in a substantially
non-glycoslyated form from a eukaryotic host organism
[0040] The present invention, in a sixth aspect, provides a
substantially non-glycosylated POI released from a eukaryotic host
organism. Preferably, the POI is released by a method according to
a first aspect of the invention.
[0041] We further describe a method for releasing a soluble or
membrane associated intracellular protein of interest (POI) from a
transformed cell comprising the steps of: providing a transformed
cell comprising an soluble or membrane associated intracellular
POI; contacting the transformed cell with a membrane extracting
composition causing the POI to be released from the transformed
cell under conditions sufficient for the specific release of the
POI and in a soluble form.
[0042] We also describe a method for releasing a HOX enzyme from a
transformed cell comprising the steps of: providing a transformed
cell comprising a HOX enzyme the transformed cell with a membrane
extracting composition causing the HOX enzyme to be released from
the transformed cell under conditions sufficient for the specific
release of the a HOX enzyme and in a soluble form.
[0043] We also describe a method for releasing an interleukin 1
receptor antagonist (IL-1ra) from a transformed cell comprising the
steps of: providing a transformed cell comprising a IL-1ra the
transformed cell with a membrane extracting composition causing the
IL-1ra to be released from the transformed cell under conditions
sufficient for the specific release of the IL-1ra and in a soluble
form.
[0044] We also describe a method for screening for mutants
producing elevated levels of a soluble or membrane associated
intracellular POI comprising the steps of: growing the mutated
cells at 30.degree. C. the mutated cells with the membrane
extracting composition the cell free medium the cell free medium
for elevated levels of the intracellular POI that the presence of
the intracellular POI cell free medium is indicative that the
intracellular POI has been released.
[0045] We also describe a membrane extracting composition suitable
for releasing a soluble or membrane associated intracellular POI
wherein the composition is contacted with the cell under the
following conditions of: a percentage by weight of quarternary
ammonium compound from about 0.05% to about 0.6% (more especially
from about 0.1% to about 0.5%, more especially from about 0.2% to
about 0.45%, more especially about 0.4%) a pH optima of from about
2.0 to about 11.0 (more especially from about 5.0 to about 7.0,
more especially about 6.3) temperature optima of from about
4.degree. C. to about 40.degree. C., (more especially from about
20.degree. C. to about 30.degree. C., more especially about
25.degree. C.).
[0046] We also describe a membrane extracting composition
comprising a quarternary ammonium compound suitable for releasing a
soluble or membrane associated intracellular POI.
[0047] Other aspects and advantages of the present invention are
presented in the accompanying claims and in the following
description and discussion. These aspects are presented under
separate section headings. However, it is to be understood that the
teachings under each section heading are not necessarily limited to
that particular section heading.
DETAILED DESCRIPTION OF THE INVENTION
[0048] The present invention demonstrates the highly surprising
finding that a membrane extraction composition comprising
quaternary ammonium compounds may be used to obtain a fast,
specific and economically efficient extraction of a soluble or
membrane associated intracellular POI, without resorting to the use
of traditional cell disruption techniques. Advantageously and
unexpectedly, the resulting cell extract contains very little
contaminating intracellular DNA and is relatively free of cell wall
fragments thereby simplifying any further purification steps to
which the POI may be subjected. This is in contradistinction to the
prior art mechanical extraction methods.
Intracellular Protein
[0049] As used herein, the term "intracellular" POI means a POI
which is found within or inside a cell or cells. The intracellular
POI may be localised within a cell (such as in the cytoplasm of the
cell) even though it has a signal secretory mechanism. In this
regard, the intracellular POI may be a POI which is not actively
secreted from a cell or is incapable of being secreted by the cell
even though it has a signal sequence secretory mechanism. In the
alternative, the intracellular POI may be a naturally secreted POI
which has been engineered to prevent its secretion from a cell.
Alternatively, the POI may be a chimeric protein comprising a
membrane binding domain.
[0050] The method of the present invention is in contrast to the
method described in Ahlstrom and Edebo ((1994) FEMS Microbiology
Letters 119 7-12) who report on the release of the periplasmic
.beta.-lactamase from E. coli with tetradecyl betainate. The
periplasm is the region in a bacterial cell between the cell
membrane and the cell wall. Thus, the periplasmic .beta.-lactamase
from E. Coli is localised outside the cell membrane and is not a
cytoplasmic enzyme. In contradistinction, the POI of the present
invention is an intracellular POI which is found within or inside a
cell or cells.
Membrane Associated POI
[0051] As used herein, the term "membrane associated POI" means a
POI which may be localised in the proximity of, but may not be
substantially associated with a cell or plasma membrane. Thus, the
membrane associated enzyme is not a substantially membrane bound
protein or the membrane associated enzyme is not substantially
bound to a cell membrane. The membrane associated POI may be
solubilised by a mechanical treatment with a cell homogeniser.
[0052] Membrane Bound POI
[0053] As used herein, the term "membrane bound POI" means a
protein which is not rendered soluble by mechanical treatment with
a cell homogeniser.
Specific Release
[0054] The term "specific release" means that the specific activity
of the POI is higher than when it has been extracted by mechanical
means--such as by use of a bead mill or a cell homogenizer
operating with a french press principle.
Transformed Cell
[0055] The term "transformed cell" includes cells that have been
transformed by use of recombinant DNA techniques. The
transformation typically occurs by insertion of one or more
nucleotide sequences into a cell that is to be transformed. The
inserted nucleotide sequence may be a heterologous nucleotide
sequence (i.e. is a sequence that is not natural to the cell that
is to be transformed. In addition, or in the alternative, the
inserted nucleotide sequence may be an homologous nucleotide
sequence (i.e. is a sequence that is natural to the cell that is to
be transformed)--so that the cell receives one or more extra copies
of a nucleotide sequence already present in it.
Membrane Extracting Composition
[0056] As used herein, the term "membrane extracting composition"
means a composition capable of affecting components in a cellular
membrane such that a membrane bound and/or membrane associated
intracellular POI is sufficiently dissociated and/or released from
the membrane component and the POI is easily recovered and/or
harvested from the membrane extracting composition. The POI may
also be a soluble POI. In a highly preferred embodiment, the
membrane extracting composition of the present invention comprises
one or more quarternary ammonium compounds or combinations
thereof.
Quarternary Ammonium Compounds
[0057] As used herein, the term "quarternary ammonium compound"
means a compound derivable from ammonium hydroxide or an ammonium
salt by replacement of all four hydrogen atoms of the
NH.sub.4.sup.+ ion by organic groups which may be the same or
different. Typically one of the organic groups is a long chain
(C.sub.8-C.sub.18) alkyl group and the other three are shorter
chain alkyl or other groups.
[0058] In a preferred embodiment, these compounds have the
structure:
CH.sub.3--(CH.sub.2).sub.n--N(CH.sub.3).sup.+.sub.3
[0059] where n is the number of methylene groups in the chain and
where the counter ion may be a halogen such as a chloride or
bromide ion. These compounds have the properties of cationic
detergents and are powerful antimicrobial agents.
[0060] Examples of these quarternary ammonium compound include but
is not limited to Lauroyl Trimethyl Ammonium Bromide (LTAB),
Myristyl Trimethyl Ammonium Chloride (MTAC), Cetyl Trimethyl
Ammonium Chloride (CTAC), Cetyl Trimethyl Ammonium Bromide (CTAB),
Cetrimide (or Cetrimidum which comprises a mixture of alkylammonium
bromides, principally CTAB), Stearoyl Trimethyl Ammonium Chloride
(STAC), Stearoyl Trimethyl Ammonium Bromide (STAB), Benzalkonium
Chloride (alkyldimethylbenzylammonium chloride), N-Cetylpyridinium
Bromide (N-Hexadecylpyridinium bromide), N-Cetylpyridinium Chloride
(N-Hexadecylpyridinium chloride), Benzyl Dimethyl Tetradecyl
Ammonium Chloride, and Benzyl Dimethyl Hexadecyl Ammonium
Chloride.
[0061] By way of example, the structure of some of these compounds
is illustrated as follows. The compounds are listed in the order of
increasing methylene groups:
[0062] LTAB is H.sub.3C--(CH.sub.2).sub.11--N(CH.sub.3).sub.3Br
[0063] MTAC is H.sub.3C--(CH.sub.2).sub.13--N(CH.sub.3).sub.3Cl
[0064] CTAC is H.sub.3C--(CH.sub.2).sub.15--N(CH.sub.3).sub.3Cl
[0065] CTAB is H.sub.3C--(CH.sub.2).sub.15--N(CH.sub.3).sub.3Br
[0066] STAC is H.sub.3C--(CH.sub.2).sub.17--N(CH.sub.3).sub.3Cl
[0067] STAB is H.sub.3C--(CH.sub.2).sub.17--N(CH.sub.3).sub.3Br
[0068] Preferably the quaternary ammonium compound is
cetylpyridinium chloride (CPC, C.sub.21H.sub.38NCl). The structure
of CPC is illustrated as follows:
##STR00001##
[0069] Preferably the quaternary ammonium compound is
cetylpyridinium bromide (CPB, C.sub.21H.sub.38NBr). The structure
of CPB is illustrated as follows:
##STR00002##
[0070] Preferably the quaternary ammonium compound is Benzyl
Dimethyl Tetradecyl Ammonium Chloride (BDTAC: C.sub.23H.sub.42NCl).
The structure of BDTAC is illustrated
[0071] as follows:
##STR00003##
[0072] Preferably the quaternary ammonium compound is Benzyl
Dimethyl Hexadecyl Ammonium Chloride (BDHAC: C.sub.25H.sub.46NCl).
The structure of BDHAC is illustrated as follows:
##STR00004##
[0073] Preferably the quaternary ammonium compound is benzalkonium
chloride (alkyldimethylbenzylammonium chloride).
[0074] The structure of benzalkonium chloride is illustrated as
follows:
C.sub.12H.sub.25N(CH.sub.3).sub.2C.sub.7H.sub.7Cl
[0075] A comparison of the structure of CTAB and benzalkonium
chloride (also known as Alkyldimethylbenzylammonium
chloride--hereinafter referred to under the proprietary name of
Rodalon) is illustrated as follows: [0076] Rodalon:
[0076] ##STR00005## [0077] CTAB:
##STR00006##
[0078] Preferably the quaternary ammonium compound is Lauroyl
Trimethyl Ammonium Bromide (LTAB).
[0079] Preferably the quaternary ammonium compound is Cetyl
Trimethyl Ammonium Chloride (CTAC).
[0080] Preferably the quaternary ammonium compound is Cetyl
Trimethyl Ammonium Bromide (CTAB).
[0081] The cationic detergent CTAB has been shown to be capable of
altering yeast permeability, probably by causing the formation of
transmembrane pores, similar to the suggested mechanism for two
other non-ionic detergents such as Pluronic F-68 and Triton X-100
(King et al 1991). The alteration of cellular permeability using
detergents such as CTAB has facilitated the measurement of
intracellular enzyme activities in whole cells (Sekhar et al 1999).
Moreover, the development of CTAB permeabilised cells has proved
useful for intracellular enzyme catalysis in, for example, cells
from yeast strains such as Saccharomyces cerevisiae (Gowda et al
1991) and Kluyveromyces fragilis (Joshi et al 1987). In these
studies, it is important to note that the detergent CTAB made yeast
cells permeable to low molecular weight molecules (such as
substrates, products, cofactors), while intracellular enzymes and
other POIs remained unchanged within the cell. In contradistinction
to the present invention, none of the above mentioned studies has
disclosed or suggested that the detergent CTAB (or related
quarternary ammonium compounds such as LTAB or CTAC) may be used to
assist in the release of a soluble or membrane associated
intracellular POI from a host cell.
[0082] The cationic detergent CTAB has also been commonly used in
methods for isolating DNA/RNA molecules. By way of example, DNA
molecules may be isolated by treating cells with CTAB at high
temperatures (about 65.degree. C.) and a low salt concentrations
(less than 0.6M NaCl) such that a DNA-CTAB precipitate is formed
and easily recovered. The CTAB detergent is also frequently used to
extract nucleic acids from plants where coprecipitation of neutral
polysaccharides, by either ethanol or isopropanol, may pose a major
problem. CTAB has also been used in the direct lysis and
precipitation of the DNA from the supernatant of E. coli cultures
infected with filamentous phage (see Ishaq et al 1990 Biotechniques
9(1): 19-20, 22, 24; Kambouris et al 1999: FEMS Immunol Med
Microbiol 25(3): 255-64; Kuipers et al 1999 Ann Rheum Dis 58(2):
103-8; Velegraki et al 1999 Med Mycol 37(1) 69-73; White et al 1998
Med Mycol 36(5): 299-303; Woodhead et al 1998 Mol Biotechnol 9(3):
243-6; Mito and Detschart 1998 Parasitol Res 84(7) 596-7; Zhang et
al 191998) J Virol Methods 71(1) 45-50; Reineke et al (1998) Insect
Mol Biol 7(1) 95-9). All of these CTAB based methods for the
isolation of DNA molecules rely on the exploitation of the
properties of CTAB to precipitate nucleic acids and acid
polysaccharides while maintaining the remaining proteins and
neutral polysaccharides in solution. Surprisingly and unexpectedly,
the method of the present invention facilitates not only the
precipitation but also the retention of intracellular DNA.
Consequently, the method of the present invention facilitates the
selective release of an intracellular POI.
Releasing
[0083] According to the method of the present invention, the
soluble or membrane associated intracellular POI is released from a
host cell or cells by contacting the cells with a membrane
extracting composition under conditions sufficient for the release
of the intracellular POI.
Preferable Conditions for Releasing the POI
[0084] (I) % Quaternary Ammonium Compound
[0085] Preferably the membrane extracting composition comprises
from about 0.05% to about 0.6% by weight of a quaternary ammonium
compound, preferably from about 0.1% to about 0.5% by weight of a
quaternary ammonium compound, preferably from about 0.2% to about
0.45% by weight of a quaternary ammonium compound, more preferably
about 0.4% by weight of a quaternary ammonium compound.
[0086] Preferably the quaternary ammonium compound is LTAB.
[0087] Preferably the quaternary ammonium compound is CTAC.
[0088] Preferably the quaternary ammonium compound is CTAB.
[0089] Preferably the quaternary ammonium compound is Benzalkonium
Chloride (C.sub.12H.sub.25N (CH.sub.3).sub.2C.sub.7H.sub.7Cl).
[0090] Preferably the quaternary ammonium compound is
Cetylpyridinium Chloride (CPC, C.sub.21H.sub.38NCl).
[0091] Preferably the quaternary ammonium compound is
Cetylpyridinium Bromide (CPB, C.sub.21H.sub.38NBr).
[0092] Preferably the quaternary ammonium compound is Benzyl
Dimethyl Tetradecyl Ammonium Chloride (BDTAC:
C.sub.23H.sub.42NCl).
[0093] Preferably the quaternary ammonium compound is Benzyl
Dimethyl Hexadecyl Ammonium Chloride (BDTAC:
C.sub.25H.sub.46NCl).
[0094] (II) Temperature
[0095] Preferably the host cell is contacted with the membrane
extracting composition at temperatures from about 4.degree. C. to
about 40.degree. C.
[0096] Preferably the host cell is contacted with the membrane
extracting composition at temperatures from about 20.degree. C. to
about 30.degree. C.
[0097] Preferably the host cell is contacted with the membrane
extracting composition at temperatures of about 25.degree. C.
[0098] Preferably the above temperature ranges are higher if the
POI is a thermostable POI.
[0099] (III) pH
[0100] Preferably the host cell is contacted with the membrane
extracting composition at a pH of from about 2.0 to about 11.0.
[0101] Preferably the host cell is contacted with the membrane
extracting composition at a pH of from about 5.0 to about 7.0.
[0102] Preferably the host cell is contacted with the membrane
extracting composition at a pH of about 6.3.
[0103] It is highly advantageous that the fermentation procedure
that precedes the method of the present invention can be carried
out at any pH that is suitable for the host cell. It is well known
in the art that a secreted POI may be affected by the pH of its
extracellular growth medium. Up until now, it was often necessary
to maintain the pH of a host organism growth medium at an
approximately neutral pH because fermentations at such a pH were
deemed necessary to maintain the stability of a secreted POI even
though they usually increased the risk of bacterial contamination.
With the method of the present invention, the POI is not secreted.
Thus, the pH of the host organism growth medium is irrelevant as
the intracellular pH remains constant irrespective of the media pH.
Accordingly, the present invention permits the growth of a host
organism (such as yeast) at a lower pH (such as pH 4.0) which
reduces the risk of bacterial contamination without affecting
either biomass or POI production.
[0104] A further advantage of the method of the present invention
is that it can be used to prevent contact of the intracellular POI
with the extracellular growth medium. This is advantageous if the
POI is unstable in the extracellular media, because of, for
example, protease sensitivity. By expressing the protein
intracellularly and then extracting with the method of the present
invention contact with the extracellular media is avoided.
POI Recovery
[0105] The intracellular POI which has been extracted in accordance
with the method of the present invention may be further treated by
employing techniques known by those of skill in the art to further
concentrate and purify the POI. Thus, the extracted intracellular
POI may be concentrated by for example, ultrafiltration, passage
through a reverse phase resin followed by elution with a minimum
volume of solvent, precipitation, ultrafiltration and
lyophilization. Techniques available for further purification of
the POI include but are not limited to size fractionation employing
size exclusion resins, high performance liquid chromatography, ion
exchange and hydrophobic chromatography.
POI
[0106] As used herein, the term "POI" includes but is not limited
to, a protein, polypeptide or peptide including, but not limited
to, a structural protein, an enzyme, a cytokine (such as an
interferon and/or an interleukin), an interleukin receptor
antagonist (such as IL-1ra), an antibiotic, a polyclonal or
monoclonal antibody, or an effective part thereof, such as an Fv
fragment, which antibody or part thereof may be natural, synthetic
or humanized, a peptide hormone, an antigen (such as a
bacterial/viral/protozoal/parasitic antigen), a tumour antigen, a
receptor, a ligand, a regulatory factor, a signalling molecule, a
neurotransmitter, a clotting factor, or any other protein including
but not limited to a membrane bound protein and/or a membrane
associated protein.
[0107] In the method of the present invention, the POI is expressed
intracellularly, that is, it is an intracellular POI.
[0108] The POI may be produced by recombinant DNA techniques using
a nucleotide sequence of interest (NOI).
NOI
[0109] As used herein, the term "NOI" is defined to encompass DNA
and RNA of both synthetic and natural origin which DNA or RNA may
contain modified or unmodified deoxy- or dideoxy-nucleotides or
ribonucleotides or analogs thereof. The nucleic acid may exist as
single- or double-stranded DNA or RNA, an RNA/DNA heteroduplex or
an RNA/DNA copolymer, wherein the term "copolymer" refers to a
single nucleic acid strand that comprises both ribonucleotides and
deoxyribonucleotides. The NOI may even be codon optimised to
further increase expression.
Synthetic
[0110] The term "synthetic", as used herein, is defined as that
which is produced by in vitro chemical or enzymatic synthesis. It
includes but is not limited to NOIs made with optimal codon usage
for host organisms such as the methylotrophic yeasts Pichia and
Hansenula.
Constructs
[0111] The NOI may be operatively linked to transcriptional and
translational regulatory elements active in a host cell of
interest. The NOI may also encode a fusion protein comprising
signal sequences such as, for example, those derived from the
glucoamylase gene from Schwanniomyces occidentalis, .alpha.-factor
mating type gene from Saccharomyces cerevisiae and the TAKA-amylase
from Aspergillus oryzae. Alternatively, the NOI may encode a fusion
protein comprising a membrane binding domain.
Expression Vector
[0112] The NOI may be expressed at the desired levels in a host
organism using an expression vector.
[0113] An expression vector comprising the NOI according to the
present invention can be any vector which is capable of expressing
the gene encoding the NOI in the selected host organism, and the
choice of vector will depend on the host cell into which it is to
be introduced. Thus, the vector can be an autonomously replicating
vector, i.e. a vector that exists as an episomal entity, the
replication of which is independent of chromosomal replication,
such as, for example, a plasmid, a bacteriophage or an episomal
element, a minichromosome or an artificial chromosome.
Alternatively, the vector according to the invention is one which,
when introduced into a host cell, is integrated into the host cell
genome and replicated together with the chromosome.
Components of the Expression Vector
[0114] The expression vector typically includes the components of a
cloning vector, such as, for example, an element that permits
autonomous replication of the vector in the selected host organism
and one or more phenotypically detectable markers for selection
purposes. The expression vector normally comprises control
nucleotide sequences encoding a promoter, operator, ribosome
binding site, translation initiation signal and optionally, a
repressor gene or one or more activator genes. Additionally, the
expression vector may comprise a sequence coding for an amino acid
sequence capable of targeting the POI to a host cell organelle such
as a peroxisome or to a particular host cell compartment. Such a
targeting sequence includes but is not limited to the sequence SKL.
In the present context, the term `expression signal" includes any
of the above control sequences, repressor or activator sequences.
For expression under the direction of control sequences, the NOI
encoding the POI is operably linked to the control sequences in
proper manner with respect to expression.
Promoter
[0115] In the vector, the NOI encoding for the POI is operably
combined with a suitable promoter sequence. The promoter can be any
DNA sequence having transcription activity in the host organism of
choice and can be derived from genes that are homologous or
heterologous to the host organism.
Bacterial Promoters
[0116] Examples of suitable promoters for directing the
transcription of the modified nucleotide sequence of the invention
in a bacterial host include the promoter of the lac operon of E.
coli, the Streptomyces coelicolor agarase gene dagA promoters, the
promoters of the Bacillus licheniformis .alpha.-amylase gene
(amyL), the promoters of the Bacillus stearothermophilus maltogenic
amylase gene (amyM), the promoters of the Bacillus
amyloliquefaciens .alpha.-amylase gene (amyQ), the promoters of the
Bacillus subtilis xylA and xylB genes and a promoter derived from a
Lactococcus sp.-derived promoter including the P170 promoter. When
the gene encoding the POI of the present invention is expressed in
a bacterial species such as E. coli, a suitable promoter can be
selected, for example, from a bacteriophage promoter including a T7
promoter and a phage lambda promoter.
Fungal Promoters
[0117] For transcription in a fungal species, examples of useful
promoters are those derived from the genes encoding the,
Aspergillus oryzae TAKA amylase, Rhizomucor miehei aspartic
proteinase, Aspergillus niger neutral .alpha.-amylase, A. niger
acid stable .alpha.-amylase, A. niger glucoamylase, Rhizomucor
miehei lipase, Aspergillus oryzae alkaline protease, Aspergillus
oryzae triose phosphate isomerase or Aspergillus nidulans
acetamidase.
Yeast Promoters
[0118] Examples of suitable promoters for the expression in a yeast
species include but are not limited to the Gal 1 and Gal 10
promoters of Saccharomyces cerevisiae and the Pichia pastoris AOX1
or AOX2 promoters.
Host Organisms
[0119] (I) Bacterial Host Organisms
[0120] Examples of suitable bacterial host organisms are gram
positive bacterial species such as Bacillaceae including Bacillus
subtilis, Bacillus licheniformis, Bacillus lentus, Bacillus brevis,
Bacillus stearothermophilus, Bacillus alkalophilus, Bacillus
amyloliquefaciens, Bacillus coagulans, Bacillus lautus, Bacillus
megaterium and Bacillus thuringiensis, Streptomyces species such as
Streptomyces murinus, lactic acid bacterial species including
Lactococcus spp. such as Lactococcus lactis, Lactobacillus spp.
including Lactobacillus reuteri, Leuconostoc spp., Pediococcus spp.
and Streptococcus spp. Alternatively, strains of a gram-negative
bacterial species belonging to Enterobacteriaceae including E.
coli, or to Pseudomonadaceae can be selected as the host
organism.
[0121] (II) Yeast Host Organisms
[0122] A suitable yeast host organism can be selected from the
biotechnologically relevant yeasts species such as but not limited
to yeast species such as Pichia sp., Hansenula sp or Kluyveromyces,
Yarrowinia species or a species of Saccharomyces including
Saccharomyces cerevisiae or a species belonging to
Schizosaccharomyce such as, for example, S. Pombe species.
[0123] Preferably a strain of the methylotrophic yeast species
Pichia pastoris is used as the host organism.
[0124] Preferably the host organism is a Hansenula species.
[0125] It is highly advantageous to use the method of the present
invention to recover an intracellular POI from a eukaryotic host
organism, such as yeast, before glycosylation takes place.
Overglycosylation of secreted proteins is a well known problem
especially in eukaryotic host organisms such as yeast. This
drawback associated with yeast expression systems has led to a
reluctance to use yeast as a production system even though yeast
expression vectors are capable of producing proteins at high levels
of expression with a large amounts of biomass, and additionally,
yeast has approved use in food. By expressing the POI
intracellularly and then extracting the POI with the method of the
present invention, the POI will be non-glycosylated, because the
POI has not passed through the secretion pathway where
glycosylation takes place.
[0126] (III) Fungal Host Organisms
[0127] Suitable host organisms among filamentous fungi include
species of Aspergillus, e.g. Aspergillus niger, Aspergillus oryzae,
Aspergillus tubigensis, Aspergillus awamori or Aspergillus
nidulans. Alternatively, strains of a Fusarium species, e.g.
Fusarium oxysporum or of a Rhizomucor species such as Rhizomucor
miehei can be used as the host organism. Other suitable strains
include Thermomyces and Mucor species.
Large Scale Application
[0128] In one preferred embodiment of the present invention, the
POI is used for large scale applications.
[0129] Preferably the POI is produced in a quantity of from 1 g per
litre to about 2 g per litre of the total cell culture volume after
cultivation of the host organism.
[0130] Preferably the POI is produced in a quantity of from 100 mg
per litre to about 900 mg per litre of the total cell culture
volume after cultivation of the host organism.
[0131] Preferably the POI is produced in a quantity of from 250 mg
per litre to about 500 mg per litre of the total cell culture
volume after cultivation of the host organism.
Food Applications
[0132] In one preferred embodiment, the method of the present
invention is used to release a POI for use in the manufacture of
food products, such as beverages.
[0133] In another preferred embodiment, the method of the present
invention is used to release a POI for use in the preparation of
detergents.
