U.S. patent application number 11/014795 was filed with the patent office on 2005-05-05 for methods and compositions for the treatment of pancreatitis.
This patent application is currently assigned to Allergan, Inc.. Invention is credited to Aoki, Kei Roger, Sachs, George, Steward, Lance E..
Application Number | 20050095251 11/014795 |
Document ID | / |
Family ID | 23106629 |
Filed Date | 2005-05-05 |
United States Patent
Application |
20050095251 |
Kind Code |
A1 |
Steward, Lance E. ; et
al. |
May 5, 2005 |
Methods and compositions for the treatment of pancreatitis
Abstract
Methods and compositions for the treatment of acute pancreatitis
in a mammal. Particular compositions comprise a binding element, a
translocation element, and a therapeutic element able to prevent
accumulation of digestive enzymes within the pancreas.
Inventors: |
Steward, Lance E.; (Irvine,
CA) ; Sachs, George; (Encino, CA) ; Aoki, Kei
Roger; (Coto de Caza, CA) |
Correspondence
Address: |
Dean G. Stathakis, Ph.D.
ALLERGAN, INC.
T2-7H
2525 Dupont Drive
Irvine
CA
92612
US
|
Assignee: |
Allergan, Inc.
|
Family ID: |
23106629 |
Appl. No.: |
11/014795 |
Filed: |
December 15, 2004 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
11014795 |
Dec 15, 2004 |
|
|
|
09548409 |
Apr 13, 2000 |
|
|
|
6843998 |
|
|
|
|
09548409 |
Apr 13, 2000 |
|
|
|
09288326 |
Apr 8, 1999 |
|
|
|
6776990 |
|
|
|
|
Current U.S.
Class: |
424/155.1 ;
424/178.1 |
Current CPC
Class: |
C07K 2319/33 20130101;
C07K 2319/00 20130101; A61K 47/6415 20170801; C07K 14/33 20130101;
A61P 1/18 20180101; C07K 2317/53 20130101 |
Class at
Publication: |
424/155.1 ;
424/178.1 |
International
Class: |
A61K 039/395 |
Claims
1-13. (canceled)
14. A method for making a polypeptide comprising: a) expressing
within a host cell a recombinant chimeric polypeptide comprising an
amino terminal side extein and a carboxyl terminal side intein
wherein said extein comprises able to facilitate the transfer of a
polypeptide across a vesicular membrane and a therapeutic element
able, when present in the cytoplasm of a pancreatic cell, to
inhibit enzymatic secretion by said pancreatic cell, and wherein
said intein comprises a binding element capable of affinity binding
under selective conditions with a binding partner and an amino
terminal end first amino acid selected from the group consisting of
cysteine, serine or threonine. b) contacting said chimeric
polypeptide with a synthetic peptide and a nucleophilic reagent
wherein said synthetic peptide comprises a CCK binding element able
to selectively bind a pancreatic cell surface marker under
physiological conditions, a carboxyl terminal end amidated
phenylalanine modification and an amino terminal end second amino
acid selected from the group consisting of cysteine, serine or
threonine, wherein said nucleophilic reagent is able to cause
cleavage of said intein from the said extein, and wherein
subsequent formation of a peptide bond occurs between carboxyl
terminal end of said extein and amino terminal end of said
synthetic peptide.
15. The method of claim 14 wherein said first and second amino
acids are cysteine.
16. The method of claim 15 wherein said nucleophilic reagent is
selected from the group consisting of phenol or thiphenol.
17. The method of claim 14 wherein said synthetic polypeptide
further comprises a sulfated tyrosine at the position 7 amino acids
from a natural C terminus of said sequence, and said therapeutic
polypeptide preferentially binds a CCK-A receptor.
18. The method of claim 17 wherein said first and second amino
acids are cysteine.
19. The method of claim 18 wherein said nucleophilic reagent is
selected from the group consisting of phenol or thiphenol.
20. The method of claim 14 wherein said first and second amino
acids are serine.
21. The method of claim 14 wherein said first and second amino
acids are threonine.
22. The method of claim 17 wherein said first and second amino
acids are serine.
23. The method of claim 17 wherein said first and second amino
acids are threonine.
24. A method for making a polypeptide comprising: a) expressing
within a host cell a recombinant chimeric polypeptide comprising an
amino terminal side extein and a carboxyl terminal side intein
wherein said extein comprises a translocation element able to
facilitate the transfer of a polypeptide across a vesicular
membrane and a therapeutic element able, when present in the
cytoplasm of a pancreatic cell, to inhibit enzymatic secretion by
said pancreatic cell, and wherein said intein comprises a binding
element capable of affinity binding under selective conditions with
a binding partner and an amino terminal end first amino acid
selected from the group consisting of cysteine, serine or
threonine. b) contacting said chimeric protein with a synthetic
peptide and a nucleophilic reagent wherein said synthetic peptide
comprises a binding element able to selectively bind a pancreatic
cell surface marker under physiological conditions, a carboxyl
terminal end amidated phenylalanine modification, and an amino
terminal end second amino acid selected from the group consisting
of cysteine, serine or threonine, wherein said nucleophilic reagent
is able to cause cleavage of said intein from the said extein, and
wherein subsequent formation of a peptide bond occurs between
carboxyl terminal end of said extein and amino terminal end of said
synthetic peptide.
25. The method of claim 24 wherein said therapeutic element will
cleave a SNARE protein.
26. The method of claim 25 wherein said SNARE protein is selected
from the group consisting of syntaxin, SNAP-25 and VAMP.
27. The method of claim 24 wherein said binding element of said
synthetic peptide comprises a CCK sequence.
28. The method of claim 27 wherein said CCK sequence comprises a
human CCK A amino acid sequence.
29. The method of claim 28 wherein said CCK A amino acid sequence
comprises SEQ ID NO: 6.
30. The method of claim 28 wherein said CCK A amino acid sequence
comprises SEQ ID NO: 5.
31. The method of claim 28 wherein said CCK A amino acid sequence
comprises SEQ ID NO: 4.
32. The method of claim 28 wherein said CCK A amino acid sequence
comprises SEQ ID NO: 3.
33. The method of claim 28 wherein said CCK A amino acid sequence
comprises SEQ ID NO: 2.
34. The method of claim 24 wherein said first and second amino
acids are cysteine.
35. The method of claim 24 wherein said nucleophilic reagent is
selected from the group consisting of phenol or thiophenol.
36. The method of claim 24 wherein said first and second amino
acids are serine.
37. The method of claim 24 wherein said first and second amino
acids are threonine.
38. The method of claim 20 wherein said binding element of said
synthetic peptide further comprises a sulfated tyrosine at the
position 7 residues from the carboxyl terminal end.
39. The method of claim 38 wherein said binding element of said
synthetic peptide comprises a CCK sequence.
40. The method of claim 39 wherein said CCK sequence comprises a
human CCK A amino acid sequence.
41. The method of claim 39 wherein said CCK A amino acid sequence
comprises SEQ ID NO: 6.
42. The method of claim 39 wherein said CCK A amino acid sequence
comprises SEQ ID NO: 5.
43. The method of claim 39 wherein said CCK A amino acid sequence
comprises SEQ ID NO: 4.
44. The method of claim 39 wherein said CCK A amino acid sequence
comprises SEQ ID NO: 3.
45. The method of claim 39 wherein said CCK A amino acid sequence
comprises SEQ ID NO: 2.
Description
[0001] This application is a continuation-in-part of application
Ser. No. 09/288,326, filed Apr. 8, 1999.
FIELD OF THE INVENTION
[0002] The present invention includes methods and compositions for
the treatment of acute pancreatitis. In a preferred embodiment the
invention concerns the use of agents to reduce or prevent the
secretion of pancreatic digestive enzymes within the pancreas. Such
agents are targeted to pancreatic cells, and serve to prevent the
exocytotic fusion of vesicles containing these enzymes with the
plasma membrane. The invention is also concerned with methods of
treating a mammal suffering from pancreatitis through the
administration of such agents.
BACKGROUND OF THE INVENTION
[0003] Pancreatitis is a serious medical condition involving an
inflammation of the pancreas. In acute or chronic pancreatitis the
inflammation manifests itself in the release and activation of
pancreatic enzymes within the organ itself, leading to
autodigestion. In many cases of acute pancreatitis, the condition
can lead to death.
[0004] In normal mammals, the pancreas, a large gland similar in
structure to the salivary gland, is responsible for the production
and secretion of digestive enzymes, which digest ingested food, and
bicarbonate for the neutralization of the acidic chyme produced in
the stomach. The pancreas contains acinar cells, responsible for
enzyme production, and ductal cells, which secrete large amounts of
sodium bicarbonate solution. The combined secretion product is
termed "pancreatic juice"; this liquid flows through the pancreatic
duct past the sphincter of Oddi into the duodenum. The secretion of
pancreatic juice is stimulated by the presence of chyme in the
upper portions of the small intestine, and the precise composition
of pancreatic juice appears to be influenced by the types of
compounds (carbohydrate, lipid, protein, and/or nucleic acid) in
the chyme.
[0005] The constituents of pancreatic juice includes proteases
(trypsin, chymotrypsin, carboxypolypeptidase), nucleases (RNAse and
DNAse), pancreatic amylase, and lipases (pancreatic lipase,
cholesterol esterase and phospholipase). Many of these enzymes,
including the proteases, are initially synthesized by the acinar
cells in an inactive form as zymogens: thus trypsin is synthesized
as trypsinogen, chymotrypsin as chymotypsinogen, and
carboxypolypeptidase as procarboxypolypeptidase. These enzymes are
activated according to a cascade, wherein, in the first step,
trypsin is activated through proteolytic cleavage by the enzyme
enterokinase. Trypsinogen can also be autoactivated by trypsin;
thus one activation has begun, the activation process can proceed
rapidly. Trypsin, in turn, activates both chymotypsinogen and
procarboxypolypeptidase to form their active protease
counterparts.
[0006] The enzymes are normally activated only when they enter the
intestinal mucosa in order to prevent autodigestion of the
pancreas. In order to prevent premature activation, the acinar
cells also co-secrete a trypsin inhibitor that normally prevents
activation of the proteolytic enzymes within the secretory cells
and in the ducts of the pancreas. Inhibition of trypsin activity
also prevents activation of the other proteases.
[0007] Pancreatitis can occur when an excess amount of trypsin
saturates the supply of trypsin inhibitor. This, in turn, can be
caused by underproduction of trypsin inhibitor, or the
overabundance of trypsin within the cells or ducts of the pancreas.
In the latter case, pancreatic trauma or blockage of a duct can
lead to localized overabundance of trypsin; under acute conditions
large amounts of pancreatic zymogen secretion can pool in the
damaged areas of the pancreas. If even a small amount of free
trypsin is available activation of all the zymogenic proteases
rapidly occurs, and can lead to digestion of the pancreas (acute
pancreatitis) and in particularly severe cases to the patient's
death.
