U.S. patent application number 10/922546 was filed with the patent office on 2005-02-10 for methods for genome annotation.
Invention is credited to Case, Casey C., Urnov, Fyodor.
Application Number | 20050032108 10/922546 |
Document ID | / |
Family ID | 25476479 |
Filed Date | 2005-02-10 |
United States Patent
Application |
20050032108 |
Kind Code |
A1 |
Case, Casey C. ; et
al. |
February 10, 2005 |
Methods for genome annotation
Abstract
The present disclosure provides methods and compositions for
identifying transcribed regions in a genome. The methods include
the use of exogenous molecules such as zinc finger proteins which
are capable of binding to and modulating transcription, followed by
assay for one or more selected phenotypes.
Inventors: |
Case, Casey C.; (San Mateo,
CA) ; Urnov, Fyodor; (Richmond, CA) |
Correspondence
Address: |
ROBINS & PASTERNAK
1731 EMBARCADERO ROAD
SUITE 230
PALO ALTO
CA
94303
US
|
Family ID: |
25476479 |
Appl. No.: |
10/922546 |
Filed: |
August 19, 2004 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10922546 |
Aug 19, 2004 |
|
|
|
09941450 |
Aug 28, 2001 |
|
|
|
6780590 |
|
|
|
|
09941450 |
Aug 28, 2001 |
|
|
|
09395448 |
Sep 14, 1999 |
|
|
|
6599692 |
|
|
|
|
Current U.S.
Class: |
506/10 ;
435/6.16; 702/20 |
Current CPC
Class: |
G01N 33/5005 20130101;
C12N 15/8241 20130101; C12N 15/1055 20130101; C12N 15/8216
20130101; C12Q 1/6897 20130101; C12N 15/8243 20130101; C12N 15/1079
20130101; G01N 33/50 20130101 |
Class at
Publication: |
435/006 ;
702/020 |
International
Class: |
C12Q 001/68; G06F
019/00; G01N 033/48; G01N 033/50 |
Claims
What is claimed is:
1. A method for identifying a transcribed sequence in a region of
interest in a genome; wherein the method comprises: (a) contacting
a cell with an exogenous molecule comprising a transcriptional
regulatory domain, wherein the exogenous molecule binds within the
region of interest; and (b) assaying the cell for at least one
selected phenotype; wherein, if one or more of the selected
phenotypes are observed, the region of interest contains a
transcribed sequence.
2. The method of claim 1, wherein the transcribed sequence encodes
a protein.
3. The method of claim 1, wherein the transcribed sequence is an
RNA selected from the group consisting of structural RNA,
regulatory RNA, enzymatic RNA, antisense RNA, ribozyme, ribosomal
RNA and transfer RNA.
4. The method of claim 1, wherein the exogenous molecule is a zinc
finger protein.
5. The method of claim 1, wherein the exogenous molecule binds
within the transcribed sequence.
6. The method of claim 1, wherein the exogenous molecule binds
outside of the transcribed sequence.
7. The method of claim 1, wherein the transcriptional regulatory
domain is an activation domain.
8. The method of claim 7, wherein the activation domain is selected
from the group consisting of VP16, p65 and functional fragments
thereof.
9. The method of claim 1, wherein the transcriptional regulatory
domain is a repression domain.
10. The method of claim 9, wherein the repression domain is
selected from the group consisting of KRAB, v-erbA and functional
fragments thereof.
11. The method of claim 1, wherein the transcriptional regulatory
domain is a bifunctional domain (BFD), wherein the activity of the
bifunctional domain is dependent upon interaction of the BFD with a
second molecule.
12. The method of claim 11, wherein the BFD is selected from the
group consisting of thyroid hormone receptor, retinoic acid
receptor, estrogen receptor, glucocorticoid receptor and functional
fragments thereof.
13. The method of claim 11, wherein the second molecule is a
protein.
14. The method of claim 11, wherein the second molecule is a small
molecule.
15. The method of claim 14, wherein the small molecule is selected
from the group consisting of 3,5,3'-triiodo-L-thyronine (T3),
all-trans-retinoic acid, estradiol, tamoxifen, 4-hydroxy-tamoxifen,
RU-486 and dexamethasone.
16. The method of claim 1, wherein the cell is an animal cell.
17. The method of claim 16 wherein the cell is a human cell.
18. The method of claim 1, wherein the cell is a plant cell.
19. The method of claim 1, wherein the phenotype is a change in a
property selected from the group consisting of cell growth, cell
cycle control, cellular physiology and cellular response to a
pathogen.
20. The method of claim 1, wherein the phenotype is expression of a
RNA molecule.
21. The method of claim 1, wherein the phenotype is an alteration
in the transcriptional program of the cell.
22. The method of claim 1, wherein the cell is infected with a
virus.
23. The method of claim 22, wherein the genome is a viral genome.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation-in-part of U.S. patent
application Ser. No. 09/395,448, filed Sep. 14, 1999, the
disclosure of which is hereby incorporated by reference in its
entirety.
TECHNICAL FIELD
[0002] The present disclosure is in the field of functional
genomics and gene identification.
BACKGROUND
[0003] Determining the function of a gene of interest is important
for identifying potential genomic targets for drug discovery. Genes
associated with a particular function or phenotype can then be
validated as targets for discovery of therapeutic compounds.
Historically, the function of a particular gene has been identified
by associating expression of the gene with a specification function
of phenotype in a biological system such as a cell or a transgenic
animal.
[0004] One known method used to validate the function of a gene is
to genetically remove the gene from a cell or animal (i.e., create
a "knockout") and determine whether or not a phenotype (i.e., any
change, e.g., morphological, functional, etc., observable by an
assay) of the cell or animal has changed. This determination
depends on whether the cell or organism survives without the gene
and is not feasible if the gene is required for survival. Other
genes are subject to counteracting mechanisms that are able to
adapt to the disappearance of the gene and compensate for its
function in other ways. This compensation may be so effective, in
fact, that the true function of the deleted gene may go unnoticed.
The technical process of creating a "knockout" is laborious and
requires extensive sequence information, thus commanding immense
monetary and technical resources if undertaken on a genome wide
scale.
[0005] In another example, antisense methods of gene regulation and
methods that rely on targeted ribozymes are highly unpredictable.
Another method for experimentally determining the function of a
newly discovered gene is to clone its cDNA into an expression
vector driven by a strong promoter and measure the physiological
consequence of its over-expression in a transfected cell. This
method is also labor intensive and does not address the
physiological consequences of down-regulation of a target gene.
Therefore, simple methods allowing the selective over- and
under-expression of uncharacterized genes would be of great utility
to the scientific community. Methods that permit the regulation of
genes in cell model systems, transgenic animals and transgenic
plants would find widespread use in academic laboratories,
pharmaceutical companies, genomics companies and in the
biotechnology industry.
[0006] An additional use of target validation is in the production
of in vivo and in vitro assays for drug discovery. Once the gene
causing a selected phenotype has been identified, cell lines,
transgenic animals and transgenic plants could be engineered to
express a useful protein product or repress a harmful one. These
model systems are then used, e.g., with high throughput screening
methodology, to identify lead therapeutic compounds that regulate
expression of the gene of choice, thereby providing a desired
phenotype, e.g., treatment of disease.
[0007] Methods currently exist in the art, which allow one to alter
the expression of a given gene, e.g., using ribozymes, antisense
technology, small molecule regulators, over-expression of cDNA
clones, and gene-knockouts. As described above, these methods have
to date proven to be generally insufficient for many applications
and typically have not demonstrated either high target efficacy or
high specificity in vivo. For useful experimental results and
therapeutic treatments, these characteristics are desired.
[0008] Gene expression is normally controlled by sequence specific
DNA binding proteins called transcription factors. These bind in
the general proximity (although occasionally at great distances) of
the point of transcription initiation of a gene and typically
include both a DNA binding domain and a regulatory domain. They act
to influence the efficiency of formation or function of a
transcription initiation complex at the promoter. Transcription
factors can act in a positive fashion (transactivation) or in a
negative fashion (transrepression). Although transcription factors
typically contain a regulatory domain, repression can also be
achieved by steric hindrance via a DNA binding domain alone.
[0009] Transcription factor function can be constitutive (always
"on") or conditional. Conditional function can be imparted on a
transcription factor by a variety of means, but the majority of
these regulatory mechanisms depend of the sequestering of the
factor in the cytoplasm and the inducible release and subsequent
nuclear translocation, DNA binding and transactivation (or
repression). Examples of transcription factors that function this
way include progesterone receptors, sterol response element binding
proteins (SREBPs) and NF-kappa B. There are examples of
transcription factors that respond to phosphorylation or small
molecule ligands by altering their ability to bind their cognate
DNA recognition sequence (Hou et al., Science 256:1701 (1994);
Gossen & Bujard, Proc. Natl. Acad. Sci. U.S.A. 89:5547 (1992);
Oligino et al., Gene Ther. 5:491-496 (1998); Wang et al., Gene
Ther. 4:432-441 (1997); Neering et al., Blood 88:1147-1155 (1996);
and Rendahl et al., Nat. Biotechnol. 16:757-761 (1998)).
[0010] Zinc finger proteins ("ZFPs") are proteins that can bind to
DNA in a sequence-specific manner. Zinc fingers were first
identified in the transcription factor TFIIIA from the oocytes of
the African clawed toad, Xenopus laevis. Zinc finger proteins are
widespread in eukaryotic cells. An exemplary motif characterizing
one class of these proteins (Cys.sub.2His.sub.2 class) is
-Cys-(X).sub.2-4-Cys-(X).sub.12-His-(X).sub- .3-5-His (SEQ ID NO:
1) (where X is any amino acid). A single finger domain is about 30
amino acids in length and several structural studies have
demonstrated that it contains an alpha helix containing the two
invariant histidine residues co-ordinated through zinc with the two
cysteines of a single beta turn. To date, over 10,000 zinc finger
sequences have been identified in several thousand known or
putative transcription factors. Zinc finger proteins are involved
not only in DNA-recognition, but also in RNA binding and
protein-protein binding. Current estimates are that this class of
molecules will constitute the products of about 2% of all human
genes.
[0011] The X-ray crystal structure of Zif268, a three-finger domain
from a murine transcription factor, has been solved in complex with
its cognate DNA-sequence and shows that each finger can be
superimposed on the next by a periodic rotation and translation of
the finger along the main DNA axis. The structure suggests that
each finger interacts independently with DNA over 3 base-pair
intervals, with side-chains at positions -1, 2, 3 and 6 on each
recognition helix making contacts with respective DNA triplet
sub-site. The amino terminus of Zif268 is situated at the 3' end of
its DNA recognition subsite. Recent results have indicated that
some zinc fingers can bind to a fourth base in a target segment
(Isalan et al., Proc. Natl. Acad. Sci. U.S.A. 94:5617-5621 (1997).
The fourth base is on the opposite strand from the other three
bases recognized by zinc finger and complementary to the base
immediately 3' of the three base subsite.
[0012] The structure of the Zif268-DNA complex also suggested that
the DNA sequence specificity of a zinc finger protein might be
altered by making amino acid substitutions at the four helix
positions (-1, 2, 3 and 6) on a zinc finger recognition helix.
Phage display experiments using zinc finger combinatorial libraries
to test this observation were published in a series of papers in
1994 (Rebar et al., Science 263:671-673 (1994); Jamieson et al.,
Biochemistry 33:5689-5695 (1994); Choo et al., Proc. Natl. Acad.
Sci. U.S.A. 91:11163-11167 (1994)). Combinatorial libraries were
constructed with randomized side-chains in either the first or
middle finger of Zif268 and then isolated with an altered Zif268
binding site in which the appropriate DNA sub-site was replaced by
an altered DNA triplet. Correlation between the nature of
introduced mutations and the resulting alteration in binding
specificity gave rise to a partial set of substitution rules for
rational design of zinc finger proteins with altered binding
specificity. Greisman & Pabo, Science 275:657-661 (1997)
discuss an elaboration of a phage display method in which each
finger of a zinc finger protein is successively subjected to
randomization and selection. This paper reported selection of zinc
finger proteins for a nuclear hormone response element, a p53
target site and a TATA box sequence.
[0013] Recombinant zinc finger proteins have been reported to have
the ability to regulate gene expression of transiently expressed
reporter genes in cultured cells (see, e.g., Pomerantz et al.,
Science 267:93-96 (1995); Liu et al., Proc. Natl. Acad. Sci. U.S.A.
94:5525-5530 1997); and Beerli et al., Proc. Natl. Acad. Sci.
U.S.A. 95:14628-14633 (1998)). For example, Pomerantz et al.,
Science 267:93-96 (1995) report an attempt to design a novel DNA
binding protein by fusing two fingers from Zif268 with a
homeodomain from Oct-1. The hybrid protein was then fused with
either a transcriptional activator or repressor domain for
expression as a chimeric protein. The chimeric protein was reported
to bind a target site representing a hybrid of the subsites of its
two components. The authors then constructed a reporter vector
containing a luciferase gene operably linked to a promoter and a
hybrid site for the chimeric DNA binding protein in proximity to
the promoter. The authors reported that their chimeric DNA binding
protein could activate or repress expression of the luciferase
gene.
[0014] Liu et al., Proc. Natl. Acad. Sci. U.S.A. 94:5525-5530
(1997) report forming a composite zinc finger protein by using a
peptide spacer to link two component zinc finger proteins, each
having three fingers. The composite protein was then further linked
to transcriptional activation or repression domains. It was
reported that the resulting chimeric protein bound to a target site
formed from the target segments bound by the two component zinc
finger proteins. It was further reported that the chimeric zinc
finger protein could activate or repress transcription of a
reporter gene when its target site was inserted into a reporter
plasmid in proximity of a promoter operably linked to the
reporter.
[0015] Beerli et al., Proc. Natl. Acad. Sci. U.S.A. 95:14628-14633
(1998) report construction of a chimeric six finger zinc finger
protein fused to either a KRAB, ERD, or SID transcriptional
repressor domain, or the VP16 or VP64 transcriptional activation
domain. This chimeric zinc finger protein was designed to recognize
an 18 bp target site in the 5' untranslated region of the human
erbB-2 gene. Using this construct, the authors of this study report
both activation and repression of a transiently expressed reporter
luciferase construct linked to the erbB-2 promoter.
[0016] In addition, a recombinant zinc finger protein was reported
to repress expression of an integrated plasmid construct encoding a
bcr-abl oncogene (Choo et al., Nature 372:642-645 (1994)). The
target segment to which the zinc finger proteins bound was a nine
base sequence GCA GAA GCC chosen to overlap the junction created by
a specific oncogenic translocation fusing the genes encoding bcr
and abl. The intention was that a zinc finger protein specific to
this target site would bind to the oncogene without binding to abl
or bcr component genes. The authors used phage display to select a
variant zinc finger protein that bound to this target segment. The
variant zinc finger protein thus isolated was then reported to
repress expression of a stably transfected bcr-abl construct in a
cell line.
[0017] To date, these methods have focused on regulation of either
transiently expressed, known genes, or on regulation of known
exogenous genes that have been integrated into the genome. In
contrast, specific regulation of a candidate gene or list of genes
to identify the cause of a selected phenotype has not been
demonstrated in the art. Therefore, a need exists for useful
methods of identifying the biological function of a selected gene
or genes and or validating a gene or genes as a suitable target for
drug discovery.
[0018] Furthermore, the determination of a draft nucleotide
sequence of the human genome opens up the prospect of identifying
all human genes. See, for example, Science 291:1177-1351 (2001) and
Nature 409:813-958 (2001). Identification of, for example,
disease-related genes could lead to the discovery of new
therapeutics. Some genes have already been identified based on
protein and/or RNA expression; while others have been and can be
identified by homology to other human genes or to related genes in
other organisms.
[0019] However, many problems in unambiguously identifying human
genes still exist and as a result, a complete list of human genes
is not currently available, nor is it likely to become available in
the near future. For example, the use of expressed sequence tag
(EST) sequences to predict the existence of a gene is subject to
artifacts arising from unspliced RNA, non-gene-derived
transcription and contamination of cDNA preparations, from which
ESTs are derived, with genomic DNA. The use of sequence similarity
to known genes as a criterion for identfying new genes rules out
the possibility of identifying any new gene for which a homologous
sequences is not already known. Various gene prediction algorithms
have been devised, but their success rate in identifying new genes
is unacceptably low. Thus, currently-available methods for
predicting the existence of a gene, based on analysis of genome
sequence, are not particularly effective. See, in particular,
Nature 409 supra p. 819 ("When is a predicted gene a gene?") and
pp. 892-907 ("Gene content of the human genome"); Galas (2001)
Science 291:1257-1260; and Goodman (2001) Genome Technology July
2001:52-55.
[0020] Accordingly, there is a need for methods to confirm putative
gene assignments that are based on gene prediction algorithms,
sequence homology, ESTs and related techniques.
SUMMARY
[0021] In one aspect, described herein is a method for identifying
a gene. In certain embodiments, the method comprises: (a) obtaining
a putative gene sequence (PGS); (b) contacting a cell with an
exogenous molecule, wherein the cell comprises the putative gene
sequence, and wherein the exogenous molecule binds to and modulates
expression of the putative gene sequence; and (c) assaying the cell
for at least one selected phenotype, wherein, if one or more of the
selected phenotypes are observed, the putative gene sequence is
identified as a gene. The putative gene sequence can be obtained,
for. example, from a gene prediction algorithm; by analysis of
expressed sequence tags; and/or by homology. In any of the methods
described herein, the gene can encode, for example, a protein or an
RNA (e.g., structural RNA, regulatory RNA, enzymatic RNA, antisense
RNA, ribozyme, ribosomal RNA or transfer RNA) and the cell can be,
for example, an animal cell (e.g., a mammalian cell such as a human
cell), a plant cell, a bacterial cell, a protozoal cell, or a
fungal cell. The exogenous molecule can be, for example, a zinc
finger protein.
[0022] In certain embodiments, the exogenous molecule binds near
the putative transcription startsite of the PGS. In other
embodiments, the exogenous molecule binds in the putative
transcribed region of the PGS (e.g,. in the putative coding region
of the PGS). In still further embodiments, the exogenous molecule
binds in a putative nontranscribed regulatory region of the
PGS.
[0023] In further embodiments, the exogenous molecule comprises an
activation domain (e.g., VP16, p65 and functional fragments
thereof); a repression domain (e.g., KRAB, v-erbA and functional
fragments thereof); or a bifunctional domain (BFD), such as thyroid
hormone receptor, retinoic acid receptor, estrogen receptor,
glucocorticoid receptor and functional fragments thereof, in which
the activity of the bifunctional domain is dependent upon
interaction of the BFD with a second molecule (e.g, a protein or a
small molecule such as 3,5,3'-triiodo-L-thyronine (T3),
all-trans-retinoic acid, estradiol, tamoxifen, 4-hydroxy-tamoxifen,
RU-486 or dexamethasone).
[0024] In further embodiments, the phenotype is a change in a
property, for example, cell growth, cell cycle control, cellular
physiology and cellular response to a pathogen. In other
embodiments, the phenotype is expression of a RNA molecule. In yet
other embodiments, the phenotype is an alteration in the
transcriptional program of the cell.
[0025] In still further embodiments, the cell is infected with a
virus and the gene is a viral gene.
[0026] These and other embodiments will be readily apparent to one
of skill in the art upon reading the present disclosure.
BRIEF DESCRIPTION OF THE DRAWINGS
[0027] FIG. 1 shows schematic representation of target validation
using zinc finger proteins to regulate gene expression.
[0028] FIG. 2 shows zinc finger protein expression constructs.
[0029] FIG. 3 shows luciferase reporter constructs for zinc finger
protein regulation of gene expression.
[0030] FIG. 4 shows the effect of zinc finger proteins on
luciferase reporter gene activation.
[0031] FIG. 5 shows activation of a human VEGF native reporter gene
by zinc finger proteins.
DETAILED DESCRIPTION
[0032] Introduction
[0033] As described herein, the present disclosure provides zinc
finger proteins used in assays to determine the phenotypic
consequences and function of gene expression. The recent advances
in analytical techniques, coupled with focused mass sequencing
efforts have created the opportunity to identify and characterize
many more molecular targets than were previously available. This
new information about genes and their functions will speed along
basic biological understanding and present many new targets for
therapeutic intervention. In some cases analytical tools have not
kept pace with the generation of new data. An example is provided
by recent advances in the measurement of global differential gene
expression. These methods, typified by gene expression microarrays,
differential cDNA cloning frequencies, subtractive hybridization
and differential display methods, can very rapidly identify genes
that are up or down-regulated in different tissues or in response
to specific stimuli. Increasingly, such methods are being used to
explore biological processes such as, transformation, tumor
progression, the inflammatory response, neurological disorders etc.
One can now very easily generate long lists of differentially
expressed genes that correlate with a given physiological
phenomenon, but demonstrating a causative relationship between a
differentially expressed gene and the phenomenon is difficult.
Until now, simple methods for assigning function to differentially
expressed genes have not kept pace with the ability to monitor
differential gene expression.
[0034] However, zinc finger protein technology can be used to
rapidly analyze differential gene expression studies. Engineered
zinc finger proteins can be readily used to up or down-regulate any
candidate target gene. Very little sequence information is required
to create a gene-specific DNA binding domain. This makes the zinc
finger protein technology ideal for analysis of long lists of
poorly characterized differentially expressed genes. One can simply
build a zinc finger-based DNA binding domain for each candidate
gene, create chimeric up and down-regulating artificial
transcription factors and test the consequence of up or
down-regulation on the phenotype under study (transformation,
response to a cytokine etc.) by switching the candidate genes on or
off one at a time in a model system.
[0035] Additionally, greater experimental control can be imparted
by zinc finger proteins than can be achieved by more conventional
methods. This is because the production and/or function of an
engineered zinc finger protein can be placed under small molecule
control. Examples of this approach are provided by the Tet-On
system, the ecdysone-regulated system and a system incorporating a
chimeric factor including a mutant progesterone receptor. These
systems are all capable of indirectly imparting small molecule
control on any candidate gene of interest or any transgene by
placing the function and/or expression of a zinc finger protein
regulator under small molecule control. In one embodiment, a cell
comprises two zinc finger proteins. The zinc finger proteins either
target two different candidate genes (i.e., two genes associated
with the same phenotype), or two different target sites on the same
candidate gene. Each zinc finger protein also comprises a
regulatory domain. Expression of each zinc finger protein is under
different small molecule control, allowing variations in the degree
of activation or repression of gene expression.
[0036] The present application therefore provides for the first
time methods of using zinc finger proteins for identifying a gene
or genes associated a selected phenotype, e.g., for drug discovery
target validation or for functional genomics. The present
disclosure provides zinc finger DNA binding proteins that have been
engineered to specifically recognize genes, with high efficacy.
Modulation of gene expression using zinc finger proteins is used to
determine the biological function of a gene, or a gene represented
by an EST, and to validate the function of potential target genes
for drug discovery.
[0037] In one embodiment, expression of at least two different
genes is regulated, using different zinc finger proteins to
regulate each gene. One of the genes is a candidate gene, and the
other gene can be a control gene or a second candidate gene. Cells
expressing the genes are contacted with zinc finger proteins, or
nucleic acids encoding zinc finger proteins. Both the genes can be
expressed in the same cell, or the genes can be each expressed in a
different cell. After expression of the first and second genes is
modulated by the zinc finger protein, the cells are assayed for
changes in a selected phenotype, thereby identifying the function
of the candidate gene or genes. In another embodiment, two zinc
finger proteins target the same candidate gene at two different
target sites. The methods and compositions disclosed herein can be
applied both to functional genomics, which typically refers to
identifying genes associated with a particular phenotype, and for
target validation, which typically refers to identifying genes that
are suitable for use in drug discovery assays.
[0038] As a result, exogenous regulatory molecules such as, for
example, zinc finger proteins can be used to identify genes that
cause a selected phenotype, both through activation and/or
repression of gene transcription. Zinc finger proteins that bind to
a promoter region can be used, but zinc finger proteins can also
regulate gene expression by binding to other regions of the gene.
Extensive sequence information is therefore not required to examine
expression of a candidate gene using zinc finger proteins. ESTs
therefore can be used in the assays described herein, to determine
their biological function.
[0039] Furthermore, the zinc finger proteins can also be linked to
regulatory domains, creating chimeric transcription factors to
activate or repress transcription. In one embodiment, the methods
of regulation use zinc finger proteins wherein the gene encoding
the zinc finger protein is linked to molecular switches controlled
by small molecules. The gene expression of the zinc finger proteins
is therefore conditional and can be regulated using small
molecules, thereby providing conditional regulation of candidate
gene expression.
[0040] Such functional genomics assays allow for discovery of novel
human and mammalian therapeutic applications, including the
discovery of novel drugs, for, e.g., treatment of genetic diseases,
cancer, fungal, protozoal, bacterial, and viral infection,
ischemia, vascular disease, arthritis, immunological disorders,
etc. Examples of assay systems for changes in phenotype include,
e.g., transformation assays, e.g., changes in proliferation,
anchorage dependence, growth factor dependence, foci formation,
growth in soft agar, tumor proliferation in nude mice, and tumor
vascularization in nude mice; apoptosis assays, e.g., DNA laddering
and cell death, expression of genes involved in apoptosis; signal
transduction assays, e.g., changes in intracellular calcium, cAMP,
cGMP, IP3, changes in hormone and neurotransmittor release;
receptor assays, e.g., estrogen receptor and cell growth; growth
factor assays, e.g., EPO, hypoxia and erythrocyte colony forming
units assays; enzyme product assays, e.g., FAD-2 induced oil
desaturation; transcription assays, e.g., reporter gene assays; and
protein production assays, e.g., VEGF ELISAs.
[0041] In one embodiment, a plurality of candidate genes is
provided, and a first zinc finger protein is used to modulate
expression of one of the candidate genes, while the expression
pattern of the other candidate genes is examined. This step is
repeated for each of the candidate genes, and changes in the
expression patterns are used to determine the biological function
of the genes. The expression data can then be analyzed to
reconstruct the order or cascade of genes in a pathway that is
associated with a selected phenotype.