[0134] In another preferred embodiment, the method of the present
invention is used to release a POI suitable for use in baking
[0135] In another preferred embodiment, the method of the present
invention is used to release a POI suitable for use as a dough
improving agent.
[0136] In another preferred embodiment, the method of the present
invention is used to release a POI suitable for improving the
properties of a flour dough, a flour dough improving composition
and improved food products (see WO 96/39851 and EP-B-0 833
563).
[0137] In a preferred embodiment, the released POI is a hexose
oxidase (D-hexose: O.sub.2-oxidoreductase, EC 1.1.3.5).
HOX Enzyme
[0138] Hexose oxidase (D-hexose: O.sub.2-oxidoreductase, EC
1.1.3.5) (also referred to as HOX) is an enzyme that in the
presence of oxygen is capable of oxidising D-glucose and several
other reducing sugars including maltose, lactose and cellobiose to
their corresponding lactones with subsequent hydrolysis to the
respective aldobionic acids. Accordingly, HOX differs from another
oxidoreductase, glucose oxidase, which can only convert D-glucose,
in that the enzyme can utilise a broader range of sugar substrates.
The oxidation catalysed by HOX can be illustrated as follows:
D-glucose+O.sub.2------>.gamma.-D-gluconolactone+H.sub.2O.sub.2,
or
D-galactose+O.sub.2----->.gamma.-D-galactonolactone+H.sub.2O.sub.2
[0139] HOX is produced naturally by several marine algal species.
Such species are found inter alia in the family Gigartinaceae. As
used herein, the term "HOX" denotes an enzyme which is capable of
oxidising the substrates selected from the group consisting of
D-glucose, D-galactose, D-mannose, maltose, lactose and
cellobiose.
HOX Production
[0140] The gene encoding the HOX enzyme has been cloned from the
seaweed Chondrus crispus (Stougaard and Hansen 1996, Hansen and
Stougaard, 1997). The methylotrophic yeast Hansenula polymorphs
(developed at Rhein Biotech, Dusseldorf/Germany as an expression
system for heterologous proteins) has also been used to produce the
HOX enzyme (the native protein was purified from seaweed (Poulsen
and Hostrup, 1998)). WO 96/40935 and WO 98/13478 also disclose the
cloning and expression in recombinant host organisms of a gene
encoding a protein with HOX activity.
[0141] In one preferred embodiment the HOX enzyme comprises the
sequence set out in SEQ ID No 22.
[0142] In one preferred embodiment the HOX enzyme comprises the
sequence set out in SEQ ID No 22 or variants, homologues,
derivatives or fragments thereof.
Glucan Lyase
[0143] Glucan lyase is an enzyme (EC 4.2.2.13) which catalyses the
degradation of .alpha.-1,4-glucans in starch and glycogen to
1,5-anhydro-D-fructose (see FIG. 15).
[0144] In one embodiment, therefore, the POI comprises a glucan
lyase enzyme. As shown in the Examples, glucan lyase is released at
high specific activity and yield when expressed from a host, for
example, Hansenula polymorphs. Extraction of expressed glucan lyase
by a membrane extracting composition comprising a quaternary
ammonium compound such as LTAB provides a high yield. The yield is
much higher than previous methods using secretion from Pichia
pistoris or Aspergillus niger.
[0145] In one embodiment, the yield of glucan lyase protein,
measured in mass/volume of culture, is more than 1 g/l, preferably
more than 2 g/l, most preferably more than 3 g/l or 3.5 g/l or
more. In another embodiment, the yield of glucan lyase protein, may
be measured as measured as a specific activity, for example, by the
DNS method described in Yu et al (1998), Carbohydrate Research 305
p. 73-82. In such an assay, the absorbance measured at 550
nanometers is a measurement of the amount of 1,5-anhydrofructose
produced and can be used to determine the specific activity of
glucan lyase. The DNS assay measures specific activity in units of
.mu.mol 1,5-anhydrofrucose/minmg.
[0146] In highly preferred embodiments, the specific activity
measured using such a DNS assay, of glucan lyase produced as
described, is 5 .mu.mol 1,5-anhydrofrucose/minmg or more,
preferably 6 .mu.mol 1,5-anhydrofrucose/minmg or more, more
preferably 7 .mu.mol 1,5-anhydrofrucose/minmg or more, more
preferably 9 .mu.mol 1,5-anhydrofrucose/minmg or more, more
preferably 9 .mu.mol 1,5-anhydrofrucose/minmg or more, most
preferably 10 .mu.mol 1,5-anhydrofrucose/minmg or more.
[0147] In contrast, previous methods employing transformation of
the algal .alpha.-1,4-glucan lyase gene in the methylotrophic yeast
Pichia pastoris has previously resulted in a specific activity of
0.7 .mu.mol 1,5-anhydrofrucose/minmg protein (Bojsen K, et al,
1999). Accordingly, expression and extraction using a membrane
extracting composition comprising a quaternary ammonium compound
results in an improved yield over the prior art.
[0148] Glucan lyase is described in detail in U.S. Pat. No.
6,541,237. Glucan lyase has also been described in Yu, S., et al
1999. The enzyme consists of 1038 amino acids and has a molecular
weight of 117 kDa. The optimal pH range is between pH 4-7 and the
temperature optimum for the glucan lyase is in the range
37-50.degree. C. The enzyme is very stable showing no loss of
activity when kept for several months at 22.degree. C. at pH
5.5-5.8 (Yu, 2003, personal communication).
[0149] Glucan lyase is also known as Exo-(1,4)-alpha-D-glucan
lyase, Exo-alpha-1,4-glucan lyase, Alpha-1,4-glucan lyase,
Alpha-1,4-glucan exo-lyase and Alpha-1,4-glucan
1,5-anhydro-D-fructose eliminase.
[0150] The reaction catalysed by glucan lyase can be illustrated as
follows:
Starch/glycogen.fwdarw.1,5-anhydro-D-fructose
[0151] Biochemically, the glucan lyase enzyme catalyzes the
sequential degradation of (1->4)-alpha-D-glucans from the
non-reducing end with the release of 1,5-anhydro-D-fructose. Thus,
for an alpha-glucan containing n(1->4)-linked glucose units, the
final products are 1 glucose plus (n-1) 1,5-anhydro-D-fructose.
Maltose, maltosaccharides and amylose are all completely degraded.
Glucan lyase does not degrade (1->6)-alpha-gucosidic bonds and
thus the degradation of a branched glucan, such as amylopectin or
glycogen, will result in the formation of 1,5-anhydro-D-fructose
plus a limit dextrin.
[0152] Methods for the isolation of glucan lyase from fungus, for
example, Morchella costata or Morchella vulgaris (and sequences of
the genes) are disclosed in detail in U.S. Pat. No. 5,908,760,
herein incorporated by reference. Corresponding database entries
include accession numbers AAE24524, AAE24523 and AAE24522. Isozymes
of gulcan lyase have also been identified, such as alpha-1,4-glucan
lyase, isozyme 5 (accession CAB51913), alpha-1,4-glucan lyase,
isozyme 4 (accession CAB51909), alpha-1,4-glucan lyase, isozyme 3
(accession CAB51912), alpha-1,4-glucan lyase, isozyme 2 (accession
CAB51911), and alpha-1,4-glucan lyase isozyme 1 (accession
CAB51910), all from Gracilariopsis lemaneiformis
[0153] Other alpha-1,4-glucan lyases include those from Peziza
ostracoderma (accession CAB52202), Morchella vulgaris (accession
CAB52201), Morchella costata (accession CAB52260).
[0154] Algal glucan lyases are the subject of U.S. Pat. No.
5,695,970, particularly those from order Gigartinales, for example
Gracilariopsis lemaneiformis, Gracilaria verrucosa and Phyllophora
truncata. This document discloses several sequences of glucan
lyases, each of which may be employed in the methods and
compositions described here. For example, accession numbers
AAC12432, AAC12431, AAC12430, AAC12429 and AAB27587. Such glucan
lyases are particularly preferred.
[0155] In highly preferred embodiments, the term "glucan lyase", as
it is used in this document, should preferably be taken to mean an
enzyme comprising (a) the amino acid sequence of SEQ ID NO: 3 or
SEQ ID NO:4, (b) an amino acid sequence which is at least 85%
homologous to the amino acid sequence of SEQ ID NO:3 or SEQ ID NO:4
as shown in U.S. Pat. No. 6,541,237, in which the enzyme has
.alpha.-1,4 glucan lyase activity. The entirety of U.S. Pat. No.
6,541,237 is incorporated herein by reference.
[0156] Glucan lyase may be produced by any of the methods described
in U.S. Pat. No. 6,541,237, herein incorporated by reference.
[0157] In one preferred embodiment the glucan lyase enzyme
comprises the sequence set out in SEQ ID No 3 in U.S. Pat. No.
6,541,237, or variants, homologues, derivatives or fragments
thereof.
[0158] In one preferred embodiment the glucan lyase enzyme
comprises the sequence set out in SEQ ID No 4 in U.S. Pat. No.
6,541,237, or variants, homologues, derivatives or fragments
thereof.
Variants/Homologues/Derivatives (Amino Acid Sequence)
[0159] Preferred amino acid sequences of the present invention are
set out in SEQ ID No 22 or are sequences obtainable from the HOX
enzyme of the present invention but also include homologous
sequences obtained from any source, for example related
viral/bacterial proteins, cellular homologues and synthetic
peptides, as well as variants or derivatives thereof.
[0160] Thus, the present invention covers variants, homologues or
derivatives of the amino acid sequences presented herein, as well
as variants, homologues or derivatives of the nucleotide sequence
coding for those amino acid sequences.
[0161] In the context of the present invention, a homologous
sequence is taken to include an amino acid sequence which is at
least 75, 85 or 90% identical, preferably at least 95 or 98%
identical at the amino acid level over at least, for example, the
amino acid sequence as set out in SEQ ID No 22 of the sequence
listing herein. In particular, homology should typically be
considered with respect to those regions of the sequence known to
be essential for enzyme activity rather than non-essential
neighbouring sequences. These regions include but are not limited
to the putative FAD binding domains in HOX such as SGGH.sub.79C
(residues 76-80 of SEQ ID NO: 23), LGGH.sub.146I (residues 143-147
of SEQ ID NO: 23) and LGGH.sub.320A (residues 317-321 of SEQ ID NO:
23). Although homology can also be considered in terms of
similarity (i.e. amino acid residues having similar chemical
properties/functions), in the context of the present invention it
is preferred to express homology in terms of sequence identity.
[0162] Homology comparisons can be conducted by eye, or more
usually, with the aid of readily available sequence comparison
programs. These commercially available computer programs can
calculate % homology between two or more sequences.
[0163] % homology may be calculated over contiguous sequences, i.e.
one sequence is aligned with the other sequence and each amino acid
in one sequence is directly compared with the corresponding amino
acid in the other sequence, one residue at a time. This is called
an "ungapped" alignment. Typically, such ungapped alignments are
performed only over a relatively short number of residues.
[0164] Although this is a very simple and consistent method, it
fails to take into consideration that, for example, in an otherwise
identical pair of sequences, one insertion or deletion will cause
the following amino acid residues to be put out of alignment, thus
potentially resulting in a large reduction in % homology when a
global alignment is performed. Consequently, most sequence
comparison methods are designed to produce optimal alignments that
take into consideration possible insertions and deletions without
penalising unduly the overall homology score. This is achieved by
inserting "gaps" in the sequence alignment to try to maximise local
homology.
[0165] However, these more complex methods assign "gap penalties"
to each gap that occurs in the alignment so that, for the same
number of identical amino acids, a sequence alignment with as few
gaps as possible--reflecting higher relatedness between the two
compared sequences--will achieve a higher score than one with many
gaps. "Affine gap costs" are typically used that charge a
relatively high cost for the existence of a gap and a smaller
penalty for each subsequent residue in the gap. This is the most
commonly used gap scoring system. High gap penalties will of course
produce optimised alignments with fewer gaps. Most alignment
programs allow the gap penalties to be modified. However, it is
preferred to use the default values when using such software for
sequence comparisons. For example when using the GCG Wisconsin
Bestfit package (see below) the default gap penalty for amino acid
sequences is -12 for a gap and -4 for each extension.
[0166] Calculation of maximum % homology therefore firstly requires
the production of an optimal alignment, taking into consideration
gap penalties. A suitable computer program for carrying out such an
alignment is the GCG Wisconsin Bestfit package (University of
Wisconsin, U.S.A.; Devereux et al., 1984, Nucleic Acids Research
12:387). Examples of other software than can perform sequence
comparisons include, but are not limited to, the BLAST package (see
Ausubel et al., 1999 ibid--Chapter 18), FASTA (Atschul et al.,
1990, J. Mol. Biol., 403-410) and the GENEWORKS suite of comparison
tools. Both BLAST and FASTA are available for offline and online
searching (see Ausubel et al., 1999 ibid, pages 7-58 to 7-60).
However it is preferred to use the GCG Bestfit program.
[0167] Although the final % homology can be measured in terms of
identity, the alignment process itself is typically not based on an
all-or-nothing pair comparison. Instead, a scaled similarity score
matrix is generally used that assigns scores to each pairwise
comparison based on chemical similarity or evolutionary distance.
An example of such a matrix commonly used is the BLOSUM62
matrix--the default matrix for the BLAST suite of programs. GCG
Wisconsin programs generally use either the public default values
or a custom symbol comparison table if supplied (see user manual
for further details). It is preferred to use the public default
values for the GCG package, or in the case of other software, the
default matrix, such as BLOSUM62.
[0168] Once the software has produced an optimal alignment, it is
possible to calculate % homology, preferably % sequence identity.
The software typically does this as part of the sequence comparison
and generates a numerical result.
[0169] The terms "variant" or "derivative" in relation to the amino
acid sequences of the present invention includes any substitution
of, variation of, modification of, replacement of, deletion of or
addition of one (or more) amino acids from or to the sequence
providing the resultant amino acid sequence has an enzyme activity,
preferably having at least the same enzyme activity as the amino
acid sequence set out in SEQ ID No 22.
[0170] SEQ ID No 22 may be modified for use in the present
invention. Typically, modifications are made that maintain the
enzyme activity of the sequence. Amino acid substitutions may be
made, for example from 1, 2 or 3 to 10 or 20 substitutions provided
that the modified sequence retains the required enzyme activity.
Amino acid substitutions may include the use of non-naturally
occurring analogues.
[0171] SEQ ID No 22 of the present invention may also have
deletions, insertions or substitutions of amino acid residues which
produce a silent change and result in a functionally equivalent
enzyme. Deliberate amino acid substitutions may be made on the
basis of similarity in polarity, charge, solubility,
hydrophobicity, hydrophilicity, and/or the amphipathic nature of
the residues as long as the enzyme activity of the HOX enzyme is
retained. For example, negatively charged amino acids include
aspartic acid and glutamic acid charged amino acids include lysine
and arginine amino acids with uncharged polar head groups having
similar hydrophilicity values include leucine, isoleucine, valine,
glycine, alanine, asparagine, glutamine, serine, threonine,
phenylalanine, and tyrosine.
[0172] Conservative substitutions may be made, for example
according to the Table below. Amino acids in the same block in the
second column and preferably in the same line in the third column
may be substituted for each other:
TABLE-US-00001 ALIPHATIC Non-polar G A P I L V Polar - uncharged C
S T M N Q Polar - charged D E K R AROMATIC H F W Y
[0173] Variants/Homologues/Derivatives (Nucleotide Sequence)
[0174] It will be understood by a skilled person that numerous
different nucleotide sequences can encode the same HOX enzyme as a
result of the degeneracy of the genetic code. In addition, it is to
be understood that skilled persons may, using routine techniques,
make nucleotide substitutions that do not affect the HOX enzyme
encoded by the nucleotide sequence of the invention to reflect the
codon usage of any particular host organism in which the HOX enzyme
of the present invention is to be expressed.
[0175] The terms "variant", "homologue" or "derivative" in relation
to the nucleotide sequence set out in SEQ ID No 22 of the present
invention includes any substitution of, variation of, modification
of, replacement of, deletion of or addition of one (or more)
nucleic acid from or to the sequence providing the resultant
nucleotide sequence codes for a HOX enzyme having an enzyme
activity, preferably having at least the same activity as the
nucleotide sequence set out in SEQ ID No 22 of the sequence
listings.
[0176] As indicated above, with respect to sequence homology,
preferably there is at least 75%, more preferably at least 85%,
more preferably at least 90% homology to the sequences shown in the
sequence listing herein. More preferably there is at least 95%,
more preferably at least 98%, homology. Nucleotide homology
comparisons may be conducted as described above. A preferred
sequence comparison program is the GCG Wisconsin Bestfit program
described above. The default scoring matrix has a match value of 10
for each identical nucleotide and -9 for each mismatch. The default
gap creation penalty is -50 and the default gap extension penalty
is -3 for each nucleotide.
[0177] The present invention also encompasses nucleotide sequences
that are capable of hybridising selectively to the sequences
presented herein, or any variant, fragment or derivative thereof,
or to the complement of any of the above. Nucleotide sequences are
preferably at least 15 nucleotides in length, more preferably at
least 20, 30, 40 or 50 nucleotides in length.
Hybrisation
[0178] The term "hybridization" as used herein shall include "the
process by which a strand of nucleic acid joins with a
complementary strand through base pairing" as well as the process
of amplification as carried out in polymerase chain reaction (PCR)
technologies.
[0179] Nucleotide sequences of the invention capable of selectively
hybridising to the nucleotide sequences presented herein, or to
their complement, will be generally at least 75%, preferably at
least 85 or 90% and more preferably at least 95% or 98% homologous
to the corresponding nucleotide sequences presented herein over a
region of at least 20, preferably at least 25 or 30, for instance
at least 40, 60 or 100 or more contiguous nucleotides. Preferred
nucleotide sequences of the invention will comprise regions
homologous to the nucleotide sequence set out in SEQ ID No 22
preferably at least 80 or 90% and more preferably at least 95%
homologous to the nucleotide sequence set out in SEQ ID No 22.
[0180] The term "selectively hybridizable" means that the
nucleotide sequence used as a probe is used under conditions where
a target nucleotide sequence of the invention is found to hybridize
to the probe at a level significantly above background. The
background hybridization may occur because of other nucleotide
sequences present, for example, in the cDNA or genomic DNA library
being screened. In this event, background implies a level of signal
generated by interaction between the probe and a non-specific DNA
member of the library which is less than 10 fold, preferably less
than 100 fold as intense as the specific interaction observed with
the target DNA. The intensity of interaction may be measured, for
example, by radiolabelling the probe, e.g. with .sup.32P.
[0181] Hybridization conditions are based on the melting
temperature (Tm) of the nucleic acid binding complex, as taught in
Berger and Kimmel (1987, Guide to Molecular Cloning Techniques,
Methods in Enzymology, Vol 152, Academic Press, San Diego Calif.),
and confer a defined "stringency" as explained below.
[0182] Maximum stringency typically occurs at about Tm-5.degree. C.
(5.degree. C. below the Tm of the probe) stringency at about
5.degree. C. to 10.degree. C. below Tm stringency at about
10.degree. C. to 20.degree. C. below Tm low stringency at about
20.degree. C. to 25.degree. C. below Tm. As will be understood by
those of skill in the art, a maximum stringency hybridization can
be used to identify or detect identical nucleotide sequences while
an intermediate (or low) stringency hybridization can be used to
identify or detect similar or related polynucleotide sequences.
[0183] In a preferred aspect, the present invention covers
nucleotide sequences that can hybridise to the nucleotide sequence
of the present invention under stringent conditions (e.g.
65.degree. C. and 0.1.times.SSC {1.times.SSC=0.15 M NaCl, 0.015 M
Na.sub.3 Citrate pH 7.0). Where the nucleotide sequence of the
invention is double-stranded, both strands of the duplex, either
individually or in combination, are encompassed by the present
invention. Where the nucleotide sequence is single-stranded, it is
to be understood that the complementary sequence of that nucleotide
sequence is also included within the scope of the present
invention.
[0184] Nucleotide sequences which are not 100% homologous to the
sequences of the present invention but fall within the scope of the
invention can be obtained in a number of ways. Other variants of
the sequences described herein may be obtained for example by
probing DNA libraries made from a range of sources. In addition,
other viral/bacterial, or cellular homologues particularly cellular
homologues found in mammalian cells (e.g. rat, mouse, bovine and
primate cells), may be obtained and such homologues and fragments
thereof in general will be capable of selectively hybridising to
the sequences shown in the sequence listing herein. Such sequences
may be obtained by probing cDNA libraries made from or genomic DNA
libraries from other animal species, and probing such libraries
with probes comprising all or part of the nucleotide sequence set
out in SEQ I.D. No 22 under conditions of medium to high
stringency. Similar considerations apply to obtaining species
homologues and allelic variants of the amino acid and/or nucleotide
sequences of the present invention.
[0185] Variants and strain/species homologues may also be obtained
using degenerate PCR which will use primers designed to target
sequences within the variants and homologues encoding conserved
amino acid sequences within the sequences of the present invention.
Conserved sequences can be predicted, for example, by aligning the
amino acid sequences from several variants/homologues. Sequence
alignments can be performed using computer software known in the
art. For example the GCG Wisconsin PileUp program is widely used.
The primers used in degenerate PCR will contain one or more
degenerate positions and will be used at stringency conditions
lower than those used for cloning sequences with single sequence
primers against known sequences.
[0186] Alternatively, such nucleotide sequences may be obtained by
site directed mutagenesis of characterised sequences, such as the
nucleotide sequence set out in SEQ ID. No 22. This may be useful
where for example silent codon changes are required to sequences to
optimise codon preferences for a particular host cell in which the
nucleotide sequences are being expressed. Other sequence changes
may be desired in order to introduce restriction enzyme recognition
sites, or to alter the enzyme activity of the HOX enzyme encoded by
the nucleotide sequences.
[0187] The nucleotide sequences of the present invention may be
used to produce a primer, e.g. a PCR primer, a primer for an
alternative amplification reaction, a probe e.g. labelled with a
revealing label by conventional means using radioactive or
non-radioactive labels, or the nucleotide sequences may be cloned
into vectors. Such primers, probes and other fragments will be at
least 15, preferably at least 20, for example at least 25, 30 or 40
nucleotides in length, and are also encompassed by the term
nucleotide sequence of the invention as used herein.
[0188] The nucleotide sequences such as a DNA polynucleotides and
probes according to the invention may be produced recombinantly,
synthetically, or by any means available to those of skill in the
art. They may also be cloned by standard techniques.
[0189] In general, primers will be produced by synthetic means,
involving a step wise manufacture of the desired nucleic acid
sequence one nucleotide at a time. Techniques for accomplishing
this using automated techniques are readily available in the
art.
[0190] Longer nucleotide sequences will generally be produced using
recombinant means, for example using a PCR (polymerase chain
reaction) cloning techniques. This will involve making a pair of
primers (e.g. of about 15 to 30 nucleotides) flanking a region of
the targeting sequence which it is desired to clone, bringing the
primers into contact with mRNA or cDNA, performing a polymerase
chain reaction (PCR) under conditions which bring about
amplification of the desired region, isolating the amplified
fragment (e.g. by purifying the reaction mixture on an agarose gel)
and recovering the amplified DNA. The primers may be designed to
contain suitable restriction enzyme recognition sites so that the
amplified DNA can be cloned into a suitable cloning vector.
[0191] Due to the inherent degeneracy of the genetic code, other
DNA sequences which encode substantially the same or a functionally
equivalent amino acid sequence, may be used to clone and express
the HOX enzyme. As will be understood by those of skill in the art,
it may be advantageous to produce the HOX enzyme--encoding
nucleotide sequences possessing non-naturally occurring codons.
Codons preferred by a particular prokaryotic or eukaryotic host
(Murray E et al (1989) Nuc Acids Res 17:477-508) can be selected,
for example, to increase the rate of the HOX enzyme expression or
to produce recombinant RNA transcripts having desirable properties,
such as a longer half-life, than transcripts produced from
naturally occurring sequence.
Screens
[0192] The method of the present invention may be used for
screening for elevated levels of the intracellular POI in mutated
host cell organisms. The cells employed in such a screen may be
affixed to a solid support or on a solid substrate, such as plastic
pins or some other surface. The cells may be contacted with the
membrane extracting composition of the present invention and the
level of the released POI may be measured using methods known in
the art.
High Through Put Screens (HTS)
[0193] The method of the present invention may be used in high
through-put screening (HTS) systems, where target cells are grown
and screened in microtiter plates (10000 mutants per day) by robot
systems. By way of example, when making new recombinant production
strains, it is usually necessary to carry out one or several rounds
of traditional mutagenesis in order to increase productivity. This
is most efficiently done using HTS of the mutated cells.
[0194] The method of the present invention is highly advantageous
because it allows for high through put screening (HTS) for
increased levels of intracellular POIs. Up until now, these systems
were only able to screen for higher levels of secreted POIs.
BRIEF DESCRIPTION OF THE FIGURES
[0195] The present invention will now be described only by way of
example in which reference is made to the following Figures.
[0196] FIG. 1 provides a genetic construct;
[0197] FIG. 2A provides genetic constructs;
[0198] FIG. 2B provides a photographic representation;
[0199] FIGS. 3A and 3B provide photographic representations;
[0200] FIG. 4 provides a graph;
[0201] FIG. 5 provides a sequence listing;
[0202] FIG. 6 provides a sequence listing;
[0203] FIGS. 7A-7D provide a photographic representation;
[0204] FIG. 8 provides a graph;
[0205] FIG. 9 provides a graph;
[0206] FIGS. 10A-10B provide a photographic representation;
[0207] FIGS. 11A-11B provide a graph;
[0208] FIGS. 12A-12B provide a photographic representation;
[0209] FIGS. 13A-13B provide a photographic representation;
[0210] FIGS. 14A-14B provide a photographic representation;
[0211] FIG. 15 provide a graphic representation of a reaction;
[0212] FIG. 16A shows a graphic representation of a gene
structure;
[0213] FIG. 16B shows a graphic representation of a expression
vector structure;
[0214] FIGS. 17A to 17C show a photographic representation;
[0215] FIG. 18 shows a photographic representation;
[0216] FIG. 19 shows a graph;
[0217] FIG. 20 shows a photographic representation; and
[0218] FIG. 21 shows a graph.