[0008] Pancreatic secretion is normally regulated by both hormonal
and nervous mechanisms. When the gastric phase of stomach secretion
occurs, parasympathetic nerve impulses are relayed to the pancreas,
which initially results in acetylcholine release, followed by
secretion of enzymes into the pancreatic acini for temporary
storage.
[0009] When acid chyme thereafter enters the small intestine, the
mucosal cells of the upper intestine release a hormone called
secretin. In humans, secretin is a 27 amino acid (3400 Dalton)
polypeptide initially produced as the inactive form prosecretin,
which is then activated by proteolytic cleavage. Secretin is then
absorbed into the blood. Secretin causes the pancreas to secrete
large quantities of a fluid containing bicarbonate ion. Secretin
does not stimulate the acinar cells, which produce the digestive
enzymes. The bicarbonate fluid serves to neutralize the chyme and
to provide a slightly alkaline optimal environment for the
enzymes.
[0010] Another peptide hormone, cholecystokinin (CCK) is released
by the mucosal cells in response to the presence of food in the
upper intestine. As described in further detail below, human CCK is
synthesized as a protoprotein of 115 amino acids. Active CCK forms
are quickly taken into the blood through the digestive tract, and
normally stimulate the secretion of enzymes by the acinar cells.
However, stimulation of the CCK receptor by the CCK analogs
cerulein and CCK-octapeptide (CCK-8) appears to lead to a worsening
of morbidity and mortality in mammals in whom pancreatitis is
induced. See Tani et al., Pancreas 5:284-290 (1990).
[0011] As indicated above, the digestive enzymes are synthesized as
zymogens; proto-enzyme synthesis occurs in the rough endoplasmic
reticulum of the acinar cells. The zymogens are then packaged
within vesicles having a single lipid bilayer membrane. The
zymogens are packed within the vesicles so densely that they appear
as quasi-crystalline structures when observed under light
microscopy and the zymogen granules are electron-dense when
observed under the electron microscope. The vesicles are localized
within the cytoplasm of the acinar cells. Secretion of zymogens by
the acinar cells occurs through vesicle docking and subsequent
fusion with the plasma membrane, resulting in the liberation of the
contents into the extracellular milieu.
[0012] Nerve cells appear to secrete neurotransmitters and other
intercellular signaling factors through a mechanism of membrane
fusion that is shared with other cell types, see e.g., Rizo &
Sudhof, Nature Struct. Biol. 5:839-842 (October 1998), hereby
incorporated by reference herein, including the pancreatic acinar
cells.
[0013] Although the Applicants do not wish to be bound by theory,
it is believed that a vesicle first contacts the intracellular
surface of the cellular membrane in a reaction called docking.
Following the docking step the membrane fuses with and becomes part
of the plasma membrane through a series of steps that currently
remain relatively uncharacterized, but which clearly involve
certain vesicle and membrane-associated proteins, as has been
illustrated using neural models.
[0014] In neurons, neurotransmitters are packaged within synaptic
vesicles, formed within the cytoplasm, then transported to the
inner plasma membrane where the vesicles dock and fuse with the
plasma membrane. Recent studies of nerve cells employing
clostridial neurotoxins as probes of membrane fusion have revealed
that fusion of synaptic vesicles with the cell membrane in nerve
cells depends upon the presence of specific proteins that are
associated with either the vesicle or the target membrane. See id.
These proteins have been termed SNAREs. As discussed in further
detail below, a protein alternatively termed synaptobrevin or VAMP
(vesicle-associated membrane protein) is a vesicle-associated SNARE
(v-SNARE). There are at least two isoforms of synaptobrevin; these
two isoforms are differentially expressed in the mammalian central
nervous system, and are selectively associated with synaptic
vesicles in neurons and secretory organelles in neuroendocrine
cells. The target membrane-associated SNAREs (t-SNARES) include
syntaxin and SNAP-25. Following docking, the VAMP protein forms a
core complex with syntaxin and SNAP-25; the formation of the core
complex appears to be an essential step to membrane fusion. See
Rizo & Sudhof, id. and Neimmann et al., Trends in Cell Biol.
4:179-185 (May 1994), hereby incorporated by referenced herein.
[0015] Recently evidence has increasingly indicated that the SNARE
system first identified in neural cells is a general model for
membrane fusion in eukaryotic cells. A yeast exocytotic core
complex similar to that of the synaptic vesicles of mammalian
neural cells has been characterized, and found to contain three
proteins: Sso 1 (syntaxin 1 homolog), SncI (synaptobrevin homolog),
and sec9 (SNAP-25 homolog). Rizo & Sudhof, id. These proteins
share a high degree of amino acid sequence homology with their
mammalian synaptosomal counterparts.
[0016] All mammalian non-neuronal cells appear to contain
cellubrevin, a synaptobrevin analog--this protein is involved in
the intracellular transport of vesicles, and is cleaved by TeTx,
BoNT/E, BoNT/F, and BoNT/G. Homologs of syntaxin have been
identified in yeast (e.g., sso1p and sso2p) and mammalian
non-neuronal cells (syn2p, syn3p, syn4p and syn5p). Finally, as
indicated above, a yeast SNAP-25 homolog, sec9 has been identified;
this protein appears to essential for vesicle fusion with the
plasma membrane.
[0017] Intoxication of neural cells by clostridial neurotoxins
exploits specific characteristics of the SNARE proteins. These
neurotoxins, most commonly found expressed in Clostridium botulinum
and Clostridium tetanus, are highly potent and specific poisons of
neural cells. These Gram positive bacteria secrete two related but
distinct toxins, each comprising two disulfide-linked amino acid
chains: a light chain (L) of about 50 KDa and a heavy chain (H) of
about 100 KDa, which are wholly responsible for the symptoms of
botulism and tetanus, respectively.
[0018] The tetanus and botulinum toxins are among the most lethal
substances known to man; both toxins function by inhibiting
neurotransmitter release in affected neurons. The tetanus
neurotoxin (TeNT) acts mainly in the central nervous system, while
botulinum neurotoxin (BONT) acts at the neuromuscular junction;
both toxins inhibit acetylcholine release from the nerve terminal
of the affected neuron into the synapse, resulting in paralysis or
reduced target organ function.
[0019] The tetanus neurotoxin (TeNT) is known to exist in one
immunologically distinct type; the botulinum neurotoxins (BONT) are
known to occur in seven different immunologically distinct
serotypes, termed BoNT/A through BoNT/G. While all of these latter
types are produced by isolates of C. botulinum, two other species,
C. baratii and C. butyricum also produce toxins similar to /F and
/E, respectively. See e.g., Coffield et al., The Site and Mechanism
of Action of Botulinum Neurotoxin in Therapy with Botulinum Toxin
3-13 (Jankovic J. & Hallett M. eds. 1994), the disclosure of
which is incorporated herein by reference.
[0020] Regardless of type, the molecular mechanism of intoxication
appears to be similar. In the first step of the process, the toxin
binds to the presynaptic membrane of the target neuron through a
specific interaction between the heavy chain and a neuronal cell
surface receptor; the receptor is thought to be different for each
type of botulinum toxin and for TeNT. The carboxy terminal
(C-terminal) half of the heavy chain is required for targeting of
the toxin to the cell surface. The cell surface receptors, while
not yet conclusively identified, appear to be distinct for each
neurotoxin serotype.
[0021] In the second step, the toxin crosses the plasma membrane of
the poisoned cell. The toxin is first engulfed by the cell through
receptor-mediated endocytosis, and an endosome containing the toxin
is formed. The toxin (or light chain thereof) then escapes the
endosome into the cytoplasm of the cell. This last step is thought
to be mediated by the amino terminal (N-terminal) half of the heavy
chain, which triggers a conformational change of the toxin in
response to a pH of about 5.5 or lower. Endosomes are known to
possess a proton pump that decreases intra-endosomal pH. The
conformational shift exposes hydrophobic residues in the toxin,
which permits the toxin to embed itself in the endosomal membrane.
The toxin then translocates through the endosomal membrane into the
cytosol.
[0022] Either during or after translocation the disulfide bond
joining the heavy and light chain is reduced, and the light chain
is released into the cytoplasm. The entire toxic activity of
botulinum and tetanus toxins is contained in the light chain of the
holotoxin; the light chain is a zinc (Zn++) endopeptidase which
selectively cleaves the SNARE proteins essential for recognition
and docking of neurotransmitter-containing vesicles with the
cytoplasmic surface of the plasma membrane, and fusion of the
vesicles with the plasma membrane. The light chain of TxNT, BoNT/B,
BoNT/D, BoNT/F, and BoNT/G cause specific proteolysis of VAMP, an
integral protein. During proteolysis, most of the VAMP present at
the cytosolic surface of the synaptic vesicle is inactivated as a
result of any one of these cleavage events. Each toxin cleaves a
different specific peptide bond.
[0023] BoNT/A and /E selectively cleave the plasma
membrane-associated SNARE protein SNAP-25; this protein is bound to
and present on the cytoplasmic surface of the plasma membrane.
BoNT/Cl cleaves syntaxin, which exists as an integral protein
having most of its mass exposed to the cytosol. Syntaxin interacts
with the calcium channels at presynaptic terminal active zones. See
Tonello et al., Tetanus and Botulism Neurotoxins in Intracellular
Protein Catabolism 251-260 (Suzuki K & Bond J. eds. 1996), the
disclosure of which is incorporated by reference as part of this
specification. Bo/NTC1 also appears to cleave SNAP-25.
[0024] Both TeNT and BONT are specifically taken up by cells
present at the neuromuscular junction. BONT remains within
peripheral neurons and, as indicated above, blocks release of the
neurotransmitter acetylcholine from these cells.
[0025] By contrast TeNT, through its receptor, enters vesicles that
move in a retrograde manner along the axon to the soma, and is
discharged into the intersynaptic space between motor neurons and
the inhibitory neurons of the spinal cord. At this point, TeNT
binds receptors of the inhibitory neurons, is again internalized,
and the light chain enters the cytosol to block the release of the
inhibitory neurotransmitters 4-aminobutyric acid (GABA) and glycine
from these cells. Id.
[0026] International Patent Publication No. WO 96/33273 relates to
derivatives of botulinum toxin designed to prevent neurotransmitter
release from sensory afferent neurons to treat chronic pain. Such
derivatives are targeted to nociceptive neurons using a targeting
moiety that binds to a binding site of the surface of the
neuron.
[0027] International Patent Publication No. 98/07864 discusses the
production of recombinant toxin fragments that have domains that
enable the polypeptide to translocate into a target cell or which
increase the solubility of the polypeptide, or both.
SUMMARY OF THE INVENTION
[0028] The present invention concerns methods and compositions
useful for the treatment of acute pancreatitis. This condition is
largely due to the defective secretion of zymogen granules by
acinar cells, and by the premature co-mingling of the secreted
zymogens with lysosomal hydrolysates capable of activating trypsin,
thereby triggering the protease activation cascade and resulting in
the destruction of pancreatic tissue.