[0042] As described herein, zinc finger proteins can be designed to
recognize any suitable target site, for regulation of expression of
any control or candidate gene of choice. Examples of target genes
suitable for regulation include VEGF, CCR5, ER.alpha., Her2/Neu,
Tat, Rev, HBV C, S, X, and P, LDL-R, PEPCK, CYP7, Fibrinogen, ApoB,
Apo E, Apo(a), renin, NF-.kappa.B, I-.kappa.B, TNF-.alpha., FAS
ligand, amyloid precursor protein, atrial naturetic factor,
ob-leptin, ucp-1, IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-12, G-CSF,
GM-CSF, Epo, PDGF, PAF, p53, Rb, fetal hemoglobin, dystrophin,
eutrophin, GDNF, NGF, IGF-1, VEGF receptors flt and flk,
topoisomerase, telomerase, bcl-2, cyclins, angiostatin, IGF,
ICAM-1, STATS, c-myc, c-myb, TH, PTI-1, polygalacturonase, EPSP
synthase, FAD2-1, delta-12 desaturase, delta-9 desaturase, delta-15
desaturase, acetyl-CoA carboxylase, acyl-ACP-thioesterase,
ADP-glucose pyrophosphorylase, starch synthase, cellulose synthase,
sucrose synthase, senescence-associated genes, heavy metal
chelators, fatty acid hydroperoxide lyase, viral genes, protozoal
genes, fungal genes, and bacterial genes. In general, suitable
genes to be regulated include cytokines, lymphokines, growth
factors, mitogenic factors, chemotactic factors, onco-active
factors, receptors, potassium channels, G-proteins, signal
transduction molecules, and other disease-related genes.
[0043] In a further embodiment, association between a gene and a
selected phenotype (e.g., a biological function of a gene) is
determined by assaying three types of cells. The first cell
comprises a first exogenous molecule (e.g., a zinc finger protein)
which binds to a first target site in the gene and activates
expression of the gene. The second cell comprises a second
exogenous molecule which binds to a second target site in the gene
and represses expression of the gene. The first and second target
sites can comprise the same sequence, or they can comprise
different sequences. In the third cell, expression of the gene is
not modulated by an exogenous molecule. The first, second and third
cells are each assayed for a selected phenotype, and the phenotypes
of each of the cells are compared. A difference in phenotype
between the first cell and the third cell, or between the second
cell and the third cell, or between the first and second cells on
the one hand, and the third cell on the other, provides evidence
for an association of the gene with the selected phenotype and, in
many cases, indicates the biological function of a gene.
[0044] In a preferred embodiment, the first and second exogenous
molecules each comprise a functional domain (e.g., a regulatory
domain). In additional embodiments, either or both of the first and
second exogenous molecules do not comprise a regulatory domain. In
certain embodiments, the first and second exogenous molecules
comprise the same functional domain, which is a bifunctional domain
whose activity is dependent on the presence of a second molecule
such as, for example, a protein or small molecule. (Said second
molecule is distinct from, and not to be confused with, the second
exogenous molecule described above.)
[0045] A cell can be subjected to one or more stimuli subsequent to
contact with an exogenous molecule and prior to assay for a
selected phenotype. Such stimuli can include, but are not limited
to, serum starvation, depletion of one or more external factors
(e.g., ligands, growth factors), addition of one or more external
factors (e.g., ligands, growth factors), stress (e.g., heat shock,
cold shock, changes in pressure, hypoxia, anoxia, exposure to one
or more oxidizing agents, exposure to one or more reducing agents,
exposure to one or more mutagens, exposure to one or more
inhibitors of DNA synthesis or DNA repair, and exposure to one or
more DNA damaging agents such a chemical or irradiation) and
treatment of a cell with a compound. In addition, cells can be
exposed to one or more pathogens (e.g., bacteria, viruses,
unicellular eukaryotes) between contact with an exogenous molecule
and assay for a selected phenotype, to determine whether modulation
of gene expression affects the response of the cell to the
pathogen.
[0046] A selected phenotype can be any phenotype that can be
detected by any method known in the art. In certain embodiments,
the phenotype provides information on a biological function of a
gene. Exemplary phenotypes include changes in cell physiology
(e.g., energy metabolism, synthesis of cellular molecules, ion
flux, membrane potential), changes in cellular morphology, changes
in cell proliferation, changes in cell cycle properties (e.g.,
arrest at a particular stage in the cell cycle, unregulated
cellular proliferation), changes in cellular metabolism (e.g., ATP
levels, second messenger levels, cell transformation) and changes
in any of the aforementioned properties that occur in response to
exposure to a pathogen.
[0047] In a further embodiment, a cell can comprise an exogenous
nucleic acid, which can encode a polypeptide, the expression of
which can be connected with a cellular phenotype. In certain
embodiments, the polypeptide is an endogenous polypeptide and the
phenotype is correlated with overexpression of the endogenous
polypeptide. In separate embodiments, the exogenous nucleic acid
encodes a mutant form of an endogenous polypeptide, and the
phenotype may, for example, mimic that of a mutation in the
cellular gene encoding the polypeptide. In these embodiments,
modulation of expression (e.g., up-regulation and/or
down-regulation) of a cellular gene, by contacting a cell with an
exogenous molecule, can alter a phenotype resulting from expression
of the exogenous nucleic acid in the cell, and the selected
phenotype corresponds to said altered phenotype.
[0048] Candidate genes are selected by methods known to those of
skill in the art, e.g., by gene expression microarrays,
differential cDNA cloning frequencies, subtractive hybridization,
differential display methods, by cloning ESTs from cells or tissues
of interest, by identifying genes that are lethal upon knockout, by
identifying genes that are up- or down-regulated in response to a
particular developmental or cellular event or stimuli; by
identifying genes that are up- or down-regulated in certain disease
and pathogenic states, by identifying mutations and RFLPs, by
identifying genes associated with regions of chromosomes known to
be involved in inherited diseases, by identifying genes that are
temporally regulated, e.g., in a pathogenic organism, differences
based on SNPs, etc.
[0049] A general theme in transcription factor function is that
simple binding and, in some cases, sufficient proximity to the
promoter are all that is generally needed. Exact positioning
relative to the promoter, orientation, and within limits, distance
do not matter greatly. In some cases enhancers are found positioned
large distances away from the gene of interest. In addition, for
repression of gene expression, often simple steric hindrance of
transcription initiation is sufficient. These features allow
considerable flexibility in choosing target sites for zinc finger
proteins. The target site recognized by the zinc finger protein
therefore can be any suitable site in the target gene that will
allow activation or repression of gene expression by a zinc finger
protein, optionally linked to a regulatory domain. Preferred target
sites include regions adjacent to, downstream, or upstream of the
transcription start site. In addition, target sites that are
located in enhancer regions, repressor sites, RNA polymerase pause
sites, and specific regulatory sites (e.g., SP-1 sites, hypoxia
response elements, nuclear receptor recognition elements, p53
binding sites), sites in the cDNA encoding region or in an
expressed sequence tag (EST) coding region. As described below,
typically each finger recognizes 2-4 base pairs, with a two finger
zinc finger protein binding to a 4 to 7 bp target site, a three
finger zinc finger protein binding to a 6 to 10 base pair site, and
a six finger zinc finger protein binding to two adjacent target
sites, each target site having from 6-10 base pairs.
[0050] Recognition of adjacent target sites by either associated or
individual zinc finger proteins can be used to produce enhanced
binding of the zinc finger proteins, resulting in an affinity that
is greater than the affinity of the zinc finger proteins when
individually bound to their target site. In one embodiment, a six
finger zinc finger protein is produced as a fusion protein linked
by an amino acid linker, and the resulting zinc finger protein
recognizes an approximately 18 base pair target site (see, e.g.,
Liu et al., Proc. Natl. Acad. Sci. U.S.A. 94:5525-5530 (1997)). An
18 base pair target site is expected to provide specificity in the
human genome, as a target site of that size should occur only once
in every 3.times.10.sup.10 base pairs, and the size of the human
genome is 3.5.times.10.sup.9 base pairs (see, e.g., Liu et al.,
Proc. Natl. Acad. Sci. U.S.A. 94:5525-5530 (1997)). In another
embodiment, the two three-fingered portions of the six fingered
zinc finger protein are non-covalently associated, through a
leucine zipper, a STAT protein N-terminal domain, or the FK506
binding protein (see, e.g., O'Shea, Science 254: 539 (1991),
Barahmand-Pour et al., Curr. Top. Microbiol. Immunol. 211:121-128
(1996); Klemm et al., Annu. Rev. Immunol. 16:569-592 (1998); Ho et
al., Nature 382:822-826 (1996)).
[0051] As described herein, two zinc finger proteins are
administered to a cell, recognizing different target genes, e.g., a
candidate gene and a control gene, or two candidate genes, or two
different target sites for the same gene. Optionally, a plurality
of zinc finger proteins can be administered, which recognize two or
more different target sites in the same gene. When two candidate
genes are examined, both the first and the second gene may be
required for the phenotype. The candidate genes may be endogenous
genes or exogenous genes. In one embodiment, more than one
candidate gene is associated with a selected phenotype.
[0052] In another embodiment, the zinc finger protein is linked to
at least one or more regulatory domains, described below. Preferred
regulatory domains include transcription factor repressor or
activator domains such as KRAB and VP16, co-repressor and
co-activator domains, DNA methyl transferases, histone
acetyltransferases, histone deacetylases, and endonucleases such as
Fokl. For repression of gene expression, typically the expression
of the gene is reduced by about 20% (i.e., 80% of non-zinc finger
protein modulated expression), more preferably by about 50% (i.e.,
50% of non-zinc finger protein modulated expression), more
preferably by about 75-100% (i.e., 25% to 0% of non-zinc finger
protein modulated expression). For activation of gene expression,
typically expression is activated by about 1.5 fold (i.e., 150% of
non-zinc finger protein modulated expression), preferably 2 fold
(i.e., 200% of non-zinc finger protein modulated expression), more
preferably 5-10 fold (i.e., 500-1000% of non-zinc finger protein
modulated expression), up to at least 100 fold or more.
[0053] The expression of engineered zinc finger protein activators
and repressors can be also controlled by small molecule systems
typified by the tet-regulated systems and the RU-486 system (see,
e.g., Gossen & Bujard, Proc. Natl. Acad. Sci. U.S.A. 89:5547
(1992); Oligino et al., Gene Ther. 5:491-496 (1998); Wang et al.,
Gene Ther. 4:432-441 (1997); Neering et al., Blood 88:1147-1155
(1996); and Rendahl et al., Nat. Biotechnol. 16:757-761 (1998)).
These impart small molecule control on the expression of the zinc
finger protein activators and repressors and thus impart small
molecule control on the target gene(s) of interest. This beneficial
feature could be used in cell culture models, and in transgenic
animals and plants.
[0054] The practice of the disclosed methods and use of the
discloses compositions employ, unless otherwise indicated,
conventional techniques in molecular biology, biochemistry,
genetics, computational chemistry, cell culture, recombinant DNA
and related fields as are within the skill of the art. These
techniques are fully explained in the literature. See, for example,
Sambrook et al. MOLECULAR CLONING: A LABORATORY MANUAL, Second
edition, Cold Spring Harbor Laboratory Press, 1989; Ausubel et al.,
CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, New
York, 1987 and periodic updates; and the series METHODS IN
ENZYMOLOGY, Academic Press, San Diego.
[0055] The disclosures of all patents, patent applications and
publications mentioned herein are hereby incorporated by reference
in their entireties.
[0056] Definitions
[0057] As used herein, the following terms have the meanings
ascribed to them unless specified otherwise.
[0058] A "candidate gene" refers to a cellular, viral, episomal,
microbial, protozoal , fungal, animal, plant, chloroplastic, or
mitochondrial gene. This term also refers to a microbial or viral
gene that is part of a naturally occurring microbial or viral
genome in a microbially or virally infected cell. The microbial or
viral genome can be extrachromosomal or integrated into the host
chromosome. This term also encompasses endogenous and exogenous
genes, as well as cellular genes that are identified as ESTs.
Often, candidate genes are those for which the biological function
is unknown. An assay of choice is used to determine whether or not
the gene is associated with a selected phenotype upon regulation of
candidate gene expression with a zinc finger protein. If the
biological function is known, typically the candidate gene acts as
a control gene, or is used to determine if one or more additional
genes are associated with the same phenotype, or is used to
determine if the gene participates with other genes in a particular
phenotype.
[0059] A "gene," for the purposes of the present disclosure,
includes a DNA region encoding a gene product (see below), as well
as all DNA regions which regulate the production of the gene
product, whether or not such regulatory sequences are adjacent to
coding and/or transcribed sequences. Accordingly, a gene includes,
but is not necessarily limited to, coding region (i.e. nucleotide
sequences encoding the amino acid sequence of a polypeptide gene
product); transcribed region (i.e., nucleotide sequences serving as
template for transcription of a RNA molecule); nontranscribed
regulatory regions such as, for example, promoter sequences,
transcription start sites, and transcription termination sites;
translational regulatory sequences such as ribosome binding sites
and internal ribosome entry sites; enhancers; silencers;
insulators; boundary elements; replication origins; matrix
attachment sites and locus control regions. Further, a promoter can
be a cellular promoter or a promoter of an infecting microorganism
such as, for example, a virus, bacterium or unicellular eukaryote.
A gene can be a cellular gene of, for example, a plant, animal or
fungus, or a gene can be part of the genome of an infectious agent
such as, for example, a virus, bacterium, or unicellular
eukaryote.
[0060] Gene expression" refers to the conversion of the
information, contained in a gene, into a gene product. A gene
product can be the direct transcriptional product of a gene (e.g.,
mRNA, tRNA, rRNA, antisense RNA, enzymatic RNA (e.g., ribozyme),
structural RNA, regulatory RNA or any other type of RNA) or a
protein produced by translation of a mRNA encoded by a gene. A gene
product can be the direct transcriptional product of a gene (e.g.,
mRNA, tRNA, rRNA, antisense RNA, ribozyme, structural RNA or any
other type of RNA) or a protein produced by translation of a mRNA.
Gene products also include RNAs which are modified, by processes
such as capping, polyadenylation, methylation, and editing, and
proteins modified by, for example, methylation, acetylation,
phosphorylation, ubiquitination, ADP-ribosylation, myristilation,
and glycosylation.
[0061] "Gene activation" and "augmentation of gene expression"
refer to any process which results in an increase in production of
a gene product. A gene product can be either RNA (including, but
not limited to, mRNA, rRNA, tRNA, snoRNA, snRNA, telomerase RNA,
7SL signal recognition particle RNA, structural RNA, regulatory
RNA, enzymatic RNA) or protein. Accordingly, gene activation
includes those processes which increase transcription of a gene
and/or translation of a mRNA. Examples of gene activation processes
which increase transcription include, but are not limited to, those
which facilitate formation of a transcription initiation complex,
those which increase transcription initiation rate, those which
increase transcription elongation rate, those which increase
processivity of transcription and those which relieve
transcriptional repression (by, for example, blocking the binding
of a transcriptional repressor). Gene activation can constitute,
for example, inhibition of repression as well as stimulation of
expression above an existing level. Examples of gene activation
processes which increase translation include those which increase
translational initiation, those which increase translational
elongation and those which increase mRNA stability. In general,
gene activation comprises any detectable increase in the production
of a gene product, preferably an increase in production of a gene
product by about 2-fold, more preferably from about 2- to about
5-fold or any integral value therebetween, more preferably between
about 5- and about 10-fold or any integral value therebetween, more
preferably between about 10- and about 20-fold or any integral
value therebetween, still more preferably between about 20- and
about 50-fold or any integral value therebetween, more preferably
between about 50- and about 100-fold or any integral value
therebetween, more preferably 100-fold or more.
[0062] "Gene repression" and "inhibition of gene expression" refer
to any process which results in a decrease in production of a gene
product. A gene product can be either RNA (including, but not
limited to, mRNA, rRNA, tRNA, snoRNA, snRNA, telomerase RNA, 7SL
signal recognition particle RNA, structural RNA, regulatory RNA,
enzymatic RNA) or protein. Accordingly, gene repression includes
those processes which decrease transcription of a gene and/or
translation of a mRNA. Examples of gene repression processes which
decrease transcription include, but are not limited to, those which
inhibit formation of a transcription initiation complex, those
which decrease transcription initiation rate, those which decrease
transcription elongation rate, those which decrease processivity of
transcription and those which antagonize transcriptional activation
(by, for example, blocking the binding of a transcriptional
activator). Gene repression can constitute, for example, prevention
of activation as well as inhibition of expression below an existing
level. Examples of gene repression processes which decrease
translation include those which decrease translational initiation,
those which decrease translational elongation and those which
decrease mRNA stability. Transcriptional repression includes both
reversible and irreversible inactivation of gene transcription. In
general, gene repression comprises any detectable decrease in the
production of a gene product, preferably a decrease in production
of a gene product by about 2-fold, more preferably from about 2- to
about 5-fold or any integral value therebetween, more preferably
between about 5- and about 10-fold or any integral value
therebetween, more preferably between about 10- and about 20-fold
or any integral value therebetween, still more preferably between
about 20- and about 50-fold or any integral value therebetween,
more preferably between about 50- and about 100-fold or any
integral value therebetween, more preferably 100-fold or more. Most
preferably, gene repression results in complete inhibition of gene
expression, such that no gene product is detectable.
[0063] The term "modulate" refers to a change in the quantity,
degree or extent of a function. For example, exogenous molecules
such as zinc finger proteins can modulate gene expression by
binding to a target sequence within or outside of a gene, thereby
inducing, enhancing or suppressing transcription of the gene. In
addition, modulation can include inhibition of transcription of a
gene wherein the modified zinc finger-nucleotide binding
polypeptide binds to the transcribed region of a gene and blocks
the passage of DNA dependent RNA polymerase, thus inhibiting
transcription of the gene. Furthermore, modulation can include
stimulation or inhibition of translation of a transcript. Thus,
"modulation" of gene expression can occur through effects on both
DNA and RNA and includes both activation and repression of gene
expression.
[0064] Accordingly, the terms "modulating expression" "inhibiting
expression" and "activating expression" of a gene can refer to the
ability of a zinc finger protein to activate or inhibit
transcription of a gene. Activation includes prevention of
transcriptional inhibition (i.e., prevention of repression of gene
expression) and inhibition includes prevention of transcriptional
activation (i.e., prevention of gene activation).
[0065] "Activation of gene expression that prevents repression of
gene expression" refers to the ability of a zinc finger protein to
block or prevent binding of a repressor molecule.
[0066] "Inhibition of gene expression that prevents gene
activation" refers to the ability of a zinc finger protein to block
or prevent binding of an activator molecule.
[0067] Modulation can be assayed by determining any parameter that
is indirectly or directly affected by the expression of the target
gene. Such parameters include, e.g., changes in RNA or protein
levels; changes in protein activity; changes in product levels;
changes in downstream gene expression; changes in transcription or
activity of reporter genes such as, for example, luciferase, CAT,
beta-galactosidase, or GFP (see, e.g., Mistili & Spector,
(1997) Nature Biotechnology 15:961-964); changes in signal
transduction; changes in phosphorylation and dephosphorylation;
changes in receptor-ligand interactions; changes in concentrations
of second messengers such as, for example, cGMP, cAMP, IP3, and
Ca.sup.2+; changes in cell growth, changes in neovascularization,
and/or changes in any functional effect of gene expression.
Measurements can be made in vitro, in vivo, and/or ex vivo. Such
functional effects can be measured by conventional methods, e.g.,
measurement of RNA or protein levels, measurement of RNA stability,
and/or identification of downstream or reporter gene expression.
Readout can be by way of, for example, chemiluminescence,
fluorescence, colorimetric reactions, antibody binding, inducible
markers, ligand binding assays; changes in intracellular second
messengers such as cGMP and inositol triphosphate (IP.sub.3);
changes in intracellular calcium levels; cytokine release, and the
like.
[0068] To determine the level of gene expression modulation by a
zinc finger protein, cells contacted with zinc finger proteins are
compared to control cells, e.g., without the zinc finger protein or
with a non-specific zinc finger protein, to examine the extent of
inhibition or activation. Control samples are assigned a relative
gene expression activity value of 100%. Modulation/inhibition of
gene expression is achieved when the gene expression activity value
relative to the control is about 80%, preferably 50% (i.e.,
0.5.times. the activity of the control), more preferably 25%, more
preferably 5-0%. Modulation/activation of gene expression is
achieved when the gene expression activity value relative to the
control is 110% , more preferably 150% (i.e., 1.5.times. the
activity of the control), more preferably 200-500%, more preferably
1000-2000% or more.
[0069] An "exogenous molecule" is a molecule that is not normally
present in a cell, but can be introduced into a cell by one or more
genetic, biochemical or other methods. Normal presence in the cell
is determined with respect to the particular developmental stage
and environmental conditions of the cell. Thus, for example, a
molecule that is present only during embryonic development of
muscle is an exogenous molecule with respect to an adult muscle
cell. Similarly, a molecule induced by heat shock is an exogenous
molecule with respect to a non-heat-shocked cell. An exogenous
molecule can comprise, for example, a functioning version of a
malfunctioning endogenous molecule or a malfunctioning version of a
normally-functioning endogenous molecule.
[0070] An exogenous molecule can be, among other things, a small
molecule, such as is generated by a combinatorial chemistry
process, or a macromolecule such as a protein, nucleic acid,
carbohydrate, lipid, glycoprotein, lipoprotein, polysaccharide, any
modified derivative of the above molecules, or any complex
comprising one or more of the above molecules. Nucleic acids
include DNA and RNA, can be single- or double-stranded; can be
linear, branched or circular; and can be of any length. Nucleic
acids include those capable of forming duplexes, as well as
triplex-forming nucleic acids. See, for example, U.S. Pat. Nos.
5,176,996 and 5,422,251. Proteins include, but are not limited to,
DNA-binding proteins, transcription factors, chromatin remodeling
factors, methylated DNA binding proteins, polymerases, methylases,
demethylases, acetylases, deacetylases, kinases, phosphatases,
integrases, recombinases, ligases, topoisomerases, gyrases and
helicases.
[0071] An exogenous molecule can be the same type of molecule as an
endogenous molecule, e.g., protein or nucleic acid (i.e., an
exogenous gene), providing it has a sequence that is different from
an endogenous molecule. For example, an exogenous nucleic acid can
comprise an infecting viral genome, a plasmid or episome introduced
into a cell, or a chromosome that is not normally present in the
cell. Methods for the introduction of exogenous molecules into
cells are known to those of skill in the art and include, but are
not limited to, lipid-mediated transfer (i.e., liposomes, including
neutral and cationic lipids), electroporation, direct injection,
cell fusion, particle bombardment, calcium phosphate
co-precipitation, DEAE-dextran-mediated transfer and viral
vector-mediated transfer.
[0072] By contrast, an "endogenous molecule" is one that is
normally present in a particular cell at a particular developmental
stage under particular environmental conditions. For example, an
endogenous nucleic acid can comprise a chromosome, the genome of a
mitochondrion, chloroplast or other organelle, or a
naturally-occurring episomal nucleic acid. Additional endogenous
molecules can include endogenous genes and endogenous proteins, for
example, transcription factors and components of chromatin
remodeling complexes.
[0073] A "selected phenotype" refers to any phenotype, e.g., any
observable characteristic or functional effect that can be measured
in an assay such as changes in cell growth, proliferation,
morphology, enzyme function, signal transduction, expression
patterns, downstream expression patterns, reporter gene activation,
hormone release, growth factor release, neurotransmittor release,
ligand binding, apoptosis, and product formation. Such assays
include, e.g., transformation assays, e.g., changes in
proliferation, anchorage dependence, growth factor dependence, foci
formation, growth in soft agar, tumor proliferation in nude mice,
and tumor vascularization in nude mice; apoptosis assays, e.g., DNA
laddering and cell death, expression of genes involved in
apoptosis; signal transduction assays, e.g., changes in
intracellular calcium, cAMP, cGMP, IP3, changes in hormone and
neurotransmittor release; receptor assays, e.g., estrogen receptor
and cell growth; growth factor assays, e.g., EPO, hypoxia and
erythrocyte colony forming units assays; enzyme product assays,
e.g., FAD-2 induced oil desaturation; transcription assays, e.g.,
reporter gene assays; and protein production assays, e.g., VEGF
ELISAs.
[0074] A candidate gene is "associated with" a selected phenotype
if modulation of gene expression of the candidate gene causes a
change in the selected phenotype.
[0075] The term "zinc finger protein" or "ZFP" refers to a protein
having DNA binding domains that are stabilized by zinc. The
individual DNA binding domains are typically referred to as
"fingers" A zinc finger protein has least one finger, typically two
fingers, three fingers, or six fingers. Each finger binds from two
to four base pairs of DNA, typically three or four base pairs of
DNA. A zinc finger protein binds to a nucleic acid sequence called
a target site or target segment. Each finger typically comprises an
approximately 30 amino acid, zinc-coordinating, DNA-binding
subdomain. An exemplary motif characterizing one class of these
proteins (Cys.sub.2His.sub.2 class) is
-Cys-(X).sub.2-4-Cys-(X).sub.12-His-(X).sub.3-5-His (SEQ ID NO: 1)
(where X is any amino acid). Studies have demonstrated that a
single zinc finger of this class consists of an alpha helix
containing the two invariant histidine residues co-ordinated with
zinc along with the two cysteine residues of a single beta turn
(see, e.g., Berg & Shi, Science 271:1081-1085 (1996)).
[0076] A "target site" is the nucleic acid sequence recognized by a
zinc finger protein. A single target site typically has about four
to about ten base pairs. Typically, a two-fingered zinc finger
protein recognizes a four to seven base pair target site, a
three-fingered zinc finger protein recognizes a six to ten base
pair target site, and a six fingered zinc finger protein recognizes
two adjacent nine to ten base pair target sites.
[0077] The term "adjacent target sites" refers to non-overlapping
target sites that are separated by zero to about 5 base pairs.
[0078] "K.sub.d" refers to the dissociation constant for the
compound, i.e., the concentration of a compound (e.g., a zinc
finger protein) that gives half maximal binding of the compound to
its target (i.e., half of the compound molecules are bound to the
target) under given conditions (i.e., when [target]
<<K.sub.d), as measured using a given assay system (see,
e.g., U.S. Pat. No. 5,789,538). The assay system used to measure
the K.sub.d should be chosen so that it gives the most accurate
measure of the actual K.sub.d of the zinc finger protein. Any assay
system can be used, as long is it gives an accurate measurement of
the actual K.sub.d of the zinc finger protein. In one embodiment,
the K.sub.d for a zinc finger protein is measured using an
electrophoretic mobility shift assay ("EMSA"), as described herein.
Unless an adjustment is made for zinc finger protein purity or
activity, the K.sub.d calculations made using the methods described
herein may result in an underestimate of the true K.sub.d of a
given zinc finger protein. Optionally, the K.sub.d of a zinc finger
protein used to modulate transcription of a candidate gene is less
than about 100 nM, or less than about 75 nM, or less than about 50
nM, or less than about 25 nM.