[0219] In slightly more detail:
[0220] FIG. 1 provides a physical map of the expression vector for
HOX production in Hansenula polymorphs. EcoRI/NotI blunt fragments
harbouring the coding region of the synthetic HOX gene fused to
optional signal sequences were cloned into the multiple cloning
site of a standard Hansenula expression vector. The expression
vectors contain the promoter of formate dehydrogenase (FMD) gene
and the terminator (MOX-T) of the methanol oxidase gene separated
by the multiple cloning site for fragment insertion, on and bla
(ampR) for propagation and selection in E. coli, the ARS (HARS)
sequence for replication in H. polymorphs, the URA3 gene for
selection.
[0221] FIG. 2A shows a diagram of the 1.4 kb genuine FMD gene
(upper scheme) and the FMD promoter with the cloned heterologous
DNA (lower scheme). The restriction sites are Asp718, NcoI.
[0222] FIG. 2B shows the gene copies of the integrated HOX gene.
Lanes 1-12 show different recombinant isolates and their
corresponding DNA dilution. Lane 13 shows an untransformed host
strain and Lane 14 shows a size marker (M).
[0223] FIGS. 3A & 3B provide an SDS-PAGE analysis of HOX
expression. FIG. 3A provides an SDS-PAGE analysis of culture
filtrate from glycerol fermentation of the mutagenized strain
DK8-27KanII3-mut25. Lane 1 shows a marker protein, lane 2 shows a
HOX standard (0.03 U/ml; 18ul), lane 3 shows a supernatant from
probe 3 (18ul), lane 4 shows a supernatant from probe 4 (18ul),
lane 5 shows a supernatant from probe 5 (18ul), lane 6 shows a
supernatant from probe 6 (18ul), lane 7 shows a supernatant from
probe 7 (18ul), lane 8 shows a supernatant from probe 8 (18ul),
lane 9 shows a supernatant from probe 9 (18ul) and lane 10 shows a
supernatant from probe 10 (18ul).
[0224] FIG. 3B provides a western blot analysis of recombinant
strains expressing HOX. The samples applied in the lanes are the
same as for FIG. 3A. The membrane was probed with a polyclonal HOX
antibody.
[0225] FIG. 4 shows the growth and productivity of a 10 liter
fermentation culture of a secreting strain DK8-27KanII3-mut25. The
fermentation was performed at 25.degree. C. and pH 5.0 with
glycerol and pO.sub.2 control.
[0226] FIG. 5 provides the individual oligonucleotides used to
synthesize the HOX gene with codon optimization (SEQ ID NOS 2-21,
respectively in order of appearance).
[0227] FIG. 6 provides a nucleotide sequence of the synthetic HOX
gene (SEQ ID NO: 22) and the corresponding amino acid sequence (SEQ
ID NO: 23).
[0228] FIGS. 7A-7D show the localisation of the HOX enzyme in H.
polymorpha as determined by immunofluorescence. The superimposition
of the location of the HOX enzyme (green signal) with the nuclear
location (blue signal) is shown. See A) RB11 strain without HOX
gene. B) DK8-27. C) DK8-27 mut25. D) DK2II-I.
[0229] FIG. 8 provides a graph showing HOX activity as a function
of number of cycles through a cell homogenizer.
[0230] FIG. 9 provides a graph showing Hansenula polymorpha cells
extracted with different concentration of CTAB and Triton
X-100.
[0231] FIG. 10A shows an SDS PAGE analysis of HOX enzyme levels in
the cell supernatant (lanes 7-10) and pellet (lanes 2-5) after CTAB
treatment. The HOX enzyme was released from the pellets by
mechanical extraction. The samples were analysed on 4-12% NuPAGE
gels from MES, Novex and 10 .mu.l samples were loaded in each lane
in the following order: Lane 2-5: residual HOX in the cell pellet;
Lane 7-10: released HOX in the supernatant; Lane 1 and 6: Novex See
Blue standard; Lane 2: control, lane 3: 0.1% CTAB; lane 4: 0.2%
CTAB; lane 5: 0.4% CTAB; lane 7: control; lane 8: 0.1% CTAB; lane
9: 0.2% CTAB and lane 10: 0.4% CTAB.
[0232] FIG. 10B shows a Western Blot analysis of HOX enzyme levels
in the cell supernatant (lanes 7-10) and pellet (lanes 2-5) after
CTAB treatment. The HOX enzyme was released from the pellets by
mechanical extraction. The samples were analysed on 4-12% NuPAGE
gels from MES, Novex and 5 .mu.l samples were loaded in each lane
in the following order: Lane 2-5: residual HOX in the cell pellet;
Lane 7-10: released HOX in the supernatant; Lane 1 and 6: Novex See
Blue standard, Lane 2: control, lane 3: 0.1% CTAB; lane 4: 0.2%
CTAB; lane 5: 0.4% CTAB; lane 7: control, lane 8: 0.1% CTAB; lane
9: 0.2% CTAB and lane 10: 0.4% CTAB.
[0233] FIG. 11A shows the elution profile for CTAB extracted
HOX.
[0234] FIG. 11B shows the elution profile for mechanically
extracted HOX.
[0235] FIG. 12A shows a Western Blot WB33. Lane 1 shows molecular
weight markers See Blue 10 .mu.L (total). Lane 2. 4-17 A SN 11,3
.mu.L, Lane 3. 4-17 D CX 1:3 dil. 11,3 .mu.L, Lane 4. 4-17 C SN
CTAB 11,3 .mu.L, Lane 5. 4-17 F CX CTAB 1:3 dil. 11,3 .mu.L, Lane
6. rhIl-1ra-standard (BSA-free) 30 ng, Lane 7. AL 9/2 A SN 11,3
.mu.L, Lane 8. AL 9/2 D CX 1:3 dil. 11,3 .mu.L, Lane 9. AL 9/2 C SN
CTAB 11,3 .mu.L, Lane 10. AL 9/2 F CX CTAB 1:3 dil. 11,3 .mu.L.
[0236] FIG. 12B shows a Coomassie Blot Coo2. Lane 1. MW marker Mark
12 10 .mu.L (total), Lane 2. 4-17 A SN 11,3 .mu.L, Lane 3. 4-17 D
CX 1:3 dil. 11,3 .mu.L, Lane 4. 4-17 C SN CTAB 11,3 .mu.L, Lane 5.
4-17 F CX CTAB 1:3 dil. 11,3 .mu.L, Lane 6. 4-17 B SN w/o CTAB 11,3
.mu.L, Lane 7. 4-17 E CX w/o CTAB 1:3 dil. 11,3 .mu.L, Lane
8.rhIl-1ra-Standard (BSA-free) 100 ng, Lane 9. AL 9/2 A SN 11,3
.mu.L, Lane 10. AL 9/2 D CX 1:3 dil. 11,3 .mu.L, Lane 11. AL 9/2 C
SN CTAB 11,3 .mu.L, Lane 12. AL 9/2 F CX CTAB 1:3 dil. 11,3 .mu.L,
Lane 13. AL 9/2 B SN w/o CTAB 11,3 .mu.L, Lane 14. AL 9/2 E CX w/o
CTAB 1:3 dil. 11,3 .mu.L, Lane 15. FPMT 8 A SN 11,3 .mu.L.
[0237] FIG. 13A shows a Western Blot WB 34. Lane 1. MW marker See
Blue 10 .mu.L (total), Lane 2. MF2 A SN 11,3 .mu.L, Lane 3.
MF.alpha.2 D CX 1:3 dil. 11,3 .mu.L, Lane 4. MF2 C SN CTAB 11,3
.mu.L, Lane 5. MF2 F CX CTAB 1:3 dil. 11,3 .mu.L, Lane 6.
rhIl-1ra-standard (BSA-free) 30 ng, Lane 7. MFAL7/1 A SN 11,3
.mu.L, Lane 8. MFAL7/1 D CX 1:3 dil. 11,3 .mu.L, Lane 9.
MF.alpha.AL7/1 C SN CTAB 11,3 .mu.L, Lane 10. MFAL7/1 F CX CTAB 1:3
dil. 11,3 .mu.L.
[0238] FIG. 13B shows a Coomassie Blot Coo 3 1. MW marker Mark 12
10 .mu.L (total), Lane 2. MF.alpha. 2 A SN 11,3 .mu.L, Lane 3.
MF.alpha. 2 D CX 1:3 dil. 11,3 .mu.L, Lane 4. MF.alpha. 2 C SN CTAB
11,3 .mu.L, Lane 5. MF.alpha. 2 F CX CTAB 1:3 dil. 11,3 .mu.L, Lane
6. MF.alpha. 2 B SN w/o CTAB 11,3 .mu.L, Lane 7. MF.alpha. 2 E CX
w/o CTAB 1:3 dil. 11,3 .mu.L, Lane 8.rhIl-1ra-Standard (BSA-free)
100 ng, Lane 9. MF.alpha. AL7/1 A SN 11,3 .mu.L, Lane 10. MF.alpha.
AL7/1 D CX 1:3 dil. 11,3 .mu.L, Lane 11. MF.alpha. AL7/1 C SN CTAB
11,3 .mu.L, Lane 12. MF.alpha. AL7/1 F CX CTAB 1:3 dil. 11,3 .mu.L,
Lane 13. MF.alpha. AL7/1 B SN w/o CTAB 11,3 .mu.L, Lane 14.
MF.alpha. AL7/1 E CX w/o CTAB 1:3 dil. 11,3 .mu.L, Lane 15. FPMT 8
C SN CTAB 11,3 .mu.L
[0239] FIG. 14A shows a Western Blot WB 35. Lane 1. MW marker See
Blue 10 .mu.L (total), Lane 2. II 3/1 SN 11,3 .mu.L, Lane 3. II 3/1
CX 1:3 dil. 11,3 .mu.L, Lane 4. II 3/1 SN CTAB 4.degree. C. 11,3
.mu.L, Lane 5. II 3/1 CX CTAB 4.degree. C. 1:3 dil. 11,3 .mu.L,
Lane 6. rhIl-1ra-Standard (BSA-free) 30 ng, Lane 7. II 3/1 SN CTAB
37.degree. C. 11,3 .mu.L, Lane 8. II 3/1 CX CTAB 37.degree. C. 1:3
dil. 11,3 .mu.L, Lane 9. II 3/1 SN w/o CTAB 37.degree. C. 11,3
.mu.L, Lane 10. II 3/1 CX w/o CTAB 37.degree. C. 1:3 dil. 11,3
.mu.L
[0240] FIG. 14B shows a Coomassie Blot Coo 4 1. MW marker Mark 12
10 .mu.L (total). Lane 2. II 3/1 SN 11,3 .mu.L, Lane 3. II 3/1 CX
1:3 dil. 11,3 .mu.L, Lane 4. II 3/1 SN CTAB 4.degree. C. 11,3
.mu.L, Lane 5. II 3/1 CX CTAB 4.degree. C. 1:3 dil. 11,3 .mu.L,
Lane 6. II 3/1 SN w/o CTAB 4.degree. C. 11,3 .mu.L, Lane 7. II 3/1
CX w/o CTAB 4.degree. C. 1:3 dil. 11,3 .mu.L, Lane 8. II 3/1 SN
CTAB 37.degree. C. 11,3 .mu.L, Lane 9. II 3/1 CX CTAB 37.degree. C.
1:3 dil. 11,3 .mu.L, Lane 10. II 3/1 SN w/o CTAB 37.degree. C. 11,3
.mu.L, Lane 11. II 3/1 CX w/o CTAB 37.degree. C. 1:3 dil. 11,3
.mu.L, Lane 12. rhIl-1ra-Standard (BSA-free) 100 ng, Lane 13. FPMT
8 CX CTAB 4.degree. C. 1:3 dil. 11,3 .mu.L, Lane 14. FPMT 8 SN CTAB
4.degree. C. 11,3 .mu.L, Lane 15. FPMT 8 SN 11,3 .mu.L.
[0241] FIG. 15 shows the reaction catalyzed by glucan lyase.
[0242] FIG. 16A shows the structure of the full length glucan lyase
gene (3153 bp). The central portion is well conserved among glucan
lyases and alpha-glucocidases. The N terminal portion is believed
to contain a starch-binding domain.
[0243] FIG. 16B shows the structure of the Hansenula expression
vector pFPMT121.
[0244] FIGS. 17A-17C. Western Blot analysis using anti-glucan lyase
antibodies. 5 and 15 .mu.l of cell-free extract of each
transformant is loaded in two lanes.
[0245] FIG. 17A. Blot A: Lane 1-8: Transformants of the aglcore
(transformant number 14, 15, 27 and 28). Lane 9: Transformant of
the full-length glucan lyase gene (transformant number 2).
[0246] FIG. 17B. Blot B: Lane 1-9 Transformants of the full-length
glucan lyase gene (transformant number 2, 4, 5, 6 and 8).
[0247] FIG. 17C. Blot C: Lane 1-8: Transformants of the 5'agl
(transformant number 13, 14, 15 and 16). Lane 9-17: Transformants
of the 3' agl (transformant number 6, 7, 8 and 9). The cell-free
extracts are heat-treated in 10 .mu.l of SDS sample buffer before
loading on the SDS-gels. The proteins are transferred to
nitrocellulose membranes that are blotted with Primary anti-algal
glucan lyase antibodies from rabbits and secondary alkaline
phosphatase Conjugated swine anti-rabbit immunoglobulins. 15 .mu.l
of Rainbow.TM. coloured protein molecular weight marker is loaded
on each gel (M). The marker is not transferred very efficiently to
the nitrocellulose membranes so the marker is shown to the right.
Marker: Myosin 220 kDa (blue), phosphorylase b 97.4 kDa (brown),
bovine serum albumin 66 kDa (red), ovalbumin 46 kDa (yellow),
carbonic anhydrase 30 kDa (orange), trypsin inhibitor 21.5 kDa
(blue), lysozyme 14.3 kDa (magenta).
[0248] FIG. 18. ELISA-plate from activity screening by the DNS
method of repressed and induced extracts prepared from cultures of
transformant 2 and 8 (2 cultures of each transformant are grown).
In column 1-3 and 4-6 extracts from culture 1 and 2 of transformant
2 are assayed. In column 7-9 and 10-12 extracts from culture 1 and
2 of transformant 8 are assayed. A1-A12: Assay on 10, 20 and 50
.mu.l of cell-free extracts from repressed cultures. The cells are
opened mechanically on a Mini Bead-Beater. C.sub.1-C.sub.12: Assay
on 10, 20 and 50 .mu.l of cell-free extracts from induced cultures.
The cells are opened mechanically on a Mini Bead-Beater. E1-E12:
Assay on 1, 5 and 10 .mu.l of cell-free extract from induced
cultures. The cells are opened with the chemical reagent LTAB and
the supernatant is used for the assay. G1-G12: The pellet from the
LTAB opening is resuspended in 0.1 M MOPS-NaOH pH=6.2 and 1, 5 and
10 .mu.l is used for the assay. The respective blanks are shown in
B1-B12, D1-D12, F1-F12 and H1-H12.
[0249] FIG. 19. The specific activity of algal .alpha.-1,4-glucan
lyase is measured by the DNS method in cell-free extracts from
repressed and induced cultures. The black columns show the specific
activity when the cells are repressed in YND+2% glucose. The cells
are opened mechanically on a Mini-Bead Beater. The pink and blue
columns show the specific activity when the cells are depressed in
YND+1% glycerol and induced with 1% methanol on the second day of
growth. The cells are opened mechanically on a Mini Bead-Beater
(pink) or opened with the chemical reagent LTAB (blue).
[0250] FIG. 20. Left: Native-PAGE on a homogenous polyacrylamide
gel. Right: Native-PAGE on an 8-25% gradient polyacrylamide gel
(right). The gels are loaded in the same order: Lane 1: Raw extract
from Aspergillus Niger. Lane 2: Fraction III. Lane 3: Fraction II.
Lane 4: Algal .alpha.-1,4-glucan lyase purified from Aspergillus
Niger. Lane 5: Fraction I. Lane 6: Raw extract from H. polymorphs.
The gels are stained with PhastGel Blue R.
[0251] FIG. 21 shows the development of biomass concentration (g
wet weight pr L) and glucan lyase activity in the two fermentations
described in Example 26. The glucan lyase activity is based on the
substrate containing glycogen at pH 4.
EXAMPLES
Materials and Methods for Examples 1 to 23
[0252] Chemicals
[0253] All chemicals used were of analytical reagent grade.
Lecithin (3-sn-phosphatidylcholine) was commercially available as
Steprnpur PM from Stern (Germany). Pronase E (a proprietary name
for a mixture of various exo- and endo-peptidases, obtained from
Streptomyces griseus, that is able to hydrolyse virtually any
protein almost completely to free amino acids). Lysolecithin
(lysophatidylcholine), D-glucose, o-dianisidine, peroxidase
(P-8125), capric acid (decanoic acid), saponin (any member of a
large group of glycosides, widely distributed in plants, that are
powerful surfactants) and CTAB (cetyltrimethylammonium bromide also
known as hexadecyltrimethylammonium bromide) (H-5882) were all from
Sigma Chemical Co., USA. Methanol (HPLC) was from Lab-Scan Ltd.
Hydrogen peroxide and Triton X-100 (a proprietary name for
polyethoxylated octylphenol) were from Merck, Germany. Emulsifier
YN also commercially known as Palsgaard 4445 was from Palsgaard,
Denmark. The quaternary ammonium compounds such as LTAB
(lauroyltrimethylammonium bromide), Cetrimide-40 (also known as
cetrimidum which is a detergent disinfectant consisting of a
mixture of alkylammonium bromides, principally CTAB), CTAB
(cetyltrimethylammonium bromide), STAB (stearoyl trimethyl ammonium
bromide), MTAC (myristyl trimethyl ammonium chloride), CTAC (Cetyl
Trimethyl Ammonium Chloride), STAC (stearoyl trimethyl ammonium
chloride) were all from FeF, Denmark. Rodalon comprises about 9.5%
(95 g/l) alkyldimethylbenzylammonium chloride
(C.sub.12H.sub.25N(CH.sub.3).sub.2C.sub.7H.sub.7Cl) was obtained
from Superfos Biosector, 2950 Vedbaek, Denmark.
Alkyldimethylbenzylammonium chloride is also known as
benzalkoniumchloride. The emulsifier Sodium Lauroyl Lactylate (SLL)
was from Danisco Cultor, Grindsted, Denmark.
[0254] Yeast Fermentation
[0255] The cultivation of yeast was performed in a 6 L or a 100 L
fermentor according to Rhein Biotech fermentation manual for 10 L
scale.
Example 1
Assembly of a Synthetic, Codon Optimized HOX Gene
[0256] Gene Design
[0257] The nucleotide sequence of the native HOX gene was altered
resulting in a synthetic gene. The synthetic HOX gene (FIG. 6) was
designed so that the codon usage was precisely matched to the known
codon preferences of biotechnologically relevant yeasts such as
Pichia sp., Hansenula sp., Kluyveromyces, Yarrowinia, S. Pombe in
order to facilitate high level production in these organisms. The
gene was divided into three separately assembled and/or cloned
fragments. The sub-assemblies, designated as 5' proximal half were
comprised of the following oligonucleotides as set out in FIG. 5 as
complementary pairs: HOX1a/HOX2b (SEQ ID NOS: 1 and 2), HOX3a/HOX4b
(SEQ ID NOS: 3 and 4), HOX5a/HOX6b (SEQ ID NOS: 5 and 6),
HOX7a/HOX8b (SEQ ID NOS: 7 and 8), HOX9a/HOX10b (SEQ ID NOS: 9 and
10); 3' distal half A using primers 1-6 and 3' distal half B using
primers 6-10.
[0258] 5' Proximal Synthetic HOX Gene
[0259] The 5' proximal half of the synthetic HOX gene was
synthesized using ten oligonucleotides HOX1A to HOX10B. The
oligonucleotides having lengths ranging from 100-120 base pairs
were used as primers (concentration=0.1 .mu.M each) in a hot start
PCR reaction of 100 .mu.L (using the thermostable DNA polymerase
Pwo (Boehringer). Hot start was performed by heating the mixture of
oligonucleotides, buffer, MgSO.sub.4 to 90.degree. C. before dNTP
(250 .mu.M) and Pwo polymerase (2.5 units) was added. 40 cycles of
PCR using the PCR profile: 94.degree. C. for 30 seconds, 57.degree.
C. for 1 minute and 72.degree. C. for 1 minute. A 10 minute
elongation step at 72.degree. C. was included at the end of the 40
cycles. Analysis of the products from this PCR in agarose gel
electrophoresis showed a smear of DNA bands ranging in size from
100 to 850 base pairs. The first PCR was reamplified using 2 ul
from the above reaction as template and the flanking primers (1
.mu.M each) HOX1A and HOX 10B. The reaction contained 200 .mu.M
dNTP, 2.5 mM MgCl.sub.2 and 2 units of AmpliTaq.degree.
(Perkin-Elmer Cetus). The PCR conditions were: 94.degree. C. for 2
minutes, then 30 cycles of PCR with the profile 94.degree. C. for
30 seconds, 60.degree. C. for 1 minute and 72.degree. C. for 45
seconds. A 10 minutes elongation step at 72.degree. C. was included
at the end of the above reaction. Analysis of the second PCR
product by agarose gel electrophoresis showed the presence of a 850
bp DNA band which was subsequently purified from the gel and cloned
into the vector pCR.RTM. (Invitrogen).
[0260] 3' Distal Synthetic HOX Gene
[0261] Ten primers of lengths ranging from 90-126 base pairs were
designed to synthesize the distal part of the HOX gene. The primers
contained overlapping (complementary) regions of 16-21 base pairs
with a calculated melting temperature of approximately 60.degree.
C. The distal part of the HOX gene was synthesized as two fragments
(A & B), each with a size of 530 base pairs. Two PCR reactions
were performed using 6 primers at a time. The PCR reaction 1
contained primers 1-6 and PCR reaction 2 contained primers 5-10.
The PCR amplification reactions were performed using 0.1 .mu.M of
each of the primers, 250 .mu.M each dNTP, 2 mM MgSO.sub.4 and 2.5
units of Pfu DNA polymerase from Pyrococcus furiosus (Strategene)
in a reaction volume of 100 .mu.l. The cycling parameters for the 2
PCR reactions using Pfu DNA polymerase included a 1 minute
denaturation at 95.degree. C. followed by 30 cycles of PCR:
94.degree. C. for 1 minute, 55.degree. C. for 1 minute and
72.degree. C. for 1 minute. This was followed by an elongation step
at 72.degree. C. for 3 minutes. Analysis of the PCR products from
the two PCR reactions by agarose gel electrophoresis showed in both
cases, the synthesis of one specific DNA band of the correct size
of approximately 530 bps in length. The PCR products were cloned in
pCR.RTM.-Blunt vector (Invitrogen). The cloned partial synthetic
HOX genes were sequenced using primers flanking the multiple
cloning sites (M13 reverse primer and T7 promoter primer). The
sequencing results verified that the synthesized partial genes
contained the correct sequence.
[0262] Assembly of the Final Codon-Optimized HOX Gene
[0263] The three parts of the synthetic HOX gene were combined by
ligation of the gel purified DNA fragments comprising of the
NcoI/PvuII 5' proximal HOX, the 3' distal PvuII/SpeI HOX fragment A
and fragment B cut with SpeI/NotI. The complete, codon optimized
synthetic HOX gene (FIG. 6) was assembled into the Hansenula
expression vector, which was developed to mediate the expression
and secretion of foreign proteins from Hansenula. The expression
vector is based upon the formate dehydrogenase promoter (FMD), the
MOX terminator, with and without a yeast secretion signal.
[0264] Results 1
[0265] Expression of the Recombinant HOX in H. polymorpha
[0266] Table 1 shows the various HOX/secretion fusion constructs
which were inserted as Eco RI/Not I blunt fragments into the
multiple cloning site of the H. polymorpha expression/integration
vector. The different signal sequences were derived from the
glucoamylase gene from Schwanniomyces occidentalis, .alpha.-factor
mating type gene from Saccharomyces cerevisiae and the TAKA-amylase
from Aspergillus oryzae. A NcoI/NotI HOX construct without a signal
sequence was also cloned into the vector.
TABLE-US-00002 TABLE 1 Name of Clone signal sequence HOX Fusion
junction 1. DK 1 glucoamylase wildtype synthetic SAIQA MATLP (SEQ
ID NOS 24 and 25) 2. DK 2 glucoamylase wildtype synthetic SAIQA
ATLP (SEQ ID NOS 24 and 26) 3. DK 3 .alpha.-factor wildtype
synthetic KREAEA MATLP (SEQ ID NOS 27 and 25) 4. DK 4
.alpha.-factor wildtype synthetic KREAEA ATLP (SEQ ID NOS 27 and
26) 5. DK 5 .alpha.-factor mutant synthetic KREAEA MATLP (SEQ ID
NOS 27 and 25) 6. DK 6 .alpha.-factor mutant synthetic KR MATLP
(SEQ ID NO: 25) 7. DK 7 TAKA amylase mutant synthetic APALA MATLP
(SEQ ID NOS 28 and 25) 8. DK 8 No signal wild type none - MATLP
sequence synthetic (SEQ ID NO: 25) The term mutant synthetic
relates to a putative KEX 2 protease cleavage site
R.sub.331-K.sub.332 to R.sub.331-P.sub.332.
Example 2
Transformation and Passaging
[0267] The different HOX expression plasmids were used to transform
the uracil auxotrophic H. polymorphs strain RB11 to uridine
prototrophy. The HOX transformants harbouring the different
expression plasmids were cultivated under selective conditions for
30 generations to amplify the plasmid DNA and allow integration
into the genome. The transformants were grown on complete
non-selective medium for 20 generations. In addition to the
selection, PCR and southern analysis were used to characterize the
transformants.
[0268] Copy Number Determination of the Integrated Heterologous
DNA
[0269] The genomic DNA of the untransformed host strain and the
various recombinant isolates of a particular HOX construct were
digested with the restriction enzymes, Asp718/NcoI. The restricted
DNA was separated on 0.8% agarose gels, transferred to membrane
(nitrocellulose) and hybridized to a .sup.32P-labelled fragment of
the cloned FMD promoter. The hybridization pattern reveals two
signals, one for the genuine single copy 1.4 kb
[0270] FMD gene and one originating from the slightly smaller
heterologous fusion. A series of dilutions enabled the estimation
of the signal intensity of the integrated DNA compared to the
intrinsic single copy control.