[0029] In one embodiment of this aspect, the invention is a
therapeutic agent comprising a chimeric protein containing an amino
acid sequence-specific endopeptidase activity which will
specifically cleave at least one synaptic vesicle-associated
protein selected from the group consisting of SNAP-25, syntaxin or
VAMP, in combination with the translocation activity of the
N-terminus of a clostridial neurotoxin heavy chain, wherein the
chimeric protein further comprises a recognition domain which will
bind a human cholecystokinin (CCK) receptor. Upon binding of the
recognition domain of the protein to the CCK receptor, the protein
is specifically transported into cells containing CCK receptors
(pancreatic acinar cells) through receptor-mediated endocytosis. In
a preferred embodiment, the CCK receptor is the CCK A receptor.
[0030] Once inside the acinar cell, the chimeric protein functions
in a manner similar to that of a clostridial neurotoxin within its
target neuron. The toxin moiety is translocated from the endosome
into the cytoplasm, where it acts to cleave a SNARE protein
identical or homologous to SNAP-25, syntaxin or VAMP. The cleavage
of this protein prevents formation of a core complex between the
SNARE proteins and thus prevents or reduces the extent of fusion of
the vesicle with the target membrane. This, in turn, results in
inhibition of zymogen release from the acinar cells and of zymogen
activation by lysosomal hydrolases. The autodigestion of pancreatic
tissue in acute pancreatitis is therefore reduced or
eliminated.
[0031] Another embodiment of the present invention concerns a
method of treating a patient suffering from acute pancreatitis by
administering an effective amount of such a chimeric protein.
[0032] Another embodiment of the invention concerns a therapeutic
composition that contains the translocation activity of a
clostridial neurotoxin heavy chain in combination with a
recognition domain able to bind a specific cell type and a
therapeutic element having an activity other than the endopeptidase
activity of a clostridial neurotoxin light chain. A non-exclusive
list of certain such therapeutic elements includes: hormones and
hormone-agonists and antagonists, nucleic acids capable being of
being used as replication, transcription, or translational
templates (e.g., for expression of a protein drug having the
desired biological activity or for synthesis of a nucleic acid drug
as an antisense agent), enzymes, toxins, and the like.
[0033] In a preferred embodiment, the specific cell type is a
pancreatic cell, most preferably a pancreatic acinar cell.
[0034] Another embodiment is drawn to methods for the treatment of
acute pancreatitis comprising contacting an acinar cell with an
effective amount of a composition comprising a chimeric protein
containing an amino acid sequence-specific endopeptidase activity
which will specifically cleave at least one synaptic
vesicle-associated protein selected from the group consisting of
SNAP-25, syntaxin or VAMP, in combination with the translocation
activity of the N-terminus of a clostridial neurotoxin heavy chain,
wherein the chimeric protein further comprises a recognition domain
able to bind to a cell surface protein characteristic of an human
pancreatic acinar cell. Preferably the cell surface protein is a
CCK receptor protein; most preferably the protein is the human CCK
A protein. CCK receptors (CCK-A receptor and CCK-B receptor) are
found mainly in on the surface of pancreatic acinar cells, although
they are also found in some brain cells and, to a lesser extent on
the surface of gastrointestinal cells.
[0035] Any suitable route of administration may be used in this
aspect of the invention. Applicants currently prefer to administer
the therapeutic agent in an intravenous infusion solution; however
methods such as ingestion (particularly when associated with
neurotoxin-associated proteins (NAPs); see Sharma et al., J. Nat.
Toxins 7:239-253(1998), incorporated by reference herein), direct
delivery to the pancreas, injection and the like may also be used.
The agent is substantially specifically targeted to pancreatic
cells; when the agent contains a CCK receptor-binding domain, the
blood-brain barrier prevents the agent from interacting with brain
cells.
[0036] In yet another embodiment the invention provides a
composition comprising a drug or other therapeutic agent having an
activity other than that of a clostridial neurotoxin light chain
for intracellular delivery, said agent joined to the translocation
domain of a clostridial neurotoxin heavy chain and a binding
element able to recognize a cell surface receptor of a target cell.
In a preferred embodiment, the target cell is not a neuron. Also,
in this embodiment it is preferred that the drug or other
therapeutic agent has an enzymatic, catalytic, or other
self-perpetuating mode of activity, so that the effective dose of
drug is greater than the number of drug molecules delivered within
the target cell. A non-exclusive list of certain such drugs would
include: hormones and hormone-agonists and antagonists, nucleic
acids capable being of being used as replication, transcription, or
translational templates (e.g., for expression of a protein drug
having the desired biological activity or for synthesis of a
nucleic acid drug as an antisense agent), enzymes, toxins (such as
diphtheria toxin or ricin), and the like.
[0037] In this embodiment the drug may be cleavably linked to the
remainder of the composition in such a way as to allow for the
release of the drug from the composition within the target
cell.
[0038] The presently claimed compositions may be provided to the
patient by intravenous administration, may be administered during
surgery, or may be provided parenterally.
[0039] WO 95/32738, which shares ownership with the present
application, describes transport proteins for the therapeutic
treatment of neural cells. This application is incorporated by
reference herein as part of this specification.
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS
[0040] In a basic and presently preferred form, the invention
comprises a therapeutic polypeptide comprising three features: a
binding element, a translocation element, and a therapeutic
element.
[0041] The binding element is able to bind to a specific target
cell provided that the target cell is not a motor neuron or a
sensory afferent neuron. Preferably, the binding element comprises
an amino acid chain; also an independently, it is preferably
located at or near the C-terminus of a polypeptide chain. By
"binding element" is meant a chemical moiety able to preferentially
bind to a cell surface marker characteristic of the target cell
under physiological conditions. The cell surface marker may
comprise a polypeptide, a polysaccharide, a lipid, a glycoprotein,
a lipoprotein, or may have structural characteristics of more than
one of these. By "preferentially interact" is meant that the
disassociation constant (K.sub.d) of the binding element for the
cell surface marker is at least one order of magnitude less than
that of the binding element for any other cell surface marker.
Preferably, the disassociation constant is at least 2 orders of
magnitude less, even more preferably the disassociation constant is
at least 3 orders of magnitude less than that of the binding
element for any other cell surface marker to which the therapeutic
polypeptide is exposed. Preferably, the organism to be treated is a
human.
[0042] In one embodiment the cell surface receptor comprises the
histamine receptor, and the binding element comprises an variable
region of an antibody which will specifically bind the histamine
receptor.
[0043] In an especially preferred embodiment, the cell surface
marker is a cholecystokinin (CCK) receptor. Cholecystokinin is a
bioactive peptide that functions as both a hormone and a
neurotransmitter in a wide variety of physiological settings. Thus,
CCK is involved in the regulation of gall bladder contraction,
satiety, gastric emptying, and gut motility; additionally it is
involved in the regulation of pancreatic exocrine secretion.
[0044] There are two types of CCK receptors, CCK A and CCK B; the
amino acid sequences of these receptors have been determined from
cloned cDNA. Despite the fact that both receptors are G
protein-coupled receptors and share approximately 50% homology,
there are distinct differences between their physiological
activity. The CCK A receptor is expressed in smooth muscle cells of
the gall bladder, smooth muscle and neurons within the
gastrointestinal tract, and has a much greater affinity
(>10.sup.2 times higher) for CCK than the related peptide
hormone gastrin. The CCK B receptor, found in the stomach and
throughout the CNS, has roughly equal ability to bind CCK and
gastrin.
[0045] The varied activities of CCK can be partly attributed to the
fact that CCK is synthesized as procholecystokinin, a protoprotein
of 115 amino acids, and is then post-translationally cleaved into a
number of active fragments all sharing the same C-terminus. The
amino acid sequence of human procholecystokinin is shown below;
amino acid residues not present in the biologically active cleavage
products are in lower case. All amino acid sequences herein are
shown from N-terminus to C-terminus, unless expressly indicated
otherwise:
[0046] Human procholecystokinin, having the amino acid sequence SEQ
ID NO:1:
1 mnsgvclcvlmavlaagaltqpvppadpagsglqraeeaprrqlr VSQRT DGESRAHLGA
LLARYIQQAR KAPSGRMSIV KNLQNLDPSH RISDRDYMGW MDF grrsaeeyeyps
[0047] Biologically active cleavage products of the full length CCK
chain include:
[0048] CCK-58, having the amino acid sequence SEQ ID NO:2:
2 VSQRT DGESRAHLGA LLARYIQQAR KAPSGRMSIV KNLQNLDPSH RISDRDYMGW
MDF;
[0049] CCK-39, having the amino acid sequence SEQ ID NO: 3:
3 YIQQAR KAPSGRMSIV KNLQNLDPSH RISDRDYMGW MDF;
[0050] CCK-33, having the amino acid sequence SEQ ID NO: 4:
4 KAPSGRMSIV KNLQNLDPSH RISDRDYMGW MDF;
[0051] CCK-12, having the amino acid sequence SEQ ID NO: 5:
5 ISDRDYMGW MDF;
[0052] and CCK-8, having the amino acid sequence SEQ ID NO: 6:
6 RDYMGW MDF.
[0053] In each case, the biologically active polypeptides contain
post-translational modifications; in the case of CCK species
binding the CCK-A receptor, amidation of the C-terminal
phenylalanine, and sulfatation of the tyrosine residue located
seven residue from the C-terminus of the biologically active
species are required for hoigh affinity binding ton the receptor.
In the case of CCK-B, only the C-terminal amidation is necessary;
sulfation of the tyrosine appears to make little diffrence in CCK-B
binding. These modifications appear to be necessary for full
biological activity, although both the unmodified C-terminal
pentapeptide and tetrapeptide of CCK retains some biological
activity. Kennedy et al., J. Biol. Chem. 272: 2920-2926 (1997),
hereby incorporated by reference herein.
[0054] In a preferred embodiment, the biologically active
therapeutic polypeptide of the present invention comprises a CCK
binding element containing the post-translational modifications
described above. This polypeptide can be produced by synthetic
chemistry or, preferably, can be produced by a combination of
recombinant and synthetic means using the "expressed protein
ligation" (EPL) method. See Cotton & Muir, Chemistry &
Biology 6:R247 (1999), hereby incorporated by reference herein. In
this method the therapeutic polypeptide is expressed without the
C-terminal binding element as a fusion protein with an "intein"
polypeptide sequence positioned at the C-terminus thereof. The
intein comprises a conserved cysteine, serine, or threonine residue
at its amino terminus; the carboxyl terminus of the intein contains
a functional binding sequence such as chitin binding domain (CBD),
poly His (6 or more consecutive histidine residues), or another
amino acid sequence capable of affinity binding. The coding
sequence of this recombinantly expressed polypeptide is constructed
using standard recombinant DNA methods.