[0079] The phrase "adjacent to a transcription initiation site"
refers to a target site that is within about 50 bases either
upstream or downstream of a transcription initiation site.
"Upstream" of a transcription initiation site refers to a target
site that is more than about 50 bases 5' of the transcription
initiation site. "Downstream" of a transcription initiation site
refers to a target site that is more than about 50 bases 3' of the
transcription initiation site.
[0080] The phrase "RNA polymerase pause site" is described in
Uptain et al., Annu. Rev. Biochem. 66:117-172 (1997).
[0081] "Administering" an expression vector, nucleic acid, zinc
finger protein, or a delivery vehicle to a cell comprises
transducing, transfecting, electroporating, translocating, fusing,
phagocytosing, or biolistic methods, etc., i.e., any means by which
a protein or nucleic acid can be transported across a cell membrane
and preferably into the nucleus of a cell, including administration
of naked DNA.
[0082] A "delivery vehicle" refers to a compound, e.g., a liposome,
toxin, or a membrane translocation polypeptide, which is used to
administer a zinc finger protein. Delivery vehicles can also be
used to administer nucleic acids encoding zinc finger proteins,
e.g., a lipid:nucleic acid complex, an expression vector, a virus,
and the like.
[0083] A "transcriptional activator" and a "transcriptional
repressor" refer to proteins or functional fragments of proteins
that have the ability to modulate transcription, as described
above. Such proteins include, e.g., transcription factors and
co-factors (e.g., KRAB, MAD, ERD, SID, nuclear factor kappa B
subunit p65, early growth response factor 1, and nuclear hormone
receptors, VP16, VP64), endonucleases, integrases, recombinases,
methyltransferases, histone acetyltransferases, histone
deacetylases etc. Activators and repressors include co-activators
and co-repressors (see, e.g., Utley et al., Nature 394:498-502
(1998)).
[0084] A "regulatory domain" or "functional domain" refers to a
protein or a polypeptide sequence that has transcriptional
modulation activity, or that is capable of interacting with
proteins and/or protein domains that have transcriptional
modulation activity. Typically, a functional domain is covalently
or non-covalently linked to a DNA-binding domain (e.g., a ZFP) to
modulate transcription of a gene of interest. Alternatively, a ZFP
can act, in the absence of a functional domain, to modulate
transcription. Furthermore, transcription of a gene of interest can
be modulated by a ZFP linked to multiple functional domains.
[0085] A "functional fragment" of a protein, polypeptide or nucleic
acid is a protein, polypeptide or nucleic acid whose sequence is
not identical to the full-length protein, polypeptide or nucleic
acid, yet retains the same function as the full-length protein,
polypeptide or nucleic acid. A functional fragment can possess
more, fewer, or the same number of residues as the corresponding
native molecule, and/or can contain one ore more amino acid or
nucleotide substitutions. Methods for determining the function of a
nucleic acid (e.g., coding function, ability to hybridize to
another nucleic acid, binding to a regulatory molecule) are
well-known in the art. Similarly, methods for determining protein
function are well-known. For example, the DNA-binding function of a
polypeptide can be determined, for example, by filter-binding,
electrophoretic mobility-shift, or immunoprecipitation assays. See
Ausubel et al., supra. The ability of a protein to interact with
another protein can be determined, for example, by
co-immunoprecipitation, two-hybrid assays or complementation, both
genetic and biochemical. See, for example, Fields et al. (1989)
Nature 340:245-246; U.S. Pat. No. 5,585,245 and PCT WO
98/44350.
[0086] A "fusion molecule" is a molecule in which two or more
subunit molecules are linked, preferably covalently. The subunit
molecules can be the same chemical type of molecule, or can be
different chemical types of molecules. Examples of the first type
of fusion molecule include, but are not limited to, fusion
polypeptides (for example, a fusion between a ZFP DNA-binding
domain and a functional domain) and fusion nucleic acids (for
example, a nucleic acid encoding a fusion polypeptide). Examples of
the second type of fusion molecule include, but are not limited to,
a fusion between a triplex-forming nucleic acid and a polypeptide,
and a fusion between a minor groove binder and a nucleic acid.
[0087] The term "heterologous" is a relative term, which when used
with reference to portions of a nucleic acid indicates that the
nucleic acid comprises two or more subsequences that are not found
in the same relationship to each other in nature. For instance, a
nucleic acid that is recombinantly produced typically has two or
more sequences from unrelated genes synthetically arranged to make
a new functional nucleic acid, e.g., a promoter from one source and
a coding region from another source. The two nucleic acids are thus
heterologous to each other in this context. When added to a cell,
the recombinant nucleic acids would also be heterologous to the
endogenous genes of the cell. Thus, in a chromosome, a heterologous
nucleic acid would include an non-native (non-naturally occurring)
nucleic acid that has integrated into the chromosome, or a
non-native (non-naturally occurring) extrachromosomal nucleic
acid.
[0088] Similarly, a heterologous protein indicates that the protein
comprises two or more subsequences that are not found in the same
relationship to each other in nature (e.g., a "fusion protein,"
where the two subsequences are encoded by a single nucleic acid
sequence). See, e.g., Ausubel, supra, for an introduction to
recombinant techniques.
[0089] The term "recombinant" when used with reference, e.g., to a
cell, or nucleic acid, protein, or vector, indicates that the cell,
nucleic acid, protein or vector, has been modified by the
introduction of a heterologous nucleic acid or protein or the
alteration of a native nucleic acid or protein, or that the cell is
derived from a cell so modified. Thus, for example, recombinant
cells express genes that are not found within the native (naturally
occurring) form of the cell or express a second copy of a native
gene that is otherwise normally or abnormally expressed, under
expressed or not expressed at all.
[0090] A "promoter" is defined as an array of nucleic acid control
sequences that direct transcription. As used herein, a promoter
typically includes necessary nucleic acid sequences near the start
site of transcription, such as, in the case of certain RNA
polymerase II type promoters, a TATA element, enhancer, CCAAT box,
SP-1 site, etc. As used herein, a promoter also optionally includes
distal enhancer or repressor elements, which can be located as much
as several thousand base pairs from the start site of
transcription. The promoters often have an element that is
responsive to transactivation by a DNA-binding moiety such as a
polypeptide, e.g., a nuclear receptor, Gal4, the lac repressor and
the like.
[0091] A "constitutive" promoter is a promoter that is active under
most environmental and developmental conditions. An "inducible"
promoter is a promoter that is active under certain environmental
or developmental conditions.
[0092] Nucleic acid or amino acid sequences are "operably linked"
(or "operatively linked") when placed into a functional
relationship with one another. For instance, a promoter or enhancer
is operably linked to a coding sequence if it regulates, or
contributes to the modulation of, the transcription of the coding
sequence. Operably linked DNA sequences are typically contiguous,
and operably linked amino acid sequences are typically contiguous
and in the same reading frame. However, since enhancers generally
function when separated from the promoter by up to several
kilobases or more and intronic sequences may be of variable
lengths, some polynucleotide elements may be operably linked but
not contiguous. Similarly, certain amino acid sequences that are
non-contiguous in a primary polypeptide sequence may nonetheless be
operably linked due to, for example folding of a polypeptide
chain.
[0093] With respect to fusion polypeptides, the terms "operatively
linked" and "operably linked" can refer to the fact that each of
the components performs the same function in linkage to the other
component as it would if it were not so linked. For example, with
respect to a fusion polypeptide in which a ZFP DNA-binding domain
is fused to a transcriptional activation domain (or functional
fragment thereof), the ZFP DNA-binding domain and the
transcriptional activation domain (or functional fragment thereof)
are in operative linkage if, in the fusion polypeptide, the ZFP
DNA-binding domain portion is able to bind its target site and/or
its binding site, while the transcriptional activation domain (or
functional fragment thereof) is able to activate transcription.
[0094] An "expression vector" is a nucleic acid construct,
generated recombinantly or synthetically, with a series of
specified nucleic acid elements that permit transcription of a
particular nucleic acid in a host cell, and optionally, integration
or replication of the expression vector in a host cell. The
expression vector can be part of a plasmid, virus, or nucleic acid
fragment, of viral or non-viral origin. Typically, the expression
vector includes an "expression cassette," which comprises a nucleic
acid to be transcribed operably linked to a promoter. The term
expression vector also encompasses naked DNA operably linked to a
promoter.
[0095] By "host cell" is meant a cell that contains a ZFP or an
expression vector or nucleic acid encoding a ZFP. The host cell
typically supports the replication or expression of the expression
vector. Host cells may be prokaryotic cells such as E. coli, or
eukaryotic cells such as fungal cells (e.g., yeast), protozoal
cells, plant cells, insect cells, animal cells, avian cells,
teleost cells, amphibian cells, mammalian cells, primate cells or
human cells. Exemplary mammalian cell lines include CHO, HeLa, 293,
COS-1, and the like, e.g., cultured cells (in vitro), explants and
primary cultures (in vitro and ex vivo), and cells in vivo.
[0096] "Nucleic acid" refers to deoxyribonucleotides or
ribonucleotides and polymers thereof in either single- or
double-stranded form. The term encompasses nucleic acids containing
known nucleotide analogs or modified backbone residues or linkages,
which are synthetic, naturally occurring, and non-naturally
occurring, which have similar binding properties as the reference
nucleic acid. Examples of such analogs include, without limitation,
phosphorothioates, phosphoramidates, methyl phosphonates,
chiral-methyl phosphonates, 2-O-methyl ribonucleotides,
peptide-nucleic acids (PNAs).
[0097] Unless otherwise indicated, a particular nucleic acid
sequence also implicitly encompasses conservatively modified
variants thereof (e.g., degenerate codon substitutions) and
complementary sequences, as well as the sequence explicitly
indicated. Specifically, degenerate codon substitutions may be
achieved by generating sequences in which the third position of one
or more selected (or all) codons is substituted with mixed-base
and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res.
19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608
(1985); Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)). The
term nucleic acid is used interchangeably with gene, cDNA, mRNA,
oligonucleotide, and polynucleotide.
[0098] The terms "polypeptide," "peptide" and "protein" are used
interchangeably herein to refer to a polymer of amino acid
residues. The terms also apply to amino acid polymers in which one
or more amino acid residue is an artificial chemical mimetic of a
corresponding naturally occurring amino acid, as well as to
naturally occurring amino acid polymers and non-naturally occurring
amino acid polymer.
[0099] The term "amino acid" refers to naturally occurring and
synthetic amino acids, as well as amino acid analogs and amino acid
mimetics that function in a manner similar to the naturally
occurring amino acids. Naturally occurring amino acids are those
encoded by the genetic code, as well as those amino acids that are
later modified, e.g., hydroxyproline, .gamma.-carboxyglutamate, and
O-phosphoserine. Amino acid analogs refers to compounds that have
the same basic chemical structure as a naturally occurring amino
acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl
group, an amino group, and an R group, e.g., homoserine,
norleucine, methionine sulfoxide, methionine methyl sulfonium. Such
analogs have modified R groups (e.g., norleucine) or modified
peptide backbones, but retain the same basic chemical structure as
a naturally occurring amino acid. Amino acid mimetics refers to
chemical compounds that have a structure that is different from the
general chemical structure of an amino acid, but that functions in
a manner similar to a naturally occurring amino acid.
[0100] Amino acids may be referred to herein by either their
commonly known three letter symbols or by the one-letter symbols
recommended by the IUPAC-IUB Biochemical Nomenclature Commission.
Nucleotides, likewise, may be referred to by their commonly
accepted single-letter codes.
[0101] "Conservatively modified variants" applies to both amino
acid and nucleic acid sequences. With respect to particular nucleic
acid sequences, conservatively modified variants refers to those
nucleic acids which encode identical or essentially identical amino
acid sequences, or where the nucleic acid does not encode an amino
acid sequence, to essentially identical sequences. Because of the
degeneracy of the genetic code, a large number of functionally
identical nucleic acids encode any given protein. For instance, the
codons GCA, GCC, GCG and GCU all encode the amino acid alanine.
Thus, at every position where an alanine is specified by a codon,
the codon can be altered to any of the corresponding codons
described without altering the encoded polypeptide. Such nucleic
acid variations are "silent variations," which are one species of
conservatively modified variations. Every nucleic acid sequence
herein which encodes a polypeptide also describes every possible
silent variation of the nucleic acid. One of skill will recognize
that each codon in a nucleic acid (except AUG, which is ordinarily
the only codon for methionine, and TGG, which is ordinarily the
only codon for tryptophan) can be modified to yield a functionally
identical molecule. Accordingly, each silent variation of a nucleic
acid which encodes a polypeptide is implicit in each described
sequence.
[0102] As to amino acid sequences, one of skill will recognize that
individual substitutions, deletions or additions to a nucleic acid,
peptide, polypeptide, or protein sequence which alters, adds or
deletes a single amino acid or a small percentage of amino acids in
the encoded sequence is a "conservatively modified variant" where
the alteration results in the substitution of an amino acid with a
chemically similar amino acid. Conservative substitution tables
providing functionally similar amino acids are well known in the
art. Such conservatively modified variants are in addition to and
do not exclude polymorphic variants, interspecies homologs, and
alleles.
[0103] The following eight groups each contain amino acids that are
conservative substitutions for one another:
[0104] 1) Alanine (A), Glycine (G);
[0105] 2) Aspartic acid (D), Glutamic acid (E);
[0106] 3) Asparagine (N), Glutamine (Q);
[0107] 4) Arginine (R), Lysine (K);
[0108] 5) Isoleucine (I), Leucine (L), Methionine (M), Valine
(V);
[0109] 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W);
[0110] 7) Serine (S), Threonine (T); and
[0111] 8) Cysteine (C), Methionine (M)
[0112] (see, e.g., Creighton, Proteins (1984)).
[0113] The transcriptional program of the cell or "transcriptome"
refers to a collection of mRNA molecules present in a given cell
under a given set of environmental conditions, and can be
determined by methods known to those of skill in the art, such as,
for example, microarray analysis, serial analysis of gene
expression, and mRNA or cDNA display techniques. See for example,
U.S. Pat. Nos. 5,599,672 and 5,695,937. Environmental conditions
can include, but are not limited to, the tissue or culture medium
in which the cell resides, stage of development, disease state,
infection and conditions such as, for example, temperature,
pressure and the presence of one or more extracellular ligands,
mitogens or growth factors, for example. A transcriptome can be
complete (i.e., it can include all mRNA molecules present in a
cell) or it can be partial such as, for example, when analysis is
limited to just those mRNAs which can be detected with a particular
microarray. Additional transcriptomal information can include
relative and/or absolute levels for each mRNA in the transcriptome.
Differences between the transcriptomes of two or more cells can be
determined by methods known to those of skill in the art including,
but not limited to subtractive hybridization and related types of
difference analysis, differential mRNA or cDNA display, serial
analysis of gene expression and microarray analysis. See, for
example, U.S. Pat. Nos. 5,436,142; 5,501,964; 5,958,738; 5,665,547;
5,965,409; and 5,695,937.
[0114] Design of Zinc Finger Proteins
[0115] Exogenous regulatory molecules (e.g., zinc finger proteins)
are engineered to recognize a selected target site in the candidate
gene of choice. Typically, a backbone from any suitable
Cys.sub.2His.sub.2 zinc finger protein, such as SP-1, SP-1C, or
ZIF268, is used as the scaffold for the engineered zinc finger
protein (see, e.g., Jacobs, EMBO J. 11:4507 (1992); Desjarlais
& Berg, Proc. Natl. Acad. Sci. U.S.A. 90:2256-2260 (1993)). A
number of methods can then be used to design and select a zinc
finger protein with high affinity for its target (e.g., preferably
with a K.sub.d of less than about 25 nM). As described above, a
zinc finger protein can be designed or selected to bind to any
suitable target site in the target candidate gene, with high
affinity. Co-owned PCT WO 00/42219 (herein incorporated by
reference in its entirety), comprehensively describes methods for
design, construction, and expression of zinc finger proteins for
selected target sites.
[0116] Any suitable method known in the art can be used to design
and construct nucleic acids encoding zinc finger proteins, e.g.,
phage display, random mutagenesis, combinatorial libraries,
computer/rational design, affinity selection, PCR, cloning from
cDNA or genomic libraries, synthetic construction and the like.
(see, e.g., U.S. Pat. No. 5,786,538; Wu et al., Proc. Natl. Acad.
Sci. U.S.A. 92:344-348 (1995); Jamieson et al., Biochemistry
33:5689-5695 (1994); Rebar & Pabo, Science 263:671-673 (1994);
Choo & Klug, Proc. Natl. Acad. Sci. U.S.A. 91:11163-11167
(1994); Choo & Klug, Proc. Natl. Acad. Sci. U.S.A. 91:
11168-11172 (1994); Desjarlais & Berg, Proc. Natl. Acad. Sci.
U.S.A. 90:2256-2260 (1993); Desjarlais & Berg, Proc. Natl.
Acad. Sci. U.S.A. 89:7345-7349 (1992); Pomerantz et al., Science
267:93-96 (1995); Pomerantz et al., Proc. Natl. Acad. Sci. U.S.A.
92:9752-9756 (1995); and Liu et al., Proc. Natl. Acad. Sci. U.S.A.
94:5525-5530 (1997); Greisman & Pabo, Science 275:657-661
(1997); Desjarlais & Berg, Proc. Natl. Acad Sci. U.S.A.
91:11-99-11103 (1994)).
[0117] In a preferred embodiment, co-owned PCT WO 00/42219 provides
methods that select a target gene, and identify a target site
within the gene containing one to six (or more) D-able sites (see
definition below). Using these methods, a zinc finger protein can
then be synthesized that binds to the preselected site. These
methods of target site selection are premised, in part, on the
recognition that the presence of one or more D-able sites in a
target segment confers the potential for higher binding affinity in
a zinc finger protein selected or designed to bind to that site
relative to zinc finger proteins that bind to target segments
lacking D-able sites. Experimental evidence supporting this insight
is provided in Examples 2-9 of co-owned PCT WO 00/42219.
[0118] A D-able site or subsite is a region of a target site that
allows an appropriately designed single zinc finger to bind to four
bases rather than three of the target site. Such a zinc finger
binds to a triplet of bases on one strand of a double-stranded
target segment (target strand) and a fourth base on the other
strand (see FIG. 2 of co-owned PCT WO 00/42219. Binding of a single
zinc finger to a four base target segment imposes constraints both
on the sequence of the target strand and on the amino acid sequence
of the zinc finger. The target site within the target strand should
include the "D-able" site motif 5' NNGK 3', in which N and K are
conventional IUPAC-IUB ambiguity codes. A zinc finger for binding
to such a site should include an arginine residue at position -1
and an aspartic acid, (or less preferably a glutamic acid) at
position +2. The arginine residues at position -1 interacts with
the G residue in the D-able site. The aspartic acid (or glutamic
acid) residue at position +2 of the zinc finger interacts with the
opposite strand base complementary to the K base in the D-able
site. It is the interaction between aspartic acid (symbol D) and
the opposite strand base (fourth base) that confers the name D-able
site. As is apparent from the D-able site formula, there are two
subtypes of D-able sites: 5' NNGG 3' and 5' NNGT 3'. For the former
site, the aspartic acid or glutamic acid at position +2 of a zinc
finger interacts with a C in the opposite strand to the D-able
site. In the latter site, the aspartic acid or glutamic acid at
position +2 of a zinc finger interacts with an A in the opposite
strand to the D-able site. In general, NNGG is preferred over
NNGT.
[0119] In the design of a zinc finger protein with three fingers, a
target site should be selected in which at least one finger of the
protein, and optionally, two or all three fingers have the
potential to bind a D-able site. Such can be achieved by selecting
a target site from within a larger target gene having the formula
5'-NNx aNy bNzc-3', wherein
[0120] each of the sets (x, a), (y, b) and (z, c) is either (N, N)
or (G, K);
[0121] at least one of (x, a), (y, b) and (z, c) is (G, K). and
[0122] N and K are IUPAC-IUB ambiguity codes
[0123] In other words, at least one of the three sets (x, a), (y,
b) and (z, c) is the set (G, K), meaning that the first position of
the set is G and the second position is G or T. Those of the three
sets (if any) which are not (G, K) are (N, N), meaning that the
first position of the set can be occupied by any nucleotide and the
second position of the set can be occupied by any nucleotide. As an
example, the set (x, a) can be (G, K) and the sets (y, b) and (z,
c) can both be (N, N).
[0124] In the formula 5'-NNx aNy bNzc-3', the triplets of NNx aNy
and bNzc represent the triplets of bases on the target strand bound
by the three fingers in a zinc finger protein. If only one of x, y
and z is a G, and this G is followed by a K, the target site
includes a single D-able subsite. For example, if only x is G, and
a is K, the site reads 5'-NNG KNy bNzc-3' with the D-able subsite
highlighted. If both x and y but not z are G, and a and b are K,
then the target site has two overlapping D-able subsites as
follows: 5'-NNG KNG KNz c-3' (SEQ ID NO: 2), with one such site
being represented in bold and the other in italics. If all three of
x, y and z are G and a, b, and c are K, then the target segment
includes three D-able subsites, as follows 5'NNG KNG KNG K3' (SEQ
ID NO: 3), the D-able subsites being represented by bold, italics
and underline.
[0125] These methods thus work by selecting a target gene, and
systematically searching within the possible subsequences of the
gene for target sites conforming to the formula 5'-NNx aNy bNzc-3',
as described above. In some such methods, every possible
subsequence of 10 contiguous bases on either strand of a potential
target gene is evaluated to determine whether it conforms to the
above formula, and, if so, how many D-able sites are present.
Typically, such a comparison is performed by computer, and a list
of target sites conforming to the formula are output. Optionally,
such target sites can be output in different subsets according to
how many D-able sites are present.
[0126] In a variation, the methods identify first and second target
segments, each independently conforming to the above formula. The
two target segments in such methods are constrained to be adjacent
or proximate (i.e., within about 0-5 bases) of each other in the
target gene. The strategy underlying selection of proximate target
segments is to allow the design of a zinc finger protein formed by
linkage of two component zinc finger proteins specific for the
first and second target segments respectively. These principles can
be extended to select target sites to be bound by zinc finger
proteins with any number of component fingers. For example, a
suitable target site for a nine finger protein would have three
component segments, each conforming to the above formula.
[0127] The target sites identified by the above methods can be
subject to further evaluation by other criteria or can be used
directly for design or selection (if needed) and production of a
zinc finger protein specific for such a site. A further criteria
for evaluating potential target sites is their proximity to
particular regions within a gene. If a zinc finger protein is to be
used to repress a cellular gene on its own (i.e., without linking
the zinc finger protein to a repressing moiety), then the optimal
location appears to be at, or within 50 bp upstream or downstream
of the site of transcription initiation, to interfere with the
formation of the transcription complex (Kim & Pabo, J. Biol.
Chem. 272:29795-296800 (1997)) or compete for an essential enhancer
binding protein. If, however, a zinc finger protein is fused to a
functional domain such as the KRAB repressor domain or the VP16
activator domain, the location of the binding site is considerably
more flexible and can be outside known regulatory regions. For
example, a KRAB domain can repress transcription at a promoter up
to at least 3 kbp from where KRAB is bound (Margolin et al., Proc.
Natl. Acad. Sci. U.S.A. 91:4509-4513 (1994)). Thus, target sites
can be selected that do not necessarily include or overlap segments
of demonstrable biological significance with target genes, such as
regulatory sequences. Other criteria for further evaluating target
segments include the prior availability of zinc finger proteins
binding to such segments or related segments, and/or ease of
designing new zinc finger proteins to bind a given target
segment.
[0128] After a target segment has been selected, a zinc finger
protein that binds to the segment can be provided by a variety of
approaches. The simplest of approaches is to provide a
precharacterized zinc finger protein from an existing collection
that is already known to bind to the target site. However, in many
instances, such zinc finger proteins do not exist. An alternative
approach can also be used to design new zinc finger proteins, which
uses the information in a database of existing zinc finger proteins
and their respective binding affinities. A further approach is to
design a zinc finger protein based on substitution rules as
discussed above. A still further alternative is to select a zinc
finger protein with specificity for a given target by an empirical
process such as phage display. In some such methods, each component
finger of a zinc finger protein is designed or selected
independently of other component fingers. For example, each finger
can be obtained from a different preexisting zinc finger protein or
each finger can be subject to separate randomization and
selection.
[0129] Once a zinc finger protein has been selected, designed, or
otherwise provided to a given target segment, the zinc finger
protein or the DNA encoding it are synthesized. Exemplary methods
for synthesizing and expressing DNA encoding zinc finger proteins
are described below. The zinc finger protein or a polynucleotide
encoding it can then be used for modulation of expression, or
analysis of the target gene containing the target site to which the
zinc finger protein binds.
[0130] Expression and Purification of Zinc Finger Proteins
[0131] Zinc finger protein polypeptides and nucleic acids can be
made using routine techniques in the field of recombinant genetics.
Basic texts disclosing the general methods in the field include
Sambrook et al., Molecular Cloning, A Laboratory Manual (2nd ed.
1989); Kriegler, Gene Transfer and Expression: A Laboratory Manual
(1990); and Current Protocols in Molecular Biology (Ausubel et al.,
eds., 1994)). In addition, essentially any nucleic acid can be
custom ordered from any of a variety of commercial sources.
Similarly, peptides and antibodies can be custom ordered from any
of a variety of commercial sources.
[0132] Two alternative methods are typically used to create the
coding sequences required to express newly designed DNA-binding
peptides. One protocol is a PCR-based assembly procedure that
utilizes six overlapping oligonucleotides (see FIG. 1 of co-owned
PCT WO 00/41566). Three oligonucleotides correspond to "universal"
sequences that encode portions of the DNA-binding domain between
the recognition helices. These oligonucleotides remain constant for
all zinc finger constructs. The other three "specific"
oligonucleotides are designed to encode the recognition helices.
These oligonucleotides contain substitutions primarily at positions
-1, 2, 3 and 6 on the recognition helices making them specific for
each of the different DNA-binding domains.
[0133] The PCR synthesis is carried out in two steps. First, a
double stranded DNA template is created by combining the six
oligonucleotides (three universal, three specific) in a four cycle
PCR reaction with a low temperature annealing step, thereby
annealing the oligonucleotides to form a DNA "scaffold." The gaps
in the scaffold are filled in by high-fidelity thermostable
polymerase, the combination of Taq and Pfu polymerases also
suffices. In the second phase of construction, the zinc finger
template is amplified by external primers designed to incorporate
restriction sites at either end for cloning into a shuttle vector
or directly into an expression vector.