Results 2
[0271] Screening for HOX Expression
[0272] Transformants were grown in 3 mL tube cultures and
cultivated under derepressing conditions by supplementing the
medium with 1% glycerol. HOX expression was analysed by SDS-PAGE
analysis of cultures from glycerol fermentation. Western blot
analysis using a polyclonal HOX antibody was used to detect the
presence of HOX protein. Table 2 shows the characteristics of
selected transformants expressing HOX.
TABLE-US-00003 TABLE 2 Characteristics of selected transformants
expressing HOX. Copy Localization HOX Transformant Number
N-terminus of expression Activity DK1-49 .apprxeq.10 unprocessed
soluble & none signal peptide insoluble fractions DK 2II-1
.apprxeq.20 unprocessed soluble & none signal peptide insoluble
fractions DK3II-4 .apprxeq.20 unprocessed soluble & none signal
peptide insoluble fractions DK4-39 .apprxeq.10 unprocessed soluble
& none signal peptide insoluble fractions DK5-13 .apprxeq.30-40
unprocessed soluble & none signal peptide insoluble fractions
DK6-16 .apprxeq.10 unprocessed soluble & none signal peptide
insoluble fractions DK7-1 .apprxeq.10 unprocessed soluble &
none signal peptide insoluble fractions DK8-1 .apprxeq.2-3 same as
soluble & active mature insoluble fractions DK8-27 .apprxeq.20
same as soluble & active mature insoluble fractions DK8-27*
.apprxeq.20 same as extracellular active Kan II3-mut25 mature
intracellular active DK8-27Kan* .apprxeq.20 same as extracellular
active IV2-mut301 mature intracellular active *The strain DK8-27
was subjected to chemical mutagenesis (NTG--nitrosoguanidine).
Example 3
Localisation of Recombinant HOX in H. polymorpha
[0273] For immunofluorescence microscopy of recombinant H.
polymorpha, cells were precultured in Yeast Nitrogen Base
(YNB)+glucose to a density of 10.sup.8 cells/ml. To induce
expression, 3.times.10.sup.8 cells were shifted to 100 mL shake
flask cultures supplemented with YNB+1% glycerol. After 1, 2 or 3
days of growth under derepressing condition 5.times.10.sup.8 cells
were fixed by a combined para-formaldehyde (4%) and glutaraldehyde
(0.2%) treatment (Hagen and Hyam, 1988). After three washes with 1
mL of PEM (100 mM Pipes, 1 mM EGTA, 1 mM MgSO.sub.4, pH 6.9), the
cell walls were partially removed in PEMS (PEM+1 M sorbitol)
supplemented with 0.5 mg/mL Zymolyase-100T. After approximately 60
minutes of digestion, cells were shifted to PEMS+1% Triton X-100,
incubated 30 seconds and washed three times with 0.5 mL PEM. To
quench unreacted glutaraldehyde cells were resuspended in PEM+1
mg/mL sodium borohydride. Immediately after this, cells were washed
twice in PEM, resuspended in PEMBAL (PEM+1% BSA (globulin free), 1
mM lysine hydrochloride, 0.1% NaN.sub.3), and incubated on a
rotating wheel for 30 minutes. 25% of the cell suspension,
equalling 10.sup.8 cells, was supplemented with 10 .mu.g/ml of
affinity purified polyclonal anti-HOX antibodies and incubated
overnight at room temperature. After three washes in 0.5 mL PEMBAL,
cells were suspended in PEMBAL, and incubated 5-20 hours in the
dark with 0.5% FITC-conjugated goat anti-rabbit antibodies (Sigma).
After wash in PEMBAL, the cells were washed once in PBS, once in
PBS+0.2 .mu.g/mL diamidinophenylindole (DAPI) and finally
resuspended in PBS+0.1% NaN.sub.3. For microscopic observation,
small samples of cell suspensions were dried onto poly-L-lysine
coated coverslips and inverted into drops of 100% glycerol
containing 1 mg/mL para-phenylene diamine. Cells were examined with
a Zeiss microscope equipped for indirect immunofluorescence at
1.000.times. and images were captured by a CCD camera (MicroMAX
Kodak) and processed using MetaMorph software.
[0274] Results 3
[0275] Immunofluorescence microscopy of the DK8-27 transformant
revealed that the recombinant HOX protein primarily localises to
the periphery of the cell as aggregates (FIG. 7b). Combined with
the biochemical data, these results indicate that HOX to some
extent may be a membrane associated protein (as opposed to a
substantially membrane bound protein). It is most likely that HOX
localises to the plasma membrane in H. polymorphs. Also, in the
DK8-27 mut25 strain, which is derived from DK8-27, HOX is
associated with the plasma membrane (FIG. 7c). The protein,
however, does not accumulate in aggregates but is more uniformly
distributed. When fused to various leader peptides HOX accumulates
in huge intracellular aggregates (FIG. 7d)
Example 4
Extraction of HOX from Recombinant Hansenula Cells by Means of
Different Detergents and Proteases
[0276] The experiment was carried out by using 5.0 mL cell
suspension (cells+supernatant) in a 15 mL centrifuge tube
(HOX9926-7, 317 g cells/L wet weight, 0.3 U/mL extracellular HOX
activity). Cells were separated by centrifugation at 4000 g for 10
min. For permeabilisation experiments, the supernatant was then
supplemented with either, CTAB, CTAB+Pronase E, Pronase E, Tween 20
(a proprietary name for polyoxyethylene sorbitan monolaurate) and
Tween 80 (a proprietary name for sorbitan monooleate). The cells
were then resuspended in 4.0 mL supernatant and incubated for 23
hours at 25.degree. C. (500 rpm). In order to examine the effect of
time with CTAB, the cells in one of the tubes were only incubated
for 7 min at 25.degree. C. in 4 mL 0.4% CTAB. The cells were then
separated by centrifugation. The cells were then re-suspended again
in the original supernatant without CTAB added and then incubated
for 23 hours as above. After incubation, the extracellular HOX in
the cell-free extracts was measured by the HOX assay.
[0277] Assay Method for Determination of HOX Activity (HOX
Assay)
[0278] HOX activity was estimated by the assay of Sullivan and
Ikawa (1973). The assay was scaled down to be run in microtiter
plates.
[0279] Principle
[0280] The HOX assay is based on the measurement of hydrogen
peroxide generated in the oxidation of glucose. The hydrogen
peroxide oxidizes o-dianisidine in presence of peroxidase (POD) to
form a dye.
##STR00007##
[0281] Reagents
[0282] 1. 100 mM phosphate buffer, pH 6.3
[0283] 2. 100 mM D-glucose in 100 mM phosphate buffer, pH 6.3
[0284] 3. o-Dianisidine, 3.0 mg/mL in distilled water
[0285] Peroxidase, 0.10 mg/mL in 100 mM phosphate buffer, pH
6.3
[0286] Assay [0287] 120 .mu.l reagent 1 [0288] 150 .mu.l reagent 2
[0289] 10 .mu.l reagent 3 [0290] 10 .mu.l reagent 4
[0291] and 10 .mu.l enzyme solution (in proper dilution)
[0292] The assay is performed in a microtiter plate. The reaction
is initiated by the addition of enzyme solution. The mixture is
incubated at 25.degree. C. for 10 min with shaking. The blank run
contains all the components with water instead of enzyme solution.
The formation of the dye is measured in a microtiter plate reader
at 405 nm. The linearity of the reaction is checked by using a
kinetics programme on the microplate reader.
[0293] Hydrogen Peroxide Standard Curve
[0294] A hydrogen peroxide standard curve is constructed by using
varying concentrations of fresh H.sub.2O.sub.2.
[0295] One unit of enzyme activity is defined as the amount of
enzyme which produces 1 .mu.mol of H.sub.2O.sub.2 per min at
25.degree. C.
[0296] Results 4
[0297] The data presented in Table 3 shows that CTAB is very
efficient in extracting HOX. CTAB is also much more efficient than
Tween 20 and Tween 80. There is no significant benefit of adding a
protease. Very interestingly CTAB exerts its positive effect even
when used only for a 7 min preincubation, this indicates that CTAB
very quickly binds to and permeabilizes the Hansenula cell wall.
This is supported by analysis of the cell free supernatant for CTAB
(see below) which shows that only 50-100 ppm out of 4000 ppm CTAB
added is present in the cell free supernatant.
[0298] A comparison of the sediment in the centrifuge tubes for
each test agent also indicates that the packed cell volume of the
CTAB treated cells is smaller than the volume of the control cells
or cells treated with detergents other than CTAB. This shrinkage of
the cells indicates that the cells have indeed been permeabilized
and emptied for some of their soluble content.
TABLE-US-00004 TABLE 3 Effect of detergent, detergent in
combination with protease and pre-incubation on the extraction of
intracellular HOX. Test HOX activity % Control 100 0.4% CTAB 4600
0.4% CTAB + Pronase E (400 PU) 5000 0.4% CTAB + Pronase E (800 PU)
4800 Pronase E (400 PU) 120 0.4% Tween 20 140 0.4% Tween 80 140
Pre-incubation in 0.4% CTAB for 7 min 5100
Example 5
Extraction of HOX using CTAB and benzalkonium chloride (BAC)
[0299] The experiment was carried out by using a 5.0 mL cell
suspension (cells+supernatant) in a 15 mL centrifuge tube (HOX9959,
Mut 45). The cell suspension was then supplemented either with CTAB
(from a 10% CTAB stock solution) or benzalkonium chloride (Rodalon,
9.5% benzalkonium chloride) and incubated for 22 hours at
25.degree. C. (200 rpm). After incubation, extracellular HOX (cells
were removed by 10 min centrifugation at 4000 g) was measured by
HOX assay.
[0300] Results 5
[0301] The data presented in Table 4 indicate that benzalkonium
chloride (BAC) is very effective in releasing the HOX enzyme from
the cells.
TABLE-US-00005 TABLE 4 Effect of CTAB and Benzalkonium chloride
(BAC) on HOX release from cells. Test HOX activity, % Control 100
0.4% CTAB 1300 0.08% BAC 2500 0.17% BAC 2300 0.50% BAC 2300 0.70%
BAC 2100 0.83% BAC 1700 1.00% BAC 1600
Example 6
Extraction of HOX by CTAB Combined with Salts and at Different
Temperatures
[0302] In order to examine the mechanism of the CTAB effect, CTAB
was combined with chaotrophic and nonchaotrophic salts. Five mL
cell suspension (cells+supernatant) was added to a 15 mL centrifuge
tube (HOX9926-7, 317 g cells/litre wet weight, 0.3 U/mL
extracellular HOX activity). Cells were separated by centrifugation
at 4000 g for 10 min. The supernatant was then supplemented with
either CTAB, CTAB+NaCl, CTAB+urea, CTAB+ammonium sulphate, or the
non-ionic detergent, octyl-glucoside. The cells were then
re-suspended in 4.0 mL supernatant and incubated for 26 hours at
25.degree. C. (500 rpm). In this experiment, the effect of shaking
and temperature was also investigated. After incubation, the
cell-free extract was used to estimate HOX activity using the HOX
assay as outlined in Example 4.
[0303] Results 6
[0304] The results are shown in Table 5. It is clear that shaking
is not necessary in order to have extraction of HOX in the presence
of CTAB. There is a clear temperature effect, meaning that
extraction at 4.degree. C. results in only half the activity
extracted at 25.degree. C. The addition of sodium chloride and
ammonium sulphate both decrease the effect of the CTAB treatment,
which may indicate that the ionic nature of CTAB is important. The
addition of urea had a less drastic effect but still reduced the
amount of extracted HOX to approximately half of the amount
extracted with 0.4% CTAB. Although urea is non-ionic, it may
interfere with hydrophobic interaction. Urea has been reported in
the prior art as a means of permeabilizing Pichia cells for
extraction of lipophilic proteins (Craig 1987). The non-ionic
detergent octyl glucoside has no significant extracting effect.
TABLE-US-00006 TABLE 5 Effect of detergent, detergent in
combination with salt, shaking, and temperature on the extraction
of intracellular HOX. Test HOX activity, % Control 100 0.4% CTAB
6700 0.4% CTAB, without shaking 7700 0.4% CTAB, without shaking, at
4.degree. C. 2800 0.4% CTAB + 1.0M NaCl 1900 0.4% CTAB + 1.0M urea
3600 0.4% CTAB + 1.0M ammonium sulphate 2300 0.2% octyl-glycoside
130 0.4% octyl-glycoside 190
Example 7
Determination of CTAB and LTAB by LC-ESI-MS in Cell Extracts
Containing HOX
[0305] The samples of extracted HOX from Example 5 were analyzed
for their content of CTAB by means of LC-ESI-MS on a
Hewlett-Packard 1100 HPLC-MS system consisting of the following
units:
[0306] (a) Binary gradient pump, HP 1100
[0307] (b) Autosampler, HP 1100,
[0308] (c) Thermostated Column Compartment, HP 1100
[0309] (d) Mass Selective Detector, HP 1100
[0310] (e) Chromatographic data system, HP ChemStation, Version
6.01
[0311] The system was equipped with a Zorbax Eclipse.RTM. XDB-C8, 5
.mu.M, 150.times.4.6 mM id. (Hewlett-Packard) column. Column
temperature was 25.degree. C.
[0312] The chromatographic conditions were a mobile phase
consisting of two solvents. Solvent A: 1 mM NH.sub.4OAc/Water,
solvent B: 1 mM NH.sub.4OAc/Methanol. The column was run with
isocratic conditions (that is, using conditions where the
composition of the eluant is maintained constantly during the
chromatographic period): 5% A+95% B, with a solvent flow rate of
0.80 mL/min and an injection volume of 10 .mu.L. The samples were
injected directly.
[0313] The mass spectrometric conditions were with the following
spray chamber settings:
[0314] Ionisation mode: Electrospray in positive mode
[0315] Drying gas (N.sub.2) temperature: 350.degree. C.
[0316] Drying gas flow rate: 6.0 l/min
[0317] Nebuliser pressure: 60 psi
[0318] Capillary voltage: -4000 Volts
[0319] Fragmentor voltage: 100 Volts
[0320] The detector settings were the following: SIM parameters:
m/z 284.1 (hexadecyltrimethylammonium cation). A stock solution
containing 500 .mu.g CTAB/mL water (concentration index 1000) was
diluted with water to obtain standard solutions with the following
concentration indices: 300-100-30-10. To the samples was added 0.4%
CTAB which would give 4000 .mu.g/mL if all the CTAB was present in
the extract.
[0321] The analysis method for the quaternary ammonium compounds
was optimised by using a different column, and by using different
mobile phase. Two 90 L scale fermentations (Vest0002b with a
biomass concentration of 314 g/L wet cells and Vest0003b with a
biomass concentration of 332 g/L wet cells) were added LTAB to a
concentration of 0.20% (w/v), and HOX was extracted for 24 h. A
sample from each fermentation was centrifuged at 10000 g for 10
minutes, and the resulting supernatants were withdrawn for LTAB
analysis. The following method was used to quantify the LTAB
content in the supernatants by means of LC-ESI-MS on a
Hewlett-Packard 1100 HPLC-MS system consisting of the following
units:
[0322] (a) Binary gradient pump, HP 1100
[0323] (b) Autosampler, HP 1100,
[0324] (c) Thermostated Column Compartment, HP 1100
[0325] (d) Mass Selective Detector, HP 1100
[0326] (e) Chromatographic data system, HP ChemStation, Version
6.01
[0327] The system was equipped with a PLRP-S, 100 .ANG., 5 .mu.m,
250.times.4.6 mM id. (Polymer Laboratories) column. Column
temperature was 25.degree. C.
[0328] The chromatographic conditions were a mobile phase
consisting of 0.1% heptafluorobutyric acid in methanol. The column
was run with a solvent flow rate of 1.00 mL/min and an injection
volume of 5 .mu.L. The samples were diluted 25 fold with methanol
and filtered through Gelman GHP Acrodisc 13 mM Minispike 0.45 .mu.M
before injection.
[0329] The mass spectrometric conditions were with the following
spray chamber settings:
[0330] Ionisation mode: Electrospray in positive mode
[0331] Drying gas (N.sub.2) temperature: 350.degree. C.
[0332] Drying gas flow rate: 13.0 L/min
[0333] Nebuliser pressure: 60 psi
[0334] Capillary voltage: -4000 Volts
[0335] Fragmentor voltage: 150 Volts
[0336] The detector settings were the following: SIM parameters:
m/z 228.1 (lauroyltrimethylammonium cation). A stock solution
containing 250 .mu.g LTAB/mL methanol
[0337] (concentration index 1000) was diluted with methanol to
obtain standard solutions with the following concentration indices:
400-200-120-80-36-10.8-5.4-2.16-0.864.
[0338] Results 7
[0339] It is clear from Table 6 that the level of CTAB in cell
extracts containing the HOX enzyme is much lower than the amount
added to the cells. This is explained by the binding and therefore
immobilization of the CTAB to the yeast cell walls. This means that
the resulting HOX enzyme only contains a very low level of
CTAB.
TABLE-US-00007 TABLE 6 Content of CTAB in the extracted HOX
supernatants from Example 6. .sup.1CTAB concentration, Test
.mu.g/mL Control no CTAB added 21 0.4% CTAB 115 0.4% CTAB, without
shaking 52 0.4% CTAB, without shaking, at 4.degree. C. 35 0.4% CTAB
+ 1.0M NaCl 212 0.4% CTAB + 1.0M urea 235 0.4% CTAB + 1.0M ammonium
sulphate 246 .sup.1Analysed by the first method.
[0340] The results obtained on LTAB in the supernatant (see Table
6A) show that only about 27% of the added LTAB is found in the cell
free fraction. This result shows the same tendency as the results
with CTAB in Table 6.
TABLE-US-00008 TABLE 6A Content of LTAB in the supernatants
extracted from fermentation Vest0002b and Vest0003b from Example 6.
LTAB added .sup.1LTAB in cell free Fermentation [.mu.g/mL] extract
[.mu.g/mL] Vest0002b 2000 538 Vest0003b 2000 550 .sup.1Analysed by
the optimised method
Example 8
Effect of Temperature on Time End Efficiency of HOX Extraction by
CTAB
[0341] The effect of temperature on time end efficiency of HOX
extraction by CTAB was examined on a Hansenula sample: Mut 45,
HOX9949, 282 g/L, 2.6 U/mL.
[0342] To 5 mL of ferment (cells+supernatant) in a centrifuge tube,
either 0.2% or 0.4% CTAB (from a 10% CTAB solution) was added. The
tubes were incubated at 25, 30, 35 and 40.degree. C., respectively
(200 rpm). At the indicated times samples were taken and after
centrifugation for 5 min at 10000 g, the supernatant was assayed
for HOX activity. The results are shown in Table 7.
TABLE-US-00009 TABLE 7 Time course of HOX extraction from H.
polymorpha at different temperatures. Extracted HOX [U/mL]
Extraction conditions 4 h 8 h 24 h 31 h 48 h 25.degree. C., 0.2%
CTAB 5.1 7.5 31 36 44 25.degree. C., 0.4% CTAB 5.9 9.2 25 29 37
30.degree. C., 0.2% CTAB 6.8 15 38 45 44 30.degree. C., 0.4% CTAB
7.4 15 36 40 42 35.degree. C., 0.2% CTAB 6.4 16 36 44 41 35.degree.
C., 0.4% CTAB 8.2 15 33 37 23 40.degree. C., 0.2% CTAB 16 27 44 43
32 40.degree. C., 0.4% CTAB 17 28 56 59 40
[0343] Results 8
[0344] It is clear that CTAB extraction is dependent on the
temperature and that a faster extraction can be achieved by using a
higher temperature. This is, however a parameter which has to be
balanced with the stability of the extracted protein. In this
experiment no significant difference seems to exist between using
0.2% or 0.4% CTAB. However, this depends on the cell concentration
in the specific experiment.
Example 9
HOX Extraction with Different Quaternary Ammonium Compounds
[0345] Several quaternary ammonium compounds were tested with
respect to extraction of the intracellular HOX enzyme from
Hansenula polymorpha. A sample of fermentation broth was withdrawn
from a 6 L scale fermentation where the biomass concentration was
approximately 340 g wet weight per L. One mL of a 4% (w/v) solution
of each of the quaternary ammonium compounds listed in Table 8 was
added to 9 mL of fermentation broth in plastic tubes. After 24 h of
incubation at 25.degree. C. at 200 RPM the tubes were centrifuged
10 min. at 12000 g. The supernatants were analysed for HOX activity
using the HOX assay as previously described.
[0346] The time course of HOX extraction was studied with CTAB,
LTAB and CTAC. A fermentation sample containing 280 g wet weight of
Hansenula polymorpha per L was withdrawn from the fermentor. A 4%
(w/v) solution of CTAB, LTAB and CTAC was added to a final
concentration of 0.2 or 0.4% (w/v) to plastic tubes containing 9 mL
of fermentation broth. After 0, 7, 17, 24, and 48 h of incubation
at 25.degree. C. at 200 RPM the tubes were centrifuged 10 min. at
12000.times.g. The supernatants were analysed for HOX activity
using the HOX assay as previously described.
[0347] The extracting effect of LTAB was tested on the Pichia
pastoris strain #349 that produces HOX intracellularly. A sample of
fermentation broth was withdrawn from a 6 L scale fermentation
where the biomass concentration was approximately 232 g wet weight
per L. Nine mL of fermentation broth was added to plastic tubes
together with 0 (control) or 180 .mu.L of a 10% (w/v) solution of
LTAB. After 24 h of incubation at 30.degree. C. at 20 RPM the tubes
were centrifuged 5 min. at 9000 g. The supernatants were analysed
for HOX activity using the HOX assay as previously described.
[0348] Results 9
[0349] HOX could be extracted with all the tested quaternary
ammonium compounds (see Table 8) when added to a fermentation
sample in a final concentration of 0.4% (w/v). After 24 h of
incubation at 25.degree. C., LTAB was superior to the other tested
compounds with respect to extraction of HOX. The amount of HOX
extracted seemed to decrease with increasing chain length of the
quaternary ammonium compound.
[0350] The time course of HOX extraction with CTAB, LTAB or CTAC is
shown in Table 9. It is clear that both incubation time and the
concentration of the extraction reagent influences the amount of
HOX activity extracted. LTAB is found to be the best extraction
reagent at all analysed incubation times which is consistent with
the results shown in Table 8. The extraction of HOX with LTAB seems
to proceed at a slower pace at a concentration of 0.2% (w/v) LTAB,
than at a concentration of 0.4% (w/v) LTAB. There seems to be
little difference between using 0.2 or 0.4% (w/v) CTAB in terms of
extraction of the HOX enzyme.
[0351] The extracellular HOX levels in the fermentation broth
before addition of extraction reagents was about 9% of the HOX
activity extracted with LTAB after 24 h.
TABLE-US-00010 TABLE 8 Extraction of HOX from Hansenula polymorpha
with various quaternary ammonium compounds. Extracted HOX activity
.sup.aMethylene normalised groups Counter with extracted
.sup.bStandard Trade name in chain ion amount with LTAB deviation
LTAB 11 bromide 100 7 Cetrimide-40 13 bromide 62 6 Cetrimide-40 13
bromide 65 1 dissolved in butanol CTAB 15 bromide 53 10 STAB 17
bromide 38 11 MTAC 13 chloride 71 2 CTAC 15 chloride 67 7 STAC 17
chloride 54 10 Pichia pastoris 11 bromide 3000.sup.c .sup. not LTAB
determined Pichia pastoris -- bromide 100.sup.c.sup. not Control
determined .sup.aThe compounds are all of the structure:
CH.sub.3--(CH.sub.2).sub.n--N(CH.sub.3).sup.+.sub.3 with chloride
or bromide as counter ion. .sup.bAll experiments were performed in
duplicate .sup.cThe results from Pichia pastoris were normalised
with respect to extracted HOX in the control tube without any LTAB
added. The extracellular HOX level in the fermentation before start
of the extraction was about 24% of the extracted level in the
control, i.e. the plastic tube without any LTAB added.
TABLE-US-00011 TABLE 9 Time course of extraction of the HOX enzyme
with CTAB, LTAB, and CTAC. Time 0.4% (w/v) 0.2% (w/v) [h] CTAB LTAB
CTAC CTAB LTAB 0 3 .+-. 1, n = 3 6 .+-. 1, n = 3 4 .+-. 1, n = 3 2
5 7 9 25 8 8 15 17 28 74 27 38 49 24 36 .+-. 5, n = 3 83 .+-. 8, n
= 3 38 .+-. 6, n = 3 43 65 48 65 .+-. 8, n = 3 100 .+-. 25, n = 3
64 .+-. 20, n = 3 65 78
[0352] The extracellular HOX level in the fermentation broth before
addition of extraction reagents was about 4% of the HOX activity
extracted with 0.4% (w/v) LTAB after 48 h.
[0353] Values are given.+-.1 standard deviation. n: the number of
experiments.
[0354] All values are normalised to the extracted levels with 0.4%
(w/v) LTAB after 48 h.
Example 10
Comparison Between CTAB and Other Emulsifiers for Extraction of
HOX
[0355] It is known that lysolecithin (lysophosphatidylcholine) can
permeabilize at least mammalian cells, with selective release of
macromolecules. In order to test the effect of lysolecithin and a
number of other emulsifiers and short chain fatty acids, their
ability to extract HOX was examined and compared with CTAB.
[0356] Five mL of cell suspension (cells+supernatant) was added to
a 15 mL centrifuge tube (HOX9910B, 305 g cells/litre wet weight,
1.6 U/ml extracellular HOX activity). Cells were separated by
centrifugation at 4000 g for 10 min. Cells were then re-suspended
in 4.0 mL 25 mM citric acid, pH 6.3 supplemented with either CTAB,
emulsifiers SLL, YN, capric acid, lysolecithin, or lecithin. The
cells were then incubated for 20 hours at 25.degree. C. (500
rpm).
[0357] Results 10
[0358] After incubation, the level of HOX activity in the cell free
extract was measured by the HOX assay. The data presented in Table
10 indicate that the tested emulsifiers other than CTAB are only
capable of releasing very low levels of active enzyme. The results
also indicate that CTAB is capable of activating latent enzyme in
the supernatant, possibly by releasing the enzyme from membrane
bound fragments.