[0055] Additionally, standard solid phase peptide synthesis methods
are employed to construct a synthetic peptide comprising a
C-terminal amidated phenylalanine and the desired CCK amino acid
sequence. Such methods are described in e.g., Bodansky, M. and
Bodansky, A. The Practice of Peptide Synthesis (2d ed. Trost B. M.,
ed. Springer Laboratory 1994), hereby incorporated by reference
herein. The synthetic peptide also contains an sulfated tyrosine at
the position 7 residues from the carboxyl terminus. This can be
done either by incorporation of commercially available
Fmoc-Tyr(OSO.sub.3.sup.-)--OH into the peptide chain at the
7.sup.th amino acid position prior to cleavage of the synthetic
peptide from the solid support hereby incorporated by reference
herein), or by standard peptide synthesis using tyrosine at
position 7, followed by a sulfation reaction of the peptide
resulting in tyrosine sulfate at the 7 position. See e.g., Koeller,
K. M., J. Am. Chem. Soc. 122:742-743 (2000). The synthetic peptide
is constructed with a cysteine (or serine or threonine) residue at
the amino terminus.
[0056] It will be understood that one can use either
hydroxyl-containing amino acids or cysteine as the amino terminal
residue of the intein and the synthetic peptide, and either
thiopheol, phenol or another nucleophile capable of creating a
reactive ester or thioester linkage in accordance with the
expressed protein ligation methods described herein. However,
thiol-containing amino acid residues and thipheonol or another
sulfur-containing nucleophile are preferred.
[0057] Thus, according to one embodiment of the expressed protein
ligation method, the fusion protein is immobilized following
expression by incubation under selective binding conditions with a
surface to which the binding partner of the carboxyl terminal has
been joined (e.g., where the binding moiety is CBP, the surface may
be a resin to which chitin is conjugated). The immobilized fusion
protein is then permitted to react in a transthioesterification
reaction with a S- or O-containing reagent (such as thiophenol or
phenol) and the synthetic modified peptide described above. In this
step, the intein which is joined to the carboxyl terminus of the
therapeutic polypeptide is cleaved at the thioester (or ester)
linkage, thus liberating the protein from the surface to which it
was bound. The intein may be transiently replaced with the
thiophenol group, and the resulting thioester is then itself
attacked by the cysteine (or serine or threonine) residue of the
synthetic peptide; this reaction is then spontaneously followed by
a shift of the carbonyl bond from S (or O) to the N terminal
nitrogen of the synthetic peptide, to form a peptide bond. The
resultant therapeutic polypeptide thus comprises a threapeutic
domain, a translocation domain, and a binding domain comprising a
CCK sequence modified to contain the naturally occuring
post-translational modifications.
[0058] As intended herein, the term "extein" refers to a portion of
a chimeric polypeptide that borders one or more intein, and is
subsequently ligated to either another extein or a synthetic
polypeptide in the EPL reaction referred to herein.
[0059] As intended herein, the term "intein" refers to a portion of
a chimeric polypeptide containing an N-terminal cysteine, serine,
or threonine which is excised from said polypeptide during the EPL
reaction referred to herein.
[0060] Of course, the Applicants contemplate that this method of
producing a CCK-containing therapeutic polypeptide is exemplary
only, and that variations and modification of the above-described
method will be well within the ability and knowledge of those of
ordinary skill in the art in light of the present patent
application.
[0061] While it will be understood that the applicants do not wish
to be bound by theory, the following findings may assist an
understanding the nature of the interaction between CCK and the CCK
receptors, and thus between the CCK receptor binding element of an
embodiment of the present invention and its CCK receptor
target.
[0062] In pancreatic acinar cells the CCK A receptor undergoes
internalization to intracellular sites within minutes after agonist
exposure. Pohl et al., J. Biol. Chem. 272: 18179-18184 (1997),
hereby incorporated by reference herein. The CCK B receptor has
also shown the same ligand-dependant internalization response in
transfected NIH 3T3 cells. In the CCK B receptor, but not the CCK A
receptor, the endocytotic feature of the receptor been shown to be
profoundly decreased by the deletion of the C terminal 44 amino
acids of the receptor chain, corresponding in both receptors to an
cytoplasmic portion of the receptor chain.
[0063] Recent studies of the interaction between the CCK A receptor
and CCK have shown that the primary receptor sequence region
containing amino acid residues 38 through 42 is involved in the
binding of CCK. Residues Trp.sub.39 and Gln.sub.40 appear to be
essential for the binding of a synthetic CCK C-terminal nonapeptide
(in which the methionine residues located at residue 3 and 6 from
the C-terminus are substituted by norleucine and threonine
respectively) to the receptor. Kennedy et al., supra. These
residues do not appear to be essential for the binding of CCK
analogs JMV 180 (corresponding the synthetic C-terminal
heptapeptide of CCK in which the phenylalanylamide residue is
substituted by a phenylethyl ester and the threonine is substituted
with norleucine), and JMV 179 (in which the phenylalanylamide
residue and the L-tryptophan residues of the synthetic CCK
nonapeptide are substituted by a phenylethyl ester and
D-tryptophan, respectively and the threonine is substituted with
norleucine). Id.
[0064] These and similar studies have shed light on the structure
of the CCK A receptor active site. Based on receptor binding
experiments, a current structural model indicates that CCK residues
Trp.sub.30 and Met.sub.31 (located at positions 4 and 3,
respectively, from the C terminus of mature CCK-8) reside in a
hydrophobic pocket formed by receptor residues Leu.sub.348,
Pro.sub.352, Ile.sub.353 and Ile.sub.356. CCK residue Asp.sub.32
(located at amino acid position 2 measured from the C terminus of
CCK-8) seems to be involved in an ionic interaction with receptor
residue Lys.sub.115. CCK Tyr-sulfate.sub.27 (the CCK-8 residue 7
amino acids from C terminus) appears involved in an ionic
interaction with receptor residue Lys.sub.106 and a stacking
interaction with receptor residue Phe.sub.198. Ji, et al., 272 J.
Biol. Chem. 24393-24401 (1997).
[0065] Such structural models provide detailed guidance to the
person of ordinary skill in the art as to the construction of a
variety of binding elements able to retain the binding
characteristics of biologically active CCK peptides for the CCK-A
receptor, for example, as, for example, by site directed
mutagenesis of a clostridial neurotoxin heavy chain. Similarly,
models deduced using similar methodologies have been proposed for
the CCK B receptor, see e.g., Jagerschmidt, A. et al., Mol.
Pharmacol. 48:783-789 (1995), and can be used as a basis for the
construction of binding elements that retain binding
characteristics similar to the CCK B receptor.
[0066] It will be appreciated that the CCK-B receptor is known to
exist on the surface of neurons associated with the certal nervious
system. In one alternative embodiment of the present invention the
therapeutic polypeptide may be directed (for example, by
intrathecal application) to these neurons rather than to the
pancreas); in such a case, the binding element may comprise a CCK
containing the C terminal amidation only. Such a binding element
may be constructed using the expressed protein ligation (EPL)
methods described above. Indeed, EPL methods may be used to
introduce and desired or required modifications to the therapeutic
element, the translocation element, and/or the binding element of
the claimed therapeutic polypeptide.
[0067] Additionally, the binding element may comprise a variable
region of an antibody which will bind the CCK-A or CCK-B
receptor.
[0068] Nucleic acids encoding polypeptides containing such a
binding element may be constructed using molecular biology methods
well known in the art; see e.g., Sambrook et al., Molecular
Cloning: A Laboratory Manual (Cold Spring Harbor Laboratory Press
2d ed. 1989), and expressed within a suitable host cell. The
disclosure of this latter reference is incorporated by reference
herein in its entirety.
[0069] The translocation element comprises a portion of a
clostridial neurotoxin heavy chain having a translocation activity.
By "translocation" is meant the ability to facilitate the transport
of a polypeptide through a vesicular membrane, thereby exposing
some or all of the polypeptide to the cytoplasm.
[0070] In the various botulinum neurotoxins translocation is
thought to involve an allosteric conformational change of the heavy
chain caused by a decrease in pH within the endosome.
[0071] This conformational change appears to involve and be
mediated by the N terminal half of the heavy chain and to result in
the formation of pores in the vesicular membrane; this change
permits the movement of the proteolytic light chain from within the
endosomal vesicle into the cytoplasm. See e.g., Lacy, et al.,
Nature Struct. Biol. 5:898-902 (October 1998).
[0072] The amino acid sequence of the translocation-mediating
portion of the botulinum neurotoxin heavy chain is known to those
of skill in the art; additionally, those amino acid residues within
this portion that are known to be essential for conferring the
translocation activity are also known.
[0073] It would therefore be well within the ability of one of
ordinary skill in the art, for example, to employ the naturally
occurring N-terminal peptide half of the heavy chain of any of the
various Clostridium tetanus or Clostridium botulinum neurotoxin
subtypes as a translocation element, or to design an analogous
translocation element by aligning the primary sequences of the
N-terminal halves of the various heavy chains and selecting a
consensus primary translocation sequence based on conserved amino
acid, polarity, steric and hydrophobicity characteristics between
the sequences. The therapeutic element of the present invention may
comprise, without limitation: active or inactive (i.e., modified)
hormone receptors (such as androgen, estrogen, retinoid,
perioxysome proliferator and ecdysone receptors etc.), and
hormone-agonists and antagonists, nucleic acids capable being of
being used as replication, transcription, or translational
templates (e.g., for expression of a protein drug having the
desired biological activity or for synthesis of a nucleic acid drug
as an antisense agent), enzymes, toxins (including
apoptosis-inducing agents), and the like.
[0074] In a preferred embodiment, the therapeutic element is a
polypeptide comprising a clostridial neurotoxin light chain or a
portion thereof retaining the SNARE-protein sequence-specific
endopeptidase activity of a clostridial neurotoxin light chain. The
amino acid sequences of the light chain of botulinum neurotoxin
(BONT) subtypes A-G have been determined, as has the amino acid
sequence of the light chain of the tetanus neurotoxin (TeNT). Each
chain contains the Zn.sup.++-binding motif His-Glu-x-x-His (N
terminal direction at the left) characteristic of
Zn.sup.++-dependent endopeptidases (HELIH in TeNT, BoNT/A /B and
/E; HELNH in BoNT/C; and HELTH in BoNT/D).