[0134] An alternative method of cloning the newly designed
DNA-binding proteins relies on annealing complementary
oligonucleotides encoding the specific regions of the desired zinc
finger protein. This particular application requires that the
oligonucleotides be phosphorylated prior to the final ligation
step. This is usually performed before setting up the annealing
reactions, but kinasing can also occur post-annealing. In brief,
the "universal" oligonucleotides encoding the constant regions of
the proteins are annealed with their complementary
oligonucleotides. Additionally, the "specific" oligonucleotides
encoding the finger recognition helices are annealed with their
respective complementary oligonucleotides. These complementary
oligos are designed to fill in the region which was previously
filled in by polymerase in the protocol described above. The
complementary oligos to the common oligos 1 and finger 3 are
engineered to leave overhanging sequences specific for the
restriction sites used in cloning into the vector of choice. The
second assembly protocol differs from the initial protocol in the
following aspects: the "scaffold" encoding the newly designed zinc
finger protein is composed entirely of synthetic DNA thereby
eliminating the polymerase fill-in step, additionally the fragment
to be cloned into the vector does not require amplification.
Lastly, the design of leaving sequence-specific overhangs
eliminates the need for restriction enzyme digests of the inserting
fragment.
[0135] The resulting fragment encoding the newly designed zinc
finger protein is ligated into an expression vector. Expression
vectors that are commonly utilized include, but are not limited to,
a modified pMAL-c2 bacterial expression vector (New England
BioLabs, "NEB") or a eukaryotic expression vector, pcDNA
(Promega).
[0136] Any suitable method of protein purification known to those
of skill in the art can be used to purify zinc finger proteins (see
Ausubel, supra, Sambrook, supra). In addition, any suitable host
can be used, e.g., bacterial cells, insect cells, yeast cells,
mammalian cells, and the like.
[0137] In one embodiment, expression of the zinc finger protein
fused to a maltose binding protein (MBP-ZFP) in bacterial strain
JM109 allows for straightforward purification through an amylose
column (NEB). High expression levels of the zinc finger chimeric
protein can be obtained by induction with IPTG since the MBP-ZFP
fusion in the pMal-c2 expression plasmid is under the control of
the IPTG inducible tac promoter (NEB). Bacteria containing the
MBP-ZFP fusion plasmids are inoculated in to 2.times. YT medium
containing 10 .mu.M ZnCl.sub.2, 0.02% glucose, plus 50 .mu.g/ml
ampicillin and shaken at 37.degree. C. At mid-exponential growth
IPTG is added to 0.3 mM and the cultures are allowed to shake.
After 3 hours the bacteria are harvested by centrifugation,
disrupted by sonication, and then insoluble material is removed by
centrifugation. The MBP-ZFP proteins are captured on an
amylose-bound resin, washed extensively with buffer containing 20
mM Tris-HCl (pH 7.5), 200 mM NaCl, 5 mM DTT and 50 .mu.M
ZnCl.sub.2, then eluted with maltose in essentially the same buffer
(purification is based on a standard protocol from NEB). Purified
proteins are quantitated and stored for biochemical analysis.
[0138] The biochemical properties of the purified proteins, e.g.,
K.sub.d, can be characterized by any suitable assay. In one
embodiment, K.sub.d is characterized via electrophoretic mobility
shift assays ("EMSA") (Buratowski & Chodosh, in Current
Protocols in Molecular Biology pp. 12.2.1-12.2.7 (Ausubel ed.,
1996); see also U.S. Pat. No. 5,789,538, co-owned PCT WO 00/42219,
herein incorporated by reference). Affinity is measured by
titrating purified protein against a low fixed amount of labeled
double-stranded oligonucleotide target. The target comprises the
natural binding site sequence (9 or 18 bp) flanked by the 3 bp
found in the natural sequence. External to the binding site plus
flanking sequence is a constant sequence. The annealed
oligonucleotide targets possess a 1 bp 5' overhang which allows for
efficient labeling of the target with T4 phage polynucleotide
kinase. For the assay the target is added at a concentration of 40
nM or lower (the actual concentration is kept at least 10-fold
lower than the lowest protein dilution) and the reaction is allowed
to equilibrate for at least 45 min. In addition the reaction
mixture also contains 10 mM Tris (pH 7.5), 100 mM KCl, 1 mM
MgCl.sub.2, 0.1 mM ZnCl.sub.2, 5 mM DTT, 10% glycerol, 0.02% BSA
(poly (dIdC) or (dAdT) (Pharmacia) can also added at 10-100
.mu.g/.mu.l).
[0139] The equilibrated reactions are loaded onto a 10%
polyacrylamide gel, which has been pre-run for 45 min in
Tris/glycine buffer. Bound and unbound labeled target is resolved
with electrophoresis at 150 V (alternatively, 10-20% gradient
Tris-HCl gels, containing a 4% polyacrylamide stacker, can be
used). The dried gels are visualized by autoradiography or
phosphoroimaging and the apparent K.sub.d is determined by
calculating the protein concentration that gives half-maximal
binding.
[0140] Similar assays can also include determining active fractions
in the protein preparations. Active fractions are determined by
stoichiometric gel shifts where proteins are titrated against a
high concentration of target DNA. Titrations are done at 100, 50,
and 25% of target (usually at micromolar levels).
[0141] In another embodiment, phage display libraries can be used
to select zinc finger proteins with high affinity to the selected
target site. This method differs fundamentally from direct design
in that it involves the generation of diverse libraries of
mutagenized zinc finger proteins, followed by the isolation of
proteins with desired DNA-binding properties using affinity
selection methods. To use this method, the experimenter typically
proceeds as follows.
[0142] First, a gene for a zinc finger protein is mutagenized to
introduce diversity into regions important for binding specificity
and/or affinity. In a typical application, this is accomplished via
randomization of a single finger at positions -1, +2, +3, and +6,
and perhaps accessory positions such as +1, +5, +8, or +10.
[0143] Next, the mutagenized gene is cloned into a phage or
phagemid vector as a fusion with, e.g., gene III of filamentous
phage, which encodes the coat protein pIII. The zinc finger gene is
inserted between segments of gene III encoding the membrane export
signal peptide and the remainder of pIII, so that the zinc finger
protein is expressed as an amino-terminal fusion with pIII in the
mature, processed protein. When using phagemid vectors, the
mutagenized zinc finger gene may also be fused to a truncated
version of gene III encoding, minimally, the C-terminal region
required for assembly of pIII into the phage particle.
[0144] The resultant vector library is transformed into E. coli and
used to produce filamentous phage which express variant zinc finger
proteins on their surface as fusions with the coat protein pIII (if
a phagemid vector is used, then the this step requires
superinfection with helper phage). The phage library is then
incubated with target DNA site, and affinity selection methods are
used to isolate phage which bind target with high affinity from
bulk phage. Typically, the DNA target is immobilized on a solid
support, which is then washed under conditions sufficient to remove
all but the tightest binding phage. After washing, any phage
remaining on the support are recovered via elution under conditions
which totally disrupt zinc finger-DNA binding.
[0145] Recovered phage are used to infect fresh E. coli, which is
then amplified and used to produce a new batch of phage particles.
The binding and recovery steps are then repeated as many times as
is necessary to sufficiently enrich the phage pool for tight
binders such that these may be identified using sequencing and/or
screening methods.
[0146] Functional Domains
[0147] A DNA-binding domain (e.g., a zinc finger domain) can
optionally be associated with one or more regulatory domains for
modulation of gene expression. The zinc finger protein can be
covalently or non-covalently associated with one or more regulatory
domains, alternatively two or more regulatory domains, with the two
or more domains being two copies of the same domain, or two
different domains. The regulatory domains can be covalently linked
to the zinc finger protein, e.g., via an amino acid linker, as part
of a fusion protein. The zinc finger proteins can also be
associated with a regulatory domain via a non-covalent dimerization
domain, e.g., a leucine zipper, a STAT protein N terminal domain,
or an FK506 binding protein (see, e.g., O'Shea, Science 254: 539
(1991), Barahmand-Pour et al., Curr. Top. Microbiol. Immunol.
211:121-128 (1996); Klemm et al., Annu. Rev. Immunol. 16:569-592
(1998); Klemm et al., Annu. Rev. Immunol. 16:569-592 (1998); Ho et
al., Nature 382:822-826 (1996); and Pomeranz et al., Biochem.
37:965 (1998)). The regulatory domain can be associated with the
zinc finger protein at any suitable position, including the C- or
N-terminus of the zinc finger protein.
[0148] Common regulatory domains for addition to the zinc finger
protein include, e.g., effector domains from transcription factors
(activators, repressors, co-activators, co-repressors), silencers,
nuclear hormone receptors, oncogene transcription factors (e.g.,
myc, jun, fos, myb, max, mad, rel, ets, bcl, myb, mos family
members etc.); DNA repair enzymes and their associated factors and
modifiers; DNA rearrangement enzymes and their associated factors
and modifiers; chromatin associated proteins and their modifiers
(e.g., kinases, acetylases and deacetylases); and DNA modifying
enzymes (e.g., methyltransferases, topoisomerases, helicases,
ligases, kinases, phosphatases, polymerases, endonucleases) and
their associated factors and modifiers.
[0149] Transcription factor polypeptides from which one can obtain
a regulatory domain include those that are involved in regulated
and basal transcription. Such polypeptides include transcription
factors, their effector domains, coactivators, silencers, nuclear
hormone receptors (see, e.g., Goodrich et al., Cell 84:825-30
(1996) for a review of proteins and nucleic acid elements involved
in transcription; transcription factors in general are reviewed in
Barnes & Adcock, Clin. Exp. Allergy 25 Suppl. 2:46-9 (1995) and
Roeder, Methods Enzymol. 273:165-71 (1996)). Databases dedicated to
transcription factors are known (see, e.g., Science 269:630
(1995)). Nuclear hormone receptor transcription factors are
described in, for example, Rosen et al., J. Med. Chem. 38:4855-74
(1995). The C/EBP family of transcription factors are reviewed in
Wedel et al., Immunobiology 193:171-85 (1995). Coactivators and
co-repressors that mediate transcription regulation by nuclear
hormone receptors are reviewed in, for example, Meier, Eur. J.
Endocrinol. 134(2):158-9 (1996); Kaiser et al., Trends Biochem.
Sci. 21:342-5 (1996); and Utley et al., Nature 394:498-502 (1998)).
GATA transcription factors, which are involved in regulation of
hematopoiesis, are described in, for example, Simon, Nat. Genet.
11:9-11 (1995); Weiss et al., Exp. Hematol. 23:99-107. TATA box
binding protein (TBP) and its associated TAF polypeptides (which
include TAF30, TAF55, TAF80, TAF110, TAF150, and TAF250) are
described in Goodrich & Tjian, Curr. Opin. Cell Biol. 6:403-9
(1994) and Hurley, Curr. Opin. Struct. Biol. 6:69-75 (1996). The
STAT family of transcription factors are reviewed in, for example,
Barahmand-Pour et al., Curr. Top. Microbiol. Immunol. 211:121-8
(1996). Transcription factors involved in disease are reviewed in
Aso et al., J. Clin. Invest. 97:1561-9 (1996).
[0150] In one embodiment, the KRAB repression domain from the human
KOX-1 protein is used as a transcriptional repressor (Thiesen et
al., New Biologist 2:363-374 (1990); Margolin et al., Proc. Natl.
Acad. Sci. U.S.A. 91:4509-4513 (1994); Pengue et al., Nucl. Acids
Res. 22:2908-2914 (1994); Witzgall et al., Proc. Natl. Acad. Sci.
U.S.A. 91:4514-4518 (1994)). In another embodiment, KAP-1, a KRAB
co-repressor, is used with KRAB (Friedman et al., Genes Dev.
10:2067-2078 (1996)). Alternatively, KAP-1 can be used alone with a
zinc finger protein. Other preferred transcription factors and
transcription factor domains that act as transcriptional repressors
include MAD (see, e.g., Sommer et al., J. Biol. Chem. 273:6632-6642
(1998); Gupta et al., Oncogene 16:1149-1159 (1998); Queva et al.,
Oncogene 16:967-977 (1998); Larsson et al., Oncogene 15:737-748
(1997); Laherty et al., Cell 89:349-356 (1997); and Cultraro et
al., Mol Cell. Biol. 17:2353-2359 (19977)); FKHR (forkhead in
rhapdosarcoma gene; Ginsberg et al., Cancer Res. 15:3542-3546
(1998); Epstein et al., Mol. Cell. Biol. 18:4118-4130 (1998));
EGR-1 (early growth response gene product-1; Yan et al., Proc.
Natl. Acad. Sci. U.S.A. 95:8298-8303 (1998); and Liu et al., Cancer
Gene Ther. 5:3-28 (1998)); the ets2 repressor factor repressor
domain (ERD; Sgouras et al., EMBO J. 14:4781-4793 (1995)); and the
MAD smSIN3 interaction domain (SID; Ayer et al., Mol. Cell. Biol.
16:5772-5781 (1996)).
[0151] In one embodiment, the HSV VP16 activation domain is used as
a transcriptional activator (see, e.g., Hagmann et al., J. Virol.
71:5952-5962 (1997)). Other preferred transcription factors that
could supply activation domains include the VP64 activation domain
(Seipel et al., EMBO J. 11:4961-4968 (1996)); nuclear hormone
receptors (see, e.g., Torchia et al., Curr. Opin. Cell. Biol.
10:373-383 (1998)); the p65 subunit of nuclear factor kappa B
(Bitko & Barik, J. Virol. 72:5610-5618 (1998) and Doyle &
Hunt, Neuroreport 8:2937-2942 (1997)); and EGR-1 (early growth
response gene product-1; Yan et al., Proc. Natl. Acad. Sci. U.S.A.
95:8298-8303 (1998); and Liu et al., Cancer Gene Ther. 5:3-28
(1998)).
[0152] Kinases, phosphatases, and other proteins that modify
polypeptides involved in gene regulation are also useful as
regulatory domains for zinc finger proteins. Such modifiers are
often involved in switching on or off transcription mediated by,
for example, hormones. Kinases involved in transcription regulation
are reviewed in Davis, Mol. Reprod. Dev. 42:459-67 (1995), Jackson
et al., Adv. Second Messenger Phosphoprotein Res. 28:279-86 (1993),
and Boulikas, Crit. Rev. Eukaryot. Gene Expr. 5:1-77 (1995), while
phosphatases are reviewed in, for example, Schonthal & Semin,
Cancer Biol. 6:239-48 (1995). Nuclear tyrosine kinases are
described in Wang, Trends Biochem. Sci. 19:373-6 (1994).
[0153] As described, useful domains can also be obtained from the
gene products of oncogenes (e.g., myc, jun, fos, myb, max, mad,
rel, ets, bcl, myb, mos family members) and their associated
factors and modifiers. Oncogenes are described in, for example,
Cooper, Oncogenes, The Jones and Bartlett Series in Biology
(2.sup.nd ed., 1995). The ets transcription factors are reviewed in
Waslylk et al., Eur. J. Biochem. 211:7-18 (1993) and Crepieux et
al., Crit. Rev. Oncog. 5:615-38 (1994). Myc oncogenes are reviewed
in, for example, Ryan et al., Biochem. J. 314:713-21 (1996). The
jun and fos transcription factors are described in, for example,
The Fos and Jun Families of Transcription Factors (Angel &
Herrlich, eds. 1994). The max oncogene is reviewed in Hurlin et
al., Cold Spring Harb. Symp. Quant. Biol. 59:109-16. The myb gene
family is reviewed in Kanei-Ishii et al., Curr. Top. Microbiol.
Immunol. 211:89-98 (1996). The mos family is reviewed in Yew et
al., Curr. Opin. Genet. Dev. 3:19-25 (1993).
[0154] Zinc finger proteins can include regulatory domains obtained
from DNA repair enzymes and their associated factors and modifiers.
DNA repair systems are reviewed in, for example, Vos, Curr. Opin.
Cell Biol. 4:385-95 (1992); Sancar, Ann. Rev. Genet. 29:69-105
(1995); Lehmann, Genet. Eng. 17:1-19(1995); and Wood, Ann. Rev.
Biochem. 65:135-67 (1996). DNA rearrangement enzymes and their
associated factors and modifiers can also be used as regulatory
domains (see, e.g., Gangloff et al., Experientia 50:261-9 (1994);
Sadowski, FASEB J. 7:760-7 (1993)).
[0155] Similarly, regulatory domains can be derived from DNA
modifying enzymes (e.g., DNA methyltransferases, topoisomerases,
helicases, ligases, kinases, phosphatases, polymerases) and their
associated factors and modifiers. Helicases are reviewed in Matson
et al., Bioessays, 16:13-22 (1994), and methyltransferases are
described in Cheng, Curr. Opin. Struct. Biol. 5:4-10 (1995).
Chromatin associated proteins and their modifiers (e.g., kinases,
acetylases and deacetylases), such as histone deacetylase (Wolffe,
Science 272:371-2 (1996)) are also useful as domains for addition
to the zinc finger protein of choice. In one preferred embodiment,
the regulatory domain is a DNA methyl transferase that acts as a
transcriptional repressor (see, e.g., Van den Wyngaert et al., FEBS
Lett. 426:283-289 (1998); Flynn et al., J. Mol. Biol. 279:101-116
(1998); Okano et al., Nucleic Acids Res. 26:2536-2540 (1998); and
Zardo & Caiafa, J. Biol. Chem. 273:16517-16520 (1998)). In
another preferred embodiment, endonucleases such as Fok1 are used
as transcriptional repressors, which act via gene cleavage (see,
e.g., WO95/09233; and PCT/US94/01201).
[0156] Factors that control chromatin and DNA structure, movement
and localization and their associated factors and modifiers;
factors derived from microbes (e.g., prokaryotes, eukaryotes and
virus) and factors that associate with or modify them can also be
used to obtain chimeric proteins. In one embodiment, recombinases
and integrases are used as regulatory domains. In one embodiment,
histone acetyltransferase is used as a transcriptional activator
(see, e.g., Jin & Scotto, Mol. Cell. Biol. 18:4377-4384 (1998);
Wolffe, Science 272:371-372 (1996); Taunton et al., Science
272:408-411 (1996); and Hassig et al., Proc. Natl. Acad. Sci.
U.S.A. 95:3519-3524 (1998)). In another embodiment, histone
deacetylase is used as a transcriptional repressor (see, e.g., Jin
& Scotto, Mol. Cell. Biol. 18:4377-4384 (1998); Syntichaki
& Thireos, J. Biol. Chem. 273:24414-24419 (1998); Sakaguchi et
al., Genes Dev. 12:2831-2841 (1998); and Martinez et al., J. Biol.
Chem. 273:23781-23785 (1998)).
[0157] Another suitable repression domain is methyl binding domain
protein 2B (MBD-2B) (see, also Hendrich et al. (1999) Mamm Genome
10:906-912 for description of MBD proteins). Another useful
repression domain is that associated with the v-ErbA protein (see
infra). See, for example, Damm, et al. (1989) Nature 339:593-597;
Evans (1989) Int. J. Cancer Suppl. 4:26-28; Pain et al. (1990) New
Biol. 2:284-294; Sap et al. (1989) Nature 340:242-244; Zenke et al.
(1988) Cell 52:107-119; and Zenke et al. (1990) Cell 61:1035-1049.
Additional exemplary repression domains include, but are not
limited to, thyroid hormone receptor (TR, see infra), SID, MBD1,
MBD2, MBD3, MBD4, MBD-like proteins, members of the DNMT family
(e.g., DNMT1, DNMT3A, DNMT3B), Rb, MeCP1 and MeCP2. See, for
example, Bird et al. (1999) Cell 99:451-454; Tyler et al. (1999)
Cell 99:443-446; Knoepfler et al. (1999) Cell 99:447-450; and
Robertson et al. (2000) Nature Genet. 25:338-342. Additional
exemplary repression domains include, but are not limited to, ROM2
and AtHD2A. See, for example, Chern et al. (1996) Plant Cell
8:305-321; and Wu et al. (2000) Plant J. 22:19-27.
[0158] Certain members of the nuclear hormone receptor (NHR)
superfamily, including, for example, thyroid hormone receptors
(TRs) and retinoic acid receptors (RARs) are among the most potent
transcriptional regulators currently known. Zhang et al., Annu.
Rev. Physiol. 62:439-466 (2000) and Sucov et al., Mol Neurobiol
10(2-3):169-184 (1995). In the absence of their cognate ligand,
these proteins bind with high specificity and affinity to short
stretches of DNA (e.g., 12-17 base pairs) within regulatory loci
(e.g., enhancers and promoters) and effect robust transcriptional
repression of adjacent genes. The potency of their regulatory
action stems from the concurrent use of two distinct functional
pathways to drive gene silencing: (i) the creation of a localized
domain of repressive chromatin via the targeting of a complex
between the corepressor N-CoR and a histone deacetylase, HDAC3
(Guenther et al., Genes Dev 14:1048-1057 (2000); Urnov et al., EMBO
J. 19:4074-4090 (2000); Li et al., EMBO J. 19, 4342-4350 (2000) and
Underhill et al., J. Biol. Chem. 275:40463-40470 (2000)) and (ii) a
chromatin-independent pathway (Urnov et al., supra) that may
involve direct interference with the function of the basal
transcription machinery (Fondell et al., Genes Dev 7(7B): 1400-1410
(1993) and Fondell et al., Mol Cell Biol 16:281-287 (1996).
[0159] In the presence of very low (e.g., nanomolar) concentrations
of their ligand, these receptors undergo a conformational change
which leads to the release of corepressors, recruitment of a
different class of auxiliary molecules (e.g., coactivators) and
potent transcriptional activation. Collingwood et al., J. Mol.
Endocrinol. 23(3):255-275 (1999).
[0160] The portion of the receptor protein responsible for
transcriptional control (e.g., repression and activation) can be
physically separated from the portion responsible for DNA binding,
and retains full functionality when tethered to other polypeptides,
for example, other DNA-binding domains. Accordingly, a nuclear
hormone receptor transcription control domain can be fused to a ZFP
DNA-binding domain such that the transcriptional regulatory
activity of the receptor can be targeted to a chromosomal region of
interest (e.g., a gene) by virtue of the ZFP binding domain.
[0161] Moreover, the structure of TR and other nuclear hormone
receptors can be altered, either naturally or through recombinant
techniques, such that it loses all capacity to respond to hormone
(thus losing its ability to drive transcriptional activation), but
retains the ability to effect transcriptional repression. This
approach is exemplified by the transcriptional regulatory
properties of the oncoprotein v-ErbA. The v-ErbA protein is one of
the two proteins required for leukemic transformation of immature
red blood cell precursors in young chicks by the avian
erythroblastosis virus. TR is a major regulator of erythropoiesis
(Beug et al., Biochim Biophys Acta 1288(3):M3547 (1996); in
particular, in its unliganded state, it represses genes required
for cell cycle arrest and the differentiated state. Thus, the
administration of thyroid hormone to immature erythroblasts leads
to their rapid differentiation. The v-ErbA oncoprotein is an
extensively mutated version of TR; these mutations include: (i)
deletion of 12 amino-terminal amino acids; (ii) fusion to the gag
oncoprotein; (iii) several point mutations in the DNA binding
domain that alter the DNA binding specificity of the protein
relative to its parent, TR, and impair its ability to
heterodimerize with the retinoid X receptor; (iv) multiple point
mutations in the ligand-binding domain of the protein that
effectively eliminate the capacity to bind thyroid hormone; and (v)
a deletion of a carboxy-terminal stretch of amino acids that is
essential for transcriptional activation. Stunnenberg et al.,
Biochim Biophys Acta 1423(1):F15-33 (1999). As a consequence of
these mutations, v-ErbA retains the capacity to bind to naturally
occurring TR target genes and is an effective transcriptional
repressor when bound (Urnov et al., supra; Sap et al., Nature
340:242-244 (1989); and Ciana et al., EMBO J. 17(24):7382-7394
(1999). In contrast to TR, however, v-ErbA is completely
insensitive to thyroid hormone, and thus maintains transcriptional
repression in the face of a challenge from any concentration of
thyroids or retinoids, whether endogenous to the medium, or added
by the investigator (4).
[0162] We have shown that this functional property of v-ErbA is
retained when its repression domain is fused to a heterologous,
synthetic DNA binding domain. Accordingly, in one aspect, v-ErbA or
its functional fragments are used as a repression domain. In
additional embodiments, TR or its functional domains are used as a
repression domain in the absence of ligand and/or as an activation
domain in the presence of ligand (e.g., 3,5,3'-triiodo-L-thyronine
or T3). Thus, TR can be used as a switchable functional domain
(i.e., a bifunctional domain); its activity (activation or
repression) being dependent upon the presence or absence
(respectively) of ligand.
[0163] Additional exemplary repression domains are obtained from
the DAX protein and its functional fragments. Zazopoulos et al.,
Nature 390:311-315 (1997). In particular, the C-terminal portion of
DAX-1, including amino acids 245-470, has been shown to possess
repression activity. Altincicek et al., J. Biol. Chem.
275:7662-7667 (2000). A further exemplary repression domain is the
RBP1 protein and its functional fragments. Lai et al., Oncogene
18:2091-2100 (1999); Lai et al., Mol. Cell. Biol. 19:6632-6641
(1999); Lai et al., Mol. Cell. Biol. 21:2918-2932 (2001) and WO
01/04296. The full-length RBP1 polypeptide contains 1257 amino
acids. Exemplary functional fragments of RBP1 are a polypeptide
comprising amino acids 1114-1257, and a polypeptide comprising
amino acids 243-452.
[0164] Members of the TIEG family of transcription factors contain
three repression domains known as R1, R2 and R3. Repression by TIEG
family proteins is achieved at least in part through recruitment of
mSIN3A histone deacetylases complexes. Cook et al. (1999) J. Biol.
Chem. 274:29,500-29,504; Zhang et al. (2001) Mol. Cell. Biol.
21:5041-5049. Any or all of these repression domains (or their
functional fragments) can be fused alone, or in combination with
additional repression domains (or their functional fragments), to a
DNA-binding domain to generate a targeted exogenous repressor
molecule.
[0165] Furthermore, the product of the human cytomegalovirus (HCMV)
UL34 open reading frame acts as a transcriptional repressor of
certain HCMV genes, for example, the US3 gene. LaPierre et al.
(2001) J. Virol. 75:6062-6069. Accordingly, the UL34 gene product,
or functional fragments thereof, can be used as a component of a
fusion polypeptide also comprising a zinc finger binding domain.