TABLE-US-00012 TABLE 10 Effect of detergent, Emulisifier and
Phospho- lipids on the extraction of HOX. Test HOX activity, %
Control (Cells and buffer) 100 0.4% CTAB 1100 0.5% emulsifier SSL
160 1.0% emulsifier SSL 140 0.5% emulsifier YN 130 1.0% emulsifier
YN 130 0.5% capric acid 120 1.0% capric acid 140 0.4% lyso-lecithin
260 0.4% lecithin 140 Control (Cells + supernatant) 170 Cells +
supernatant + 0.4% CTAB 1900
Example 11
Comparison Between CTAB and Saponin for Extraction of HOX
[0359] In order to establish whether saponin works like digitonin,
the effect of saponin on the extraction of the HOX enzyme from
Hansenula was examined.
[0360] The experiment was carried out with 5.0 mL cell suspension
(cells+supernatant) in a 15 mL centrifuge tube (HOX190799, 340 g
cells/litre wet weight, 0.5 U/mL extracellular HOX activity). Cells
were separated by centrifugation at 4000 g for 10 min. The cells
were then re-suspended in 4.0 mL of supernatant which was
supplemented with either CTAB, or saponin, or re-suspended in 25 mM
citric acid, pH 6.3 supplemented with either CTAB, or saponin.
[0361] In order to confirm that the measured HOX activity in the
cell-free extract (after treatment with CTAB) is actually the
result of extraction and not just the result of HOX activation in
the supernatant (it could be that HOX already exists in the
supernatant but is inactive), the cell-free supernatant (after
supplementation with CTAB or saponin) was also incubated and
analysed for HOX activity. The tubes were incubated for 19 hours at
25.degree. C. (500 rpm). After incubation, the extracellular HOX in
the cell-free extract was measured by the HOX assay.
[0362] Results 11
[0363] The results in Table 11 show that saponin has a negligible
ability to extract HOX from the cells. In addition, there is no
indication of HOX activation neither by saponin nor by CTAB.
TABLE-US-00013 TABLE 11 Comparative HOX extraction/activation by
using different permeabilising 1530 agents. Test HOX activity, %
Control 0 (cells + supernatant) 100 0.2% CTAB (cells + supernatant)
1200 0.4% CTAB (cells + supernatant) 3100 0.2% Saponin (cells +
supernatant) 150 0.4% Saponin (cells + supernatant) 140 0.8%
Saponin (cells + supernatant) 140 Control 1 (cells + buffer) 100
0.2% CTAB (cells + buffer) 3100 0.4% CTAB (cells + buffer) 7700
0.2% Saponin (cells + buffer) 230 0.4% Saponin (cells + buffer) 230
0.8% Saponin (cells + buffer) 230 Supernatant + 0.2% CTAB 80
Supernatant + 0.4% CTAB 80 supernatant + 0.2% Saponin 80
Supernatant + 0.4% Saponin 80 Supernatant + 0.8% Saponin 80
Example 12
CTAB Extraction of HOX in 100 L Fermentor
[0364] After 120 h of fermentation (FermID Vest9910b) a CTAB
solution (360 g CTAB dissolved in 3.6 L water at 40.degree. C.) was
added directly to the broth through an inlet port in the 100 L
fermentor. The final concentration of CTAB in the fermentation
broth was approximately 4 g/L, since the active fermentor volume
was approximately 90 L. Simultaneously, agitation, aeration, pH
control and feed addition were stopped. The temperature was
controlled to 25.degree. C., and after 22 h of CTAB treatment the
broth's HOX content had increased from 1.6 U/mL to 30 U/mL.
Example 13
Homogenization of HOX Producing Hansenula Polymorpha in Lab
Scale
[0365] In order to test the efficiency of HOX extraction as a
result of the CTAB treatment, the cells from two different
fermentation trials were disrupted by using a cell disruption
equipment "Z Plus" 2.2 kW (Constant Systems Ltd, UK). The cells (5
mL) were disrupted using a one shot pump head at various pressures.
After opening, the cell debris was separated from the supernatant
by centrifugation (5 min at 10,000 g) and the intracellular HOX
level in the cell-free supernatant was measured using the HOX assay
as previously described. The same cells have also been treated with
0.2% CTAB (25.degree. C., 500 rpm, 20 h) and cell-free extract was
used as a comparable matter.
[0366] Results 13
[0367] The data presented in Table 12 indicate that the total
amount of intracellular HOX is extracted by treatment with 0.2%
CTAB.
TABLE-US-00014 TABLE 12 Efficiency of CTAB-treatment. Pressure HOX
activity Test [bar] [U/mL] HOX9931-8 1500 14.1 HOX9931-8 2000 16.3
HOX9931-8 2200 16.4 HOX9931-8 2500 16.2 HOX9931-8 2600 16.7
HOX9931-8 2700 15.7 HOX9931-8 + 0.2% CTAB* -- 18.6 HOX9934-8 2700
8.9 HOX9934-8 + 0.2% CTAB* -- 7.3 *Cells were incubated for 48
hours at 25.degree. C.
Example 14
Homogenization of HOX Producing Hansenula polymorpha in Large
Scale
[0368] 10 L of fermentation broth (FermID Vest9907b) was
homogenised in an APV Gaulin high pressure homogenizer model 30 CD.
The homogenizer was operated by maximum flow rate (100 L/min) and
by a pressure of 1000 bar. During the homogenisation procedure the
broth was cooled with ice water, and the product temperature never
exceeded 20.degree. C. A rapid increase in HOX activity was
observed during the first three cycles, followed by an almost
steady level after 5-7 cycles.
[0369] Results 14
[0370] The results are shown in Table 13 and in FIG. 8.
TABLE-US-00015 TABLE 13 Mechanical extraction of HOX from Hansenula
polymorpha HOX activity Cycle # [U/mL] 0 0.86 1 5.6 2 6.4 3 6.6 4
6.6 5 6.7 6 6.9 7 6.7
Example 15
The Effect of Triton X-100 on the Extraction of HOX from Hansenula
polymorpha
[0371] CTAB or Triton X-100 was added to 5 mL of ferment, (sample
HOX9954, Mut 45, 18.10.99, HVP) in a centrifuge tube. Water was
added to the control. The samples were incubated at 25.degree. C.
for 22 h at 200 rpm. After incubation the samples were centrifuged
and the supernatant was analyzed for HOX activity as previously
described.
[0372] Results 15
[0373] The results are shown in Table 14 and FIG. 9. The non-ionic
detergent, Triton X-100 has been used to permeabilize yeast cells
(see Naglak et al 1990 and U.S. Pat. No. 5,124,256) but it is clear
from this experiment that Triton X-100 has no extracting effect,
contrary to CTAB which has not been described in the prior art to
be capable of extracting an intracellular enzyme such as a HOX
enzyme, although it has been described to give permeabilisation of
cells.
TABLE-US-00016 TABLE 14 HOX extraction with CTAB compared to Triton
X-100. HOX activity Test [U/mL] 0.2% CTAB 14.5 0.4% CTAB 20.5 0.1%
Triton X-100 1.5 0.2% Triton X-100 1.6 0.4% Triton X-100 1.8 0.6%
Triton X-100 1.9 1.0% Triton X-100 1.9 Control, ferment 1.2
Example 16
Western Blotting
[0374] Western blotting was used to test the efficiency of HOX
secretion by analysing the amounts of residual (pellet) and
released (supernatant) HOX enzyme. Cells were treated with 0, 0.1,
0.2 and 0.4% CTAB, respectively, for 20 hours. After incubation the
cells were separated by centrifugation at 4000 g for 10 min.
SDS-Page (4-12% Mes Nu-Page) of the resultant supernatant is shown
in lane 7-10 of FIG. 10A. The pellets were washed twice with
buffer, and then re-suspended in buffer and disrupted on a FastPrep
cell disrupter. The pellet extracts were also applied to an
SDS-PAGE (see lanes 2-5 in FIG. 10A), using precast Novex gels
according to manufacturer's instructions (Novex, San Diego, US).
The SDS-Page gel was blotted to a nitrocellulose membrane according
to manufacturer's instructions (Novex, San Diego, US). The blot was
incubated with antibodies (rabbit antiserum #4364 BI/OCH 190797)
raised against the HOX enzyme, the preparation of which is
described below.
Production of HOX Specific Antibodies
[0375] A recombinant HOX enzyme was produced in Escherichia coli
from the expression plasmid PUPO181 as described in WO 96/40935.
The crude extract of E. coli cells expressing recombinant HOX was
analysed by SDS-PAGE. A prominent protein band at the relative
molecular weight (Mr) of 62 kD corresponding to HOX was transferred
to a polyvinylidene difluoride (PVDF) membrane and subjected to
N-terminal amino acid sequence analysis as described in WO
96/40935. The amino acid sequence identified was:
Ala-Thr-Leu-Pro-Gln-Lys-Asp-Pro-Gly-Tyr- (SEQ ID NO: 1). This
sequence corresponded to amino acids Nos. 2-11 in the published
sequence for HOX (Hansen and Stougaard, 1997). Therefore, it was
concluded that the expressed 62 kD protein was recombinant HOX
lacking the N-terminal amino acid methionine, Met.sub.1.
[0376] The 62 kD HOX band observed in SDS-PAGE was purified by
preparative SDS-PAGE and electroelution from the gel as described
by Hunkapiller et al (1983). The purity of the electroeluted 62 kD
HOX band was analysed by SDS-PAGE and by amino acid sequence
analysis as described above. The purified HOX was used for antibody
production in rabbits. Portions of approximately 50 .mu.g were
mixed with an equal volume of incomplete Freund's adjuvant and used
for immunization.
[0377] The HOX specific polyclonal antibodies produced in the
rabbits were used throughout this study in Western blot analyses.
Proteins to be analysed by Western blot analysis were
electrophoresed as described above and transferred to a
nitrocellulose filter according to standard procedures. The
nitrocellulose membrane was blocked 1 hour in a TBS-T solution (50
mM Tris, pH 7.5; 150 mM NaCl; O.1% Tween-20) containing 3% skimmed
milk powder.
[0378] HOX specific antibodies diluted 1:10,000 in TBS-T containing
1.5% skimmed milk powder were added and the blot was incubated
overnight. The blot was washed three times in TBS-T before
incubation (1 to 2 hours) with the secondary antibody (alkaline
phosphatase-conjugated goat anti-rabbit immunoglobulins, DAKO, cat.
no. D0487), diluted 1:1000 in TBS-T containing 1.5% skimmed milk
powder. The blot was subsequently washed in TBS-T (2.times.20 min)
and in TBS (50 mM Tris, pH 7.5; 150 mM NaCl; 1.times.5 min) before
development in Nitroblue
tetrazolium/5-Bromo-4-chloro-3-indolylphosphate (NBT/BCIP) buffer
according to standard procedures.
[0379] The specificity of the antibodies was investigated in a
series of Western blots with HOX containing extracts from Chondrus
crispus, E. coli and Pichia pastoris, respectively. Western blot
analysis of HOX containing extracts of P. pastoris showed a strong
HOX specific band at Mr 62 kD in addition to two or three weaker
bands at lower molecular weight.
[0380] Results 16
[0381] The results of the Western blot are shown in FIG. 10B. This
Western blot confirms that practically no HOX is left in the cells
after treatment with 0.4% CTAB.
Example 17
Description of High Throughput Screening (HTS) for Increased Levels
of Intracellular Enzymes
[0382] A Hansenula polymorpha strain expressing the intracellular
HOX enzyme was mutated with UV light at a wavelength of 254 nm. The
mutated strain was plated on agar plates (1.4 g/L Yeast Nitrogen
Base (YNB) from Gibco, 5 g/L (NH.sub.4).sub.2SO.sub.4, 1 g/L
glycerol and 2% (w/v) agar) and incubated at 30.degree. C. until
colonies were formed. The colonies were inoculated with a robotic
colony picker (Q-Pix, Genetix, Christchurch Dorsett, UK) into 96
well microtiter plates. Each microtiter well contained 200 .mu.L
YNB medium (100 mM MES pH 6.1, 1.4 g/L YNB from Gibco, 5 g/L
(NH.sub.4).sub.2SO.sub.4 and 10 g/L glycerol). The microtiter
plates were incubated at 25.degree. C. with shaking for 7 days in
an IOC400.XX2.0 shaking incubator (SANYO Gallenkamp BV, Breda, The
Netherlands). HOX activities were measured on 10 .mu.L fermentation
broth with the HOX assay modified to contain only 105 .mu.L reagent
1 and 15 .mu.L 0.4% (w/v) CTAB was added to the assay. The reaction
time was 60 minutes at 30.degree. C. The HOX assay was carried out
with a Plato 7 pipetting robot (Rosys, Hombrechtikon, Switzerland)
and the absorbencies were measured in a Spectramax plus microtiter
plate reader (Molecular Devices, UK). The growth in each individual
microtiter well was measured by transferring 10 .mu.L of
fermentation broth to a new microtiter plate, adding 100 .mu.L of
100 mM phosphate buffer, pH 6.3 and measuring the absorbency at 600
nm. The HOX measurements were normalized with respect to the
absorbency at 600 nm to take poor growth into account.
[0383] Results 17
[0384] The results demonstrate that it is possible to screen for
mutants of Hansenula polymorpha producing elevated levels of
intracellular HOX enzyme.
Example 18
Comparison of Specific Activity from CTAB Extracted HOX and
"Mechanically Extracted" HOX
[0385] Comparison of specific activity from CTAB extracted HOX (see
for example Table 12) and "mechanically extracted" HOX enzymes (see
for example Table 13 and FIG. 8).
[0386] Results 18
[0387] The results demonstrate that the specific activity of CTAB
extracted HOX is higher than the specific activity of "mechanically
extracted" HOX. These results indicate that the CTAB does not
extract all of the intracellular proteins localised in the
organelle, but mainly the cytosolic proteins.
Example 19
Characterisation of CTAB- and Mechanically Extracted HOX by Anion
Exchange Chromatography
[0388] In order to analyse the purity of the CTAB extracted HOX, it
was compared to HOX extracted by using cell disruption. The
specific activity was determined and compared, and the nucleic acid
contents of the extracts were compared. Furthermore the purity was
examined by anion exchange chromatography.
[0389] Seven mL cell suspension (cell+supernatant) was added to a
15 mL centrifuge tube (HOX9957, Mut 45). Upon addition of 0.4% CTAB
the cell suspension was incubated for 23 hours at 30.degree. C.
(200 rpm). The cells were removed by centrifugation (10000 g and 10
min) and cell-free supernatant was used as a source of CTAB
extracted HOX. Another 7 mL of the same cell suspension (without
adding CTAB) was disrupted by using a one shot pump head at
2.times.2400 bar (Z Plus, 2.2 kW, Constant Systems Ltd, UK). The
cell debris was then separated by centrifugation (10000 g and 10
min) and the supernatant was used as a source of mechanically
extracted HOX.
[0390] Both samples were desalted on a PD10 column (Pharmacia
Biotech.) in 20 mM TEA (triethanolamin, Merck) buffer, pH 7.3. The
samples were analysed for HOX activity and protein-concentration
(protein assay is based on the assay method described by Schleif
and Wensink, 1981. The nucleic acid content was determined by
measurement of the absorption at 260 and 280 nm (Bollag and
Edelstein, 1991.
[0391] Ion Exchange Chromatography was carried out by using a
Biologic Duo Flow (Bio-Rad, CA, USA) system. 500 .mu.l of desalted
sample was applied to a Source Q 15 column (HR5/5, Pharmacia
Biotech.) equilibrated in TEA buffer (buffer A, 20 mM, pH 7.3). The
HOX was eluted with a 20 mL linear gradient from 0-0.5 M NaCl in
buffer A with a flow rate of 1.5 mL/min during which 1.5 mL
fractions were collected and assayed for HOX activity.
[0392] Results 19
[0393] Determination of specific activity shows that CTAB extracted
HOX is much more pure compared to mechanically extracted HOX (Table
15). Also the nucleic acid content is much lower in the CTAB
extracted HOX than in the mechanically extracted HOX (Table
15).
TABLE-US-00017 TABLE 15 HOX- and protein concentration in CTAB- and
mechanically extracted HOX. Protein Specific Nucleic acid HOX
activity concentration activity concentration Test [U/mL] [mg/mL]
[U/mg protein] [.mu.g/mL] CTAB 30.6 2.33 13.1 102 extracted
Mechanically 32.0 12.7 2.5 384 extracted
[0394] The anion exchange chromatography analyses in FIGS. 11A and
11B which show chromatograms of the Source Q analyses for the CTAB-
and mechanically extracted HOX also strongly confirm this
result.
[0395] Examples 20, 21 and 22 describe experiments with CTAB. In
Examples 20 and 21, two different media were chosen for experiments
with CTAB: YP/1% glyceroln (Example 20) and YNB/1% glycerol+0.1 M
NaPi pH 6.0 (Example 21).
Example 20
HOX/CTAB/Cultivation in YP/1% Glycerol
[0396] 50 mL medium was inoculated with 2.5 mL of a YPD preculture
and cultivated at 37.degree. C., 160 rpm.
[0397] After 28 h cultivation, 1% (v/v) methanol was added and
further incubated for 18 h at 37.degree. C., 160 rpm.
[0398] The OD.sub.600nm was measured to calculate the amount of
CTAB which is necessary.
[0399] Aliquots of the supernatant (SN) and the cell pellet of 1.5
mL culture were taken.
[0400] After mechanical disruption of the cells the soluble
fraction (CX) was isolated.
[0401] =>SN of these conditions was designated A [0402] CX of
these conditions was designated D
[0403] Same volumes of the culture (20 mL) were aliquoted into two
shake flasks.
[0404] 20 ml, of the culture was supplemented with 0.005 g
CTAB.
[0405] (CTAB-stock solution: 0.02 g/mL; DANISCO: 0.4% in fermentor
culture (OD.sub.600nm .about.300)
[0406] =>shake flask experiments OD.sub.600nm
.about.20=>0.027 g CTAB/100 mL culture)
[0407] incubation of the culture: 24 h, 4.degree. C. without
shaking
[0408] =>SN of these conditions was designated C
[0409] CX of these conditions was designated F
[0410] The second shake flask without CTAB was incubated under the
same conditions as the CTAB-flask and served as reference
culture.
[0411] =>SN of these conditions was designated B [0412] CX of
these conditions was designated E
[0413] Strains, harbouring five different IL-1ra constructions were
cultivated. The strains 4-17, AL 9/2 and II 3-1 contained three
different constructions without a signal sequence, while the
strains MF.alpha. 2 and MF.alpha. AL7/1 represented two different
constructions with the MF.alpha. pre-pro sequence.
[0414] Strain FPMT 8 was cultivated under the same conditions as
the recombinant strains. This strain is an RB11 integrant with
nearly 30 copies of the empty Hansenula vector pFPMT121 and served
as negative control.
[0415] After treatment with CTAB, a 40fold (20fold) to 110fold
increase of the IL-1ra concentration was detected in the
supernatant of strains, harbouring constructions without signal
sequences.
[0416] For the MF.alpha.-strains treated with CTAB, a lower
increase (2 to 5fold) of the IL-1ra concentration was measured.
[0417] Results 20
[0418] The results are summarized in Table 16.
TABLE-US-00018 TABLE 16 experiments with CTAB in
YP/glycerol/methanol se- SN ELISA IL-1ra strain quence OD.sub.600
nm sample [.mu.g/mL] factor 4-17 2 20.5 A 0.345 C/A = 113 B 0.346
C/B = 113 C 39.0 AL 9/2 3 22.6 A 0.166* C/A = 20 B 0.179 C/B = 19 C
3.39 II 3/1 4 18.7 A 1.67 C/A = 49 B 1.94 C/B = 42 C 81.2 MF
.alpha.2 6 20.4 A 4.85 C/A = 6 B 5.69 C/B = 5 C 27.7 MF .alpha.AL
7/1 8 22.6 A 2.28 C/A = 2.3 B 2.02 C/B = 2.6 C 5.23 A: supernatant
after cultivation for 46 h in YP/glycerol/methanol B: supernatant
after cultivation for 46 h in YP/glycerol/methanol, than incubated
for 24 h without CTAB C: steril filtrated supernatant after
cultivation for 46 h in YP/glycerol/methanol, than incubated for 24
h with CTAB *remarks: The IL-1ra concentration in supernatant of
strain AL 9/2 was unusually low. In further experiments
concentrations between 0.6 and 0.7 .mu.g/mL were detected. The
reason for the low yield is not known.
Example 21
HOX/CTAB/Cultivation in YNB/1% Glycerol+0.1 M Na Pi pH 6.0
[0419] For further experiments with CTAB, three strains harbouring
three different constructs without signal sequences were selected
(strain 4-17; AL 9/2; II 3-1).
[0420] 45 mL medium was inoculated with 5 mL of a YPD preculture
and cultivated at 37.degree. C., 160 rpm.
[0421] After 28 h cultivation 1% (v/v) methanol was added and
further incubated for 18 h at 37.degree. C., 160 rpm.
[0422] The OD.sub.600nm was measured to calculate the amount of
CTAB which is necessary.
[0423] Aliquots of the supernatant (SN) and the cell pellet of 3 mL
culture were taken.
[0424] After mechanical disruption of the cells the soluble
fraction (CX) was isolated.
[0425] =>SN of these conditions was designated A [0426] CX of
these conditions was designated D
[0427] Same volumes of the culture (20 mL) were aliquoted into two
shake flasks.
[0428] 20 ml, of the culture was supplemented with 0.003 g
CTAB.
[0429] incubation of the culture: 24 h, 4.degree. C. without
shaking
[0430] =>SN of these conditions was designated C
[0431] CX of these conditions was designated F
[0432] The second shake flask without CTAB was incubated under the
same conditions as the CTAB-flask and served as reference
culture.
[0433] =>SN of these conditions was designated B [0434] CX of
these conditions was designated E
[0435] In all cases, incubation with CTAB led to an significant
increase of the IL-1ra concentration in the supernatant (100 to
130fold).
[0436] Results 21
[0437] The ELISA results of the CTAB experiments after cultivation
in two different media are compared in the following Table 17.
TABLE-US-00019 TABLE 17 comparison of CTAB experiments in
YP/glyc/methanol and YNB/glyc/methanol YP/glyc/methanol
YNB/glyc/methanol (pH 6.0) ELISA ELISA SN IL-1ra IL-1ra strain
sample OD.sub.600 nm [.mu.g/mL] factor OD.sub.600 nm [.mu.g/mL]
factor 4-17 A 20.5 0.345 C/A = 113 10.2 0.205 C/A = 108 B 0.346 C/B
= 113 10.8 0.069 ? (C/B = 322) C 39.0 9.8 22.2 AL 9/2 A 22.6 0.166
C/A = 20 10.1 0.045 C/A = 137 B 0.179 C/B = 19 11.6 0.025 ? (C/B =
246) C 3.39 11.0 6.16 II 3/1 A 18.7 1.67 C/A = 49 10.0 0.276 C/A =
105 B 1.94 C/B = 42 11.4 0.279 C/B = 104 C 81.2 10.6 29.1 A:
supernatant after cultivation for 46 h in YP/glycerol/methanol (or
YNB/glycerol/methanol) B: supernatant after cultivation for 46 h in
YP/glycerol/methanol (or YNB/glycerol/methanol), than incubated for
24 h without CTAB C: steril filtrated supernatant after cultivation
for 46 h in YP/glycerol/methanol (or YNB/glycerol/methanol), than
incubated for 24 h with CTAB
Example 22
Test of Different Incubation Conditions
[0438] For strain II 3/1, cultivated in YP/glycerol/methanol (see
1.a) different incubation conditions after addition of CTAB were
tested.
[0439] conditions:
[0440] 24 h CTAB, 4.degree. C. without shaking ("standard"
condition)
[0441] 24 h CTAB; 4.degree. C. gently shaking
[0442] 24 h CTAB, 37.degree. C. without shaking
[0443] 24 h CTAB; 37.degree. C. gently shaking
[0444] Results 22
[0445] The concentration of IL-1ra in the supernatant was measured
by ELISA. The results are summarized in Table 18.
TABLE-US-00020 TABLE 18 different incubation condition of CTAB
(ELISA results) ELISA IL-1ra strain II 3/1 [.mu.g/mL] factor
supernatant A 1.67 4.degree. C. } B 1.94 C/B = 42 without shaking C
81.2 C/A = 49 4.degree. C. } B 1.62 C/B = 28 gently shaking C 44.7
C/A = 27 37.degree. C. } B 8.04 C/B = 16 without shaking C 127.4
C/A = 76 37.degree. C. } B 11.1 C/B = 4 gently shaking C 46.2 C/A =
28 A: supernatant after cultivation for 46 h in
YP/glycerol/methanol B: supernatant after cultivation for 46 h in
YP/glycerol/methanol, than incubated for 24 h without CTAB C:
steril filtrated supernatant after cultivation for 46 h in
YP/glycerol/methanol, than incubated for 24 h with CTAB
[0446] A: supernatant after cultivation for 46 h in
YP/glycerol/methanol
[0447] B: supernatant after cultivation for 46 h in
YP/glycerol/methanol, than incubated for 24 h without CTAB
[0448] C: steril filtrated supernatant after cultivation for 46 h
in YP/glycerol/methanol, than incubated for 24 h with CTAB
[0449] The highest increase of IL-1ra in the supernatant was
measured after CTAB incubation at 37.degree. C. without shaking
(76fold) and after CTAB incubation at 4.degree. C. without shaking
(49fold).
[0450] The highest IL-1ra concentration was detected at 37.degree.
C., but the concentration in the reference sample incubated without
CTAB was also increased (16 fold). The high concentration in the
reference sample could be caused by cell lysis.
[0451] =>best conditions: 4.degree. C. (to avoid cell lysis)
without shaking
Example 23
SDS-PAGE, Western Blot and Coomassie Staining
[0452] The supernatant and the soluble fraction of the crude
extract isolated from the shake flask experiments were analyzed by
SDS-PAGE under reducing conditions.