[0075] Recent studies of the BoNT/A light chain have revealed
certain features important for the activity and specificity of the
toxin towards its target substrate, SNAP-25. Thus, studies by Zhou
et al. Biochemistry 34:15175-15181 (1995) have indicated that when
the light chain amino acid residue His.sub.227 is substituted with
tyrosine, the resulting polypeptide is unable to cleave SNAP-25;
Kurazono et al., J. Biol. Chem. 14721-14729 (1992) performed
studies in the presynaptic cholinergic neurons of the buccal
ganglia of Aplysia californica using recombinant BoNT/A light chain
that indicated that the removal of 10 N-terminal or 32 C-terminal
residues did not abolish toxicity, but that removal of 10
N-terminal or 57 C-terminal residues abolished toxicity in this
system. Most recently, the crystal structure of the entire BoNT/A
holotoxin has been solved; the active site is indicated as
involving the participation of His.sub.222, Glu.sub.223,
His.sub.226, Glu.sub.261 and Tyr.sub.365. Lacy et al., supra.
(These residues correspond to His.sub.223, Glu.sub.224,
His.sub.227, Glu.sub.262 and Tyr.sub.366 of the BoNT/A L chain of
Kurazono et al., supra.) Interestingly, an alignment of BoNT/A
through E and TeNT light chains reveals that every such chain
invariably has these residues in positions analogous to BoNT/A.
Kurazono et al., supra.
[0076] The catalytic domain of BoNT/A is very specific for the
C-terminus of SNAP-25 and appears to require a minimum of 16
SNAP-25 amino acids for cleavage to occur. The catalytic site
resembles a pocket; when the light chained is linked to the heavy
chain via the disulfide bond between Cys.sub.429 and Cys.sub.453,
the translocation domain of the heavy chain appears to block access
to the catalytic pocket until the light chain gains entry to the
cytosol. When the disulfide bond is reduced, the two polypeptide
chains dissociate, and the catalytic pocket is then "opened" and
the light chain is fully active.
[0077] As described above, VAMP and syntaxin are cleaved by BoNT/B,
D, F, G and TeNT, and BoNT/C.sub.1, respectively, while SNAP-25 is
cleaved by BoNT/A and E.
[0078] The substrate specificities of the various clostridial
neurotoxin light chains other than BoNT/A are known. Therefore, the
person of ordinary skill in the art could easily determine the
toxin residues essential in these subtypes for cleavage and
substrate recognition (for example, by site-directed mutagenesis or
deletion of various regions of the toxin molecule followed by
testing of proteolytic activity and substrate specificity), and
could therefore easily design variants of the native neurotoxin
light chain that retain the same or similar activity.
[0079] Additionally, construction of the therapeutic agents set
forth in this specification would be easily constructed by the
person of skill in the art. It is well known that the clostridial
neurotoxins have three functional domains analogous to the three
elements of the present invention. For example, and without
limitation, the BoNT/A neurotoxin light chain is present in amino
acid residues 1-448 of the BoNT/A prototoxin (i.e., before nicking
of the prototoxin to form the disulfide-linked dichain holotoxin);
this amino acid sequence is provided below as SEQ ID NO: 7. Active
site residues are underlined:
7 BoNT/A light chain MPFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFK- IHNKIWV
(SEQ ID NO:7) IPERDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLST-
DNEKDNYLKGVTKLFERIYSTD LGRMLLTSIVRGIPFWGGSTIDTELKVIDTNCINV-
IQPDGSYRSEELNLVIIGPSADI IQFECKSFGHEVLNLTRNGYGSTQYIRFSPDFTF-
GFEESLEVDTNPLLGAGKFATDPA VTLAHELIHAGHRLYGIAINPNRVFKVNTNAYY-
EMSGLEVSFEELRTFGGHDAKFIDS LQENEFRLYYYNKFKDIASTLNKAKSIVGTTA-
SLQYMKNVFKEKYLLSEDTSGKFSVD KLKFDKLYKMLTEIYTEDNFVKFFKVLNRKT-
YLNFDKAVFKINIVPKVNYTIYDGFNL RNTNLAANFNGQNTEINNMNFTKLKNFTGL-
FEFYKLLCVRGIITSKTKSLDKGYNK;
[0080] The heavy chain N-terminal (H.sub.N) translocation domain is
contained in amino acid residues 449-871 of the BoNT/A amino acid
sequence, shown below as SEQ ID NO: 8; a gated ion channel-forming
domain probably essential for the translocation activity of this
peptide is underlined (see Oblatt-Montal et al., Protein Sci.
4:1490-1497(1995), hereby incorporated by reference herein.
8 ALNDLCIKVNNWDLFFSPSEDNFTNDLNKGEEITSDTNIEAAEENISLDLIQQYYLTFNF
DNEPENISIENLSSDIIGQLELMPNIERFPNGKKYELDKYTMFHYLRAQEFEHGKSRI
ALTNSVNEALLNPSRVYTFFSSDYVKKVNKATEAAMFLGWVEQLVYDFTDETSEVSTT
DKIADITIIIPYIGPALNIGNMLYKDDFVGALIFSGAVILLEFIPEIAIPVLGTFALV
SYIANKVLTVQTIDNALSKRNEKWDEVYKYIVTNWLAKVNTQIDLIRKKMKEALENQ- A
EATKAIINYQYNQYTEEEKNNINFNIDDLSSKLNESINKAMININKFLNQCSVSYL- MN
SMIPYGVKRLEDFDASLKDALLKYIYDNRGTLIGQVDRLKDKVNNTLSTDIPFQL- SKY
VDNQRLLSTFTEYIK;
[0081] The heavy chain C-terminal neural cell binding domain is
contained in amino acid residues 872-1296 (SEQ ID NO: 9) of the
BoNT/A prototoxin.
9 NIINTSILNLRYESNHLIDLSRYASKINIGSKVNFDPIDKNQI
QLFNLESSKIEVILKNAIVYNSMYENFSTSFWIRIPKYFNSISLNNEYTIINCMENNS
GWKVSLNYGEIIWTLQDTQEIKQRVVFKYSQMINISDYINRWIFVTITNNRLNNSKIY
INGRLIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYFNLFDKELNEKEIKDLY
DNQSNSGILKDFWGDYLQYDKPYYMLNLYDPNKYVDVNNVGIRGYMYLKGPRGSVMTT
NIYLNSSLYRGTKFIIKKYASGNKDNIVRNNDRVYINVVVKNKEYRLATNASQAGVEK
ILSALEIPDVGNLSQVVVMKSKNDQGITNKCKMNLQDNNGNDIGFIGFHQFNNIAKLV
ASNWYNRQIERSSRTLGCSWEFIPVDDGWGERPL
[0082] The amino acid sequence of the BoNT/A prototoxin is encoded
by nucleotides 358 to 4245 of the neurotoxin cDNA sequence, set
forth herein below as SEQ ID NO: 10.
10 aagcttctaa atttaaatta ttaagtataa atccaaataa acaatatgtt
caaaaacttg atgaggtaat aatttctgta ttagataata tggaaaaata tatagatata
tctgaagata atagattgca actaatagat aacaaaaata acgcaaagaa gatgataatt
agtaatgata tatttatttc caattgttta accctatctt ataacggtaa atatatatgt
ttatctatga aagatgaaaa ccataattgg atgatatgta ataatgatat gtcaaagtat
ttgtatttat ggtcatttaa ataattaata atttaattaa ttttaaatat tataagaggt
gttaaatatg ccatttgtta ataaacaatt taattataaa gatcctgtaa atggtgttga
tattgcttat ataaaaattc caaatgcagg acaaatgcaa ccagtaaaag cttttaaaat
tcataataaa atatgggtta ttccagaaag agatacattt acaaatcctg aagaaggaga
tttaaatcca ccaccagaag caaaacaagt tccagtttca tattatgatt caacatattt
aagtacagat aatgaaaaag ataattattt aaagggagtt acaaaattat ttgagagaat
ttattcaact gatcttggaa gaatgttgtt aacatcaata gtaaggggaa taccattttg
gggtggaagt acaatagata cagaattaaa agttattgat actaattgta ttaatgtgat
acaaccagat ggtagttata gatcagaaga acttaatcta gtaataatag gaccctcagc
tgatattata cagtttgaat gtaaaagctt tggacatgaa gttttgaatc ttacgcgaaa
tggttatggc tctactcaat acattagatt tagcccagat tttacatttg gttttgagga
gtcacttgaa gttgatacaa atcctctttt aggtgcaggc aaatttgcta cagatccagc
agtaacatta gcacatgaac ttatacatgc tggacataga ttatatggaa tagcaattaa
tccaaatagg gtttttaaag taaatactaa tgcctattat gaaatgagtg ggttagaagt
aagctttgag gaacttagaa catttggggg acatgatgca aagtttatag atagtttaca
ggaaaacgaa tttcgtctat attattataa taagtttaaa gatatagcaa gtacacttaa
taaagctaaa tcaatagtag gtactactgc ttcattacag tatatgaaaa atgtttttaa
agagaaatat ctcctatctg aagatacatc tggaaaattt tcggtagata aattaaaatt
tgataagtta tacaaaatgt taacagagat ttacacagag gataattttg ttaagttttt
taaagtactt aacagaaaaa catatttgaa ttttgataaa gccgtattta agataaatat
agtacctaag gtaaattaca caatatatga tggatttaat ttaagaaata caaatttagc
agcaaacttt aatggtcaaa atacagaaat taataatatg aattttacta aactaaaaaa
ttttactgga ttgtttgaat tttataagtt gctatgtgta agagggataa taacttctaa
aactaaatca ttagataaag gatacaataa ggcattaaat gatttatgta tcaaagttaa
taattgggac ttgtttttta gtccttcaga agataatttt actaatgatc taaataaagg
agaagaaatt acatctgata ctaatataga agcagcagaa gaaaatatta gtttagattt
aatacaacaa tattatttaa cctttaattt tgataatgaa cctgaaaata tttcaataga
aaatctttca agtgacatta taggccaatt agaacttatg cctaatatag aaagatttcc
taatggaaaa aagtatgagt tagataaata tactatgttc cattatcttc gtgctcaaga
atttgaacat ggtaaatcta ggattgcttt aacaaattct gttaacgaag cattattaaa
tcctagtcgt gtttatacat ttttttcttc agactatgta aagaaagtta ataaagctac
ggaggcagct atgtttttag gctgggtaga acaattagta tatgatttta ccgatgaaac
tagcgaagta agtactacgg ataaaattgc ggatataact ataattattc catatatagg
acctgcttta aatataggta atatgttata taaagatgat tttgtaggtg ctttaatatt
ttcaggagct gttattctgt tagaatttat accagagatt gcaatacctg tattaggtac
ttttgcactt gtatcatata ttgcgaataa ggttctaacc gttcaaacaa tagataatgc
tttaagtaaa agaaatgaaa aatgggatga ggtctataaa tatatagtaa caaattggtt
agcaaaggtt aatacacaga ttgatctaat aagaaaaaaa atgaaagaag ctttagaaaa
tcaagcagaa gcaacaaagg ctataataaa ctatcagtat aatcaatata ctgaggaaga
gaaaaataat attaatttta atattgatga tttaagttcg aaacttaatg agtctataaa
taaagctatg attaatataa ataaattttt gaatcaatgc tctgtttcat atttaatgaa
ttctatgatc ccttatggtg ttaaacggtt agaagatttt gatgctagtc ttaaagatgc
attattaaag tatatatatg ataatagagg aactttaatt ggtcaagtag atagattaaa
agataaagtt aataatacac ttagtacaga tatacctttt cagctttcca aatacgtaga