Nucleic acids encoding such fusions are also useful in the methods
and compositions disclosed herein.
[0166] Yet another exemplary repression domain is the CDF-1
transcription factor and/or its functional fragments. See, for
example, WO 99/27092.
[0167] The Ikaros family of proteins are involved in the regulation
of lymphocyte development, at least in part by transcriptional
repression. Accordingly, an Ikaros family member (e.g., Ikaros,
Aiolos) or a functional fragment thereof, can be used as a
repression domain. See, for example, Sabbattini et al. (2001) EMBO
J. 20:2812-2822.
[0168] The yeast Ash1p protein comprises a transcriptional
repression domain. Maxon et al. (2001) Proc. Natl. Acad. Sci. USA
98:1495-1500. Accordingly, the Ash1p protein, its functional
fragments, and homologues of Ash1p, such as those found, for
example, in, vertebrate, mammalian, and plant cells, can serve as a
repression domain for use in the methods and compositions disclosed
herein.
[0169] Additional exemplary repression domains include those
derived from histone deacetylases (HDACs, e.g., Class I HDACs,
Class II HDACs, SIR-2 homologues), HDAC-interacting proteins (e.g.,
SIN3, SAP30, SAP15, NCoR, SMRT, RB, p107, p130, RBAP46/48, MTA,
Mi-2, Brg1, Brm), DNA-cytosine methyltransferases (e.g., Dnmt1,
Dnmt3a, Dnmt3b), proteins that bind methylated DNA (e.g., MBD1,
MBD2, MBD3, MBD4, MeCP2, DMAP1), protein methyltransferases (e.g.,
lysine and arginine methylases, SuVar homologues such as Suv39H1),
polycomb-type repressors (e.g., Bmi-1, eed1, RING1, RYBP, E2F6,
Mel18, YY1 and CtBP), viral repressors (e.g., adenovirus Elb 55K
protein, cytomegalovirus UL34 protein, viral oncogenes such as
v-erbA), hormone receptors (e.g., Dax-1, estrogen receptor, thyroid
hormone receptor), and repression domains associated with
naturally-occurring zinc finger proteins (e.g., WT1, KAP1). Further
exemplary repression domains include members of the pplycomb
complex and their homologues, HPH1, HPH2, HPC2, NC2, groucho, Eve,
tramtrak, mHP1, SIP1, ZEB1, ZEB2, and Enx1/Ezh2. In all of these
cases, either the full-length protein or a functional fragment can
be used as a repression domain for fusion to a zinc finger binding
domain. Furthermore, any homologues of the aforementioned proteins
can also be used as repression domains, as can proteins (or their
functional fragments) that interact with any of the aforementioned
proteins.
[0170] Additional repression domains, and exemplary functional
fragments, are as follows. Hes1 is a human homologue of the
Drosophila hairy gene product and comprises a functional fragment
encompassing amino acids 910-1014. In particular, a WRPW
(trp-arg-pro-trp) motif can act as a repression domain. Fisher et
al. (1996) Mol. Cell. Biol. 16:2670-2677.
[0171] The TLE1, TLE2 and TLE3 proteins are human homologues of the
Drosophila groucho gene product. Functional fragments of these
proteins possessing repression activity reside between amino acids
1-400. Fisher et al., supra.
[0172] The Tbx3 protein possesses a functional repression domain
between amino acids 524-721. He et al. (1999) Proc. Natl. Acad.
Sci. USA 96:10,212-10,217. The Tbx2 gene product is involved in
repression of the p14/p16 genes and contains a region between amino
acids 504-702 that is homologous to the repression domain of Tbx3;
accordingly Tbx2 and/or this functional fragment can be used as a
repression domain. Carreira et al. (1998) Mol. Cell. Biol.
18:5,099-5,108.
[0173] The human Ezh2 protein is a homologue of Drosophila enhancer
of zeste and recruits the eed1 polycomb-type repressor. A region of
the Ezh2 protein comprising amino acids 1-193 can interact with
eed1 and repress transcription; accordingly Ezh2 and/or this
functional fragment can be used as a repression domain. Denisenko
et al. (1998) Mol. Cell. Biol. 18:5634-5642.
[0174] The RYBP protein is a corepressor that interacts with
polycomb complex members and with the YY1 transcription factor. A
region of RYBP comprising amino acids 42-208 has been identified as
functional repression domain. Garcia et al. (1999) EMBO J.
18:3404-3418.
[0175] The RING finger protein RING1A is a member of two different
vertebrate polycomb-type complexes, contains multiple binding sites
for various components of the polycomb complex, and possesses
transcriptional repression activity. Accordingly, RING1A or its
functional fragments can serve as a repression domain. Satjin et
al. (1997) Mol. Cell. Biol. 17:4105-4113.
[0176] The Bmi-1 protein is a member of a vertebrate polycomb
complex and is involved in transcriptional silencing. It contains
multiple binding sites for various polycomb complex components.
Accordingly, Bmi-1 and its functional fragments are useful as
repression domains. Gunster et al. (1997) Mol. Cell. Biol.
17:2326-2335; Hemenway et al. (1998) Oncogene 16:2541-2547.
[0177] The E2F6 protein is a member of the mammalian
Bmi-1-containing polycomb complex and is a transcriptional
repressor that is capable or recruiting RYBP, Bmi-1 and RING1A. A
functional fragment of E2F6 comprising amino acids 129-281 acts as
a transcriptional repression domain. Accordingly, E2F6 and its
functional fragments can be used as repression domains. Trimarchi
et al. (2001) Proc Natl. Acad. Sci. USA 98:1519-1524.
[0178] The eed1 protein represses transcription at least in part
through recruitment of histone deacetylases (e.g., HDAC2).
Repression activity resides in both the N- and C-terminal regions
of the protein. Accordingly, eed1 and its functional fragments can
be used as repression domains. van der Vlag et al. (1999) Nature
Genet. 23:474-478.
[0179] The CTBP2 protein represses transcription at least in part
through recruitment of an HPC2-polycomb complex. Accordingly, CTBP2
and its functional fragments are useful as repression domains.
Richard et al. (1999) Mol. Cell. Biol. 19:777-787.
[0180] Neuron-restrictive silencer factors are proteins that
repress expression of neuron-specific genes. Accordingly, a NRSF or
functional fragment thereof can serve as a repression domain. See,
for example, U.S. Pat. No. 6,270,990.
[0181] It will be clear to those of skill in the art that, in the
formation of a fusion protein (or a nucleic acid encoding same)
between a zinc finger binding domain and a functional domain,
either a repressor or a molecule that interacts with a repressor is
suitable as a functional domain. Essentially any molecule capable
of recruiting a repressive complex and/or repressive activity (such
as, for example, histone deacetylation) to the target gene is
useful as a repression domain of a fusion protein.
[0182] Additional exemplary activation domains include, but are not
limited to, p300, CBP, PCAF, SRC1 PvALF, AtHD2A and ERF-2. See, for
example, Robyr et al. (2000) Mol. Endocrinol. 14:329-347;
Collingwood et al. (1999) J. Mol. Endocrinol. 23:255-275; Leo et
al. (2000) Gene 245:1-11; Manteuffel-Cymborowska (1999) Acta
Biochim. Pol. 46:77-89; McKenna et al. (1999) J. Steroid Biochem.
Mol. Biol. 69:3-12; Malik et al. (2000) Trends Biochem. Sci.
25:277-283; and Lemon et al. (1999) Curr. Opin. Genet. Dev.
9:499-504. Additional exemplary activation domains include, but are
not limited to, OsGAI, HALF-1, C1, AP1, ARF-5, -6, -7, and -8,
CPRF1, CPRF4, MYC-RP/GP, and TRAB1. See, for example, Ogawa et al.
(2000) Gene 245:21-29; Okanami et al. (1996) Genes Cells 1:87-99;
Goff et al. (1991) Genes Dev. 5:298-309; Cho et al. (1999) Plant
Mol. Biol. 40:419-429; Ulmason et al. (1999) Proc. Natl. Acad. Sci.
USA 96:5844-5849; Sprenger-Haussels et al. (2000) Plant J. 22:1-8;
Gong et al. (1999) Plant Mol. Biol. 41:33-44; and Hobo et al.
(1999) Proc. Natl. Acad. Sci. USA 96:15,348-15,353.
[0183] It will be clear to those of skill in the art that, in the
formation of a fusion protein (or a nucleic acid encoding same)
between a zinc finger binding domain and a functional domain,
either an activator or a molecule that interacts with an activator
is suitable as a functional domain. Essentially any molecule
capable of recruiting an activating complex and/or activating
activity (such as, for example, histone acetylation) to the target
gene is useful as an activating domain of a fusion protein.
[0184] Insulator domains, chromatin remodeling proteins such as
ISWI-containing domains and/or methyl binding domain proteins
suitable for use as functional domains in fusion molecules are
described, for example, in co-owned PCT application US01/40616 and
co-owned U.S. Patent applications 60/236,409; 60/236,884; and
60/253,678.
[0185] In a further embodiment, a DNA-binding domain (e.g., a zinc
finger domain) is fused to a bifunctional domain (BFD). A
bifunctional domain is a transcriptional regulatory domain whose
activity depends upon interaction of the BFD with a second
molecule. The second molecule can be any type of molecule capable
of influencing the functional properties of the BFD including, but
not limited to, a compound, a small molecule, a peptide, a protein,
a polysaccharide or a nucleic acid. An exemplary BFD is the ligand
binding domain of the estrogen receptor (ER). In the presence of
estradiol, the ER ligand binding domain acts as a transcriptional
activator; while, in the absence of estradiol and the presence of
tamoxifen or 4-hydroxy-tamoxifen, it acts as a transcriptional
repressor. Another example of a BFD is the thyroid hormone receptor
(TR) ligand binding domain which, in the absence of ligand, acts as
a transcriptional repressor and in the presence of thyroid hormone
(T3), acts as a transcriptional activator. An additional BFD is the
glucocorticoid receptor (GR) ligand binding domain. In the presence
of dexamethasone, this domain acts as a transcriptional activator;
while, in the presence of RU486, it acts as a transcriptional
repressor. An additional exemplary BFD is the ligand binding domain
of the retinoic acid receptor. In the presence of its ligand
all-trans-retinoic acid, the retinoic acid receptor recruits a
number of co-activator complexes and activates transcription. In
the absence of ligand, the retinoic acid receptor is not capable of
recruiting transcriptional co-activators. Additional BFDs are known
to those of skill in the art. See, for example, U.S. Pat. Nos.
5,834,266 and 5,994,313 and PCT WO 99/10508.
[0186] Examples of the ability of various functional domains to
regulate gene expression are provided in co-owned patent
application entitled "Modulation of Endogenous Gene Expression in
Cells," reference S2-US5, filed even date herewith, the disclosure
of which is hereby incorporated by reference in its entirety.
[0187] Linker domains between polypeptide domains, e.g., between
two zinc finger proteins or between a zinc finger protein and a
regulatory domain, can be included. Such linkers are typically
polypeptide sequences, such as poly gly sequences of between about
5 and 200 amino acids. Preferred linkers are typically flexible
amino acid subsequences which are synthesized as part of a
recombinant fusion protein. For example, in one embodiment, the
linker DGGGS (SEQ ID NO: 4) is used to link two zinc finger
proteins. In another embodiment, the flexible linker linking two
zinc finger proteins is an amino acid subsequence comprising the
sequence TGEKP (SEQ ID NO: 5) (see, e.g., Liu et al., Proc. Natl.
Acad. Sci. U.S.A. 5525-5530 (1997)). In another embodiment, the
linker LRQKDGERP (SEQ ID NO: 6) is used to link two zinc finger
proteins. In another embodiment, the following linkers are used to
link two zinc finger proteins: GGRR (SEQ ID NO: 7) (Pomerantz et
al. 1995, supra), (G.sub.4S).sub.n (SEQ ID NO: 8) (Kim et al.,
Proc. Natl. Acad. Sci. U.S.A. 93, 1156-1160 (1996.); and GGRRGGGS
(SEQ ID NO: 9); LRQRDGERP (SEQ ID NO: 10); LRQKDGGGSERP (SEQ ID NO:
11); LRQKD(G.sub.3S).sub.2ERP (SEQ ID NO: 12). Alternatively,
flexible linkers can be rationally designed using computer program
capable of modeling both DNA-binding sites and the peptides
themselves (Desjarlais & Berg, Proc. Natl. Acad. Sci. U.S.A.
90:2256-2260 (1993), Proc. Natl. Acad. Sci. U.S.A. 91:11099-11103
(1994) or by phage display methods.
[0188] In other embodiments, a chemical linker is used to connect
synthetically or recombinantly produced domain sequences. Such
flexible linkers are known to persons of skill in the art. For
example, poly(ethylene glycol) linkers are available from
Shearwater Polymers, Inc. Huntsville, Ala. These linkers optionally
have amide linkages, sulfhydryl linkages, or heterofunctional
linkages. In addition to covalent linkage of zinc finger proteins
to regulatory domains, non-covalent methods can be used to produce
molecules with zinc finger proteins associated with regulatory
domains.
[0189] In addition to regulatory domains, often the zinc finger
protein is expressed as a fusion protein such as maltose binding
protein ("MBP"), glutathione S transferase (GST), hexahistidine,
c-myc, and the FLAG epitope, for ease of purification, monitoring
expression, or monitoring cellular and subcellular
localization.
[0190] Subcloning and Expression of Nucleic Acids Encoding Zinc
Finger Protein
[0191] The nucleic acid encoding the zinc finger protein of choice
is typically cloned into vectors for transformation into
prokaryotic or eukaryotic cells for replication, expression, e.g.,
for determination of K.sub.d. Such vectors are typically prokaryote
vectors, e.g., plasmids, or shuttle vectors, or eukaryotic vectors
such insect vectors, for storage or manipulation of the nucleic
acid encoding zinc finger protein or production of protein, or
eukaryotic vector such as viral vectors (e.g., adenoviral vectors,
retroviral vector, etc.) for expression of zinc finger proteins and
optionally regulation of gene expression. The nucleic acid encoding
a zinc finger protein can then be administered to a plant cell,
animal cell, a mammalian cell or a human cell, a fungal cell, a
bacterial cell, or a protozoal cell.
[0192] To obtain expression of a cloned gene or nucleic acid, a
zinc finger protein is typically subcloned into an expression
vector that contains a promoter to direct transcription. Suitable
bacterial and eukaryotic promoters are well known in the art and
described, e.g., in Sambrook et al., Molecular Cloning, A
Laboratory Manual (2nd ed. 1989); Kriegler, Gene Transfer and
Expression: A Laboratory Manual (1990); and Current Protocols in
Molecular Biology (Ausubel et al., eds., 1994). Bacterial
expression systems for expressing the zinc finger protein are
available in, e.g., E. coli, Bacillus sp., and Salmonella (Palva et
al., Gene 22:229-235 (1983)). Kits for such expression systems are
commercially available. Eukaryotic expression systems for mammalian
cells, yeast, and insect cells are well known in the art and are
also commercially available.
[0193] The promoter used to direct expression of a zinc finger
protein nucleic acid depends on the particular application. For
example, a strong constitutive promoter is typically used for
expression and purification of zinc finger protein. In contrast,
when a zinc finger protein is administered in vivo for gene
regulation, either a constitutive or an inducible promoter is used,
depending on the particular use of the zinc finger protein. The
promoter typically can also include elements that are responsive to
transactivation, e.g., hypoxia response elements, Gal4 response
elements, lac repressor response element, and small molecule
control systems such as tet-regulated systems and the RU-486 system
(see, e.g., Gossen & Bujard, Proc. Natl. Acad. Sci. U.S.A.
89:5547 (1992); Oligino et al., Gene Ther. 5:491-496 (1998); Wang
et al., Gene Ther. 4:432-441 (1997); Neering et al., Blood
88:1147-1155 (1996); and Rendahl et al., Nat. Biotechnol.
16:757-761 (1998)).
[0194] In addition to the promoter, the expression vector typically
contains a transcription unit or expression cassette that contains
all the additional elements required for the expression of the
nucleic acid in host cells, either prokaryotic or eukaryotic. A
typical expression cassette thus contains a promoter operably
linked, e.g., to the nucleic acid sequence encoding the zinc finger
protein, and signals required, e.g., for efficient polyadenylation
of the transcript, transcriptional termination, ribosome binding
sites, or translation termination. Additional elements of the
cassette may include, e.g., enhancers, and heterologous spliced
intronic signals.
[0195] The particular expression vector used to transport the
genetic information into the cell is selected with regard to the
intended use of the zinc finger protein, e.g., expression in
plants, animals, bacteria, fungus, protozoa etc. (see expression
vectors described below and in the Example section). Standard
bacterial expression vectors include plasmids such as pBR322 based
plasmids, pSKF, pET23D, and commercially available fusion
expression systems such as GST and LacZ. A preferred fusion protein
is the maltose binding protein, "MBP." Such fusion proteins are
used for purification of the zinc finger protein. Epitope tags can
also be added to recombinant proteins to provide convenient methods
of isolation, for monitoring expression, and for monitoring
cellular and subcellular localization, e.g., c-myc or FLAG.
[0196] Expression vectors containing regulatory elements from
eukaryotic viruses are often used in eukaryotic expression vectors,
e.g., SV40 vectors, papilloma virus vectors, and vectors derived
from Epstein-Barr virus. Other exemplary eukaryotic vectors include
pMSG, pAV009/A+, pMTO1O/A+, pMAMneo-5, baculovirus pDSVE, and any
other vector allowing expression of proteins under the direction of
the SV40 early promoter, SV40 late promoter, CMV promoter,
metallothionein promoter, murine mammary tumor virus promoter, Rous
sarcoma virus promoter, polyhedrin promoter, or other promoters
shown effective for expression in eukaryotic cells.
[0197] Some expression systems have markers for selection of stably
transfected cell lines such as neomycin, thymidine kinase,
hygromycin B phosphotransferase, and dihydrofolate reductase. High
yield expression systems are also suitable, such as using a
baculovirus vector in insect cells, with a zinc finger protein
encoding sequence under the direction of the polyhedrin promoter or
other strong baculovirus promoters.
[0198] The elements that are typically included in expression
vectors also include a replicon that functions in E. coli, a gene
encoding antibiotic resistance to permit selection of bacteria that
harbor recombinant plasmids, and unique restriction sites in
nonessential regions of the plasmid to allow insertion of
recombinant sequences.
[0199] Standard transfection methods are used to produce bacterial,
mammalian, yeast or insect cell lines that express large quantities
of protein, which are then purified using standard techniques (see,
e.g., Colley et al., J. Biol. Chem. 264:17619-17622 (1989); Guide
to Protein Purification, in Methods in Enzymology, vol. 182
(Deutscher, ed., 1990)). Transformation of eukaryotic and
prokaryotic cells are performed according to standard techniques
(see, e.g., Morrison, J. Bact. 132:349-351 (1977); Clark-Curtiss
& Curtiss, Methods in Enzymology 101:347-362 (Wu et al., eds,
1983).
[0200] Any of the well known procedures for introducing foreign
nucleotide sequences into host cells may be used. These include the
use of calcium phosphate transfection, polybrene, protoplast
fusion, electroporation, liposomes, microinjection, naked DNA,
plasmid vectors, viral vectors, both episomal and integrative, and
any of the other well known methods for introducing cloned genomic
DNA, cDNA, synthetic DNA or other foreign genetic material into a
host cell (see, e.g., Sambrook et al., supra). It is only necessary
that the particular genetic engineering procedure used be capable
of successfully introducing at least one gene into the host cell
capable of expressing the protein of choice.
[0201] Vectors
[0202] Conventional viral and non-viral based gene transfer methods
can be used to introduce nucleic acids encoding engineered zinc
finger protein in mammalian cells or target tissues. Such methods
can be used to administer nucleic acids encoding zinc finger
proteins to cells in vitro or in vivo. Non-viral vector delivery
systems include DNA plasmids, naked nucleic acid, and nucleic acid
complexed with a delivery vehicle such as a liposome. Viral vector
delivery systems include DNA and RNA viruses, which have either
episomal or integrated genomes after delivery to the cell. For a
review of gene therapy procedures, see Anderson, Science
256:808-813 (1992); Nabel & Felgner, TIBTECH 11:211-217 (1993);
Mitani & Caskey, TIBTECH 11:162-166 (1993); Dillon, TIBTECH
11:167-175 (1993); Miller, Nature 357:455-460 (1992); Van Brunt,
Biotechnology 6(10):1149-1154 (1988); Vigne, Restorative Neurology
and Neuroscience 8:35-36 (1995); Kremer & Perricaudet, British
Medical Bulletin 51(1):31-44 (1995); Haddada et al., in Current
Topics in Microbiology and Immunology Doerfler and Bohm (eds)
(1995); and Yu et al., Gene Therapy 1:13-26 (1994).
[0203] Methods of non-viral delivery of nucleic acids encoding
engineered zinc finger proteins include lipofection,
microinjection, biolistics, virosomes, liposomes, immunoliposomes,
polycation or lipid:nucleic acid conjugates, naked DNA, artificial
virions, and agent-enhanced uptake of DNA. Lipofection is described
in e.g., U.S. Pat. Nos. 5,049,386, 4,946,787; and 4,897,355) and
lipofection reagents are sold commercially (e.g., Transfectam.TM.
and Lipofectin.TM.). Cationic and neutral lipids that are suitable
for efficient receptor-recognition lipofection of polynucleotides
include those of Felgner, WO 91/17424, WO 91/16024. Delivery can be
to cells (ex vivo administration) or target tissues (in vivo
administration).
[0204] The preparation of lipid:nucleic acid complexes, including
targeted liposomes such as immunolipid complexes, is well known to
one of skill in the art (see, e.g., Crystal, Science 270:404410
(1995); Blaese et al., Cancer Gene Ther. 2:291-297 (1995); Behr et
al., Bioconjugate Chem. 5:382-389 (1994); Remy et al., Bioconjugate
Chem. 5:647-654 (1994); Gao et al., Gene Therapy 2:710-722 (1995);
Ahmad et al., Cancer Res. 52:48174820 (1992); U.S. Pat. Nos.
4,186,183, 4,217,344, 4,235,871, 4,261,975, 4,485,054, 4,501,728,
4,774,085, 4,837,028, and 4,946,787).
[0205] The use of RNA or DNA viral based systems for the delivery
of nucleic acids encoding engineered zinc finger protein take
advantage of highly evolved processes for targeting a virus to
specific cells in the body and trafficking the viral payload to the
nucleus. Viral vectors can be administered directly to subjects (in
vivo) or they can be used to treat cells in vitro and the modified
cells are administered to patients (ex vivo). Conventional viral
based systems for the delivery of zinc finger proteins could
include retroviral, lentivirus, adenoviral, adeno-associated and
herpes simplex virus vectors for gene transfer. Viral vectors are
currently the most efficient and versatile method of gene transfer
in target cells and tissues. Integration in the host genome is
possible with the retrovirus, lentivirus, and adeno-associated
virus gene transfer methods, often resulting in long term
expression of the inserted transgene. Additionally, high
transduction efficiencies have been observed in many different cell
types and target tissues.
[0206] The tropism of a retrovirus can be altered by incorporating
foreign envelope proteins, expanding the potential target
population of target cells. Lentiviral vectors are retroviral
vector that are able to transduce or infect non-dividing cells and
typically produce high viral titers. Selection of a retroviral gene
transfer system would therefore depend on the target tissue.
Retroviral vectors are comprised of cis-acting long terminal
repeats with packaging capacity for up to 6-10 kb of foreign
sequence. The minimum cis-acting LTRs are sufficient for
replication and packaging of the vectors, which are then used to
integrate the therapeutic gene into the target cell to provide
permanent transgene expression. Widely used retroviral vectors
include those based upon murine leukemia virus (MuLV), gibbon ape
leukemia virus (GaLV), simian immuno-deficiency virus (SIV), human
immuno-deficiency virus (HIV), and combinations thereof (see, e.g.,
Buchscher et al., J. Virol. 66:2731-2739 (1992); Johann et al., J.
Virol. 66:1635-1640 (1992); Sommerfelt et al., Virol. 176:58-59
(1990); Wilson et al., J. Virol. 63:2374-2378 (1989); Miller et
al., J. Virol. 65:2220-2224 (1991); PCT/US94/05700).
[0207] In applications where transient expression of the zinc
finger protein is preferred, adenoviral based systems are typically
used. Adenoviral based vectors are capable of very high
transduction efficiency in many cell types and do not require cell
division. With such vectors, high titer and levels of expression
have been obtained. This vector can be produced in large quantities
in a relatively simple system. Adeno-associated virus ("AAV")
vectors are also used to transduce cells with target nucleic acids,
e.g., in the in vitro production of nucleic acids and peptides, and
for in vivo and ex vivo gene therapy procedures (see, e.g., West et
al., Virology 160:38-47 (1987); U.S. Pat. No. 4,797,368; WO
93/24641; Kotin, Human Gene Therapy 5:793-801 (1994); Muzyczka, J.
Clin. Invest. 94:1351 (1994). Construction of recombinant AAV
vectors are described in a number of publications, including U.S.
Pat. No. 5,173,414; Tratschin et al., Mol. Cell. Biol. 5:3251-3260
(1985); Tratschin, et al., Mol. Cell. Biol. 4:2072-2081 (1984);
Hermonat & Muzyczka, Proc. Natl. Acad. Sci. U.S.A. 81:6466-6470
(1984); and Samulski et al., J. Virol. 63:03822-3828 (1989).
[0208] Packaging cells are used to form virus particles that are
capable of infecting a host cell. Such cells include 293 cells,
which package adenovirus, and .psi.2 cells or PA317 cells, which
package retrovirus. Viral vectors used in gene therapy are usually
generated by producer cell line that packages a nucleic acid vector
into a viral particle. The vectors typically contain the minimal
viral sequences required for packaging and subsequent integration
into a host, other viral sequences being replaced by an expression
cassette for the protein to be expressed. The missing viral
functions are supplied in trans by the packaging cell line. For
example, AAV vectors used in gene therapy typically only possess
ITR sequences from the AAV genome which are required for packaging
and integration into the host genome. Viral DNA is packaged in a
cell line, which contains a helper plasmid encoding the other AAV
genes, namely rep and cap, but lacking ITR sequences. The cell line
is also infected with adenovirus as a helper. The helper virus
promotes replication of the AAV vector and expression of AAV genes
from the helper plasmid. The helper plasmid is not packaged in
significant amounts due to a lack of ITR sequences. Contamination
with adenovirus can be reduced by, e.g., heat treatment to which
adenovirus is more sensitive than AAV.