[0453] gel: 16% Novex-gel TG 1 mm conditions [0454] colloidal
coomassie staining (BIO-SAFE Coomassie, Biorad)
[0455] Referenz-Stamme: samples:
[0456] A: supernatant after cultivation for 46 h in
YP/glycerol/methanol
[0457] B: reference supernatant without CTAB
[0458] C: supernatant after treatment with CTAB
[0459] D: soluble fraction (CX) of crude extract 1:3 diluted
[0460] E: soluble fraction (CX) of crude extract reference culture
1:3 diluted
[0461] F: soluble fraction (CX) of crude extract after CTAB
treatment 1:3 diluted
[0462] Results 23
[0463] WB 33 and Coo2
[0464] strains: 4-17 pFPMT icIL 1raI
[0465] A1 9/2 pFPMT icIL 1raI+A1
[0466] CTAB: incubation for 24 h; 4.degree. C. without shaking
[0467] The western blot (WB 33) results are presented in FIG.
12A.
[0468] The test samples and quantities added are presented in the
following legend to FIG. 12A.
TABLE-US-00021 1. MW marker See Blue 10 .mu.L (total) 2. 4-17 A SN
11.3 .mu.L 3. 4-17 D CX 1:3 dil. 11.3 .mu.L 4. 4-17 C SN CTAB 11.3
.mu.L 5. 4-17 F CX CTAB 1:3 dil. 11.3 .mu.L 6. rhIl-1ra-standard
(BSA-free) 30 ng 7. AL 9/2 A SN 11.3 .mu.L 8. AL 9/2 D CX 1:3 dil.
11.3 .mu.L 9. AL 9/2 C SN CTAB 11.3 .mu.L 10. AL 9/2 F CX CTAB 1:3
dil. 11.3 .mu.L
[0469] The results demonstrate that for both strains an increase of
IL-1ra in the SN (lane 4, lane 9) and a decrease in the CX (lane 5,
lane 10) was detected after treatment with CTAB.
[0470] The colloidal coomassie (Coo 2) blue staining is shown in
FIG. 12B
[0471] The test samples and quantities added are presented in the
following legend to FIG. 12B.
TABLE-US-00022 1. MW marker Mark 12 10 .mu.L (total) 2. 4-17 A SN
11.3 .mu.L 3. 4-17 D CX 1:3 dil. 11.3 .mu.L 4. 4-17 C SN CTAB 11.3
.mu.L 5. 4-17 F CX CTAB 1:3 dil. 11.3 .mu.L 6. 4-17 B SN w/o CTAB
11.3 .mu.L 7. 4-17 E CX w/o CTAB 1:3 dil. 11.3 .mu.L 8.
rhIl-1ra-Standard (BSA-free) 100 ng 9. AL 9/2 A SN 11.3 .mu.L 10.
AL 9/2 D CX 1:3 dil. 11.3 .mu.L 11. AL 9/2 C SN CTAB 11.3 .mu.L 12.
AL 9/2 F CX CTAB 1:3 dil. 11.3 .mu.L 13. AL 9/2 B SN w/o CTAB 11.3
.mu.L 14. AL 9/2 E CX w/o CTAB 1:3 dil 11.3 .mu.L 15. FPMT 8 A SN
11.3 .mu.L
[0472] WB 34 and Coo 3
[0473] strains: MF .alpha.2 pFPMT MF.alpha. IL-1raI [0474]
MF.alpha.AL 7/1 pFPMT MF.alpha. IL-1raI+A1
[0475] CTAB: incubation for 24 h; 4.degree. C. without shaking
[0476] The western blot (WB 34) results are presented in FIG.
13A
[0477] The test samples and quantities added are presented in the
following legend to FIG. 13A.
TABLE-US-00023 1. MW marker See Blue 10 .mu.L (total) 2. MF.alpha.
2 A SN 11.3 .mu.L 3. MF.alpha. 2 D CX 1:3 dil. 11.3 .mu.L 4.
MF.alpha. 2 C SN CTAB 11.3 .mu.L 5. MF.alpha. 2 F CX CTAB 1:3 dil.
11.3 .mu.L 6. rhIl-1ra-standard (BSA-free) 30 ng 7. MF.alpha. AL7/1
A SN 11.3 .mu.L 8. MF.alpha. AL7/1 D CX 1:3 dil. 11.3 .mu.L 9.
MF.alpha. AL7/1 C SN CTAB 11.3 .mu.L 10. MF.alpha. AL7/1 F CX CTAB
1:3 dil. 11.3 .mu.L
[0478] The results indicate that after treatment with CTAB a
mixture of intracellular and secreted IL-1ra was detected in the
supernatants C in lane 4 and 9.
[0479] MF.alpha. 2: additional band of .about.20 kDa and 34 kDa
derived from intracellular IL-1ra
[0480] MF.alpha. 7/1: additional band of <17 kDa derived from
intracellular IL-1ra intensity of 18 kDa signal increased
[0481] The colloidal coomassie (Coo 3) results are presented in
FIG. 13B
[0482] The test samples and quantities added are presented in the
following legend to FIG. 13B.
TABLE-US-00024 1. MW marker Mark 12 10 .mu.L (total) 2. MF.alpha. 2
A SN 11.3 .mu.L 3. MF.alpha. 2 D CX 1:3 dil. 11.3 .mu.L 4.
MF.alpha. 2 C SN CTAB 11.3 .mu.L 5. MF.alpha. 2 F CX CTAB 1:3 dil.
11.3 .mu.L 6. MF.alpha. 2 B SN w/o CTAB 11.3 .mu.L 7. MF.alpha. 2 E
CX w/o CTAB 1:3 dil. 11.3 .mu.L 8. rhIl-1ra-Standard (BSA-free) 100
ng 9. MF.alpha. AL7/1 A SN 11.3 .mu.L 10. MF.alpha. AL7/1 D CX 1:3
dil. 11.3 .mu.L 11. MF.alpha. AL7/1 C SN CTAB 11.3 .mu.L 12.
MF.alpha. AL7/1 F CX CTAB 1:3 dil. 11.3 .mu.L 13. MF.alpha. AL7/1 B
SN w/o CTAB 11.3 .mu.L 14. MF.alpha. AL7/1 E CX w/o CTAB 1:3 dil
11.3 .mu.L 15. FPMT 8 C SN CTAB 11.3 .mu.L
[0483] WB 35 and Coo 4
[0484] strain: II 3/1 pFPMT icIL-1ra type II
[0485] different incubation conditions after addition of CTAB:
[0486] 24 h CTAB, 4.degree. C. without shaking ("standard"
condition)
[0487] 24 h CTAB, 37.degree. C. without shaking
[0488] The western blot (WB 35) results are presented in FIG.
14A
[0489] The test samples and quantities added are presented in the
following legend to FIG. 14A.
TABLE-US-00025 1. MW marker See Blue 10 .mu.L (total) 2. II 3/1 SN
11.3 .mu.L 3. II 3/1 CX 1:3 dil. 11.3 .mu.L 4. II 3/1 SN CTAB
4.degree. C. 11.3 .mu.L 5. II 3/1 CX CTAB 4.degree. C. 1:3 dil.
11.3 .mu.L 6. rhIl-1ra-Standard (BSA-free) 30 ng 7. II 3/1 SN CTAB
37.degree. C. 11.3 .mu.L 8. II 3/1 CX CTAB 37.degree. C. 1:3 dil.
11.3 .mu.L 9. II 3/1 SN w/o CTAB 37.degree. C. 11.3 .mu.L 10. II
3/1 CX w/o CTAB 37.degree. C. 1:3 dil. 11.3 .mu.L
[0490] The colloidal coomassie (Coo 4) results are presented in
FIG. 14B
[0491] The test samples and quantities added are presented in the
following legend to FIG. 14B.
TABLE-US-00026 1. MW marker Mark 12 10 .mu.L (total) 2. II 3/1 SN
11.3 .mu.L 3. II 3/1 CX 1:3 dil. 11.3 .mu.L 4. II 3/1 SN CTAB
4.degree. C. 11.3 .mu.L 5. II 3/1 CX CTAB 4.degree. C. 1:3 dil.
11.3 .mu.L 6. II 3/1 SN w/o CTAB 4.degree. C. 11.3 .mu.L 7. II 3/1
CX w/o CTAB 4.degree. C. 1:3 dil. 11.3 .mu.L 8. II 3/1 SN CTAB
37.degree. C. 11.3 .mu.L 9. II 3/1 CX CTAB 37.degree. C. 1:3 dil.
11.3 .mu.L 10. II 3/1 SN w/o CTAB 37.degree. C. 11.3 .mu.L 11. II
3/1 CX w/o CTAB 37.degree. C. 1:3 dil 11.3 .mu.L 12.
rhIl-1ra-Standard (BSA-free) 100 ng 13. FPMT 8 CX CTAB 4.degree. C.
1:3 dil. 11.3 .mu.L 14. FPMT 8 SN CTAB 4.degree. C. 11.3 .mu.L 15.
FPMT 8 SN 11.3 .mu.L
[0492] The results demonstrate that after CTAB incubation at
4.degree. C. as well as at 37.degree. C. an increase of IL-1ra in
the SN (WB 35: lane 4, lane 8) and a decrease in the CX (WB 35:
lane 5, lane 9) was detected.
[0493] In SN CTAB 37.degree. C. (lane 8) the highest amount of
IL-1raII was obtained. This result is in agreement with the ELISA
results (see Table 3).
[0494] In this supernatant not only more IL-1raII but more other
proteins (>35 kDa) were stained (Coo 4: lane 8). This
observation confirmed the assumption that a significant cell lysis
took place at 37.degree. C. as compared to 4.degree. C.
[0495] Discussion
[0496] The codon usage of the Chondrus crispus HOX gene (Stougaard
and Hansen 1996, Hansen and Stougaard, 1997) was modified by
replacement of the low-usage codons with those of the more
frequently used codons of the Hansenula host organism. A
transformant of the methylotrophic yeast, Hansenula polymorphs,
expression system (developed at Rhein Biotech, Dusseldorf/Germany),
containing a codon optimized HOX DNA fragment for the expression of
HOX was prepared.
[0497] The codon optimisation of the gene encoding the HOX enzyme
resulted in high levels of expression (in terms of high levels of
enzyme activity) of the HOX enzyme in the Hansenula polymorphs
yeast host organisms. When a signal sequence was not present the
HOX enzyme was localized intracellularly. However, even when a
number of different signal sequences were used in different
constructs, little or no HOX activity could be measured in the
extracellular medium. These results indicated that the HOX enzyme
is incapable of being secreted even from host strains expressing a
HOX enzyme comprising a signal sequence. Western blots also
confirmed that the HOX enzyme may be localized in a membrane
associated fraction even when a signal sequence was present,
indicating that although there is transcription and translation of
the HOX gene, the HOX enzyme was not secreted and seemed to get
lodged in the secretion pathway.
[0498] The extraction of the intracellular enzymatically active HOX
enzyme using the method of the present invention was compared with
a traditional cell disruption method and with extraction procedures
using other ionic/non ionic detergents and emulsifiers.
Combinations of detergents with protease and salts were also
investigated.
Example 24
Expression of Glucan Lyase in Hansenula
[0499] The glucan lyase from the seaweed Gracilariopsis
lemaneiformis is an enzyme (EC 4.2.2.13) which catalyses the
degradation of .alpha.-1,4-glucans in starch and glycogen to
1,5-anhydro-D-fructose (see FIG. 15).
[0500] Details of the identification of glucan lyase, including its
purification from red alga, are set out in Yu et al., 1999,
Biochimica et Biophysica Acta 1430, 396-402.
[0501] The enzyme consists of 1038 amino acids and has a molecular
weight of 117 kDa. The optimal pH range is between pH 4-7 and the
temperature optimum for the glucan lyase is in the range
37-50.degree. C. The enzyme is very stable showing no loss of
activity when kept for several months at 22.degree. C. at pH
5.5-5.8.
[0502] FIG. 16A shows the structure of the full length glucan lyase
gene (3153 bp). The central part is well conserved among glucan
lyases and .alpha.-glucosidases. The N-terminal part is thought to
have a starch-binding domain (Yu et al (1999), Biochimica et
Biophysica Acta 1433p. 1-15).
Example 25
Expression and Purification of Glucan Lyase from Hansenula
polymorpha using LTAB
[0503] In this and the following Examples, glucan lyase in is
expressed in an industrial organism for mass production of the
enzyme and therefore the sugar. The expression and catalytic role
of the N- and C-terminal and the central of the lyase is also
examined.
[0504] Expression constructs for expression of glucan lyase are
described in Larsen, Kans. 2003. Expression of algal
.alpha.-1,4-glucan lyase in Hansenula polymorpha. B.Sc. report,
incorporated by reference. In particular, tranformant 42 (also
referred to as HP#42 and DCDK0129) is an expression construct
comprising the full length glucan lyase gene, which encodes a
glucan lyase with 1035 amino acids and molecular weight of 117
kDa.
[0505] In Examples 25 to 32, four constructs are made by standard
PCR and recombinant DNA techniques: (1) the full length gene (1038
aa); (2) the 5' end+the central part (938 aa, 5'agl); (3) the
central part (715 aa, aglcore) (4) the 3' end+the central part (815
aa, 3'agl).
[0506] The constructs are transformed into H. polymorpha by
electroporation. The aim of the study is to obtain an efficient
expression of algal glucan lyase in order to get a large scale
production of the enzyme.
[0507] Construction of Glucan Lyase Expression Vector
[0508] The Hansenula expression vector pFPMT121 (FIG. 16B) is used
to construct the glucan lyase expression vector.
[0509] The glucan lyase gene is assembled using PCR using the
following primers
TABLE-US-00027 US-agl1: (SEQ ID NO: 29) GAA TTC ATG ACC GCA TTG TCC
GAC AAA CAA ACG GCT LS-agl2: (SEQ ID NO: 30) ACC CGG GGT AGA AGA
GCC GGC AGC AAA CCA GTT US-agl5: (SEQ ID NO: 31) GGG TGA GCT CTG
CCA CTT CCA GGG CTG CGC TGT TC LS-agl6: (SEQ ID NO: 32) GGA GAT CTT
TAT TAA TGG TGA TGG TGA TGG TGG GTA ATT GTG ATC ACA GCG TCC GG
[0510] The PCR protocol used is as follows: The 3' end of the
glucan lyase gene is amplified using primers US-agl5 and LS-agl6,
and the 5' end is amplified using US-agl1 and LS-agl2, and the
respective PCR products are ligated into pCR-Blunt II-TOPO and
transformed into TOP10 E. coli cells using standard protocols
(Strategene/Invitrogen).
[0511] The 3' end product is excised from pCR Blunt using EcoRI and
BglII and ligated into pFPMT121 and transformed into TOP10 E. coli
cells, the resultant plasmid is cut with EcoRI to produce vector
fragment 1. The 5' end product is excised using EcoRI and XmaI to
make insert fragment 1. Insert fragment 1 and vector fragment 1 are
ligated using standard protocols to prepare the pFPMT121-glucan
lyase expression vector. The PCR products are sequenced to ensure
no errors had been introduced during the cloning strategy.
[0512] Preparation of Hansenula polymorpha Competent Cells
[0513] The strain RB11 (ura.sup.-) is grown in 5 ml of YPD
containing 2% peptone, 1% yeast extract and 2% glucose at
37.degree. C. with shaking over night. The culture is diluted
50-fold in 200 ml of prewarmed YPD and the culture is grown at
37.degree. C. to an OD.sub.660nm=1.0-1.3. The culture is
transferred to a centrifuge tube and the cells are harvested by
centrifugation at 3000 rpm for 5 minutes at room temperature.
[0514] The cells are resuspended in 20 ml of PPD buffer (prewarmed
to 37.degree. C.) and incubated for 15 minutes at 37.degree. C.
Cells are harvested by centrifugation at 3000 rpm for 5 minutes at
room temperature. The cells are washed three times with 50 ml of
STM buffer. After last wash and centrifugation the cells are put on
ice and resuspended in 1 ml of ice-cold STM buffer. Batches of 60
.mu.l cell suspensions are transferred to storage tubes and
directly frozen in liquid N.sub.2 and kept at -80.degree. C.
[0515] Transformation of Gene Constructs in Hansenula polymorpha by
Electroporation
[0516] The constructs are transformed into H. polymorpha by
electroporation in which the cells get an electric pulse that
perforates their cell walls and facilitates the uptake of foreign
DNA. 1 .mu.g DNA of each gene construct is used for the
transformations. DNA of pFPMT121 without insert and sterile
distilled water are transformed as positive and negative control,
respectively.
[0517] The DNA is added to 60 .mu.l of RB11 competent cells and the
mixture is transferred to a prechilled 2-mm electroporation cuvet
that is kept on ice until electroporation. The genepulser is
adjusted to 1.5 kV, 25 .mu.f, 200.OMEGA. so it is ready to fire.
Immediately after the pulse 1 ml of YPD medium is added to the
cuvet. The cell suspension is incubated at 37.degree. C. for one
hour and transferred to eppendorf tubes. The cells are harvested by
centrifugation at 3600 rpm for 5 minutes. The cells are washed
twice with YND medium (0.14% yeast nitrogen base without amino
acids and ammonium sulfate, 2% ammonium sulfate, 2% glucose (2%
agarose is added for plates)) and resuspended in 0.5 ml of YND. The
samples are plated on YND plates and incubated at 37.degree. C.
Transformants appeared on the plates after 3-5 days.
[0518] Integration of the construct into the genome of H.
polymorpha requires time and proper conditions. From the YND-plates
transformants are inoculated in 3 ml YND and grown at 37.degree. C.
with shaking for two days. As a control 5 transformants of vector
DNA are also picked. Every second day 50 .mu.l of cells are
transferred to 3 ml fresh YND (repeated 7 times). After the seventh
passage 50 .mu.l of cells are transferred to 3 ml YPD and grown
over night (repeated once). 20 .mu.l of cells are transferred to 3
ml YND and streaked on YND-plates. The plates are incubated at
37.degree. C. until transformants appeared. This passaging of
transformants allows stabilization of the construct that initially
exists as a free replicating plasmid and results in forced
integration into the chromosomal DNA (1,2). One colony from each
YND-plate is inoculated in 3 ml YPD and grown overnight at
37.degree. C. with shaking To induce the expression of the
integrated constructs 100 .mu.l of cells are transferred to 3 ml
YND containing 1% glycerol and grown for two days at 37.degree.
C.
[0519] Transformants are screened using PCR using primers
US3-alcore and LS4.
[0520] 1.0 ml of cell culture is pelleted by centrifugation in a
microcentrifuge tube. The supernatant is decanted. One third of the
tube is filled with acid washed glass beads (425-600 microns) and
400 .mu.l of 0.1 M MOPS-NaOH (pH=6.2) is added. The cells are
opened by shaking in a Mini Bead-Beater (Biospec Products,
Bartlesville, Okla.) 4 times 20 seconds at maximum speed. With a
hot glowing needle a hole is made in the bottom of each
microcentrifuge tube and the tubes are placed in eppendorf tubes.
The tubes are centrifuged at low speed so the cell-free extracts
are transferred to the eppendorf tubes and the glass beads are
retained in the microcentrifuge tubes.
[0521] In a PCR tube 10 .mu.l of cell-free extract is mixed with 50
pmole of primers, 1 .mu.l of each dNTP, 10 .mu.l of AmpliTaq DNA
Polymerase Buffer, 1 U of AmpliTaq DNA Polymerase and water to a
final volume of 50 .mu.l. After preheating for 30 seconds at
95.degree. C. the PCR-program consisted in 30 cycles of 95.degree.
C. for 30 seconds, 55.degree. C. for 1 minute and 68.degree. C. for
2 minutes and 5 minutes at 72.degree. C. extension at the end. The
PCR products are loaded on 2% agarose gels to check the size of the
products. The two primers US3-aglcore and LS4-aglcore are used for
the PCR-screening
TABLE-US-00028 US3-aglcore: (SEQ ID NO: 33) GGA GAT ACT ACC TGG AAC
TCT GGA CAA GAG GAC LS4-aglcore: (SEQ ID NO: 34) GTT TGG ATC CCC
GCC AGT ACC CAC
[0522] Intracelluar protein expression is determined using western
blot analysis using polyclonal antibodies raised against the glucan
lyase protein and raised in rabbit, and conjugated swine
anti-rabbit immunoglobulin (DAKA A/S) using standard
techniques.
Expression and Purification
[0523] Two transformants from transformation of the full-length
glucan lyase gene are grown in 250 ml of YND+1% glycerol in 2 L
shakeflasks with baffles at 24.degree. C. with shaking The cultures
are inoculated with cells grown in YND+2% glucose so an
OD.sub.600nm=1 is obtained in the new media. YND=0.14% yeast
nitrogen base without amino acids and ammonium sulphate, 2%
ammonium sulphate, 2% glucose.
[0524] On the second day of growth the cultures are induced with 1%
methanol. After three days of growth the cells are harvested by
centrifuging for 10 minutes at 4000 rpm.
[0525] The cells are resuspended in 5 mM sodium acetate pH=5.5 with
0.2% LTAB at 30% wet biomass in order to lyse the cells and release
the intracellular glucan lyase.
[0526] The tubes are incubated over night with shaking at
37.degree. C. The cells are harvested by centrifuging at 4000 rpm
in 10 minutes and the glucan lyase activity is determined in the
cell-free extract and in the pellet. This is done to check if LTAB
had opened the cells successfully before starting the purification
of glucan lyase.
[0527] Further Purification of Recombinant Algal .alpha.-1,4-glucan
Lyase
[0528] The recombinant algal .alpha.-1,4-glucan lyase expressed in
H. polymorphs may be further purified by affinity chromatography on
a starch column connected to a Fast Protein Liquid Chromatography
system (FPLC).
[0529] An AKTA explorer 10S from Pharmacia Biotech is used and it
measured the absorbance at 260 nm and 280 nm. 1.5 g of starch/mg
glucan lyase resuspended in 5 mM potassium acetate pH=4 is used to
pack a column with a diameter of 1.6 cm and a volume of 23 ml. The
column is equilibrated with 5 mM potassium acetate pH=4. The
cell-free extract is adjusted to pH=4 and loaded on another column.
Both columns are connected to the AKTA.
[0530] Before starting the purification the system is washed with
sterile distilled water and the pumps are washed with 5 mM
potassium acetate pH=4 and 20 mM Bis-Tris-HCl pH=6.6+2% dextrin10
(elusion buffer). The starch column is equilibrated with 5 column
volumes of 5 mM potassium acetate pH=4. Then the cell-free extract
is loaded automatically on the starch column and the column is
washed with 5 column volumes of 5 mM potassium acetate pH=4. Glucan
lyase is eluted with 20 mM Bis-Tris-HCl pH=6.6 with 2% dextrin10 in
fractions of 1 ml. The fractions with a high absorbance at 260 and
280 nanometers are tested for glucan lyase activity and the
fractions with highest activity are collected into three large
fractions. The three fractions are separately concentrated with a
Centriprep YM-30 from Millipore by centrifuging at 1500 rpm at
4.degree. C. so molecules smaller than 30 kDa are removed.
[0531] The three fractions are mixed and filtrated, and the glucan
lyase is purified by ion-exchange chromatography on a MonoQ column
(an anion exchange column from Pharmacia Biotech) connected to the
same FLPC system as used above. The column is equilibrated with 10
mM Bis-Tris-HCl pH=7 and the glucan lyase fractions are injected
into the system with a needle. The column is washed with 10 mM
Bis-Tris-HCl pH=7 and the glucan lyase is eluted with 10 mM
Bis-Tris-HCl pH=7+1 M NaCl. The fractions with a high absorbance at
260 nm and 280 nm are tested for glucan lyase activity. Two
fractions with high glucan lyase activity are concentrated
separately with a Centriprep YM-10 from Millipore by centrifuging
at 3000 rpm at 4.degree. C. where the molecule cutoff is 10
kDa.
Example 26
Characterisation of Expressed .alpha.-1,4 Glucan Lyase: Western
Blot Analysis
[0532] A Western blot analysis was done to examine if transformants
of the truncated forms express glucan lyase. The Western blot is
shown in FIGS. 17A, 17B and 17C.
[0533] From the Western blot we can conclude that transformants of
the aglcore and the 3'agl construct do not express any algal
.alpha.-1,4-glucan lyase even though the constructs have been
integrated into the genome of H. polymorphs as seen during the PCR
screening (FIG. 17A. Blot A lanes 1-8 and blot C lanes 9-17). All
the transformants from transformation of the full-length glucan
lyase gene express large amounts of algal .alpha.-1,4-glucan lyase
with a molecular weight of over 100 kDa (FIG. 17A. Blot A lane 9
and FIG. 17B Blot B lanes 1-9). Transformation of the 5'agl
construct has resulted in a single transformant that also express
algal .alpha.-1,4-glucan lyase (transformant number 14 in lanes 3
and 4, blot C, FIG. 17C). Several smaller bands are also seen in
these two lanes.
[0534] In summary, glucan lyase expression is observed in
transformants with the full-length gene and in a single
transformant harbouring the 5'agl construct as shown in FIGS. 17A,
17B and 17C. No expression is observed for the other two
constructs.
Example 27
Characterisation of Expressed .alpha.-1,4 Glucan Lyase: Activity
Screening
[0535] Cell-free extracts from all transformants are used in the
activity screening by the DNS method (Yu et al (1998), Carbohydrate
Research 305 p. 73-82). The absorbance measured at 550 nanometers
in the assay is a measurement of the amount of 1,5-anhydrofructose
produced and can be used to determine the specific activity of the
glucan lyase.
[0536] Activity screening of the transformants only detected glucan
lyase activity when the full-length gene was transformed.
Determination of the specific activity indicated that glucan lyase
was expressed at a very high level in 8 transformants as shown in
Table 19 below.
TABLE-US-00029 TABLE 19 Eight transformants from transformation of
the full-length glucan lyase gene showed a high lyase activity when
assayed by the DNS method. The protein concentration was determined
by the BioRad protein assay. The specific activity and the protein
concentration is the average of four independent measurements.
Specific activity (.mu.mol 1,5- Protein anhydrofrucose/
concentration Transformant min ml) (mg/ml) 1 4.0 0.65 2 9.3 0.86 3
7.2 0.74 4 4.2 0.64 5 2.5 0.63 6 5.4 0.70 7 6.7 0.79 8 8.9 0.92
[0537] As expected no activity was seen when assaying the cell-free
extracts from the control transformation of vector DNA.