taatcaaaga ttattatcta catttactga atatattaag aatattatta atacttctat
attgaattta agatatgaaa gtaatcattt aatagactta tctaggtatg catcaaaaat
aaatattggt agtaaagtaa attttgatcc aatagataaa aatcaaattc aattatttaa
tttagaaagt agtaaaattg aggtaatttt aaaaaatgct attgtatata atagtatgta
tgaaaatttt agtactagct tttggataag aattcctaag tattttaaca gtataagtct
aaataatgaa tatacaataa taaattgtat ggaaaataat tcaggatgga aagtatcact
taattatggt gaaataatct ggactttaca ggatactcag gaaataaaac aaagagtagt
ttttaaatac agtcaaatga ttaatatatc agattatata aacagatgga tttttgtaac
tatcactaat aatagattaa ataactctaa aatttatata aatggaagat taatagatca
aaaaccaatt tcaaatttag gtaatattca tgctagtaat aatataatgt ttaaattaga
tggttgtaga gatacacata gatatatttg gataaaatat tttaatcttt ttgataagga
attaaatgaa aaagaaatca aagatttata tgataatcaa tcaaattcag gtattttaaa
agacttttgg ggtgattatt tacaatatga taaaccatac tatatgttaa atttatatga
tccaaataaa tatgtcgatg taaataatgt aggtattaga ggttatatgt atcttaaagg
gcctagaggt agcgtaatga ctacaaacat ttatttaaat tcaagtttgt atagggggac
aaaatttatt ataaaaaaat atgcttctgg aaataaagat aatattgtta gaaataatga
tcgtgtatat attaatgtag tagttaaaaa taaagaatat aggttagcta ctaatgcatc
acaggcaggc gtagaaaaaa tactaagtgc attagaaata cctgatgtag gaaatctaag
tcaagtagta gtaatgaagt caaaaaatga tcaaggaata acaaataaat gcaaaatgaa
tttacaagat aataatggga atgatatagg ctttatagga tttcatcagt ttaataatat
agctaaacta gtagcaagta attggtataa tagacaaatag aaagatcta gtaggacttt
gggttgctca tgggaattta ttcctgtaga tgatggatgg ggagaaaggc cactgtaatt
aatctcaaac tacatgagtc tgtcaagaat tttctgtaaa catccataaa aattttaaaa
ttaatatgtt taagaataac tagatatgag tattgtttga actgcccctg tcaagtagac
aggtaaaaaa ataaaaatta agatactatg gtctgatttc gatattctat cggagtcaga
ccttttaact tttcttgtat cctttttgta ttgtaaaact ctatgtattc atcaattgca
agttccaatt agtcaaaatt atgaaacttt ctaagataat acatttctga ttttataatt
tcccaaaatc cttccatagg accattatca atacatctac caactcgaga catactttga
gttgcgccta tctcattaag tttattcttg aaagatttac ttgtatattg aaaaccgcta
tcactgtgaa aaagtggact agcatcagga ttggaggtaa ctgctttatc aaaggtttca
aagacaagga cgttgttatt tgattttcca agtacatagg aaataatgct attatcatgc
aaatcaagta tttcactcaa gtacgccttt gtttcgtctg ttaac
[0083] Of course, three distinct domains analogous to those
described above for BoNT/A exist for all the BONT subtypes as well
as for TeNT neurotoxin; an alignment of the amino acid sequences of
these holotoxins will reveal the sequence coordinates for these
other neurotoxin species. Additionally, while sequence information
is given above for BoNT/A, the amino acid sequences of all BONT
species and tetanus toxin TeNT are known and can easily be obtained
from, for example, the NCBI Gen-Bank Web site:
www.ncbi.nlm.nih.gov. The Clostrdial neurotoxin nucleotide and
amino acid sequences disclosed at this site are expressly
incorporated by reference herein.
[0084] Preferably, the translocation element and the binding
element of the compositions of the present invention are separated
by a spacer moiety that facilitates the binding element's binding
to the desired cell surface receptor. Such a spacer may comprise,
for example, a portion of the BONT H.sub.c sequence (so long as the
portion does not retain the ability to bind to the BONT or TeNT
binding site of motor neurons or sensory afferent neurons), another
sequence of amino acids, or a hydrocarbon moiety. The spacer moiety
may also comprise a proline, serine, threonine and/or cysteine-rich
amino acid sequence similar or identical to a human immunoglobulin
hinge region. In a preferred embodiment, the spacer region
comprises the amino acid sequence of an immunoglobulin .gamma.1
hinge region; such a sequence has the sequence (from N terminus to
C terminus):
EPKSCDKTHTCPPCP (SEQ ID NO:11)
[0085] It will be understood that none of the examples or
embodiments described herein are to be construed as limiting the
scope of the invention, which is defined solely by the claims that
conclude this specification.
EXAMPLE 1
[0086] An agent for the treatment of acute pancreatitis is
constructed as follows.
[0087] A culture of Clostridium botulinum is permitted to grown to
confluence. The cells are then lysed and total RNA is extracted
according to conventional methods and in the presence of an RNAse
inhibitor. The RNA preparation is then passed over a oligo(dT)
cellulose column, the polyadenylated messenger RNA is permitted to
bind, and the column is washed with 5-10 column volumes of 20 mM
Tris pH 7.6, 0.5 M NaCl, 1 mM EDTA (ethylenediamine tetraacetic
acid), 0.1% (w/v)SDS (sodium dodecyl sulfate). Polyadenylated RNA
is then eluted with 2-3 column volumes of STE (10 mM Tris (pH 7.6),
1 mM EDTA, 0.05% (w/v) SDS). The pooled MRNA is then precipitated
in 2 volumes of ice cold ethanol, pelleted in a centrifuge at
10,000.times.g for 15 minutes, then redissolved in a small volume
of STE.
[0088] The BoNT/A MRNA is used as a template for DNA synthesis
using Moloney murine leukemia virus reverse transcriptase
(MMLV-RT), then the L chain and then H N chain of the neurotoxin is
amplified from the cDNA by the polymerase chain reaction (PCR)
using appropriate oligonucleotide primers whose sequences are
designed based on the BoNT/A neurotoxin cDNA sequence of SEQ ID NO:
9. These procedures are performed using the standard techniques of
molecular biology as detailed in, for example, Sambrook et al.,
already incorporated by reference herein. The primer defining the
beginning of the coding region (5' side of the L chain fragment) is
given a StuI site. The PCR primer defining the 3' end of the
H.sub.N-encoding domain has the following features (from 3' to 5'):
a 5' region sufficiently complementary to the 3' end of the
HN-encoding domain to anneal thereto under amplification
conditions, a nucleotide sequence encoding the human immunoglobulin
hinge region .gamma..sub.1 (SEQ ID NO:11), a nucleotide sequence
encoding the human CCK-8 octapeptide (SEQ ID NO:6), and a unique
restriction endonuclease cleavage site.
[0089] The PCR product (termed BoNT/A.sup.L-HN-.gamma.-CCK) is
purified by agarose gel electrophoresis, and cloned into a
pBluescript II SK vector. The resulting plasmid is used to
transform competent E. coli cells, and a preparation of the
resulting plasmid is made. The BoNT/A.sup.L-HN-.gamma.- -CCK
fragment is excised from the pBluescript vector and cloned into a
mammalian expression vector immediately downstream of a strong
promoter. The resulting vector is used to transfect a culture of
the appropriate host cell, which is then grown to confluence.
Expression of the BoNT/A.sup.L-HN-.gamma.-CCK polypeptide is
induced, and the cells are lysed. The polypeptide is first purified
by gel exclusion chromatography, the fractions containing the
recombinant therapeutic agent are pooled, then the
BoNT/A.sup.L-HN-.gamma.-CCK polypeptide is further purified using
an anti-Ig affinity column wherein the antibody is directed to the
.gamma..sub.1 hinge region of a human immunoglobulin.
EXAMPLE 2
[0090] Method of Treating a Patient Suffering from Acute
Pancreatitis
[0091] A therapeutically effective amount of the
BoNT/A.sup.L-HN-.gamma.-C- CK agent constructed and purified as set
forth in Example 1 is formulated in an acceptable infusion
solution. Properties of pharmacologically acceptable infusion
solutions, including proper electrolyte balance, are well known in
the art. This solution is provided intravenously to a patient
suffering from acute pancreatitis on a single day over a period of
one to two hours. Additionally, the patient is fed intravenously on
a diet low in complex carbohydrates, complex fats and proteins.
[0092] At the beginning of treatment, the patient's pancreas shows
signs of autodigestion, as measured by blood amylase levels. After
the treatment regimen, autodigestion has ceased, and the patient's
pancreas has stabilized.
EXAMPLE 3
[0093] Alternative Treatment Method
[0094] In this example, a patient suffering from acute pancreatitis
is treated as in Example 2, with, the therapeutic agent given
continuously over a period of two weeks. After the treatment
regimen, autodigestion has ceased, and the patient's pancreas has
stabilized.
EXAMPLE 4
[0095] Alternative Treatment Method
[0096] In this example, a patient suffering from acute pancreatitis
is given a single pharmacologically effective amount of the
therapeutic agent of Example 1 by parenteral administration. Two
days after the treatment regimen, autodigestion has ceased and the
patient's pancreas has stabilized.
[0097] It will be understood that the present invention is not to
be limited by the embodiments and examples described herein, and
that the invention is defined solely by the claims that conclude
this specification.