[0209] In many situations, it is desirable that the vector be
delivered with a high degree of specificity to a particular. tissue
type. A viral vector is typically modified to have specificity for
a given cell type by expressing a ligand as a fusion protein with a
viral coat protein on the viruses outer surface. The ligand is
chosen to have affinity for a receptor known to be present on the
cell type of interest. For example, Han et al., Proc. Natl. Acad.
Sci. U.S.A. 92:9747-9751 (1995), reported that Moloney murine
leukemia virus can be modified to express human heregulin fused to
gp70, and the recombinant virus infects certain human breast cancer
cells expressing human epidermal growth factor receptor. This
principle can be extended to other pairs of virus expressing a
ligand fusion protein and target cell expressing a receptor. For
example, filamentous phage can be engineered to display antibody
fragments (e.g., FAB or Fv) having specific binding affinity for
virtually any chosen cellular receptor. Although the above
description applies primarily to viral vectors, the same principles
can be applied to nonviral vectors. Such vectors can be engineered
to contain specific uptake sequences thought to favor uptake by
specific target cells.
[0210] Expression vectors can be delivered in vivo by
administration to an individual subject, typically by systemic
administration (e.g., intravenous, intraperitoneal, intramuscular,
subdermal, or intracranial infusion) or topical application, as
described below. Alternatively, naked DNA can be administered.
Alternatively, vectors can be delivered to cells ex vivo, such as
cells explanted from an individual subject (e.g., lymphocytes, bone
marrow aspirates, tissue biopsy) or universal donor hematopoietic
stem cells, followed by reimplantation of the cells into a patient,
usually after selection for cells which have incorporated the
vector.
[0211] Administration is by any of the routes normally used for
introducing a molecule into ultimate contact with blood or tissue
cells. Suitable methods of administering such nucleic acids are
available and well known to those of skill in the art, and,
although more than one route can be used to administer a particular
composition, a particular route can often provide a more immediate
and more effective reaction than another route.
[0212] Pharmaceutically acceptable carriers are determined in part
by the particular composition being administered, as well as by the
particular method used to administer the composition. Accordingly,
there is a wide variety of suitable formulations of pharmaceutical
compositions available, as described below (see, e.g., Remington's
Pharmaceutical Sciences, 17th ed., 1989).
[0213] Delivery Vehicles
[0214] An important factor in the administration of polypeptide
compounds, such as the zinc finger proteins, is ensuring that the
polypeptide has the ability to traverse the plasma membrane of a
cell, or the membrane of an intra-cellular compartment such as the
nucleus. Cellular membranes are composed of lipid-protein bilayers
that are freely permeable to small, nonionic lipophilic compounds
and are inherently impermeable to polar compounds, macromolecules,
and therapeutic or diagnostic agents. However, proteins and other
compounds such as liposomes have been described, which have the
ability to translocate polypeptides such as zinc finger proteins
across a cell membrane.
[0215] For example, "membrane translocation polypeptides" have
amphiphilic or hydrophobic amino acid subsequences that have the
ability to act as membrane-translocating carriers. In one
embodiment, homeodomain proteins have the ability to translocate
across cell membranes. The shortest internalizable peptide of a
homeodomain protein, Antennapedia, was found to be the third helix
of the protein, from amino acid position 43 to 58 (see, e.g.,
Prochiantz, Current Opinion in Neurobiology 6:629-634 (1996)).
Another subsequence, the h (hydrophobic) domain of signal peptides,
was found to have similar cell membrane translocation
characteristics (see, e.g., Lin et al., J. Biol. Chem. 270:1
4255-14258 (1995)).
[0216] Examples of peptide sequences which can be linked to a
protein, for facilitating uptake of the protein into cells,
include, but are not limited to: an 11 animo acid peptide of the
tat protein of HIV; a 20 residue peptide sequence which corresponds
to amino acids 84-103 of the p16 protein (see Fahraeus et al.,
Current Biology 6:84 (1996)); the third helix of the 60-amino acid
long homeodomain of Antennapedia (Derossi et al., J. Biol. Chem.
269:10444 (1994)); the h region of a signal peptide such as the
Kaposi fibroblast growth factor (K-FGF) h region (Lin et al.,
supra); or the VP22 translocation domain from HSV (Elliot &
O'Hare, Cell 88:223-233 (1997)). Other suitable chemical moieties
that provide enhanced cellular uptake may also be chemically linked
to zinc finger proteins.
[0217] Toxin molecules also have the ability to transport
polypeptides across cell membranes. Often, such molecules are
composed of at least two parts (called "binary toxins"): a
translocation or binding domain or polypeptide and a separate toxin
domain or polypeptide. Typically, the translocation domain or
polypeptide binds to a cellular receptor, and then the toxin is
transported into the cell. Several bacterial toxins, including
Clostridium perfringens iota toxin, diphtheria toxin (DT),
Pseudomonas exotoxin A (PE), pertussis toxin (PT), Bacillus
anthracis toxin, and pertussis adenylate cyclase (CYA), have been
used in attempts to deliver peptides to the cell cytosol as
internal or amino-terminal fusions (Arora et al., J. Biol. Chem.,
268:3334-3341 (1993); Perelle et al., Infect. Immun., 61:5147-5156
(1993); Stenmark et al., J. Cell Biol. 113:1025-1032 (1991);
Donnelly et al., Proc. Natl. Acad. Sci. U.S.A. 90:3530-3534 (1993);
Carbonetti et al., Abstr. Annu. Meet. Am. Soc. Microbiol. 95:295
(1995); Sebo et al., Infect. Immun. 63:3851-3857 (1995); Klimpel et
al., Proc. Natl. Acad. Sci. U.S.A. 89:10277-10281 (1992); and Novak
et al., J. Biol. Chem. 267:17186-17193 1992)).
[0218] Such subsequences can be used to translocate zinc finger
proteins across a cell membrane. zinc finger proteins can be
conveniently fused to or derivatized with such sequences.
Typically, the translocation sequence is provided as part of a
fusion protein. Optionally, a linker can be used to link the zinc
finger protein and the translocation sequence. Any suitable linker
can be used, e.g., a peptide linker.
[0219] The zinc finger protein can also be introduced into an
animal cell, preferably a mammalian cell, via a liposomes and
liposome derivatives such as immunoliposomes. The term "liposome"
refers to vesicles comprised of one or more concentrically ordered
lipid bilayers, which encapsulate an aqueous phase. The aqueous
phase typically contains the compound to be delivered to the cell,
i.e., a zinc finger protein.
[0220] The liposome fuses with the plasma membrane, thereby
releasing the drug into the cytosol. Alternatively, the liposome is
phagocytosed or taken up by the cell in a transport vesicle. Once
in the endosome or phagosome, the liposome either degrades or fuses
with the membrane of the transport vesicle and releases its
contents.
[0221] In current methods of drug delivery via liposomes, the
liposome ultimately becomes permeable and releases the encapsulated
compound (in this case, a zinc finger protein) at the target tissue
or cell. For systemic or tissue specific delivery, this can be
accomplished, for example, in a passive manner wherein the liposome
bilayer degrades over time through the action of various agents in
the body. Alternatively, active drug release involves using an
agent to induce a permeability change in the liposome vesicle.
Liposome membranes can be constructed so that they become
destabilized when the environment becomes acidic near the liposome
membrane (see, e.g., Proc. Natl. Acad. Sci. U.S.A. 84:7851 (1987);
Biochemistry 28:908 (1989)). When liposomes are. endocytosed by a
target cell, for example, they become destabilized and release
their contents. This destabilization is termed fusogenesis.
Dioleoylphosphatidylethanolamine (DOPE) is the basis of many
"fusogenic" systems.
[0222] Such liposomes typically comprise a zinc finger protein and
a lipid component, e.g., a neutral and/or cationic lipid,
optionally including a receptor-recognition molecule such as an
antibody that binds to a predetermined cell surface receptor or
ligand (e.g., an antigen). A variety of methods are available for
preparing liposomes as described in, e.g., Szoka et al., Ann. Rev.
Biophys. Bioeng. 9:467 (1980), U.S. Pat. Nos. 4,186,183, 4,217,344,
4,235,871, 4,261,975, 4,485,054, 4,501,728, 4,774,085, 4,837,028,
4,235,871, 4,261,975, 4,485,054, 4,501,728, 4,774,085, 4,837,028,
4,946,787, PCT Publication No. WO 91.backslash.17424, Deamer &
Bangham, Biochim. Biophys. Acta 443:629-634 (1976); Fraley, et al.,
Proc. Natl. Acad. Sci. U.S.A. 76:3348-3352 (1979); Hope et al.,
Biochim. Biophys. Acta 812:55-65 (1985); Mayer et al., Biochim.
Biophys. Acta 858:161-168 (1986); Williams et al., Proc. Natl.
Acad. Sci. U.S.A. 85:242-246 (1988); Liposomes (Ostro (ed.), 1983,
Chapter 1); Hope et al., Chem. Phys. Lip. 40:89 (1986);
Gregoriadis, Liposome Technology (1984) and Lasic, Liposomes: from
Physics to Applications (1993)). Suitable methods include, for
example, sonication, extrusion, high pressure/homogenization,
microfluidization, detergent dialysis, calcium-induced fusion of
small liposome vesicles and ether-fusion methods, all of which are
well known in the art.
[0223] In certain embodiments, it is desirable to target liposomes
using targeting moieties that are specific to a particular cell
type, tissue, and the like. Targeting of liposomes using a variety
of targeting moieties (e.g., ligands, receptors, and monoclonal
antibodies) has been previously described (see, e.g., U.S. Pat.
Nos. 4,957,773 and 4,603,044).
[0224] Examples of targeting moieties include monoclonal antibodies
specific to antigens associated with neoplasms, such as prostate
cancer specific antigen and MAGE. Tumors can also be diagnosed by
detecting gene products resulting from the activation or
over-expression of oncogenes, such as ras or c-erbB2. In addition,
many tumors express antigens normally expressed by fetal tissue,
such as the alphafetoprotein (AFP) and carcinoembryonic antigen
(CEA). Sites of viral infection can be diagnosed using various
viral antigens such as hepatitis B core and surface antigens (HBVc,
HBVs) hepatitis C antigens, Epstein-Barr virus antigens, human
immunodeficiency type-1 virus (HIV1) and papilloma virus antigens.
Inflammation can be detected using molecules specifically
recognized by surface molecules which are expressed at sites of
inflammation such as integnins (e.g., VCAM-1), selectin receptors
(e.g., ELAM-1) and the like.
[0225] Standard methods for coupling targeting agents to liposomes
can be used. These methods generally involve incorporation into
liposomes lipid components, e.g., phosphatidylethanolamine, which
can be activated for attachment of targeting agents, or derivatized
lipophilic compounds, such as lipid derivatized bleomycin. Antibody
targeted liposomes can be constructed using, for instance,
liposomes which incorporate protein A (see Renneisen et al., J.
Biol. Chem., 265:16337-16342 (1990) and Leonetti et al., Proc.
Natl. Acad. Sci. U.S.A. 87:2448-2451 (1990).
[0226] Assays for Determining Regulation of Gene Expression
[0227] A variety of assays can be used to determine association of
a candidate gene with a selected phenotype. The activity of a
particular gene regulated by a zinc finger protein can be assessed
using a variety of in vitro and in vivo assays, by measuring, e.g.,
protein or mRNA levels, product levels, enzyme activity, tumor
growth; transcriptional activation or repression of a reporter
gene; second messenger levels (e.g., cGMP, cAMP, IP3, DAG,
Ca.sup.2+); cytokine and hormone production levels; and
neovascularization, using, e.g., immunoassays (e.g., ELISA and
immunohistochemical assays with antibodies), hybridization assays
(e.g., RNase protection, northerns, in situ hybridization,
oligonucleotide array studies), colorimetric assays, amplification
assays, enzyme activity assays, tumor growth assays, phenotypic
assays, cDNA arrays studies, and the like.
[0228] Zinc finger proteins are often first tested for activity in
vitro using cultured cells, e.g., 293 cells, CHO cells, VERO cells,
BHK cells, HeLa cells, COS cells, and the like. Preferably, human
or mouse cells are used. The zinc finger protein is often first
tested using a transient expression system with a reporter gene,
and then regulation of the target candidate gene is tested in cells
and in animals, both in vivo and ex vivo. The zinc finger protein
can be recombinantly expressed in a cell, recombinantly expressed
in cells transplanted into an animal, or recombinantly expressed in
a transgenic animal, as well as administered as a protein to an
animal or cell using delivery vehicles described below. The cells
can be immobilized, be in solution, be injected into an animal, or
be naturally occurring in a transgenic or non-transgenic
animal.
[0229] Modulation of gene expression and association of the
candidate gene with a selected phenotype is tested using one of the
in vitro or in vivo assays described herein. Cells or subject
animals comprising the candidate genes are contacted with zinc
finger proteins and compared to control genes or second candidate
genes to examine the extent of phenotype modulation. For regulation
of gene expression, the zinc finger protein optionally has a
K.sub.d of 200 nM or less, more preferably 100 nM or less, more
preferably 50 nM, most preferably 25 nM or less.
[0230] The effects of the zinc finger proteins can be measured by
examining any of the parameters described above. Any suitable gene
expression, phenotypic, or physiological change can be used to
assess the influence of a zinc finger protein. When the functional
consequences are determined using intact cells or animals, one can
also measure a variety of effects such as tumor growth,
neovascularization, hormone release, transcriptional changes to
both known and uncharacterized genetic markers (e.g., northern
blots or oligonucleotide array studies), changes in cell metabolism
such as cell growth or pH changes, and changes in intracellular
second messengers such as cGMP.
[0231] Examples of assays for a selected phenotype include e.g.,
transformation assays, e.g., changes in proliferation, anchorage
dependence, growth factor dependence, foci formation, growth in
soft agar, tumor proliferation in nude mice, and tumor
vascularization in nude mice; apoptosis assays, e.g., DNA laddering
and cell death, expression of genes involved in apoptosis; signal
transduction assays, e.g., changes in intracellular calcium, cAMP,
cGMP, IP3, changes in hormone and neurotransmittor release;
receptor assays, e.g., estrogen receptor and cell growth; growth
factor assays, e.g., EPO, hypoxia and erythrocyte colony forming
units assays; enzyme product assays, e.g., FAD-2 induced oil
desaturation; transcription assays, e.g., reporter gene assays; and
protein production assays, e.g., VEGF ELISAs.
[0232] In one embodiment, the assay for the selected phenotype is
performed in vitro. In one preferred in vitro assay format, zinc
finger protein regulation of gene expression in cultured cells is
examined by determining protein production using an ELISA
assay.
[0233] In another embodiment, zinc finger protein regulation of
candidate gene expression is determined in vitro by measuring the
level of target gene mRNA expression. The level of gene expression
is measured using amplification, e.g., using PCR, LCR, or
hybridization assays, e.g., northern hybridization, RNase
protection, dot blotting. RNase protection is used in one
embodiment. The level of protein or mRNA is detected using directly
or indirectly labeled detection agents, e.g., fluorescently or
radioactively labeled nucleic acids, radioactively or enzymatically
labeled antibodies, and the like, as described herein.
[0234] Alternatively, a reporter gene system can be devised using a
target gene promoter operably linked to a reporter gene such as
luciferase, green fluorescent protein, CAT, or .beta.-gal. The
reporter construct is typically co-transfected into a cultured
cell. After treatment with the zinc finger protein of choice, the
amount of reporter gene transcription, translation, or activity is
measured according to standard techniques known to those of skill
in the art.
[0235] Another example of an assay format useful for monitoring
zinc finger protein regulation of candidate gene expression is
performed in vivo. This assay is particularly useful for examining
zinc finger proteins that inhibit expression of tumor promoting
genes, genes involved in tumor support, such as neovascularization
(e.g., VEGF), or that activate tumor suppressor genes such as p53.
In this assay, cultured tumor cells expressing the zinc finger
protein of choice are injected subcutaneously into an immune
compromised mouse such as an athymic mouse, an irradiated mouse, or
a SCID mouse. After a suitable length of time, preferably 4-8
weeks, tumor growth is measured, e.g., by volume or by its two
largest dimensions, and compared to the control. Tumors that have
statistically significant reduction (using, e.g., Student's T test)
are said to have inhibited growth. Alternatively, the extent of
tumor neovascularization can also be measured. Immunoassays using
endothelial cell specific antibodies are used to stain for
vascularization of the tumor and the number of vessels in the
tumor. Tumors that have a statistically significant reduction in
the number of vessels (using, e.g., Student's T test) are said to
have inhibited neovascularization.
[0236] Transgenic and non-transgenic animals are also used as an
embodiment for examining regulation of candidate gene expression in
vivo. Transgenic animals typically express the zinc finger protein
of choice. Alternatively, animals that transiently express the.zinc
finger protein of choice, or to which the zinc finger protein has
been administered in a delivery vehicle, can be used. Regulation of
candidate gene expression is tested using any one of the assays
described herein. Animals can be observed and assayed for
functional changes, e.g., challenged with drugs, mitogens, viruses,
pathogens, toxins, and the like.
[0237] Transgenic Mice and in vitro High Throughput Assays for Drug
Discovery
[0238] A further application of the zinc finger protein technology
is manipulating gene expression in cell lines and transgenic
animals. Once a selected candidate gene has been associated with a
phenotype, and the candidate gene has been validated as a drug
therapy target, cell and transgenic-animal based assays are
developed for the purposes of high throughput drug screening. A
cell line or animal expressing the candidate gene is provided with
a zinc finger protein that regulates expression of the candidate
gene. The zinc finger protein typically is provided as a nucleic
acid encoding the zinc finger protein, although it can also be
administered as a protein. The cell line or animal is then
contacted with test compounds to determine the effect of the
compound upon the candidate gene and the selected phenotype. The
zinc finger protein technology is an improvement for high
throughput cell-based and animal assays, for example, because
expression of the zinc finger protein can be made conditional using
small molecule systems.
[0239] In one embodiment of a high throughput assay for
therapeutics, zinc finger proteins can be used for regulation of
candidate genes in cell lines or animals using the small molecule
regulated systems described herein. Expression and/or function of a
zinc finger-based repressor can be switched off during development
and switched on at will in the cells or animals. This approach
relies on the addition of the zinc finger protein expressing module
only; homologous recombination is not required. Because the zinc
finger protein repressors are trans dominant, there is no concern
about germline transmission or homozygosity. These issues
dramatically affect the time and labor required to go from a poorly
characterized gene candidate (a cDNA or EST clone) to a mouse
model. This ability can be used to rapidly identify and/or validate
gene targets for therapeutic intervention, generate novel model
systems and permit the analysis of complex physiological phenomena
(development, hematopoiesis, transformation, neural function etc.).
Chimeric targeted mice can be derived according to Hogan et al.,
Manipulating the Mouse Embryo: A Laboratory Manual, (1988);
Teratocarcinomas and Embryonic Stem Cells: A Practical Approach,
Robertson, ed., (1987); and Capecchi et al., Science 244:1288
(1989.
[0240] Gene Identification
[0241] The methods and compositions described herein can be used to
confirm or rebut putative gene identification based on various
analyses of genomic sequence. One type of analysis used for
putative gene assignment is alignment of EST and/or mRNA sequences.
See, for example, Mott et al. (1997) Comput. Appl. Biosci.
13:477-478; Florea et al. (1998) Genome Res. 8:967-974; Bailey et
al. (1998) Genome Res. 8:362-376. Another method for gene
prediction is based on sequence homology to known genes and/or
proteins. See, for example, Birney et al. (1996) Nucleic Acids Res.
24:2730-2739; Gelfand et al. (1996) Proc. Natl. Acad. Sci. USA
93:9061-9066. In addition, a number of ab initio gene prediction
algorithms are available and are known to those of skill in the
art; these include but are not limited to Genescan, Genie and
FGENES. See, for example, Burge et al. (1997) J. Mol. Biol.
268:78-94; Kulp et al. (1996) ISMB 4:134-142; Reese et al. (2000)
Genome Res. 10:529-538; Solovyev et al. (1997) ISMB 5:294-302.
[0242] Additional gene prediction algorithms include, but are not
limited to, GenScan, Grail, GrailEXP, Veil, AAT,MZEF, PROCRUSTES,
PGF, GeneParser, Glimmer, HMMgene, GeneMark-HMM, Selfid, the
Webgene suite, GeneMark, EuGene, Morgan, GenomeScan, Diogenes,
Genlang, FGENE, FGENESH, FGENESH+, GeneID, GENMARK, Xpound, Otto,
GeneFinder, GeneWise, GENEBUILDER, GLIMMERM and Ensembl. These
algorithms can be accessed, for example, on the Internet, as will
be known to those of skill in the art. See also Haussler et al.
(1998) Trends Biochem. Sci. 23(suppl): 12 and Claverie (1997) Human
Mol. Genet. 6:1735.
[0243] Despite the existence of a large number of gene prediction
algorithms (as well as additional methods of gene prediction, see
supra), the current success rate for exon prediction in the human
genome is only 70%, while the success rate for correctly
identifying all exons of a human gene is a mere 20%. See, for
example, Dunham et al. (1999) Nature 402:489-495; Guigo et al.
(2000) Genome Res. 10:163 1-1642. Additional problems in eukaryotic
genome annotation, based on analyses of the Drosophila and
Arabidopsis genomes, are discussed by Lewis et al. (2000) Curr.
Opin. Struct. Biol. 10:349 and Pavy et al. (1999) Bioinformatics
15:887.
[0244] Thus, the methods described above generate one or more
putative gene sequences, whose identification as a gene must be
confirmed. One method of confirmation is to test for functionality,
i.e., if a putative gene sequence is actually a gene, it should be
possible to modulate its expression, and such modulation should be
accompanied by a phenotype.
[0245] Accordingly, the methods and compositions disclosed herein
are used to test a putative gene prediction (i.e., to identify a
gene) by contacting a cell, comprising the putative gene sequence,
with an exogenous molecule that, if the putative gene sequence
actually encodes a gene, will bind to, and modulate expression of,
the gene. The cells are then assayed for at least one selected
phenotype. If one or more of the selected phenotypes are observed,
the putative gene sequence is identified as a gene. Thus, detection
of a phenotype is indicative of a correct gene prediction.
[0246] Thus, a putative gene sequences can be used as a source of
target sites for the design of one or more exogenous regulatory
molecules. In a preferred embodiment, the exogenous regulatory
molecule is a zinc finger protein. A zinc finger protein can be
designed or selected to bind, in a sequence-specific fashion, to a
predetermined target site, as known in the art. For example, in one
embodiment, target sites are selected and zinc finger proteins are
designed to recognize such target sites, as disclosed in co-owned
PCT WO 00/42219. In another embodiment, zinc finger DNA binding
domains are designed according to design rules disclosed in PCT WO
98/53058, WO 98/53059 and WO 98/53060. In a further embodiment,
zinc finger DNA binding domains are selected as disclosed in PCT WO
98/53057 or WO 00/27878. The target site(s) can reside in any
portion of the putative gene, including but not limited to putative
coding regions, putative transcribed regions, overlapping the
putative transcriptional startsite and within putative regulatory
regions.
[0247] The zinc finger protein can optionally comprise one or more
functional domains, for example, as described supra in the section
entitled "Functional domains." Fusion proteins comprising a zinc
finger DNA-binding domain and one or more functional domains (and
nucleic acids encoding them) are constructed by methods known in
the art and described supra. See also co-owned PCT WO 00/41566 and
WO 00/42219.
[0248] In one embodiment, a zinc finger DNA-binding domain is fused
to a transcriptional activation domain. Preferred activation
domains include VP16 and the p65 subunit of NF-.kappa.B. In another
embodiment, a zinc finger DNA-binding domain is fused to a
transcriptional repression domain. Preferred repression domains
include KRAB and v-erbA.
[0249] In a further embodiment, a zinc finger DNA-binding domain is
fused to a bifunctional domain (BFD). A bifunctional domain is a
transcriptional regulatory domain whose activity depends upon
interaction of the BFD with a second molecule. The second molecule
can be any type of molecule capable of influencing the functional
properties of the BFD including, but not limited to, a compound, a
small molecule, a peptide, a protein, a polysaccharide or a nucleic
acid. An exemplary BFD is the ligand binding domain of the estrogen
receptor (ER). In the presence of estradiol, the ER ligand binding
domain acts as a transcriptional activator; while, in the absence
of estradiol and the presence of tamoxifen or 4-hydroxy-tamoxifen,
it acts as a transcriptional repressor. Another example of a BFD is
the thyroid hormone receptor (TR) ligand binding domain which, in
the absence of ligand, acts as a transcriptional repressor and in
the presence of its ligand 3,5,3'-triiodo-L-thyronine (T3), acts as
a transcriptional activator. An additional BFD is the
glucocorticoid receptor (GR) ligand binding domain. In the presence
of dexamethasone, this domain acts as a transcriptional activator;
while, in the presence of RU486, it acts as a transcriptional
repressor. An additional exemplary BFD is the ligand binding domain
of the retinoic acid receptor. In the presence of its ligand
all-trans-retinoic acid, the retinoic acid receptor recruits a
number of co-activator complexes and activates transcription. In
the absence of ligand, the retinoic acid receptor is not capable of
recruiting transcriptional co-activators. Additional BFDs are known
to those of skill in the art. See, for example, U.S. Pat. Nos.
5,834,266 and 5,994,313 and PCT WO 99/10508.
[0250] Following contact of a cell comprising a putative gene
sequence with an exogenous molecule capable of modulating
expression of the sequence if it is indeed a gene, the cell is
assayed for one or more selected phenotypes, with an optional
incubation period intervening between contact and assay. During the
incubation period, if it occurs, the cell can also be optionally
subjected to one or more stimuli. Any phenotype can be used as the
basis for assay; exemplary assays and phenotypes have been
described supra in the section entitled "Introduction" and in the
definition of "selected phenotype." In addition, a phenotype can
comprise a change in cell growth (e.g., more rapid growth or slower
growth), cell cycle control (e.g., loss of cell cycle control, cell
cycle arrest), cellular physiology (i.e., energy state, membrane
potential, ion flux, production of metabolites, macromolecules, and
other cellular products) or cellular response to a pathogen such
as, for example, a virus, bacterium or unicellular eukaryote.
Cellular responses to a pathogen can include, for example, any of
the phenotypes already described. Furthermore, the same techniques
can be applied to confirm the assignment of a viral gene; i.e., if
the putative gene sequence is part of a viral genome and a cell is
infected with a virus comprising the putative gene sequence.