Example 28
Comparison of .alpha.-1,4 Glucan Lyase Expressed in H. polymorpha
and vs .alpha.-1,4 Glucan Lyase Expressed in Pichia pastoris
[0538] The specific activity of algal .alpha.-1,4-glucan lyase
expressed from H. polymorpha and purified using LTAB, (from data
shown in Table 19) expressed in .mu.mol 1,5-anhydrofrucose/minmg
protein is as follow:
TABLE-US-00030 Specific activity (.mu.mol 1,5-anhydrofrucose/
Transformant min mg) 1 6.11 2 10.78 3 9.70 4 6.61 5 3.98 6 7.76 7
8.42 8 9.62
[0539] Transformation of the algal .alpha.-1,4-glucan lyase gene in
the methylotrophic yeast Pichia pastoris has previously resulted in
a specific activity of 0.7 .mu.mol 1,5-anhydrofrucose/minmg protein
(Bojsen K, et al 1999). The expression construct contained a signal
sequence, and purification was by secretion into the medium.
[0540] This indicates that the expression of glucan lyase in H.
polymorpha is very efficient, compared to previous methods.
Expression in the fungi Aspergillus niger has also been done but a
low yield is obtained (Yu, et al, 1999, supra).
[0541] Specifically, other expression systems tried (P. pastoris
and A. niger) only result in a specific activity of 0.70 .mu.mol
AF/minmg protein, indicating that the expression in H. polymorpha
is highly efficient in comparison.
Example 29
Comparison Between Mechanical and Chemical Recovery Methods
[0542] In this Example, a comparison is made between the efficiency
of recovering lyase from the yeast cells by mechanical means, and
by using LTAB.
[0543] Two transformants that expressed a high level of glucan
lyase (transformant number 2 and 8) are grown at 24.degree. C. (2
cultures of each transformant are started) since the expression of
glucan lyase can be optimised at this temperature as seen in the
growth experiment.
[0544] To compare the specific activity under repressed and induced
conditions samples are collected when the cells are grown in YND+2%
glucose (repressed) and in YND+1% glycerol with 1% methanol added
on the second day of growth (induced).
[0545] FIG. 18 shows the ELISA-plate from the activity screening by
the DNS method of the repressed and induced extracts. The assay is
performed as described in S. Yu et al., 1998. The red colour
indicates glucan lyase activity is much stronger when the induced
cells are opened with LTAB compared with opening of the cells
mechanically on a Mini Bead-Beater (E1-E12 compared with C1-C12).
The specific activity is almost 60-fold higher in the case of
LTAB-treated cells indicating that this is a much more effective
way of releasing intracellular proteins in H. polymorpha (See FIG.
19). When the cells are grown in YND+2% glucose a very low specific
activity is observed as expected since the FMD promoter is
repressed in this media. The pellet from the LTAB opening is
resuspended in 0.1 M MOPS-NaOH pH=6.2 and also assayed to check if
some glucan lyase is still bound in the pellet. The assay detected
a quite high glucan lyase activity in the pellet. A second round of
LTAB incubation of the pellet did not release the glucan lyase so
it is possible that the protein is bound to membranes.
[0546] The cell-free extract from the LTAB treated cells is used to
purify the recombinant algal .alpha.-1,4-glucan lyase by FPLC on a
starch column. The glucan lyase is eluted with 20 mM Bis-Tris-HCl
pH=6.6+2% dextrin10 and a broad peak in the absorbance at 260 nm
and at 280 is observed. Fraction 21-40 is tested for glucan lyase
activity and the fractions with highest specific activity are
collected into three larger fractions: Fraction I (fractions
21-26), fraction II (fraction 27-32) and fraction III (fraction
32-38) with fraction II having the highest specific activity. The
purification of glucan lyase resulted in a yield of 61% and a fold
of purification of 1.43 (See Table 20 below).
TABLE-US-00031 TABLE 20 Purification of recombinant algal
.alpha.-1,4-glucan lyase by affinity chromatography on a starch
column. Total Total Specific activity protein activity Yield
Fraction (U) (mg) (U/mg) Fold (%) 1. Cell-free extract 1237.95
11.76 105.26 1 100 2. Starch column 757.86 5.04 150.34 1.43 .sup.
61%
[0547] In summary, the detergent LTAB is found to selectively
extract the glucan lyase from the yeast biomass. This method proves
to be much more effective than the mechanical method using glass
beads as bullets (FIGS. 18 and 19).
[0548] Compared to previous expression systems (P. pastoris and A.
niger) which only result in a specific activity of 0.70 .mu.mol
AF/minmg protein, this Examples shows clearly that expression in H.
polymorphs combined with purification using a quaternary ammonium
compound CTAB is highly efficient in comparison.
Example 30
Further Purification of Recombinant Algal Glucan Lyase
[0549] The three fractions are concentrated with a Centriprep YM-30
and the purity of the glucan lyase is analysed by native PAGE (FIG.
20).
[0550] Comparison of the gels in FIG. 20 clearly indicates that a
much better separation of the proteins is obtained on the gradient
gel. On the homogenous gel it is not possible to distinguish
between the raw extract and the purified glucan lyase. In lane 1 on
the gradient gel it is very clear that glucan lyase is the
predominant protein in the raw extract which is consistent with the
very high expression of glucan lyase observed in the raw extract
-90.2% of the proteins expressed in the raw extract is glucan
lyase. Native-PAGE of all three fractions shows that the one-step
purification on a starch column has resulted in a pure glucan lyase
with an estimated purity of 95% FIG. 20 lane 2, 3 and 5 on the
gradient gel). The broader band in some of the lanes is due to
dextrin10 in the elusion buffer.
[0551] In summary, FIG. 20 clearly shows that the glucan lyase
expressed in H. polymorphs can easily be purified to a high degreee
of purity--the protein is already 95% pure in the cell-free extract
obtained by LTAB treatment.
Example 31
MALDI-TOF Mass Spectrometry and N-Terminal Sequencing
[0552] Glucan lyase in the three fractions is further purified by
FPLC on an ion-exchange column in order to remove dextrin10 from
the elution buffer. This is necessary since we wanted to analyze
the purified protein by MALDI-TOF mass spectrometry that requires a
very pure sample. The glucan lyase is eluted from the ion-exchange
column with 10 mM Bis-Tris-HCl pH=7+1 M NaCl and activity screening
of fraction B2-B6 revealed that all glucan lyase had been eluted in
fraction B4 and B5. These two fractions are concentrated with a
Centriprep YM-10 and the buffer is changed to 10 mM Bis-Tris-HCl
pH=7 to remove the salts. A few microliter of fraction B5 is
further desalted prior to the mass spectrometry analysis.
[0553] The molecular weight of the purified glucan lyase is
determined to 115794.+-.57Da and 115722.+-.57Da, respectively two
MALDI-TOF mass spectrometry analyses with the second analysis
resulting in a molecular weight of 115722 Da being the best
analysis. This purified algal .alpha.-1,4-glucan lyase from H.
polymorpha has a smaller molecular weight than the algal
.alpha.-1,4-glucan lyase purified from Aspergillus niger which has
a molecular weight of 117030 Da as determined by MALDI-TOF mass
spectrometry.
[0554] The N-terminal sequencing of the purified glucan lyase
resulted in a sequence of 20 amino acids (GSTDNPDGIDYKTYDYV GVW)
(SEQ ID NO: 35) that was 100% identical with the wild type algal
glucan lyase (See Table 21 below). Surprisingly the glucan lyase
from H. polymorpha is very active even though the N-terminal is 11
amino acids shorter than the wild type protein.
TABLE-US-00032 TABLE 21 The N-terminal sequence of the wildtype
algal .alpha.-1,4-glucan lyase and of the algal .alpha.-1,4-glucan
lyase from H. polymorpha. An Applied Biosystems 476A Protein
Sequencer was used for the N-terminal sequencing. N-terminal
sequence Wild type glucan lyase (SEQ ID NO: 36)
TALSDKQTATAGSTDNPDGIDYKTYDYVGVW Algal glucan lyase from H.
Polymorpha GSTDNPDGIDYKTYDYVGVW (SEQ ID NO: 35)
[0555] The shorter N-terminal observed in the glucan lyase from H.
polymorpha can explain the lower molecular weight determined by
MALDI-TOF mass spectrometry. The molecular weight of the 11 amino
acids in the N-terminal is 1088 Da. Thus, the molecular weight of
the glucan lyase from H. polymorpha is expected to be 115942 Da
(117030 Da-1088 Da) which is consistent with the molecular weight
of 115722 Da determined by MALDI-TOF mass spectrometry.
[0556] The results shown in Examples 24 to 31 show that a glucan
lyase of red algal origin with a mass over 117 kDa can be
efficiently expressed in the yeast Hansenula polymorpha. It is also
concluded the central and central+C-terminal parts of the gene are
not sufficient for enzyme activity. Furthermore, it is clear from
these Examples that the detergent LTAB is capable of selectively
extracting the intracellularly expressed glucan lyase from the
yeast biomass.
Example 32
Discussion (Examples 24 to 31)
[0557] The DNS method is used to assay for glucan lyase activity in
the different transformants. This assay is specific for glucan
lyase activity since only 1,5-anhydrofructose reacts so fast with
the DNS reagent. The reaction of 1,5-anhydrofructose with the DNS
reagent is completed in less than 10 minutes at room temperature
(22.degree. C.). In contrast it takes 5-10 minutes at 100.degree.
C. to complete the same reaction with D-glucose (Yu, S et al,
1998).
[0558] The DNS method is therefore a good way to assay for glucan
lyase activity. The activity is determined in cell-free extracts
prepared in two different ways: The cells are either opened
mechanically on a Mini Bead-Beater or opened with the chemical
reagent LTAB. The LTAB procedure resulted in a much more efficient
release of the glucan lyase and is a good alternative for opening
of H. polymorpha cells instead of the time consuming and
inefficient mechanical method.
[0559] All four gene constructs had been integrated into the genome
of H. polymorpha as determined by PCR screening and western blot
analysis showed that glucan lyase is only expressed in the
transformants containing the full-length gene and in a single
transformant containing the 5'agl construct. Activity screening
revealed that transformation of the full-length gene resulted in a
very high glucan lyase activity. Thus, the expression of glucan
lyase in H. polymorpha is much more efficient than seen in other
expression systems (Pichia pastoris and Aspergillus niger).
[0560] No glucan lyase activity is detected with the truncated
forms except in one case where the 5'agl construct is transformed.
The aglcore construct consists of the minimum catalytic domain and
this domain is probably not sufficient for activity since all 30
transformants failed to show any activity. In addition the aglcore
and the 3'agl construct lacked the N-terminal domain which includes
a starch-binding domain that is important for substrate binding.
Since glucan lyase activity and expression only is detected for one
transformant of the 5'agl construct it is possible that the
starch-binding domain is damaged during the construction when
different gene fragments are ligated. These data could indicate
that the 5' end of the glucan lyase gene is more important than the
3' end but one active transformant is not sufficient to conclude
this. It would be necessary to make some other truncated forms
where a bigger part of the catalytic core is included so a higher
number of transformants expressing the constructs can be
compared.
[0561] The growth experiment revealed that the expression of glucan
lyase is temperature dependent and can be optimised when growing
the cells at 24.degree. C. or 30.degree. C. A 10-fold increase in
expression of glucan lyase is observed compared with growth at
37.degree. C. so these two temperatures are recommended for high
expression of glucan lyase in H. polymorpha.
[0562] The glucan lyase expressed in H. polymorpha is purified on a
starch column connected to a FPLC system. The identity of the
purified glucan lyase is confirmed by MALDI-TOF mass spectrometry
and N-terminal sequencing. The molecular weight of the purified
glucan lyase is determined to 115722 Da by the MALDI-TOF mass
spectrometry analysis and the N-terminal sequencing resulted in a
sequence of 20 amino acids that is identical with the wild type
protein. This two-step purification procedure by affinity
chromatography and ion-exchange chromatography allows a quick and
very efficient purification of algal glucan lyase and the protein
is very pure even after the first step of purification (.gtoreq.95%
purity).
Example 33
High Yields of Glucan Lyase in Hansenula polymorpha (Large
Scale)
[0563] In this Example, two large scale fermentations with
Hansenula polymorpha #42 containing an algal glucan lyase gene are
carried out, and the intracellular levels of glucan lyase are
quantified.
[0564] Microorganisms
[0565] The following strain of H. polymorpha is used in this study:
HP #42 (DCDK0129, internal strain collection) obtained from Susan
Madrid and Shukun Yu, DIC. This strain and the expression construct
contained therein is also described in detail in Larsen, Kans.
2003. Expression of algal .alpha.-1,4-glucan lyase in Hansenula
polymorpha. B.Sc. report. The strain contained the glucan lyase
gene under control of the formate dehydrogenase promoter and the
methanol oxidase terminator from H. polymorpha.
[0566] Growth Media and Culture Conditions
[0567] YNB-Glycerol Medium
[0568] The medium used for preparation of inoculum for the
bioreactor fermentations and for growth in shake flasks contained:
1.7 g/L Yeast Nitrogen Base (DIFCO, Detroit, USA, 0335-15-9), 5 g/L
(NH.sub.4).sub.2SO.sub.4, 10 g/L glycerol, and 0.1 M
2-[N-Morpholino]ethanesulfonic acid (MES) as a buffer. The pH is
adjusted to 6.1 (the pKa of MES) with 4 M NaOH (before
autoclaving). Yeast Nitrogen Base and (NH.sub.4).sub.2SO.sub.4 are
filter-sterilized to the medium after autoclaving. This medium is
used for growth in shake flasks (250 mL medium in a shake flask
with a total volume of 500 mL).
[0569] YNB agar
[0570] The defined medium used for plating of stock cultures (kept
at -80.degree. C. in 25% (w/v) glycerol) contained: 1.7 g/L Yeast
Nitrogen Base (DIFCO, Detroit, USA, 0335-15-9), 5 g/L
(NH.sub.4).sub.2SO.sub.4, 10 g/L glycerol, and 20 g/L agar (DIFCO,
Detroit, USA, 0140-01). Yeast Nitrogen Base and
(NH.sub.4).sub.2SO.sub.4 are filter-sterilized to the medium after
autoclaving.
[0571] YPD Agar
[0572] The rich medium is used for contamination check in the
fermentors and for isolation of mutants. The medium contained: 10
g/L yeast extract, 10 g/L peptone, 20 g/L glycerol and 20 g/L
agar.
[0573] Fermentation in Bioreactor
[0574] The batch medium (3 L) used for the fermentation in 6 L
bioreactors contained: 13.3 g/L NH.sub.4H.sub.2PO.sub.4, 3.0 g/L
MgSO.sub.4H.sub.2O, 3.3 g/L KCl, 0.3 g/L NaCl, 15 g/L glycerol, and
3 mL/L ADD APT.RTM. Foamstop Sin 260 (ADD APT Chemicals AG,
Helmond, The Netherlands), 1.0 g/L CaCl.sub.22H.sub.2O, 67 mg/L
(NH.sub.4).sub.2Fe(SO.sub.4).sub.26H.sub.2O, 5 mg/L
CuSO.sub.45H.sub.2O, 20 mg/L ZnSO.sub.47H.sub.2O, 21 mg/L
MnSO.sub.4H.sub.2O, and 67 mg/L EDTA), 0.65 mg/L
NiSO.sub.46H.sub.2O, 0.65 mg/L CoCl.sub.2, 0.65 mg/L
H.sub.3BO.sub.4, 0.65 mg/L KI, 0.65 mg/L
Na.sub.2MoO.sub.42H.sub.2O), 2 mg/L D-biotin and 0.67 g/L
thiaminchloride-hydrochloride.
[0575] The feed medium contained 630 g/kg glycerol and 133 g/kg
formic acid. The pH is controlled by adding 8.75% (w/v)
NH.sub.3-water.
[0576] The fermentations are carried out as fed-batch cultivations
in in-house built 6 L fermentors. The following fermentation
conditions are used: pH 3.5 (GL0301) or 5.0 (GL0302), aeration 1
VVM, temperature 26.degree. C., and stirring from 400 to 700
RPM.
[0577] The fermentor containing 3 L batch medium is inoculated 500
mL of H. polymorphs grown to an OD.sub.600 of 10 in YNB medium at
25.degree. C. at 200 RPM. The feed is initiated when more than 0.45
moles of carbon dioxide are evolved. The feed, 630 g/kg glycerol
and 133 g/kg formic acid, is fed with a rate controlled by the
accumulated CO.sub.2 evolution, and based on the following
equations:
Feed-flow[g/h]=0,AcCO.sub.2<0.45
Feed-flow[g/h]=1.33VAccCO.sub.2,
0.45.ltoreq.AccCO.sub.2.ltoreq.3.25
Feed-flow[g/h]=4.33V,3.25.ltoreq.AccCO.sub.2
V: The fermentation broth volume [L] AccCO.sub.2: The accumulated
CO.sub.2 evolution [moles]
[0578] Analytical Procedures
[0579] Determination of Glucan Lyase Activity
[0580] A fermentation sample (10 mL) is centrifuged at 9000.times.g
for 10 minutes, and the supernatant is replaced with 100 mM MES, pH
6.1 containing 0.2% (w/v) LTAB. The glucan lyase is extracted from
the cells at 30.degree. C. for 24 hours followed by centrifugation
at 9000.times.g for 10 minutes to remove the cell debris. The
supernatant is used for glucan lyase measurements.
[0581] The following reagents are used in the glucan lyase
assay:
[0582] Substrate:
[0583] The following substrate is used: 20 g/L glycogen (Type III
from rabbit liver, Sigma G8876) in 50 mM acetic acid, pH 4.0.
[0584] DNS Reagent
[0585] The DNS reagent is prepared by dissolving 1 g
3,5-dinitrosalicylic acid in 40 mL 1 M NaOH+30 mL water. Then 3 g
potassium-sodium tartrate is added, and water is added to a total
volume of 100 mL. The reagent is stored in a brown bottle.
Standard Curve
[0586] A standard curve is prepared by adding 0, 20, 40, 60, 80 and
100 .mu.L 21 mmol/L 1,5-anhydro-D-fructose to microtiter wells, and
adding water to a total volume of 100 .mu.L. Then 100 .mu.L DNS
reagent is added and the micro titer plate is incubated at room
temperature for 10 minutes, followed by measurement of absorbance
at 550 nm.
[0587] Measurement of Glucan Lyase Activity
[0588] 25 .mu.L of sample and 75 .mu.L substrate (preheated to
45.degree. C.) is added to a micro titer well, and incubated for 15
minutes at 45.degree. C. Then 100 .mu.L DNS reagent is added, and
the micro titer plate is incubated 10 minutes at room temperature,
followed by absorbance measurement at 550 nm. A blank, 100 mM MES,
pH 6.1, is included.
[0589] The glucan lyase activity is calculated from the standard
curve, and expressed in U/mL. 1 U is defined as the amount of
glucan lyase that produces 1 .mu.mmol of 1,5-anhydro-D-fructose per
minute at 45.degree. C. at the above described conditions.
Biomass Growth
[0590] Growth of the yeast is followed by measuring the culture
turbidity at 600 nm. The biomass concentration in a culture fluid
is determined by centrifugation of 10 mL of culture fluid at
9000.times.g for 10 minutes in a pre weighed container. After
centrifugation, the supernatant is removed and the container is
weighed. The biomass concentration is calculated as g wet weight of
cells per L culture fluid.
[0591] Results and Discussion
[0592] The two fermentations carried out are conducted exactly
identically, except that GL0301 is carried out at pH 3.5 and GL0302
is carried out at pH 5.
[0593] FIG. 21 shows the development in biomass concentration and
glucan lyase activity in the two fermentations.
[0594] It is seen that the biomass and glucan lyase development is
somewhat slower for GL0301 than for GL0302. This may be explained
by the sudden shift from pH 6.1 in the shake flask culture to pH
3.5 in the fermentor for GL0301, which may have slowed down the
biomass growth and glucan lyase production. For GL0302 the pH shift
is only from pH 6.1 to 5, which is probably not as harsh as the
shift experienced by the culture in GL0301. From FIG. 21 it is seen
that the activity of glucan lyase reaches about 370 U/mL for both
fermentations. The biomass concentration reaches about 300 g/L for
both fermentations.
[0595] Larsen (Larsen, Kans. 2003. Expression of algal
.alpha.-1,4-glucan lyase in Hansenula polymorpha. B.Sc. report)
reported that the specific activity of glucan lyase is 105 U/mg
when assayed on 20 g/L glycogen at pH 4, which may be considered
comparable to the assay conditions used in this study (15 g/L
glycogen, pH 4). Using this specific activity, the level of glucan
lyase reaches 3.5 g/L protein at the end of the fermentations.
CONCLUSIONS
[0596] Glucan lyase from G. lemaneiformis is effectively produced
in H. polymorpha. The estimated level of glucan lyase reached 370
U/mL at the end of the fermentation, both when the fermentation is
carried out at pH 3.5 and at pH 5. This corresponds to a glucan
lyase yield of 3.5 g/L.
FURTHER ASPECTS OF THE INVENTION
[0597] Further aspects and embodiments of the invention are now set
out in the following numbered paragraphs is to be understood that
the invention encompasses these aspects:
[0598] Paragraph 1. A method for releasing a soluble or membrane
associated intracellular protein of interest (POI) from a cell
comprising the steps of: (a) providing a cell comprising a soluble
or membrane associated intracellular POI; (b) contacting the cell
with a membrane extracting composition (c) causing the POI to be
released from the cell under conditions sufficient for the specific
release of the POI and in a soluble form.
[0599] Paragraph 2. A method according to Paragraph 1 wherein the
cell is a transformed cell.
[0600] Paragraph 3. A method according to Paragraph 1 or Paragraph
2 for releasing a POI from a transformed cell said POI is a HOX
enzyme method comprising the steps of: (a) providing a transformed
cell comprising a HOX enzyme; (b) contacting the transformed cell
with a membrane extracting composition (c) causing the HOX enzyme
to be released from the transformed cell under conditions
sufficient for the specific release of the a HOX enzyme and in a
soluble form.
[0601] Paragraph 4. A method for releasing a POI from a transformed
cell said POI is an interleukin 1 receptor antagonist (IL-1ra) said
method comprising the steps of: (a) providing a transformed cell
comprising an IL-1ra; (b) contacting the transformed cell with a
membrane extracting composition (c) causing the IL-1ra to be
released from the transformed cell under conditions sufficient for
the specific release of the IL-1ra and in a soluble form.
[0602] Paragraph 5. A method according to any one of the preceding
Paragraphs wherein the cell is selected from the group consisting
of yeast cells, fungal cells and bacterial cells, preferably from
yeast and fungal cells.
[0603] Paragraph 6. A method according to any one of the preceding
Paragraphs wherein the intracellular POI is produced by recombinant
DNA techniques.
[0604] Paragraph 7. A method according to any one of the preceding
Paragraphs wherein the membrane extracting composition comprises a
quarternary ammonium compound.
[0605] Paragraph 8. A method according to any one of the preceding
Paragraphs wherein the quarternary ammonium compound is selected
from the group consisting of Lauroyl Trimethyl Ammonium Bromide
(LTAB), Myristyl Trimethyl Ammonium Chloride (MTAC), Cetyl
Trimethyl Ammonium Chloride (CTAC), Cetrimide, Cetyl Trimethyl
Ammonium Bromide (CTAB), Stearoyl Trimethyl Ammonium Chloride
(STAC), Stearoyl Trimethyl
[0606] Ammonium Bromide (STAB), Benzalkonium Chloride
(alkyldimethylbenzylammonium chloride), N-Cetylpyridinium Bromide
(N-Hexadecylpyridinium bromide), N-Cetylpyridinium Chloride
(N-Hexadecylpyridinium chloride), Benzyl Dimethyl Tetradecyl
Ammonium Chloride, Benzyl Dimethyl Hexadecyl Ammonium Chloride and
a combination of any two or more thereof.
[0607] Paragraph 9. A method according to any one of the preceding
Paragraphs wherein the membrane extracting composition comprises
from about 0.05% to about 0.6% by weight of the quarternary
ammonium compound, preferably from about 0.1% to about 0.5% by
weight of the quarternary ammonium compound, preferably from about
0.2% to about 0.45% by weight of the quarternary ammonium compound,
more preferably about 0.4% by weight of the quarternary ammonium
compound.
[0608] Paragraph 10. A method according to any one of preceding
Paragraphs wherein the cell is contacted with the membrane
extracting composition at temperatures from about 4.degree. C. to
40.degree. C., preferably from about 20.degree. C. to about
30.degree. C., more preferably about 25.degree. C.
[0609] Paragraph 11. A method according to any one of preceding
Paragraphs wherein the cell is contacted with the membrane
extracting composition at a pH optima of from about 2.0 to about
11.0 (more especially from about to 5.0 to about 7.0, more
especially about 6.3).
[0610] Paragraph 12. A method for screening for mutated cells or
transformed cells producing elevated levels of a soluble or
membrane associated intracellular POI comprising the steps of: (a)
growing the mutated cells at 30.degree. C.; (b) incubating the
mutated cells or transformed cells with the membrane extracting
composition as defined in Paragraph 7 or Paragraph 8; (c)
recovering the cell free medium; (c) screening the cell free medium
for elevated levels of the intracellular POI that the presence of
the intracellular POI in the cell free medium is indicative that
the intracellular POI has been released.
[0611] Paragraph 13. A membrane extracting composition suitable for
specifically releasing a soluble or membrane associated
intracellular POI wherein the composition is contacted with the
cell under the following conditions: (a) a percentage by weight of
quarternary ammonium compound from about 0.05% to about 0.6% (more
especially from about 0.1% to about 0.5%, more especially from
about 0.2% to about 0.45%, more especially about 0.4%); (b) a pH
optima of from about 2.0 to about 11.0 (more especially from about
to 5.0 to about 7.0, more especially about 6.3); (c) a temperature
optima of from about 4.degree. C. to about 40.degree. C., (more
especially from about 20.degree. C. to about 30.degree. C., more
especially about 25.degree. C.) that the intracellular POI
substantially free of contaminating proteins is obtained.
[0612] Paragraph 14. Use of a membrane extracting composition
comprising a quarternary ammonium compound to selectively release a
soluble or membrane associated intracellular POI.