Sequence CWU 1
1
12 1 129 PRT Homo sapiens 1 Ser Glu Gln Glu Asn Cys Glu Leu Ile Ser
Thr Ile Asn Gly Met Asn 1 5 10 15 Ser Gly Val Cys Leu Cys Val Leu
Met Ala Val Leu Ala Ala Gly Ala 20 25 30 Leu Thr Gln Pro Val Pro
Pro Ala Asp Pro Ala Gly Ser Gly Leu Gln 35 40 45 Arg Ala Glu Glu
Ala Pro Arg Arg Gln Leu Arg Val Ser Gln Arg Thr 50 55 60 Asp Gly
Glu Ser Arg Ala His Leu Gly Ala Leu Leu Ala Arg Tyr Ile 65 70 75 80
Gln Gln Ala Arg Lys Ala Pro Ser Gly Arg Met Ser Ile Val Lys Asn 85
90 95 Leu Gln Asn Leu Asp Pro Ser His Arg Ile Ser Asp Arg Asp Tyr
Met 100 105 110 Gly Trp Met Asp Phe Gly Arg Arg Ser Ala Glu Glu Tyr
Glu Tyr Pro 115 120 125 Ser 2 58 PRT Homo sapiens 2 Val Ser Gln Arg
Thr Asp Gly Glu Ser Arg Ala His Leu Gly Ala Leu 1 5 10 15 Leu Ala
Arg Tyr Ile Gln Gln Ala Arg Lys Ala Pro Ser Gly Arg Met 20 25 30
Ser Ile Val Lys Asn Leu Gln Asn Leu Asp Pro Ser His Arg Ile Ser 35
40 45 Asp Arg Asp Tyr Met Gly Trp Met Asp Phe 50 55 3 39 PRT Homo
sapiens 3 Tyr Ile Gln Gln Ala Arg Lys Ala Pro Ser Gly Arg Met Ser
Ile Val 1 5 10 15 Lys Asn Leu Gln Asn Leu Asp Pro Ser His Arg Ile
Ser Asp Arg Asp 20 25 30 Tyr Met Gly Trp Met Asp Phe 35 4 33 PRT
Homo sapiens 4 Lys Ala Pro Ser Gly Arg Met Ser Ile Val Lys Asn Leu
Gln Asn Leu 1 5 10 15 Asp Pro Ser His Arg Ile Ser Asp Arg Asp Tyr
Met Gly Trp Met Asp 20 25 30 Phe 5 12 PRT Homo sapiens 5 Ile Ser
Asp Arg Asp Tyr Met Gly Trp Met Asp Phe 1 5 10 6 9 PRT Homo sapiens
6 Arg Asp Tyr Met Gly Trp Met Asp Phe 1 5 7 448 PRT Clostridium
botulinum 7 Met Pro Phe Val Asn Lys Gln Phe Asn Tyr Lys Asp Pro Val
Asn Gly 1 5 10 15 Val Asp Ile Ala Tyr Ile Lys Ile Pro Asn Ala Gly
Gln Met Gln Pro 20 25 30 Val Lys Ala Phe Lys Ile His Asn Lys Ile
Trp Val Ile Pro Glu Arg 35 40 45 Asp Thr Phe Thr Asn Pro Glu Glu
Gly Asp Leu Asn Pro Pro Pro Glu 50 55 60 Ala Lys Gln Val Pro Val
Ser Tyr Tyr Asp Ser Thr Tyr Leu Ser Thr 65 70 75 80 Asp Asn Glu Lys
Asp Asn Tyr Leu Lys Gly Val Thr Lys Leu Phe Glu 85 90 95 Arg Ile
Tyr Ser Thr Asp Leu Gly Arg Met Leu Leu Thr Ser Ile Val 100 105 110
Arg Gly Ile Pro Phe Trp Gly Gly Ser Thr Ile Asp Thr Glu Leu Lys 115
120 125 Val Ile Asp Thr Asn Cys Ile Asn Val Ile Gln Pro Asp Gly Ser
Tyr 130 135 140 Arg Ser Glu Glu Leu Asn Leu Val Ile Ile Gly Pro Ser
Ala Asp Ile 145 150 155 160 Ile Gln Phe Glu Cys Lys Ser Phe Gly His
Glu Val Leu Asn Leu Thr 165 170 175 Arg Asn Gly Tyr Gly Ser Thr Gln
Tyr Ile Arg Phe Ser Pro Asp Phe 180 185 190 Thr Phe Gly Phe Glu Glu
Ser Leu Glu Val Asp Thr Asn Pro Leu Leu 195 200 205 Gly Ala Gly Lys
Phe Ala Thr Asp Pro Ala Val Thr Leu Ala His Glu 210 215 220 Leu Ile
His Ala Gly His Arg Leu Tyr Gly Ile Ala Ile Asn Pro Asn 225 230 235
240 Arg Val Phe Lys Val Asn Thr Asn Ala Tyr Tyr Glu Met Ser Gly Leu
245 250 255 Glu Val Ser Phe Glu Glu Leu Arg Thr Phe Gly Gly His Asp
Ala Lys 260 265 270 Phe Ile Asp Ser Leu Gln Glu Asn Glu Phe Arg Leu
Tyr Tyr Tyr Asn 275 280 285 Lys Phe Lys Asp Ile Ala Ser Thr Leu Asn
Lys Ala Lys Ser Ile Val 290 295 300 Gly Thr Thr Ala Ser Leu Gln Tyr
Met Lys Asn Val Phe Lys Glu Lys 305 310 315 320 Tyr Leu Leu Ser Glu
Asp Thr Ser Gly Lys Phe Ser Val Asp Lys Leu 325 330 335 Lys Phe Asp
Lys Leu Tyr Lys Met Leu Thr Glu Ile Tyr Thr Glu Asp 340 345 350 Asn
Phe Val Lys Phe Phe Lys Val Leu Asn Arg Lys Thr Tyr Leu Asn 355 360
365 Phe Asp Lys Ala Val Phe Lys Ile Asn Ile Val Pro Lys Val Asn Tyr
370 375 380 Thr Ile Tyr Asp Gly Phe Asn Leu Arg Asn Thr Asn Leu Ala
Ala Asn 385 390 395 400 Phe Asn Gly Gln Asn Thr Glu Ile Asn Asn Met
Asn Phe Thr Lys Leu 405 410 415 Lys Asn Phe Thr Gly Leu Phe Glu Phe
Tyr Lys Leu Leu Cys Val Arg 420 425 430 Gly Ile Ile Thr Ser Lys Thr
Lys Ser Leu Asp Lys Gly Tyr Asn Lys 435 440 445 8 423 PRT
Clostridium botulinum 8 Ala Leu Asn Asp Leu Cys Ile Lys Val Asn Asn
Trp Asp Leu Phe Phe 1 5 10 15 Ser Pro Ser Glu Asp Asn Phe Thr Asn
Asp Leu Asn Lys Gly Glu Glu 20 25 30 Ile Thr Ser Asp Thr Asn Ile
Glu Ala Ala Glu Glu Asn Ile Ser Leu 35 40 45 Asp Leu Ile Gln Gln
Tyr Tyr Leu Thr Phe Asn Phe Asp Asn Glu Pro 50 55 60 Glu Asn Ile
Ser Ile Glu Asn Leu Ser Ser Asp Ile Ile Gly Gln Leu 65 70 75 80 Glu
Leu Met Pro Asn Ile Glu Arg Phe Pro Asn Gly Lys Lys Tyr Glu 85 90
95 Leu Asp Lys Tyr Thr Met Phe His Tyr Leu Arg Ala Gln Glu Phe Glu
100 105 110 His Gly Lys Ser Arg Ile Ala Leu Thr Asn Ser Val Asn Glu
Ala Leu 115 120 125 Leu Asn Pro Ser Arg Val Tyr Thr Phe Phe Ser Ser
Asp Tyr Val Lys 130 135 140 Lys Val Asn Lys Ala Thr Glu Ala Ala Met
Phe Leu Gly Trp Val Glu 145 150 155 160 Gln Leu Val Tyr Asp Phe Thr
Asp Glu Thr Ser Glu Val Ser Thr Thr 165 170 175 Asp Lys Ile Ala Asp
Ile Thr Ile Ile Ile Pro Tyr Ile Gly Pro Ala 180 185 190 Leu Asn Ile
Gly Asn Met Leu Tyr Lys Asp Asp Phe Val Gly Ala Leu 195 200 205 Ile
Phe Ser Gly Ala Val Ile Leu Leu Glu Phe Ile Pro Glu Ile Ala 210 215
220 Ile Pro Val Leu Gly Thr Phe Ala Leu Val Ser Tyr Ile Ala Asn Lys
225 230 235 240 Val Leu Thr Val Gln Thr Ile Asp Asn Ala Leu Ser Lys
Arg Asn Glu 245 250 255 Lys Trp Asp Glu Val Tyr Lys Tyr Ile Val Thr
Asn Trp Leu Ala Lys 260 265 270 Val Asn Thr Gln Ile Asp Leu Ile Arg
Lys Lys Met Lys Glu Ala Leu 275 280 285 Glu Asn Gln Ala Glu Ala Thr
Lys Ala Ile Ile Asn Tyr Gln Tyr Asn 290 295 300 Gln Tyr Thr Glu Glu
Glu Lys Asn Asn Ile Asn Phe Asn Ile Asp Asp 305 310 315 320 Leu Ser
Ser Lys Leu Asn Glu Ser Ile Asn Lys Ala Met Ile Asn Ile 325 330 335
Asn Lys Phe Leu Asn Gln Cys Ser Val Ser Tyr Leu Met Asn Ser Met 340
345 350 Ile Pro Tyr Gly Val Lys Arg Leu Glu Asp Phe Asp Ala Ser Leu
Lys 355 360 365 Asp Ala Leu Leu Lys Tyr Ile Tyr Asp Asn Arg Gly Thr
Leu Ile Gly 370 375 380 Gln Val Asp Arg Leu Lys Asp Lys Val Asn Asn
Thr Leu Ser Thr Asp 385 390 395 400 Ile Pro Phe Gln Leu Ser Lys Tyr
Val Asp Asn Gln Arg Leu Leu Ser 405 410 415 Thr Phe Thr Glu Tyr Ile
Lys 420 9 382 PRT Clostridium botulinum 9 Gln Leu Phe Asn Leu Glu
Ser Ser Lys Ile Glu Val Ile Leu Lys Asn 1 5 10 15 Ala Ile Val Tyr
Asn Ser Met Tyr Glu Asn Phe Ser Thr Ser Phe Trp 20 25 30 Ile Arg
Ile Pro Lys Tyr Phe Asn Ser Ile Ser Leu Asn Asn Glu Tyr 35 40 45
Thr Ile Ile Asn Cys Met Glu Asn Asn Ser Gly Trp Lys Val Ser Leu 50
55 60 Asn Tyr Gly Glu Ile Ile Trp Thr Leu Gln Asp Thr Gln Glu Ile
Lys 65 70 75 80 Gln Arg Val Val Phe Lys Tyr Ser Gln Met Ile Asn Ile
Ser Asp Tyr 85 90 95 Ile Asn Arg Trp Ile Phe Val Thr Ile Thr Asn
Asn Arg Leu Asn Asn 100 105 110 Ser Lys Ile Tyr Ile Asn Gly Arg Leu
Ile Asp Gln Lys Pro Ile Ser 115 120 125 Asn Leu Gly Asn Ile His Ala
Ser Asn Asn Ile Met Phe Lys Leu Asp 130 135 140 Gly Cys Arg Asp Thr
His Arg Tyr Ile Trp Ile Lys Tyr Phe Asn Leu 145 150 155 160 Phe Asp
Lys Glu Leu Asn Glu Lys Glu Ile Lys Asp Leu Tyr Asp Asn 165 170 175
Gln Ser Asn Ser Gly Ile Leu Lys Asp Phe Trp Gly Asp Tyr Leu Gln 180
185 190 Tyr Asp Lys Pro Tyr Tyr Met Leu Asn Leu Tyr Asp Pro Asn Lys
Tyr 195 200 205 Val Asp Val Asn Asn Val Gly Ile Arg Gly Tyr Met Tyr
Leu Lys Gly 210 215 220 Pro Arg Gly Ser Val Met Thr Thr Asn Ile Tyr