[0251] In addition, a selected phenotype can be a change in the
rate or level of expression of a RNA molecule. For example,
expression of a mRNA corresponding to a putative gene. sequence
following contact of a cell comprising the putative gene sequence
with an exogenous molecule designed to activate transcription of
the putative gene sequence, provides evidence that the putative
gene sequence is a gene.
[0252] On a more global level, a selected phenotype can comprise a
change in expression of a plurality of RNA molecules. Accordingly,
in one embodiment, a phenotype can be an alteration in the
transcriptional program of a cell (i.e., the transcriptome). Such
changes in cellular transcriptional patterns can be detected by
assays known in the art, including but not limited to, microarray
analysis, subtractive hybridization, differential display and
serial analysis of gene expression.
[0253] Dosages
[0254] The dose administered to a subject or a cell should be
sufficient to effect the desired phenotype. Particular dosage
regimens can be useful for determining phenotypic changes in an
experimental setting, e.g., in functional genomics studies, and in
cell or animal models. The dose is determined by the efficacy and
K.sub.d of the particular zinc finger protein employed, the nuclear
volume of the target cell, and the condition of the cell or
patient, as well as the body weight or surface area of the cell or
patient to be treated. The size of the dose also is determined by
the existence, nature, and extent of any adverse side-effects that
accompany the administration of a particular compound or vector in
a particular cell or patient.
[0255] The maximum effective dosage of zinc finger protein for
approximately 99% binding to target sites is calculated to be in
the range of less than about 1.5.times.10.sup.5 to
1.5.times.10.sup.6 copies of the specific zinc finger protein
molecule per cell. The number of zinc finger proteins per cell for
this level of binding is calculated as follows, using the volume of
a HeLa cell nucleus (approximately 1000 .mu.m.sup.3 or 10.sup.-12
L; Cell Biology, (Altman & Katz, eds. (1976)). As the HeLa
nucleus is relatively large, this dosage number is recalculated as
needed using the volume of the target cell nucleus. This
calculation also does not take into account competition for zinc
finger protein binding by other sites. This calculation also
assumes that essentially all of the zinc finger protein is
localized to the nucleus. A value of 100.times. K.sub.d is used to
calculate approximately 99% binding of to the target site, and a
value of 10.times. K.sub.d is used to calculate approximately 90%
binding of to the target site. For this example, K.sub.d=25 nM
[0256] ZFP+target sitecomplex
[0257] i.e., DNA+proteinDNA:protein complex
[0258] K.sub.d=[DNA][protein][DNA:protein complex]
[0259] When 50% of ZFP is bound, K.sub.d=[protein]
[0260] So when [protein]=25 nM and the nucleus volume is 10.sup.-12
L
[0261] [protein]=(25.times.10.sup.-9 moles/L) (10.sup.-12
L/nucleus) (6.times.10.sup.23 molecules/mole)=15,000
molecules/nucleus for 50% binding
[0262] When 99% target is bound; 100.times. K.sub.d=[protein]
[0263] 100.times. K.sub.d=[protein]=2.5 .mu.M
[0264] (2.5.times.10.sup.-6 moles/L) (10.sup.-12L/nucleus)
(6.times.10.sup.23 molecules/mole)=about 1,500,000 molecules per
nucleus for 99% binding of target site.
[0265] The appropriate dose of an expression vector encoding a zinc
finger protein can also be calculated by taking into account the
average rate of zinc finger protein expression from the promoter
and the average rate of zinc finger protein degradation in the
cell. Preferably, a weak promoter such as a wild-type or mutant HSV
TK is used, as described above. The dose of zinc finger protein in
micrograms is calculated by taking into account the molecular
weight of the particular zinc finger protein being employed.
[0266] In determining the effective amount of the zinc finger
protein to be administered, circulating plasma levels of the zinc
finger protein or nucleic acid encoding the zinc finger protein,
potential zinc finger protein toxicities, progression of the
phenotype, and the production of anti-zinc finger protein
antibodies are evaluated. Administration can be accomplished via
single or divided doses.
[0267] Pharmaceutical Compositions and Administration
[0268] Zinc finger proteins and expression vectors encoding zinc
finger proteins can be administered directly to the subject or cell
for modulation of gene expression. Administration of effective
amounts is by any of the routes normally used for introducing zinc
finger protein into ultimate contact with the tissue or cell. The
zinc finger proteins are administered in any suitable manner,
preferably with pharmaceutically acceptable carriers. Suitable
methods of administering such modulators are available and well
known to those of skill in the art, and, although more than one
route can be used to administer a particular composition, a
particular route can often provide a more immediate and more
effective reaction than another route.
[0269] Pharmaceutically acceptable carriers are determined in part
by the particular composition being administered, as well as by the
particular method used to administer the composition. Accordingly,
there is a wide variety of suitable formulations of pharmaceutical
compositions available (see, e.g., Remington's Pharmaceutical
Sciences, 17.sup.th ed. 1985)).
[0270] The zinc finger proteins, nucleic acids encoding the same,
alone or in combination with other suitable components, can be made
into aerosol formulations (i.e., they can be "nebulized") to be
administered via inhalation. Aerosol formulations can be placed
into pressurized acceptable propellants, such as
dichlorodifluoromethane, propane, nitrogen, and the like.
[0271] Formulations suitable for parenteral administration, such
as, for example, by intravenous, intramuscular, intradermal, and
subcutaneous routes, include aqueous and non-aqueous, isotonic
sterile injection solutions, which can contain antioxidants,
buffers, bacteriostats, and solutes that render the formulation
isotonic with the blood of the intended recipient, and aqueous and
non-aqueous sterile suspensions that can include suspending agents,
solubilizers, thickening agents, stabilizers, and preservatives. In
practice, compositions can be administered, for example, by
intravenous infusion, orally, topically, intraperitoneally,
intravesically or intrathecally. The formulations of compounds can
be presented in unit-dose or multi-dose sealed containers, such as
ampules and vials. Injection solutions and suspensions can be
prepared from sterile powders, granules, and tablets of the kind
previously described.
[0272] All publications and patent applications cited in this
specification are herein incorporated by reference as if each
individual publication or patent application were specifically and
individually indicated to be incorporated by reference.
EXAMPLES
[0273] The following examples are provided by way of illustration
only and not by way of limitation. Those of skill in the art will
readily recognize a variety of noncritical parameters that could be
changed or modified to yield essentially similar results.
Example I
[0274] Targeting Human VEGF Gene with Zinc Finger Proteins for
Target Validation
[0275] An important consideration in target validation is to
efficiently determine and accurately evaluate the relationship
between a targeted gene and resulting phenotype. This example
demonstrates the use of the zinc finger protein technology to
validate a gene as a target for the development of therapeutic
compounds that can regulate, e.g., expression of the gene or the
function of the gene product. This process is based on the
following simple assumptions (FIG. 1).
[0276] If a gene X is up-regulated by a ZFP-A1, which specifically
targets at the X1 site, a phenotype Q is observed.
[0277] If the gene X is up-regulated by ZFP-A2, which specifically
targets at a different site X2, the same phenotype Q should be
observed.
[0278] If the gene X is down-regulated by ZFP-B1, which targets at
the X3 site (X3 can be X1 or X2), a different phenotype Z should be
observed.
[0279] If the ZFP-A1, ZFP-A2, or ZFP-B1 are used to target a gene
that is not involved in the phenotype Q, no phenotype change
related to this gene should be observed.
[0280] The human and mouse vascular endothelial growth factor
(VEGF) genes were selected for target validation in this example.
VEGF is an approximately 46 kDa glycoprotein that is an endothelial
cell-specific mitogen induced by hypoxia. VEGF binds to endothelial
cells via interaction with tyrosine kinase receptors Flt-1
(VEGFR-1) and Flk-1/KDR (VEGFR-2). Since VEGF plays a very
important role in angiogenesis, targeting this gene for development
of therapeutics has attracted great interest. While inhibition
(down-regulation) of the VEGF gene may be used for cancer and
diabetic retinopathy treatments, activation (up-regulation) of the
gene may be used for ischemic heart and tissue diseases. These two
desired phenotypic changes make the VEGF gene ideal for target
validation using zinc finger protein technology.
[0281] Testing Zinc Finger Proteins for Biochemical Affinity and
Specificity in vitro
[0282] The DNA target sites for zinc finger proteins were chosen in
a region surrounding the transcription site of the targeted gene.
The primary targets were chosen within the region approximately 1
kb upstream of the transcription initiation site, where a majority
of enhancer elements are located. Each 3-finger zinc finger protein
recognizes a 9-bp DNA sequence. To increase DNA-binding
specificity, two 3-finger zinc finger proteins are fused together
in order to target two 9-bp DNA sequences that are in a close
proximity (Liu et al. Proc. Natl. Acad. Sci. U.S.A. 94:5525-5530
(1997)).
[0283] Human SP-1 or murine Zif268 transcription factors were used
as a progenitor molecular for the construction of designed zinc
finger proteins. The amino acid sequences (fingers), which
recognize the target DNA sequence, were designed based on the
"recognition rules" described herein. The designed zinc finger
protein genes were constructed using a PCR-based procedure that
utilizes six overlapping oligonucleotides. The methods of designing
and assembling zinc finger protein genes that target VEGF are
detailed in co-owned PCT WO 00/41566.
[0284] The designed zinc finger protein genes were initially cloned
into the pMAL-KNB vector after digesting with KpnI and BamHI (FIG.
2). The pMAL-KNB vector is modified from the pMAL-c2 vector (New
England Biolabs, MA). The zinc finger protein proteins were
purified from bacteria and were subjected to biochemical affinity
and specificity assays. The methods for these in vitro assays are
described herein and in co-owned PCT WO 00/41566.
[0285] Activation or repression of a luciferase promoter in
transiently transfected cells The zinc finger proteins with high
biochemical affinity and specificity were subcloned into the KpnI
and BamHI sites in pcDNA-NVF or pcDNA-NKF (FIG. 2). The pcDNA-NVF
construct contains a CMV promoter-controlled sequence encoding a
nuclear localization signal, a herpes simplex virus VP16 activation
domain, and a Flag peptide. This construct was designed to
up-regulate the targeted gene when introduced into mammalian cells.
The pcDNA-NKF construct contains the Kruppel-associated box (KRAB)
repression domain instead of VP16 domain and was used for
down-regulation of the targeted genes. These constructs are
described in detail in co-owned PCT WO 00/41566.
[0286] The reporter plasmid system is based on the pGL3-promoter
and pGL3-control vectors (Promega, Wis.). Three tandem repeats of
the zinc finger protein target sites were inserted upstream of the
SV40 promoter (FIG. 3. The pGLP reporters were used to evaluate the
activities of the engineered zinc finger proteins for up-regulation
of gene expression and the pGLC reporters were used to measure the
effects of ZFP-KRAB activities inhibition of gene expression. These
constructs are described in detail in co-owned PCT WO 00/41566.
[0287] The control plasmids used in this example are shown in FIG.
2. pcDNA-NVF (or pcDNA-NKF) is a ZFP-less effector. pcV-RAN (or
pcK-RAN) expresses all components except that the engineered zinc
finger protein has no known DNA binding capability (FIG. 2). The
zinc finger protein sequence in the pcV-RAN (or pcK-RAN) constructs
is: VPGKKKQHICHIQGCGKVYGGHDTVVGHLRWHTGERPFMCTWSYCGKRFTAA
DEVGLHKRTHTGEKKFACPECPKRFMLVVATQLHIKTHQNKKGGS (SEQ ID NO: 13),
where the fingers are underlined. These control constructs were
used to check the effects of the regulation domains (VP16 or KRAB),
in the absence of the DNA binding domain. The pc-ZFP-cat plasmid
expresses a specifically designed zinc finger protein, however the
functional domain (VP16 or KRAB) was replaced with a 234 bp
fragment isolated from the chloramphenicol acetyltransferase (CAT)
gene in the pcDNA3.1/CAT vector (nt1442 to 1677) (Invitrogen, CA)
(FIG. 2). This control plasmid was used to test whether the DNA
binding domain alone has any effects on gene expression. The other
controls include effectors expressing zinc finger proteins that
recognize different DNA sequences and reporters containing
non-specific zinc finger protein target sequences.
[0288] The following example demonstrates the effect of a designed
zinc finger protein, which activates the luciferase reporter gene
in 293 cells. The targeted sequence, GGGGTTGAG, is named M6-1892S
and is in the promoter region of the human VEGF gene. The zinc
finger protein recognizing this 9-bp DNA sequence was designed and
assembled as described herein and in co-owned PCT WO 00/41566. The
DNA sequence (SEQ ID NO: 14) and the amino acid sequence (SEQ ID
NO: 15) of the zinc finger protein are shown below.
1 KpnI 5'GGTACCGGGCAAGAAGAAGCAGCACATCTGCCACATCC- AGGGCTGTGGTAAAGTT
V P G K K K Q H I C H I Q G C G K V
TACGGCCGCTCCGACAACCTGACCCGCCACCTGCGCTGGC- ACACCGGCGAGAGGCCT Y G R S
D N L T R H L R W H T G E R P (Finger 1: GAG)
TTCATGTGTACATGGTCCTACTGTGGTAAACGCTTCACCAACCGCGACACCCTGGCC F M C T W
S Y C G K R F T N R D T L A (Finger 2: GTT)
CGCCACAAGCGTACCCACACCGGTGAGAAGAAATTTGCTTGTCCGGAATGTCCGAAG R H K R T
H T G E K K F A C P E C P K
CGCTTCATGCGCTCCGACCACCTGTCCAAGCACATCAAGACCCACCAGAACAAGAAG R F M R S
D H L S K H I K T H Q N K K (Finger 3: GGG) GGTGGATCC-3' G G S
BamHI
[0289] The KpnI-BamHI DNA fragment of the assembled zinc finger
protein was cloned into KpnI-BamHI sites of the pMAL-KNB vector.
The ability of the designed zinc finger proteins to bind their
target sites was verified by expressing and purifying recombinant
proteins from E. coli and performing electrophoretic mobility shift
assays (EMSA). The binding affinity (K.sub.d) of the protein shown
above was 20 nM, as determined by EMSA. This KpnI-BamHI ZFP
fragment was then subcloned into KpnI-BamHI sites of the pcDNA-NVF
vector and was named pcV-VF471A. The luciferase reporter plasmid
containing three tandem repeats of the M6-1892S sites was made and
named pGLP-VF471x3.
[0290] All plasmid DNA was prepared using Qiagen plasmid
purification kits. The human embryonic kidney 293 cells were seeded
into each well of a 6-well plate with a density to reach
approximately 70% confluence the next day. Cells were
co-transfected with 50 ng effector DNA (ZFP-expression plasmid),
900 ng reporter DNA and 100 ng pCMV-LacZ DNA using either
Lipofectamine (GIBCO-BRL, MD) or GenePORTER (Gene Therapy Systems
Inc, CA) transfection reagent. The co-expressed
.beta.-galactosidase activity was used a control to normalize the
luciferase activity. Cell lysates were harvested 40 to 48 hours
after transfection. Luciferase assays were performed using the
Dual-Light Luciferase and .beta.-galactosidase Reporter Assay
System (Tropix, MA). A typical luciferase assay result is shown in
FIG. 4.
[0291] This example demonstrated that this designed ZFP-expressing
plasmid, pcV-VF471A, was able to stimulate the luciferase gene
expression by 8 fold when compared with control plasmid pcV-RAN,
which does not possess known DNA binding capability. When the VP16
domain was replaced with a peptide, which has no transcription
regulation activity, this zinc finger protein (pcV-VF-471A-cat)
lost its activity of trans-activating the luciferase gene. The
designed zinc finger protein (pcV-VF471A) failed to activate the
luciferase expression from the reporter containing a different zinc
finger protein binding site, indicating that the trans-activation
effect is sequence specific. Therefore, the DNA binding domain
(VF471A ZFP) combined with the regulation domain (VP16) in this
example were able to turn on the gene at an appropriate target
sites.
[0292] Testing a Reporter Containing Native Promoter of the
Targeted Gene in Transiently Transfected Cells
[0293] The difference between the simple reporter system and the
native reporter system is that the native reporter plasmid
construct contains the promoter of the targeted gene. A unique
advantage for the native reporter system is that a single native
reporter plasmid construct can be used to analyze the effects of
multiple zinc finger proteins in the context of the promoter.
[0294] The pGLP-native reporter was constructed by replacing the
SV40 promoter in pGL3-promoter with a DNA fragment containing the
promoter and flanking sequences of the targeted gene (FIG. 3). In
this example, the native reporter construct of the human VEGF gene
was generated by PCR-amplifying a 3319-bp fragment from the human
genomic DNA. This fragment contains the VEGF promoter and its
flanking regions. The VEGF ATG codon was fused to the luciferase
coding region. Nest-PCR is performed for the amplification. The
external primers were hVEGFU1 (5'-GAATTCTGTGCCCTCACTCCCCTGG (SEQ ID
NO: 16); nt 1 to 25 based on GenBank sequence M63971) and VEGFD2
(5'-ACCGCTTACCTTGGCATGGTGGAGG (SEQ ID NO: 17); nt 3475 to 3451).
The internal primer pair are hVEHFU2 (5'-ACACACCTTGCTGGGTACCACCATG
(SEQ ID NO: 18); nt 71 to 95, KpnI site underlined)) and VEGFD1
(5'-GCAGAAAGTcCATGGTTTCGGAGGCC (SEQ ID NO: 19); nt 3413 to 3388, a
T to C substitution is made to generate the underlined NcoI site).
The nested PCR product was digested with KpnI and NcoI and ligated
with the KpnI-NcoI vector fragment of the pGL3-promoter plasmid
(FIG. 3). The human VEGF native reporter plasmid was named
pGLPVFH.
[0295] A similar strategy was used to amplify a 2070-bp fragment
from the mouse genomic DNA. The external primers were mVEGFU2
(5'-TGTTTAGAAGATGAACCGTAAGCCT (SEQ ID NO: 20); nt 1 to 25 based on
GenBank sequence U41383) and VEGFD2 (5'-ACCGCTTACCTTGGCATGGTGGAGG
(SEQ ID NO: 21); nt 3475 to 3451 based on M63971). The internal
primers were mVEGF (5'-GCCCCCATTGGtACCCTGGCTTCAGTTCCCTGGCAACA (SEQ
ID NO: 22); nt 155 to 192; a C to T replacement is made to generate
the underlined KpnI site) and VEGFD (5'-GCAGAAAGTcCATGGTTTCGGAGGCC
(SEQ ID NO: 23); nt 3413 to 3388 based on M63971; a T to C
substitution is made to generate the underlined NcoI site). VEGFD2
and VEGFD1 primers were used to amplify both human and mouse
genomic DNA since the sequences are highly homologous at that
region (Shima et al. J. Biol. Chem. 271:3877 (1996)). The murine
VEGF native reporter plasmid was called pGLPmVF.
[0296] The following example demonstrates that two designed zinc
finger proteins were able to up-regulate the human VEGF native
promoter gene in 293 cells. One zinc finger protein (pcV-M6-2009A)
was designed to target a proximal site GAAGGGGGC located at 362-bp
upstream of the transcription start site and the other one
(pcV-M6-111S) was designed to target a distal site ATGGGGGTG
located at 2240-nt upstream of the transcription start site.
Similar to the luciferase reporter assay described above, 50 to 100
ng of effector DNA are co-transfected with 900 ng of native
reporter DNA and 100 ng of pCMVlacZ DNA. Luciferase activities were
measured approximately 40 hours post-transfection and were shown as
fold activation in FIG. 5.
[0297] Primary Zinc Finger Proteins to Activate or Repress the
Endogenous Human and Mouse VEGF Genes in Cell Culture
[0298] To test whether these engineered zinc finger proteins can
activate or repress the endogenous human and mouse VEGF genes in
cell culture, transient transfection experiments were conducted.
The human 293 cells and mouse mammary epithelial cells C127I (Shima
et al., JBC 271:3877 (1996)) express low levels of endogenous VEGF
proteins, which are used to evaluate the zinc finger protein effect
on VEGF activation. The human glioblastoma U87MG cells, the mouse
neuroblastoma NB41 cells (Levy et al., Growth Factors 2:9 (1989))
and the rat glioma GS-9L cells (Conn et al., Proc. Natl. Acad. Sci.
U.S.A. 87:1323 (1990)) express high levels of endogenous VEGF
proteins, which are used for testing the repression effects of the
zinc finger proteins. These cells are seeded into each well of a
6-well plate with a density to reach approximately 70% confluence
the next day. 0.1 to 1 g effector DNA are usually used to transfect
the cells using either Lipofectamine or GenePORTER transfection
reagent depends on the cell types. Approximately 14 hours after
transfection, cells are fed with fresh medium and cultured for
another 24 hours. The mediums are then harvested and endogenous
VEGF levels are measured using the VEGF ELISA Assay kits (R&D
Systems, MN).
[0299] The VEGF M6-111S and M6-2009S ZFPs were designed as primary
zinc finger proteins to test their activities in human VEGF gene
regulation. The results in Table 1 indicated that both primary zinc
finger proteins significantly activated the human endogenous VEGF
gene expression in 293 cells.
2TABLE 1 Activation of Human Endogenous VEGF Gene by zinc finger
proteins in 293 Cells Fold Effector Target Location* Reporter
Activation Vector control pcV-RAN None N/F pGLPVFH 1 Primary ZFP
pcV-M6-111S ATGGGGGTC -2252 pGLPVFH 4.1 Primary ZFP pcV-M6-2009S
GAAGGGGGC -363 pGLPVFH 4.5 Secondary ZFP pcV-M6-120S GGGGGTGCC
-2243 pGLPVFH 13.8 Secondary ZFP pcV-M6-1878S GAGTGTGTG -536
pGLPVFH 4.2 *Distance between the target sites and the VEGF
transcription initiation site. N/F: Not found in the vicinity of
the VEGF promoter region.
[0300] To repress the targeted gene, the designed zinc finger
protein domains were cloned into the pcDNA-NKF vector. After
transfection of the DNA into the appropriate cells, the ZFP-KRAB
fusion proteins can inhibit the endogenous gene as well as the
cotransfected luciferase reporter gene. The example used here is
pcK-M6-11S. As shown in Table 1, M6-111S ZFP recognizes the target
sequence ATGGGGGTG. When the M6-111S ZFP fused to KRAB repression
domain, an approximately 80% repression on the cotransfected
luciferase reporter gene expression and approximately 40%
repression on the endogenous VEGF gene expression were
achieved.
[0301] Secondary Zinc Finger Proteins to Activate or Repress the
Endogenous Human and Mouse VEGF Genes in Cell Culture
[0302] To confirm that the physiological effects observed using the
primary zinc finger proteins are due to the effects on the VEGF
gene and not other side effects such as regulation of alternative
gene targets, secondary zinc finger proteins that target the VEGF
gene at sites different than that of the primary zinc finger
protein were engineered. As shown in Table 1, the two secondary
zinc finger proteins also activate the endogenous VEGF gene
expression in cultured cells. These results demonstrated that the
zinc finger protein technology can be used to regulate gene
expression and to validate a gene as a target for therapeutics.
[0303] Tertiary Zinc Finger Proteins to Target the Genes not
Involved in VEGF Physiology
[0304] To confirm that the physiological effects observed using the
primary and secondary zinc finger proteins are due to the specific
effects on the VEGF gene and not any non-specific DNA-binding or
squelching effects, tertiary zinc finger proteins that target genes
not involved in VEGF physiology are used as negative controls. For
example, a zinc finger protein designed for regulating human EPO
gene expression is used as a specificity control (see Example II).
EPO is also affected by hypoxia and thus is useful as a control for
VEGF target validation using a hypoxia assay. VEGF inhibition
specifically reverses diabetic retinopathy. This result validates
VEGF as a molecular target for drug discovery and development.
[0305] Test the VEGF Inhibition Effect on a Diabetic Retinopathy
Model in Rodents
[0306] Diabetic retinopathy is the most common cause of blindness
amongst individuals of working age. Increased VEGF expression is a
major contributor for the pathology of diabetic retinopathy. One of
the strategies to treat this disease is to inhibit endogenous VEGF
gene expression using therapeutic compounds. As described above,
zinc finger proteins provide the means to validate VEGF as a
therapeutic target. Adeno-associate virus (AAV) and or
retrovirus-based viral vectors are constructed as described above.
These virus vectors express the zinc finger proteins that are fused
with the KRAB repression domain as described above. The viruses are
generated, purified, and injected into the animals. The efficacy of
the engineered zinc finger proteins is evaluated by suppression of
retinal neovascularization as previously described (Admais et al.,
Arch. Ophthalmol. 114:66 (1996); Pierce et al., Proc. Natl. Acad.
Sci. U.S.A. 92:905 (1995); Aiello et al., Proc. Natl. Acad. Sci.
U.S.A. 92:10457 (1995); Smith et al., Invest. Ophthalmol. Vis. Sci.
35:101, 1994). All necessary controls, including the viral vectors
expressing the secondary and tertiary zinc finger proteins are also
used.
[0307] Test the VEGF Activation Effect on a Peripheral Artery
Disease Model in Rodents
[0308] Stimulation of peripheral angiogenesis by VEGF to augment
collateral artery development is a potentially novel form of
therapy for patients with ischemic vascular disease. The same
strategy described above is used to validate VEGF as a target using
a mouse peripheral artery disease model. The AAV or retrovirus
vectors, which express the zinc finger proteins fused to VP16
activation domain, are constructed as described above. The efficacy
of the zinc finger proteins are evaluated similar to the procedures
described previously (Couffinhal et al., Am. J. Pathol. 152:1667
(1998); Takeshita et al., Lab. Invst. 75:487 (1996); Isner et al.,
Human Gene Therapy 7:959(1996)). All necessary controls, including
the viral vectors expressing the secondary and tertiary zinc finger
proteins are also used. VEGF overexpression triggers collateral
artery growth. This result validates VEGF as a target for drug
discovery and development.
Example II
[0309] Erythropoiesis Target Discovery
[0310] Mammalian erythropoiesis is regulated via stimulation of the
erythroid progenitors by certain factor(s) that provide
proliferation and differentiation signals. Hypoxia is a potent
signal that induces the expression of genes controlling many
physiologically relevant processes (Ratcliffe et al. J. Exp. Biol.
201:1153 (1998)). One of the processes is to "request" that certain
tissues release a factor(s) for the production of additional red
blood cells. This phenomenon can be detected by stimulating
different cell lines and/or tissues with hypoxic conditions,
sampling the culture supernatants, and testing for the stimulation
of erythrocyte colony forming units from murine bone marrow
cultures. Cell lines or tissues found to respond to hypoxia in this
way likely express erythropoietic growth factors in a hypoxia
inducible manner. The analysis of genes differentially expressed in
such cells or tissues upon hypoxic treatment should lead to the
identification of erythropoietic growth factor expressing genes.