[0613] Paragraph 15. A method according to any one of the preceding
Paragraphs wherein the POI is a HOX enzyme.
[0614] Paragraph 16. A method according to Paragraph 15 wherein the
HOX enzyme comprises the amino acid sequence set out in SEQ ID No
22 or a variant, homologue, derivative or fragment thereof.
[0615] Paragraph 17. A method according to Paragraph 15 or
Paragraph 16 wherein the HOX enzyme is encoded by a nucleotide
sequence set out in SEQ ID No 22 or a variant, homologue,
derivative or fragment thereof.
[0616] Paragraph 18. A method according to Paragraph 15 or
Paragraph 16 or Paragraph 17 wherein the HOX enzyme is encoded by a
nucleotide sequence capable of hybridising to the nucleotide
sequence set out in SEQ ID No 22 or a variant, homologue,
derivative or fragment thereof or a sequence complementary to the
hybridisable sequence.
[0617] Paragraph 19. A HOX enzyme producible by the method
according to any one of the preceding Paragraphs wherein the HOX
enzyme is encoded by a nucleotide sequence as defined in any one of
Paragraphs 16-18 and wherein the nucleotide sequence is synthesised
by the oligonucleotides as set out in SEQ ID Nos 2-22.
[0618] Paragraph 20. A POI as defined in Paragraph 1 or any
dependent Paragraph thereon wherein the POI is released in a
substantially non-glycoslyated form from a eukaryotic host
organism
[0619] Paragraph 21. A substantially non-glycosylated POI released
from a eukaryotic host organism.
[0620] Paragraph 22. A substantially non-glycosylated POI according
to Paragraph 21 wherein the POI is released by the method of any
one of the preceding Paragraphs.
[0621] Paragraph 23. A method according to any of the preceeding
Paragraphs, in which the POI is an IL-1ra enzyme.
[0622] Paragraph 24. A method according to any of the preceeding
Paragraphs, in which the POI is a glucan lyase enzyme.
[0623] Paragraph 25. A method according to paragraph 24, in which
the yield of glucan lyase is 1 g/litre or more.
SUMMARY
[0624] In one broad aspect of the present invention a method is
provided for releasing a soluble or membrane associated
intracellular protein of interest (POI) comprising the steps of:
providing a cell comprising a a soluble or membrane associated
intracellular POI the cell with a membrane extracting composition
causing the POI to be released from the cell under conditions
sufficient for the release of the POI and in a soluble form.
[0625] In another broad aspect of the present invention a method is
provided for specifically releasing a soluble or membrane
associated intracellular protein of interest (POI) comprising the
steps of: providing a cell comprising a soluble or membrane
associated intracellular POI; contacting the cell with a membrane
extracting composition causing the POI to be released from the cell
under conditions sufficient for the release of the POI but
insufficient for the release of other contaminating proteins.
REFERENCES
[0626] Bojsen, K., S. Yu, Kragh, K. M., and Marcussen, J. A group
of .quadrature.-1,4-glucan lyases and their genes from the red alga
Gracilariopsis lemaneiformis: purification, cloning, and
heterologous expression. Biochim. Biophys. Acta 1430 (1999):
396-402. [0627] Bollag, D. M. and Edelstein, S. J. (1991) Protein
Methods. New York, Wiley-Liss. [0628] Crahay, J., Delcour, J. M. A.
G. and Hanotier, J. D. V. (1992) Process for recovering
polypeptides localized in the periplasmic space of yeast without
breaking the cell wall by using an non-ionic detergent and a
neutral salt. U.S. Pat. No. 5,124,256. [0629] Craig, W. S. (1987)
Purification of pichia produced lipophilic proteins. U.S. Pat. No.
4,683,293. [0630] Gowda, L. R., Bachhawat, N. & Bhat, S. G.
(1991) Permeabilization of baker's yeast by cetyltrimethylammonium
bromide for intracellular enzyme catalysis. Enzyme Microb. Technol.
13, 154-157. [0631] Hagen, I. M. and Hyam, J. S. (1988) J. Cell
Sci. 89, 343-357. [0632] Hansen, O. C. and Stougaard, P. (1997)
Hexose oxidase from the red alga Chondrus crispus: purification,
molecular cloning, and expression in Pichia pastoris. J. Biol.
Chem. 272, 11581-11587. [0633] Hunkapiller, M. W., Lujan, U.,
Ostrander, F., and Hood, L. E. (1983). Isolation of proteins from
polyacrylamide gels for amino acid sequence analysis. Methods in
Enzymology, 91: 227-236. [0634] Joshi, M. S., Gowda, L. R. and
Bhat, S. G. (1987) Permeabilization of yeast cells (Kluyveromyces
fragilis) to lactose by cetyltrimethylammonium bromide. Biotechnol.
Lett. 9, 549-554. [0635] Joshi, M. S., Gowda, L. R., Katwa, L. C.
and Bhat, S. G. (1989) Permeabilization of yeast cells
(Kluyveromyces fragilis) to lactose by digitonin. Enzyme Microb.
Technol. 11, 439-443. [0636] King, A. T., Davey, M. R., Mellor, I.
R, Mulligan, B. J. and Lowe, K. C. (1991) Surfactant effects on
yeast cells. Enzyme Microb. Technol. 13, 148-153. [0637] Miyake, T.
and Shiosaka, M. (1974) Process for the extraction of enzymes from
microorganisms. U.S. Pat. No. 3,801,461. [0638] Naglak, T. J.,
Hettwer, D. J. and Wang, H. Y. (1990) Chemical permeabilization of
cells for intracellular product release. In Separation processes in
biotechnology (Asenjo, J. A. ed) Vol 9, chapter 7. M. Dekker, New
York. [0639] Poulsen, C. H. and Hostrup, P. B. (1998) Purification
and characterization of a hexose oxidase with excellent
strengthening effects in bread. Cereal Chem. 75, 51-57. [0640]
Schleif, R. F. and Wensink, P. C. (1981) Practical Methods in
Molecular Biology. New York, Springer-Verlag. [0641] Sekhar, S.,
Bhat, N. and Bhat, S. G. (1999) Preparation of detergent
permeabilized Bakers' yeast whole cell catalase. Process Biochem.
34, 349-354. [0642] Stougaard, P. and Hansen, O. C. (1996)
Recombinant hexose oxidase, a method of producing same and use of
such enzyme. WO 96/40935. [0643] Sullivan, J. D., and Ikawa, M.
(1973) Purification and characterization of hexose oxidase from the
red alga chondrus crispus. Biochem. Biophys. Acta 309,11-22. [0644]
Yu, S., K. Bojsen, B. Svensson, and J. Marcussen: alpha-1,4-Glucan
lyases producing 1,5-anhydro-D-fructose from starch and glycogen
have sequence similarity to alpha-glucosidases. Biochim. Biophys.
Acta. 1433(1-2) (1999): 1-15. [0645] Yu, S., Olsen C E, Marcussen
J: Methods for the assay of 1,5-anhydro-D-fructose and
alpha-1,4-glucan lyase. Carbohydr Res 305: 73-82 (1998).
[0646] Each of the applications and patents mentioned in this
document, and each document cited or referenced in each of the
above applications and patents, including during the prosecution of
each of the applications and patents ("application cited
documents") and any manufacturer's instructions or catalogues for
any products cited or mentioned in each of the applications and
patents and in any of the application cited documents, are hereby
incorporated herein by reference. Furthermore, all documents cited
in this text, and all documents cited or referenced in documents
cited in this text, and any manufacturer's instructions or
catalogues for any products cited or mentioned in this text, are
hereby incorporated herein by reference.
[0647] Various modifications and variations of the described
methods and system of the invention will be apparent to those
skilled in the art without departing from the scope and spirit of
the invention. Although the invention has been described in
connection with specific preferred embodiments, it should be
understood that the invention as claimed should not be unduly
limited to such specific embodiments. Indeed, various modifications
of the described modes for carrying out the invention which are
obvious to those skilled in molecular biology or related fields are
intended to be within the scope of the claims.
Sequence CWU 1
1
36110PRTArtificial SequenceDescription of Artificial Sequence
Synthetic N-terminal amino acid sequence 1Ala Thr Leu Pro Gln Lys
Asp Pro Gly Tyr1 5 10261DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 2actccatggc
tactttgcca caaaaggacc caggttacat tgttattgac gtcaacgctg 60g
613107DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 3cgaaatcgat gttggtacca atccatcttc
tgttgaaacc ttgcttcatg gatggcaatc 60ttgggtcagg cttgtctgga gtaccagcgt
tgacgtcaat aacaatg 1074106DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 4gattggtacc
aacatcgatt tcgtttacgt cgtttacact ccacaaggtg cttgtactgc 60tttggacaga
gctatggaaa agtgttctcc aggtaccgtc agaatc 1065106DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 5ttcaaccaaa ccagtaacgt tgataatagc cttgacacat
tcgtcgaaaa cgaagtcttc 60gtaacagtga ccaccagaaa cgattctgac ggtacctgga
gaacac 1066120DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 6atcaacgtta ctggtttggt
tgaatctggt tacgacgacg atagaggtta cttcgtctct 60tccggtgaca ccaactgggg
ttccttcaag accttgttca gagaccacgg tagagttttg 1207109DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 7caaaccgtgc aatctggcca aaataccgtc acctccaccg
acaatgtgac cacccaaacc 60gacggagtaa caggaaccac ctggcaaaac tctaccgtgg
tctctgaac 1098109DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 8tttggccaga ttgcacggtt
tgccagtcga ttggttatcc ggtgttgaag ttgtcgttaa 60gccagtcttg accgaagact
ctgttcttaa gtacgttcac aaggattcc 1099116DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 9ggcaaatcct tgaagtagta tttggtgata ataccgaagt
tacctccacc tccaccagtg 60tgagcccaaa acaactcacc gtcgttacct tcggaatcct
tgtgaacgta cttaag 11610118DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 10caaatactac
ttcaaggatt tgccaatgtc tccaagaggt gtcatcgctt ctaacttaca 60cttctcttgg
gacggtttca ctagagatgc cttgcaagat ttgttgacta agtacttc
11811118DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 11ggaggtatac aagtacataa caaactcttc
agctgcttgg tggaagattt ggaacttacc 60aacagtattc ttccaatcac atctagccaa
cttgaagtac ttagtcaaca aatcttgc 1181296DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 12atcttccatc aggcagctga agagtttgtt atgtacttgt
atacatccta ctctaacgac 60gccgagagag aagttgccca agacagacac tatcat
9613102DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 13gaaaggagcc caaccagcat gaccaccaag
agctttggta ggctcgcatg ttttgtagat 60ctgttcaatg tcagcctcca aatgatagtg
tctgtcttgg gc 1021490DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 14gctggttggg
ctcctttccc tgttagacct agacctagac acacatccaa gacttcttat 60atgcatgacg
agactatgga ctaccctttc 9015120DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 15aatctggaag
tctggaaagt ccttgatcat gtaagcagac ttgtacttac ctctctgatt 60aggaccggaa
ccgttgatag tctcagtcaa agcgtagaaa gggtagtcca tagtctcgtc
12016108DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 16gactttccag acttccagat tgatgttatc
tggaaatacc ttactgaggt tcctgacggt 60ttgactagtg ccgaaatgaa ggatgctctt
cttcaggttg atatgttc 10817126DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 17cttgtcttct
tcctgccagt atgtctggta ctgcagtttg atgatgtact ctctctgagc 60aactgcagta
gcatcccaaa caaccttgtg aatctcacca ccgaacatat caacctgaag 120aagagc
12618108DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 18acatactggc aggaagaaga caaggatgca
gttaacttga agtggattag agacttttac 60gaggagatgt atgagcctta tggtggtgtt
ccagacccta acactcag 10819111DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 19ggcaccatac
ttaccgttct tccagttgtt caagtcaaca tcagggtagt tgaagtagca 60tccctcaaaa
acacctttac cactctcaac ctgagtgtta gggtctggaa c 11120117DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 20aagaacggta agtatggtgc cttggaactt tactttttgg
gtaacctgaa cagattgatc 60aaggccaaat ggttgtggga tcctaacgag atcttcacaa
acaaacagtc tatccct 1172178DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 21gaattccgcg
gccgcctact atttagtctg cttaggctcc ttaagaggtt tagtagggat 60agactgtttg
tttgtgaa 78221644DNAArtificial SequenceDescription of Artificial
Sequence Nucleotide sequence of synthetic Hox gene 22atg gct act
ttg cca caa aag gac cca ggt tac att gtt att gac gtc 48Met Ala Thr
Leu Pro Gln Lys Asp Pro Gly Tyr Ile Val Ile Asp Val1 5 10 15aac gct
ggt act cca gac aag cct gac cca aga ttg cca tcc atg aag 96Asn Ala
Gly Thr Pro Asp Lys Pro Asp Pro Arg Leu Pro Ser Met Lys 20 25 30caa
ggt ttc aac aga aga tgg att ggt acc aac atc gat ttc gtt tac 144Gln
Gly Phe Asn Arg Arg Trp Ile Gly Thr Asn Ile Asp Phe Val Tyr 35 40
45gtc gtt tac act cca caa ggt gct tgt act gct ttg gac aga gct atg
192Val Val Tyr Thr Pro Gln Gly Ala Cys Thr Ala Leu Asp Arg Ala Met
50 55 60gaa aag tgt tct cca ggt acc gtc aga atc gtt tct ggt ggt cac
tgt 240Glu Lys Cys Ser Pro Gly Thr Val Arg Ile Val Ser Gly Gly His
Cys65 70 75 80tac gaa gac ttc gtt ttc gac gaa tgt gtc aag gct att
atc aac gtt 288Tyr Glu Asp Phe Val Phe Asp Glu Cys Val Lys Ala Ile
Ile Asn Val 85 90 95act ggt ttg gtt gaa tct ggt tac gac gac gat aga
ggt tac ttc gtc 336Thr Gly Leu Val Glu Ser Gly Tyr Asp Asp Asp Arg
Gly Tyr Phe Val 100 105 110tct tcc ggt gac acc aac tgg ggt tcc ttc
aag acc ttg ttc aga gac 384Ser Ser Gly Asp Thr Asn Trp Gly Ser Phe
Lys Thr Leu Phe Arg Asp 115 120 125cac ggt aga gtt ttg cca ggt ggt
tcc tgt tac tcc gtc ggt ttg ggt 432His Gly Arg Val Leu Pro Gly Gly
Ser Cys Tyr Ser Val Gly Leu Gly 130 135 140ggt cac att gtc ggt gga
ggt gac ggt att ttg gcc aga ttg cac ggt 480Gly His Ile Val Gly Gly
Gly Asp Gly Ile Leu Ala Arg Leu His Gly145 150 155 160ttg cca gtc
gat tgg tta tcc ggt gtt gaa gtt gtc gtt aag cca gtc 528Leu Pro Val
Asp Trp Leu Ser Gly Val Glu Val Val Val Lys Pro Val 165 170 175ttg
acc gaa gac tct gtt ctt aag tac gtt cac aag gat tcc gaa ggt 576Leu
Thr Glu Asp Ser Val Leu Lys Tyr Val His Lys Asp Ser Glu Gly 180 185
190aac gac ggt gag ttg ttt tgg gct cac act ggt gga ggt gga ggt aac
624Asn Asp Gly Glu Leu Phe Trp Ala His Thr Gly Gly Gly Gly Gly Asn
195 200 205ttc ggt att atc acc aaa tac tac ttc aag gat ttg cca atg
tct cca 672Phe Gly Ile Ile Thr Lys Tyr Tyr Phe Lys Asp Leu Pro Met
Ser Pro 210 215 220aga ggt gtc atc gct tct aac tta cac ttc tct tgg
gac ggt ttc act 720Arg Gly Val Ile Ala Ser Asn Leu His Phe Ser Trp
Asp Gly Phe Thr225 230 235 240aga gat gcc ttg caa gat ttg ttg act
aag tac ttc aag ttg gct aga 768Arg Asp Ala Leu Gln Asp Leu Leu Thr
Lys Tyr Phe Lys Leu Ala Arg 245 250 255tgt gat tgg aag aat act gtt
ggt aag ttc caa atc ttc cac caa gca 816Cys Asp Trp Lys Asn Thr Val
Gly Lys Phe Gln Ile Phe His Gln Ala 260 265 270gct gaa gag ttt gtt
atg tac ttg tat aca tcc tac tct aac gac gcc 864Ala Glu Glu Phe Val
Met Tyr Leu Tyr Thr Ser Tyr Ser Asn Asp Ala 275 280 285gag aga gaa
gtt gcc caa gac aga cac tat cat ttg gag gct gac att 912Glu Arg Glu
Val Ala Gln Asp Arg His Tyr His Leu Glu Ala Asp Ile 290 295 300gaa
cag atc tac aaa aca tgc gag cct acc aaa gct ctt ggt ggt cat 960Glu
Gln Ile Tyr Lys Thr Cys Glu Pro Thr Lys Ala Leu Gly Gly His305 310
315 320gct ggt tgg gct cct ttc cct gtt aga cct aga aag aga cac aca
tcc 1008Ala Gly Trp Ala Pro Phe Pro Val Arg Pro Arg Lys Arg His Thr
Ser 325 330 335aag act tct tat atg cat gac gag act atg gac tac cct
ttc tac gct 1056Lys Thr Ser Tyr Met His Asp Glu Thr Met Asp Tyr Pro
Phe Tyr Ala 340 345 350ttg act gag act atc aac ggt tcc ggt cct aat
cag aga ggt aag tac 1104Leu Thr Glu Thr Ile Asn Gly Ser Gly Pro Asn
Gln Arg Gly Lys Tyr 355 360 365aag tct gct tac atg atc aag gac ttt
cca gac ttc cag att gat gtt 1152Lys Ser Ala Tyr Met Ile Lys Asp Phe
Pro Asp Phe Gln Ile Asp Val 370 375 380atc tgg aaa tac ctt act gag
gtt cct gac ggt ttg act agt gcc gaa 1200Ile Trp Lys Tyr Leu Thr Glu
Val Pro Asp Gly Leu Thr Ser Ala Glu385 390 395 400atg aag gat gct
ctt ctt cag gtt gat atg ttc ggt ggt gag att cac 1248Met Lys Asp Ala
Leu Leu Gln Val Asp Met Phe Gly Gly Glu Ile His 405 410 415aag gtt
gtt tgg gat gct act gca gtt gct cag aga gag tac atc atc 1296Lys Val
Val Trp Asp Ala Thr Ala Val Ala Gln Arg Glu Tyr Ile Ile 420 425
430aaa ctg cag tac cag aca tac tgg cag gaa gaa gac aag gat gca gtt
1344Lys Leu Gln Tyr Gln Thr Tyr Trp Gln Glu Glu Asp Lys Asp Ala Val
435 440 445aac ttg aag tgg att aga gac ttt tac gag gag atg tat gag
cct tat 1392Asn Leu Lys Trp Ile Arg Asp Phe Tyr Glu Glu Met Tyr Glu
Pro Tyr 450 455 460ggt ggt gtt cca gac cct aac act cag gtt gag agt
ggt aaa ggt gtt 1440Gly Gly Val Pro Asp Pro Asn Thr Gln Val Glu Ser
Gly Lys Gly Val465 470 475 480ttt gag gga tgc tac ttc aac tac cct
gat gtt gac ttg aac aac tgg 1488Phe Glu Gly Cys Tyr Phe Asn Tyr Pro
Asp Val Asp Leu Asn Asn Trp 485 490 495aag aac ggt aag tat ggt gcc
ttg gaa ctt tac ttt ttg ggt aac ctg 1536Lys Asn Gly Lys Tyr Gly Ala
Leu Glu Leu Tyr Phe Leu Gly Asn Leu 500 505 510aac aga ttg atc aag
gcc aaa tgg ttg tgg gat cct aac gag atc ttc 1584Asn Arg Leu Ile Lys
Ala Lys Trp Leu Trp Asp Pro Asn Glu Ile Phe 515 520 525aca aac aaa
cag tct atc cct act aaa cct ctt aag gag cct aag cag 1632Thr Asn Lys
Gln Ser Ile Pro Thr Lys Pro Leu Lys Glu Pro Lys Gln 530 535 540act
aaa tag tag 1644Thr Lys54523546PRTArtificial SequenceDescription of
Artificial Sequence Amino acid sequence of synthetic Hox gene 23Met
Ala Thr Leu Pro Gln Lys Asp Pro Gly Tyr Ile Val Ile Asp Val1 5 10
15Asn Ala Gly Thr Pro Asp Lys Pro Asp Pro Arg Leu Pro Ser Met Lys
20 25 30Gln Gly Phe Asn Arg Arg Trp Ile Gly Thr Asn Ile Asp Phe Val
Tyr 35 40 45Val Val Tyr Thr Pro Gln Gly Ala Cys Thr Ala Leu Asp Arg
Ala Met 50 55 60Glu Lys Cys Ser Pro Gly Thr Val Arg Ile Val Ser Gly
Gly His Cys65 70 75 80Tyr Glu Asp Phe Val Phe Asp Glu Cys Val Lys
Ala Ile Ile Asn Val 85 90 95Thr Gly Leu Val Glu Ser Gly Tyr Asp Asp
Asp Arg Gly Tyr Phe Val 100 105 110Ser Ser Gly Asp Thr Asn Trp Gly
Ser Phe Lys Thr Leu Phe Arg Asp 115 120 125His Gly Arg Val Leu Pro
Gly Gly Ser Cys Tyr Ser Val Gly Leu Gly 130 135 140Gly His Ile Val
Gly Gly Gly Asp Gly Ile Leu Ala Arg Leu His Gly145 150 155 160Leu
Pro Val Asp Trp Leu Ser Gly Val Glu Val Val Val Lys Pro Val 165 170
175Leu Thr Glu Asp Ser Val Leu Lys Tyr Val His Lys Asp Ser Glu Gly
180 185 190Asn Asp Gly Glu Leu Phe Trp Ala His Thr Gly Gly Gly Gly
Gly Asn 195 200 205Phe Gly Ile Ile Thr Lys Tyr Tyr Phe Lys Asp Leu
Pro Met Ser Pro 210 215 220Arg Gly Val Ile Ala Ser Asn Leu His Phe
Ser Trp Asp Gly Phe Thr225 230 235 240Arg Asp Ala Leu Gln Asp Leu
Leu Thr Lys Tyr Phe Lys Leu Ala Arg 245 250 255Cys Asp Trp Lys Asn
Thr Val Gly Lys Phe Gln Ile Phe His Gln Ala 260 265 270Ala Glu Glu
Phe Val Met Tyr Leu Tyr Thr Ser Tyr Ser Asn Asp Ala 275 280 285Glu
Arg Glu Val Ala Gln Asp Arg His Tyr His Leu Glu Ala Asp Ile 290 295
300Glu Gln Ile Tyr Lys Thr Cys Glu Pro Thr Lys Ala Leu Gly Gly
His305 310 315 320Ala Gly Trp Ala Pro Phe Pro Val Arg Pro Arg Lys
Arg His Thr Ser 325 330 335Lys Thr Ser Tyr Met His Asp Glu Thr Met
Asp Tyr Pro Phe Tyr Ala 340 345 350Leu Thr Glu Thr Ile Asn Gly Ser
Gly Pro Asn Gln Arg Gly Lys Tyr 355 360 365Lys Ser Ala Tyr Met Ile
Lys Asp Phe Pro Asp Phe Gln Ile Asp Val 370 375 380Ile Trp Lys Tyr
Leu Thr Glu Val Pro Asp Gly Leu Thr Ser Ala Glu385 390 395 400Met
Lys Asp Ala Leu Leu Gln Val Asp Met Phe Gly Gly Glu Ile His 405 410
415Lys Val Val Trp Asp Ala Thr Ala Val Ala Gln Arg Glu Tyr Ile Ile
420 425 430Lys Leu Gln Tyr Gln Thr Tyr Trp Gln Glu Glu Asp Lys Asp
Ala Val 435 440 445Asn Leu Lys Trp Ile Arg Asp Phe Tyr Glu Glu Met
Tyr Glu Pro Tyr 450 455 460Gly Gly Val Pro Asp Pro Asn Thr Gln Val
Glu Ser Gly Lys Gly Val465 470 475 480Phe Glu Gly Cys Tyr Phe Asn
Tyr Pro Asp Val Asp Leu Asn Asn Trp 485 490 495Lys Asn Gly Lys Tyr
Gly Ala Leu Glu Leu Tyr Phe Leu Gly Asn Leu 500 505 510Asn Arg Leu
Ile Lys Ala Lys Trp Leu Trp Asp Pro Asn Glu Ile Phe 515 520 525Thr
Asn Lys Gln Ser Ile Pro Thr Lys Pro Leu Lys Glu Pro Lys Gln 530 535
540Thr Lys545245PRTSchwanniomyces occidentalis 24Ser Ala Ile Gln
Ala1 5255PRTArtificial SequenceDescription of Artificial Sequence
Synthetic amino acid signal sequence 25Met Ala Thr Leu Pro1
5264PRTArtificial SequenceDescription of Artificial Sequence
Synthetic amino acid signal sequence 26Ala Thr Leu
Pro1276PRTSaccharomyces cerevisiae 27Lys Arg Glu Ala Glu Ala1
5285PRTAspergillus oryzae 28Ala Pro Ala Leu Ala1 52936DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
29gaattcatga ccgcattgtc cgacaaacaa acggct 363033DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
30acccggggta gaagagccgg cagcaaacca gtt 333135DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
31gggtgagctc tgccacttcc agggctgcgc tgttc 353256DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
32ggagatcttt attaatggtg atggtgatgg tgggtaattg tgatcacagc gtccgg
563333DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 33ggagatacta cctggaactc tggacaagag gac
333424DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 34gtttggatcc ccgccagtac ccac 243520PRTHansenula
polymorpha 35Gly Ser Thr Asp Asn Pro Asp Gly Ile Asp Tyr Lys Thr
Tyr Asp Tyr1 5 10 15Val Gly Val Trp 203631PRTGracilariopsis
lemaneiformis 36Thr Ala Leu Ser Asp Lys Gln Thr Ala Thr Ala Gly Ser
Thr Asp Asn1 5 10 15Pro Asp Gly Ile Asp Tyr Lys Thr Tyr Asp Tyr Val
Gly Val Trp 20 25 30
* * * * *