Leu Asn Ser Ser Leu 225 230 235 240 Tyr Arg Gly Thr Lys Phe Ile Ile
Lys Lys Tyr Ala Ser Gly Asn Lys 245 250 255 Asp Asn Ile Val Arg Asn
Asn Asp Arg Val Tyr Ile Asn Val Val Val 260 265 270 Lys Asn Lys Glu
Tyr Arg Leu Ala Thr Asn Ala Ser Gln Ala Gly Val 275 280 285 Glu Lys
Ile Leu Ser Ala Leu Glu Ile Pro Asp Val Gly Asn Leu Ser 290 295 300
Gln Val Val Val Met Lys Ser Lys Asn Asp Gln Gly Ile Thr Asn Lys 305
310 315 320 Cys Lys Met Asn Leu Gln Asp Asn Asn Gly Asn Asp Ile Gly
Phe Ile 325 330 335 Gly Phe His Gln Phe Asn Asn Ile Ala Lys Leu Val
Ala Ser Asn Trp 340 345 350 Tyr Asn Arg Gln Ile Glu Arg Ser Ser Arg
Thr Leu Gly Cys Ser Trp 355 360 365 Glu Phe Ile Pro Val Asp Asp Gly
Trp Gly Glu Arg Pro Leu 370 375 380 10 4835 DNA Clostridium
botulinum 10 aagcttctaa atttaaatta ttaagtataa atccaaataa acaatatgtt
caaaaacttg 60 atgaggtaat aatttctgta ttagataata tggaaaaata
tatagatata tctgaagata 120 atagattgca actaatagat aacaaaaata
acgcaaagaa gatgataatt agtaatgata 180 tatttatttc caattgttta
accctatctt ataacggtaa atatatatgt ttatctatga 240 aagatgaaaa
ccataattgg atgatatgta ataatgatat gtcaaagtat ttgtatttat 300
ggtcatttaa ataattaata atttaattaa ttttaaatat tataagaggt gttaaatatg
360 ccatttgtta ataaacaatt taattataaa gatcctgtaa atggtgttga
tattgcttat 420 ataaaaattc caaatgcagg acaaatgcaa ccagtaaaag
cttttaaaat tcataataaa 480 atatgggtta ttccagaaag agatacattt
acaaatcctg aagaaggaga tttaaatcca 540 ccaccagaag caaaacaagt
tccagtttca tattatgatt caacatattt aagtacagat 600 aatgaaaaag
ataattattt aaagggagtt acaaaattat ttgagagaat ttattcaact 660
gatcttggaa gaatgttgtt aacatcaata gtaaggggaa taccattttg gggtggaagt
720 acaatagata cagaattaaa agttattgat actaattgta ttaatgtgat
acaaccagat 780 ggtagttata gatcagaaga acttaatcta gtaataatag
gaccctcagc tgatattata 840 cagtttgaat gtaaaagctt tggacatgaa
gttttgaatc ttacgcgaaa tggttatggc 900 tctactcaat acattagatt
tagcccagat tttacatttg gttttgagga gtcacttgaa 960 gttgatacaa
atcctctttt aggtgcaggc aaatttgcta cagatccagc agtaacatta 1020
gcacatgaac ttatacatgc tggacataga ttatatggaa tagcaattaa tccaaatagg
1080 gtttttaaag taaatactaa tgcctattat gaaatgagtg ggttagaagt
aagctttgag 1140 gaacttagaa catttggggg acatgatgca aagtttatag
atagtttaca ggaaaacgaa 1200 tttcgtctat attattataa taagtttaaa
gatatagcaa gtacacttaa taaagctaaa 1260 tcaatagtag gtactactgc
ttcattacag tatatgaaaa atgtttttaa agagaaatat 1320 ctcctatctg
aagatacatc tggaaaattt tcggtagata aattaaaatt tgataagtta 1380
tacaaaatgt taacagagat ttacacagag gataattttg ttaagttttt taaagtactt
1440 aacagaaaaa catatttgaa ttttgataaa gccgtattta agataaatat
agtacctaag 1500 gtaaattaca caatatatga tggatttaat ttaagaaata
caaatttagc agcaaacttt 1560 aatggtcaaa atacagaaat taataatatg
aattttacta aactaaaaaa ttttactgga 1620 ttgtttgaat tttataagtt
gctatgtgta agagggataa taacttctaa aactaaatca 1680 ttagataaag
gatacaataa ggcattaaat gatttatgta tcaaagttaa taattgggac 1740
ttgtttttta gtccttcaga agataatttt actaatgatc taaataaagg agaagaaatt
1800 acatctgata ctaatataga agcagcagaa gaaaatatta gtttagattt
aatacaacaa 1860 tattatttaa cctttaattt tgataatgaa cctgaaaata
tttcaataga aaatctttca 1920 agtgacatta taggccaatt agaacttatg
cctaatatag aaagatttcc taatggaaaa 1980 aagtatgagt tagataaata
tactatgttc cattatcttc gtgctcaaga atttgaacat 2040 ggtaaatcta
ggattgcttt aacaaattct gttaacgaag cattattaaa tcctagtcgt 2100
gtttatacat ttttttcttc agactatgta aagaaagtta ataaagctac ggaggcagct
2160 atgtttttag gctgggtaga acaattagta tatgatttta ccgatgaaac
tagcgaagta 2220 agtactacgg ataaaattgc ggatataact ataattattc
catatatagg acctgcttta 2280 aatataggta atatgttata taaagatgat
tttgtaggtg ctttaatatt ttcaggagct 2340 gttattctgt tagaatttat
accagagatt gcaatacctg tattaggtac ttttgcactt 2400 gtatcatata
ttgcgaataa ggttctaacc gttcaaacaa tagataatgc tttaagtaaa 2460
agaaatgaaa aatgggatga ggtctataaa tatatagtaa caaattggtt agcaaaggtt
2520 aatacacaga ttgatctaat aagaaaaaaa atgaaagaag ctttagaaaa
tcaagcagaa 2580 gcaacaaagg ctataataaa ctatcagtat aatcaatata
ctgaggaaga gaaaaataat 2640 attaatttta atattgatga tttaagttcg
aaacttaatg agtctataaa taaagctatg 2700 attaatataa ataaattttt
gaatcaatgc tctgtttcat atttaatgaa ttctatgatc 2760 ccttatggtg
ttaaacggtt agaagatttt gatgctagtc ttaaagatgc attattaaag 2820
tatatatatg ataatagagg aactttaatt ggtcaagtag atagattaaa agataaagtt
2880 aataatacac ttagtacaga tatacctttt cagctttcca aatacgtaga
taatcaaaga 2940 ttattatcta catttactga atatattaag aatattatta
atacttctat attgaattta 3000 agatatgaaa gtaatcattt aatagactta
tctaggtatg catcaaaaat aaatattggt 3060 agtaaagtaa attttgatcc
aatagataaa aatcaaattc aattatttaa tttagaaagt 3120 agtaaaattg
aggtaatttt aaaaaatgct attgtatata atagtatgta tgaaaatttt 3180
agtactagct tttggataag aattcctaag tattttaaca gtataagtct aaataatgaa
3240 tatacaataa taaattgtat ggaaaataat tcaggatgga aagtatcact
taattatggt 3300 gaaataatct ggactttaca ggatactcag gaaataaaac
aaagagtagt ttttaaatac 3360 agtcaaatga ttaatatatc agattatata
aacagatgga tttttgtaac tatcactaat 3420 aatagattaa ataactctaa
aatttatata aatggaagat taatagatca aaaaccaatt 3480 tcaaatttag
gtaatattca tgctagtaat aatataatgt ttaaattaga tggttgtaga 3540
gatacacata gatatatttg gataaaatat tttaatcttt ttgataagga attaaatgaa
3600 aaagaaatca aagatttata tgataatcaa tcaaattcag gtattttaaa
agacttttgg 3660 ggtgattatt tacaatatga taaaccatac tatatgttaa
atttatatga tccaaataaa 3720 tatgtcgatg taaataatgt aggtattaga
ggttatatgt atcttaaagg gcctagaggt 3780 agcgtaatga ctacaaacat
ttatttaaat tcaagtttgt atagggggac aaaatttatt 3840 ataaaaaaat
atgcttctgg aaataaagat aatattgtta gaaataatga tcgtgtatat 3900
attaatgtag tagttaaaaa taaagaatat aggttagcta ctaatgcatc acaggcaggc
3960 gtagaaaaaa tactaagtgc attagaaata cctgatgtag gaaatctaag
tcaagtagta 4020 gtaatgaagt caaaaaatga tcaaggaata acaaataaat
gcaaaatgaa tttacaagat 4080 aataatggga atgatatagg ctttatagga
tttcatcagt ttaataatat agctaaacta 4140 gtagcaagta attggtataa
tagacaaata gaaagatcta gtaggacttt gggttgctca 4200 tgggaattta
ttcctgtaga tgatggatgg ggagaaaggc cactgtaatt aatctcaaac 4260
tacatgagtc tgtcaagaat tttctgtaaa catccataaa aattttaaaa ttaatatgtt
4320 taagaataac tagatatgag tattgtttga actgcccctg tcaagtagac
aggtaaaaaa 4380 ataaaaatta agatactatg gtctgatttc gatattctat
cggagtcaga ccttttaact 4440 tttcttgtat cctttttgta ttgtaaaact
ctatgtattc atcaattgca agttccaatt 4500 agtcaaaatt atgaaacttt
ctaagataat acatttctga ttttataatt tcccaaaatc 4560 cttccatagg
accattatca atacatctac caactcgaga catactttga gttgcgccta 4620
tctcattaag tttattcttg aaagatttac ttgtatattg aaaaccgcta tcactgtgaa
4680 aaagtggact agcatcagga ttggaggtaa ctgctttatc aaaggtttca
aagacaagga 4740 cgttgttatt tgattttcca agtacatagg aaataatgct
attatcatgc aaatcaagta 4800 tttcactcaa gtacgccttt gtttcgtctg ttaac
4835 11 15 PRT Homo sapiens 11 Glu Pro Lys Ser Cys Asp Lys Thr His
Thr Cys Pro Pro Cys Pro 1 5 10 15 12 5 PRT Artificial Sequence
METAL (3)...(4) Xaa=Ala,Cys,Asp,Glu,Phe,Gly,His,Ile,Lys,
Leu,Met,Asn,Pro,Gln,Arg,Se- r,Thr,Val,Trp orTyr 12 His Glu Xaa Xaa
His 1 5
* * * * *
References