Zinc finger protein technology can be used as analytical tools for
such differential gene expression experiments and to validate the
hypothetical erythropoietic growth factor genes.
[0311] A collection of cell types (including human hepatoma cell
line, Hep3B) are cultured in appropriate medium and maintained in a
humidified 5% CO.sub.2-95% air incubator at 37.degree. C. Hypoxic
conditions are achieved by flushing 1% O.sub.2-5% CO.sub.2-94%
N.sub.2 for 18 hours (Goldberg et al., Blood 77:271 (1991)). The
culture supernatants are harvested and tested in colony forming
assay (Muller et al., Exp. Hematol. 21:1353 (1993); Eaves &
Eaves, Blood 52:1196 (1978)). The human hepatoma Hep3B cell line is
found to produce an erythropoietic growth factor(s) upon hypoxic
induction (Goldberg et al. Proc. Natl. Acad. Sci. U.S.A. 84:7972
(1987)) and this cell line is used for further
characterization.
[0312] One working hypothesis is that one (or more) of the cellular
genes, which are responsible for stimulating red cell production,
is activated upon hypoxia. This gene(s) may be identified by
performing a differential gene expression experiment, such as
Differential Display (GeneHunter, TN), PCR-Select cDNA Subtraction
(Clontech, CA), or microarray (Affymetrix, CA). The gene expression
patterns of the RNA extracted from the Hep3B cells growing under
normal and hypoxic conditions are compared.
[0313] It is very likely that multiple genes are up-regulated in
the hypoxic cells. Approximately eighteen genes have been
identified as up-regulated by hypoxia (Ratcliffe et al,. J. Exp.
Biol. 201:1153 (1998)). The erythropoietin (EPO) gene and the
vascular endothelial growth factor (VEGF) gene, which have been
extensively studied, are used in this example to demonstrate the
application of the zinc finger protein technology to functional
genomics and identification of the gene encoding the erythropoietic
growth factor.
[0314] Based on the DNA sequences of the candidate genes identified
from the above experiments, primary zinc finger protein s are
designed to target the DNA sequences located in a proximity of the
promoters. The zinc finger protein construction and
characterization process is the same as that described in the
Example I. The zinc finger proteins (a 3-finger one or a 6-finger
protein) with high DNA-binding affinity and specificity are fused
with either the HSV VP-16 activation domains or the KRAB repression
domains to activate or block expression of the individual genes on
the list.
[0315] These designed ZFP-VP16 constructs are individually
transiently transfected into Hep3B cells using the GenePORTER
transfection reagent (Gene Therapy Systems Inc, CA) under the
non-hypoxic condition. 48 hours post-transfection, the supernatants
are collected and the colony forming assays are performed. The
gene(s) that induces the red cell production upon zinc finger
protein up-regulation is considered to be the gene(s) that encodes
an erythropoietic growth factor. The results indicate that the
erythropoietin (EPO) gene is responsible for the erythropoiesis
regulation while all other tested genes (including VEGF) are not.
All necessary zinc finger protein control constructs described in
Example I are also used in this example.
[0316] Another way to identify and validate the gene is to perform
the similar experiments described above except that these zinc
finger proteins are fused with the KRAB domains and the Hep3B cells
are stimulated by hypoxia 14 hours post-transfection. When the zinc
finger proteins, which are designed to repress the EPO gene
expression, are transfected into the Hep3B cells, no or reduced
activity based on the colony forming assay is observed. All zinc
finger proteins, which target genes other than the EPO gene, do not
affect the red cell production under hypoxic induction.
[0317] To further validate the gene function, secondary zinc finger
proteins, which target at different sites of the EPO gene, are
constructed. These secondary zinc finger proteins, when fused with
VP16 activation domains, activate the EPO gene expression and
stimulate the red cell production. Conversely, when fused with KRAB
repression domains, these zinc finger proteins inhibit the EPO gene
expression under hypoxic condition and fail to stimulate the red
cell production.
Example III
[0318] Breast Cancer Target Gene Discovery
[0319] The growth of some breast tumors depends on the continued
presence of the hormone estrogen. Estrogen is likely involved in
the up-regulation of genes required for maintenance of the
transformed phenotype. Cell lines derived from these tissues (such
as MCF-7, BT20 and T47D) retain this dependence on estrogen for
growth in culture. Thus, it appears estrogen stimulates expression
of essential genes in the dependent cell lines. The discovery of
these estrogen-induced genes are useful molecular targets for the
development of new drugs to treat breast cancer. The use of zinc
finger proteins to identify estrogen-induced genes required for
estrogen-dependent cell growth is described herein. Furthermore,
the newly discovered targets are validated using zinc finger
proteins and appropriate controls.
[0320] Identifying ER-responsive Genes
[0321] MCF-7 cells are grown in the absence of estrogen (estradiol)
for short term (1 week) and long term (28 weeks) to allow
transcription of estradiol-induced genes to reach basal levels.
Cells are propagated in 162 ml flasks; containing Dulbecco's
Modified Eagle Medium (DMEM), lacking phenol red and supplemented
with 10% charcoal-stripped Fetal Calf Serum (FCS) (Hyclone), 10
.mu.g/ml insulin and 0.5 nM estradiol. Upon reaching 80%
confluency, cells will trypsinized and transferred to fresh medium
lacking estradiol. The flasks are incubated at 37.degree. C. in a
humidified atmosphere of 5% CO.sub.2.
[0322] Estrogen-responsive gene expression is stimulated by adding
estradiol to the cells. The cells grown in the absence of estradiol
are split into fresh medium lacking estradiol. One flask will
receive 10 nM estradiol (dissolved in ethanol) while the other will
receive an equivalent amount of ethanol not containing estradiol.
Both stimulated and unstimulated cells are harvested after 6
hrs.
[0323] RNA is isolated from the cells for identifying
differentially expressed genes using a standard RNA isolation kit.
Estrogen responsive genes are identified using one or a combination
of the following methods; subtractive hybridization such as
PCR-Select from Clontech, differential display methods such as the
READS technology offered by Genelogic, or Perkin-Elmer's GenScope,
cDNA arrays such as GEM technology from Incyte, or a high-density
oligonucleotide matrix technologies offered by Affymetrix.
[0324] A number of differentially expressed (estradiol activated)
genes should be identified. The cDNAs for these genes are sequenced
and compiled into a list of candidate genes. It is expected that
many genes will be identified, including the estrogen receptor.
[0325] Initial Validation of Estrogen-responsive Genes
[0326] Zinc finger proteins are engineered to target each of the
individual members of the list of candidate genes, as described
above and in co-owned PCT WO 00/41566. The sequences of candidate
genes are scanned for unique and easily targetable 9 bp sequences.
This process will include searching databases for matches to
previously sequenced genes in order to obtain additional sequences
and to confirm the accuracy of the cDNA sequence generated
above.
[0327] These designed zinc finger proteins are fused to functional
domains, allowing both up regulation and knock-down of expression
of the candidate genes, as described-above. The functional domains
to be employed are the Kruppel-associated box (KRAB) repression
domain and the herpes simplex virus (HSV-1) VP16 activation
domain.
[0328] Repression of Candidate Genes
[0329] For repressor studies, cells harboring the individual zinc
finger proteins are assayed for failure to grow due to blocking
estrogen-dependent functions. It has been established that estrogen
receptor is essential for growth in MCF-7; hence these cells should
fail to grow when the ER gene or other estrogen dependent functions
are targeted for down regulation.
[0330] Cells are cultured in the medium previously described with
and without estradiol. Eukaryotic expression vectors, constructed
to fuse the zinc finger proteins to the SV40 NLS and KRAB, are
described above. Transfections are done using Lipofectamine, a
commercially available liposome preparation from GIBCO-BRL. All
plasmid DNAs are prepared using Qiagen Midi DNA purification
system. 10 g of the effector plasmid is mixed with 100 ng
Lipofectamine (50 .mu.l) in a total volume of 1600 .mu.l of
Opti-MEM. A pCMV .beta.-gal plasmid (Promega) will also be included
in the DNA mixture as an internal control for transfection
efficiency. Following a 30 minute incubation, 6.4 ml of DMEM is
added and the mixture was layered on the cells. After five hours,
the DNA-Lipofectamine mixture is removed, and fresh culture medium
containing 10% charcoal-stripped FCS, 10 .mu.g/ml insulin and 10 nM
estradiol are layered on the cells.
[0331] Viability is assayed by trypan blue exclusion and monitoring
growth. Cells are trypsinized, concentrated by centrifugation and
resuspended at approximately 10.sup.6 cells/ml. A solution of 0.4%
trypan blue is added to an equal volume of cells on a hemocytometer
slide. Total and stained cells are counted under a microscope.
Growth is monitored by measuring DNA synthesis. Radioactive
[.sup.3H]thymidine (0.5 .mu.Ci at 30 Ci/mmol; Ammersham) is added
and the cells are allowed to grow for an additional 17 h. The
medium is removed and cells are lysed in situ with 1% SDS. Cell
lysates are precipitated with 15% trichloroacetic acid (TCA) and
collected by filtration with Whatman 3M filter discs and washed
with 5% TCA then ethanol. Filters are dried and thymidine
incorporation is quantitated by liquid scintillation counting.
[0332] Activation of Candidate Genes
[0333] Activation of each member of the list will also be performed
to assay for estrogen-independent growth of MCF-7 cells. Eukaryotic
expression vectors are constructed as described above.
Transfections are done using Lipofectamine, a commercially
available liposome preparation from GIBCO-BRL. All plasmid DNAs are
prepared using the Qiagen Midi DNA purification system.
Transfection is performed as described above
[0334] Viability is assayed by trypan blue exclusion and monitoring
growth. Cells are trypsinized, concentrated by centrifugation and
resuspended at approximately 10.sup.6 cells/ml. A solution of 0.4%
trypan blue is added to an equal volume of cells on a hemocytometer
slide. Total and stained cells are counted under a microscope.
Growth is monitored by measuring DNA synthesis. Radioactive [3
H]thymidine (0.5 .mu.Ci at 30 Ci/mmol; Ammersham) is added and the
cells are allowed to grow for an additional 17 h. The medium is
removed and cells are lysed in situ with 1% SDS. Cell lysates are
precipitated with 15% trichloroacetic acid (TCA) and collected by
filtration with Whatman 3M filter discs and washed with 5% TCA then
ethanol. Filters are dried and thymidine incorporation is
quantitated by liquid scintillation counting.
[0335] Secondary Validation
[0336] Additional testing will validate candidate genes identified
during this first round of repressor and activator studies. These
zinc finger proteins are designed to target two distinct and
separated target sites in the candidate gene. Additionally, the
specificity and affinity of the zinc finger proteins are improved
by fusing two three finger zinc finger protein domains to form a
six finger molecule that recognizes 18 bp.
[0337] Three finger zinc finger proteins are designed, produced and
assayed by EMSA as described herein. In order to locate suitable
sequences, for which zinc finger proteins can be easily and
reliably designed, additional sequencing of the candidate genes may
be required. Furthermore, additional sequences may be found in
nucleotide sequence databases. Target sequences are chosen so that
two 9 bp sequences are within 5 bp of each other; thus allowing
linking of the zinc finger protein pairs. After identifying pairs
of three finger zinc finger proteins that bind with acceptable
affinities and specificities, the domains are linked by PCR,
amplifying the domain which constitutes fingers 4-6 of the six
finger molecule. A short DNA sequence encoding a peptide sequence
predicted to be unstructured and flexible is added to the
N-terminus of this domain during amplification.
[0338] Each construct is transiently transfected into MCF-7 cells
growing in culture and is scored for failure to grow (repression)
or estrogen-independent growth (activation) as described above.
[0339] Target Validation Using Xenografts
[0340] The effects of altered target gene expression on tumor
growth is assessed by xenografts in nude mice. The genes encoding
the zinc finger proteins are cloned into adeno-associated virus
(AAV) or retrovirus-based viral vectors as described above. The
zinc finger proteins are fused to either KRAB or VP16 domains. The
resulting recombinant viruses are generated, purified and used to
infect MCF-7 cells. These transgenic cells are introduced
subcutaneously into nude mice (Bissery et al., Semin. Oncol.
22:3-16 (1995)). Tumors are measured twice weekly in order to
estimate tumor weight (Bissery et al., Semin. Oncol. 22:3-16
(1995); Kubota et al., J. Surg. Oncol. 64:115-121 (1997)). The
experiment is allowed to progress until tumors obtain a weight of
100-300 mg or the animals die.
[0341] End-point assays will include macroscopic examination of the
thoracic and abdominal cavities to determine probable cause of
death. Additional assays will include histological analysis of
tissue samples and excision of tumors for weighing.
Example IV
[0342] Fatty Acid Saturation Target Discovery in Plants
[0343] Vegetable oil quality is determined in part by the degree of
saturation of the component fatty acid side chains. Excessive
desaturation (beyond one or two double bonds) leads to poorer
quality oils that are more prone to oxidation and rancidity.
Components of the biosynthetic machinery in oil producing seeds
determine the degree of desaturation. Inhibiting the expression of
a gene whose product is involved in fatty acid desaturation may
lead to higher quality oils. Zinc finger proteins are used as
probes for differential gene expression experiment in order to
identify genes that play a role in setting the level of fatty acid
saturation. Primary, secondary and tertiary zinc finger proteins
are used to validate the newly discovered gene function. Finally,
transgenic plants, producing higher quality oils, are produced.
[0344] Generating Candidate Genes through Random Mutagenesis
[0345] Starting material is either soybean (Glycine max) seeds or
plants. Mutagenesis is performed by either chemical treatment or
random DNA insertion (Katavic et al., Plant. Physiol. 108:399-409
(1995); Martienssen, Proc. Natl. Acad. Sci. U.S.A. 95:2021-2026
(1998); Hohn & Puchta, Proc. Natl. Acad. Sci. U.S.A.
96:8321-8323 (1999); Facciotti et al., Nature Biotech. 17:593-597
(1999)).
[0346] Chemical mutagenesis of seeds is performed by soaking in
0.3% (v/v) ethylmethanesulfonate (EMS) for 16 h (Haughn &
Somerville, Mol. Gen. Genet. 204:430-434 (1986)). M.sub.1 seeds are
propagated and allowed to self-fertilize, then M.sub.2 seeds are
randomly collected and propagated followed by another round of
self-fertilization to form M.sub.3 seeds. The fatty acid
composition of the seeds and resulting plants is analyzed as
described below.
[0347] Alternatively, random DNA insertion can be performed by
transposition using a number of systems developed in plants
(Martienssen, Proc. Natl. Acad. Sci. U.S.A. 95:2021-2026
(1998)).
[0348] Identifying Potential Candidate Genes by Fatty Acid and
Lipid Analyses
[0349] Fatty acid and lipid composition is determined for
approximately 20-30 of the M.sub.3 seeds according to the method of
Katavic (Plant Physiol. 108:399-409 (1995)). Mature plant tissues
are also similarly analyzed. Seeds are grouped into categories
according to degree of fatty acid saturation.
[0350] Expression profiles are generated for seeds expressing
either elevated or reduced degrees of desaturation by employing one
of the methods described in Example III. (Note: FAD2-1, encoding
omega-6-desaturase, is expected to be a gene underexpressed in
seeds that will lower levels of polyunsaturated long chain fatty
acids). Once a particular gene has been identified as participating
in the altered phenotype, the cDNA is selected for sequencing.
[0351] Initial Target Validation with Primary Zinc Finger
Proteins
[0352] Zinc finger proteins are engineered to target each of the
individual members of the list of candidate genes, as described
above and in co-owned PCT WO 00/42219 and PCT WO 00/41566. The
sequences of candidate genes are scanned for unique and easily
targetable 9 bp sequences. This process includes searching
databases for matches to previously sequenced genes in order to
obtain additional sequences and to confirm the accuracy of the cDNA
sequence generated above.
[0353] These designed zinc finger proteins are fused to functional
domains, allowing both up regulation and knock-down of expression
of the candidate genes, as described above. The functional domains
to be employed are the Kruppel-associated box (KRAB) repression
domain and the herpes simplex virus (HSV-1) VP16 activation
domain.
[0354] The genes encoding the ZFP-functional domain fusions are
cloned into a plant expression vector such as pCAMBIA1301. This
vector possesses the following attributes: 1) a selectable marker
such as the gene encoding hygromycin resistance; 2) left and right
T-DNA borders for Agrobacterium-mediated transformation; 3)
convenient restriction sites which will allow insertion of the zinc
finger protein gene downstream of desired promoters (such as CaMV
35S, napin or phaseolin promoters); 4) a plant polyadenylation
signal such as Nos; 5) a GUS reporter gene.
[0355] Designed zinc finger proteins are tested for activity
against the desired target by assaying activation or repression of
reporter genes. A single plasmid that independently expresses the
zinc finger protein and the reporter is used. The target sequence
is inserted in the DNA near the start site for transcription for
the GUS gene. Transformation of reporter constructs into tobacco
callus is carried out by standard co-cultivation procedures
(Grayburn et al., Biotechnol. 10:675-678 (1992)). GUS assays are
conducted using a fluorometric assay (Jefferson, Plant Mol. Biol.
Rep. 5:387-405 (1987)).
[0356] Zinc finger proteins that demonstrate acceptable affinities
as assessed by EMSA and in vivo function as assessed by reporter
assays are transformed into soybean somatic embryos via particle
bombardment of proliferating embryogenic cultures derived from
cotyledons of immature seeds (Liu et al., Plant Cell Tiss. Org.
Cult. 46:33-42 (1996)).
[0357] Tissues and seeds derived from 10-20 separate transformation
events for each ZFP-bearing plasmid are isolated to assess fatty
acid and lipid profiles. Candidate genes which produce an altered
fatty acid or lipid profile when transformed with the above zinc
finger proteins are selected for secondary and tertiary designs
which will generate more specific zinc finger proteins.
[0358] Secondary and Tertiary Zinc Finger Proteins to further
Validate Target in Desaturation Pathway
[0359] Additional testing is used to validate candidate genes
identified during this first round of repressor and activator
studies. These zinc finger proteins are designed to target two
distinct and separated target sites in the candidate gene
Additionally, the specificity and affinity of the zinc finger
proteins are improved by fusing two three finger zinc finger
protein domains to form a six finger molecule that recognizes 18
bp.
[0360] Three finger zinc finger proteins are designed, produced and
assayed by EMSA as described herein. In order to locate suitable
sequences, for which zinc finger proteins can be easily and
reliably designed, additional sequencing of the candidate genes may
be required. Furthermore, additional sequences may be found in
nucleotide sequence databases. Target sequences are chosen so that
two 9 bp sequences are within 5 bp of each other; thus allowing
linking of the zinc finger protein pairs. After identifying pairs
of three finger zinc finger proteins that bind with acceptable
affinities and specificities, the domains are linked by PCR,
amplifying the domain which constitutes fingers 4-6 of the six
finger molecule. A short DNA sequence encoding a peptide sequence
predicted to be unstructured and flexible is added to the
N-terminus of this domain during amplification.
[0361] Six finger zinc finger proteins are fused to either
repression or activation domains and assayed first in tobacco
callus reporter studies then in soybean plants as described
herein.
[0362] Candidate genes that produce altered fatty acid or lipid
profiles when targeted by the secondary zinc finger proteins
described above are selected for design of tertiary zinc finger
proteins. A second region of the gene separate from that targeted
with the secondary zinc finger proteins is chosen. Again, zinc
finger proteins designed to bind 18 bp are designed and tested as
described herein. These zinc finger proteins are introduced into
soybean and the resulting alteration on fatty acid and lipid
profiles will again be examined.
[0363] Although the foregoing methods and compositions have been
described in some detail by way of illustration and example for
purposes of clarity of understanding, it will be readily apparent
to one of ordinary skill in the art, in light of the teachings
herein, that certain changes and modifications may be made thereto
without departing from the spirit or scope of the appended claims.
Sequence CWU 1
1
23 1 25 PRT Artificial Sequence Description of Artificial
Sequenceexemplary motif of C2H2 class of zinc finger proteins (ZFP)
1 Cys Xaa Xaa Xaa Xaa Cys Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa 1
5 10 15 Xaa Xaa His Xaa Xaa Xaa Xaa Xaa His 20 25 2 10 DNA
Artificial Sequence Description of Artificial SequenceZFP target
site with two overlapping D-able subsites 2 nngkngknnn 10 3 10 DNA
Artificial Sequence Description of Artificial SequenceZFP target
site with three overlapping D-able subsites 3 nngkngkngk 10 4 5 PRT
Artificial Sequence Description of Artificial Sequencelinker 4 Asp
Gly Gly Gly Ser 1 5 5 5 PRT Artificial Sequence Description of
Artificial Sequencelinker 5 Thr Gly Glu Lys Pro 1 5 6 9 PRT
Artificial Sequence Description of Artificial Sequencelinker 6 Leu
Arg Gln Lys Asp Gly Glu Arg Pro 1 5 7 4 PRT Artificial Sequence
Description of Artificial Sequencelinker 7 Gly Gly Arg Arg 1 8 5
PRT Artificial Sequence Description of Artificial Sequencelinker 8
Gly Gly Gly Gly Ser 1 5 9 8 PRT Artificial Sequence Description of
Artificial Sequencelinker 9 Gly Gly Arg Arg Gly Gly Gly Ser 1 5 10
9 PRT Artificial Sequence Description of Artificial Sequencelinker
10 Leu Arg Gln Arg Asp Gly Glu Arg Pro 1 5 11 12 PRT Artificial
Sequence Description of Artificial Sequencelinker 11 Leu Arg Gln
Lys Asp Gly Gly Gly Ser Glu Arg Pro 1 5 10 12 16 PRT Artificial
Sequence Description of Artificial Sequencelinker 12 Leu Arg Gln
Lys Asp Gly Gly Gly Ser Gly Gly Gly Ser Glu Arg Pro 1 5 10 15 13 97
PRT Artificial Sequence Description of Artificial SequenceZFP
sequence in control construct 13 Val Pro Gly Lys Lys Lys Gln His
Ile Cys His Ile Gln Gly Cys Gly 1 5 10 15 Lys Val Tyr Gly Gly His
Asp Thr Val Val Gly His Leu Arg Trp His 20 25 30 Thr Gly Glu Arg
Pro Phe Met Cys Thr Trp Ser Tyr Cys Gly Lys Arg 35 40 45 Phe Thr
Ala Ala Asp Glu Val Gly Leu His Lys Arg Thr His Thr Gly 50 55 60
Glu Lys Lys Phe Ala Cys Pro Glu Cys Pro Lys Arg Phe Met Leu Val 65
70 75 80 Val Ala Thr Gln Leu His Ile Lys Thr His Gln Asn Lys Lys
Gly Gly 85 90 95 Ser 14 292 DNA Artificial Sequence Description of
Artificial Sequencedesigned ZFP construct (from KpnI to BamHI)
targeting 9-base pair target site in VEGF promoter 14 g gta ccg ggc
aag aag aag cag cac atc tgc cac atc cag ggc tgt ggt 49 Val Pro Gly
Lys Lys Lys Gln His Ile Cys His Ile Gln Gly Cys Gly 1 5 10 15 aaa
gtt tac ggc cgc tcc gac aac ctg acc cgc cac ctg cgc tgg cac 97 Lys
Val Tyr Gly Arg Ser Asp Asn Leu Thr Arg His Leu Arg Trp His 20 25
30 acc ggc gag agg cct ttc atg tgt aca tgg tcc tac tgt ggt aaa cgc
145 Thr Gly Glu Arg Pro Phe Met Cys Thr Trp Ser Tyr Cys Gly Lys Arg
35 40 45 ttc acc aac cgc gac acc ctg gcc cgc cac aag cgt acc cac
acc ggt 193 Phe Thr Asn Arg Asp Thr Leu Ala Arg His Lys Arg Thr His
Thr Gly 50 55 60 gag aag aaa ttt gct tgt ccg gaa tgt ccg aag cgc
ttc atg cgc tcc 241 Glu Lys Lys Phe Ala Cys Pro Glu Cys Pro Lys Arg
Phe Met Arg Ser 65 70 75 80 gac cac ctg tcc aag cac atc aag acc cac
cag aac aag aag ggt gga 289 Asp His Leu Ser Lys His Ile Lys Thr His
Gln Asn Lys Lys Gly Gly 85 90 95 tcc 292 Ser 15 97 PRT Artificial
Sequence Description of Artificial Sequencedesigned ZFP 15 Val Pro
Gly Lys Lys Lys Gln His Ile Cys His Ile Gln Gly Cys Gly 1 5 10 15
Lys Val Tyr Gly Arg Ser Asp Asn Leu Thr Arg His Leu Arg Trp His 20
25 30 Thr Gly Glu Arg Pro Phe Met Cys Thr Trp Ser Tyr Cys Gly Lys
Arg 35 40 45 Phe Thr Asn Arg Asp Thr Leu Ala Arg His Lys Arg Thr
His Thr Gly 50 55 60 Glu Lys Lys Phe Ala Cys Pro Glu Cys Pro Lys
Arg Phe Met Arg Ser 65 70 75 80 Asp His Leu Ser Lys His Ile Lys Thr
His Gln Asn Lys Lys Gly Gly 85 90 95 Ser 16 25 DNA Artificial
Sequence Description of Artificial SequencePCR primer hVEGFU1 16
gaattctgtg ccctcactcc cctgg 25 17 25 DNA Artificial Sequence
Description of Artificial SequencePCR primer VEGFD2 17 accgcttacc
ttggcatggt ggagg 25 18 25 DNA Artificial Sequence Description of
Artificial SequencePCR primer hVEHFU2 18 acacaccttg ctgggtacca
ccatg 25 19 26 DNA Artificial Sequence Description of Artificial
SequencePCR primer VEGFD1 19 gcagaaagtc catggtttcg gaggcc 26 20 25
DNA Artificial Sequence Description of Artificial SequencePCR
primer VEGFU2 20 tgtttagaag atgaaccgta agcct 25 21 25 DNA
Artificial Sequence Description of Artificial SequencePCR primer
VEGFD2 21 accgcttacc ttggcatggt ggagg 25 22 38 DNA Artificial
Sequence Description of Artificial SequencePCR primer mVEGF 22
gcccccattg gtaccctggc ttcagttccc tggcaaca 38 23 26 DNA Artificial
Sequence Description of Artificial SequencePCR primer VEGFD 23
gcagaaagtc catggtttcg gaggcc 26
* * * * *