U.S. patent number 9,045,470 [Application Number 12/874,153] was granted by the patent office on 2015-06-02 for compounds and compositions as tlr activity modulators.
This patent grant is currently assigned to IRM LLC. The grantee listed for this patent is Alex Cortez, Yongkai Li, Manmohan Singh, David Skibinski, Tom Yao Hsiang Wu, Kathy Yue, Xiaoyue Zhang. Invention is credited to Alex Cortez, Yongkai Li, Manmohan Singh, David Skibinski, Tom Yao Hsiang Wu, Kathy Yue, Xiaoyue Zhang.
United States Patent |
9,045,470 |
Wu , et al. |
June 2, 2015 |
**Please see images for:
( Certificate of Correction ) ** |
Compounds and compositions as TLR activity modulators
Abstract
The invention provides a novel class of compounds, immunogenic
compositions and pharmaceutical compositions comprising such
compounds and methods of using such compounds to treat or prevent
diseases or disorders associated with Toll-Like Receptors 7. In one
aspect, the compounds are useful as adjuvants for enhancing the
effectiveness of a vaccine.
Inventors: |
Wu; Tom Yao Hsiang (San Diego,
CA), Li; Yongkai (San Diego, CA), Cortez; Alex (San
Diego, CA), Yue; Kathy (Riverside, CA), Zhang;
Xiaoyue (San Diego, CA), Singh; Manmohan (Lexington,
MA), Skibinski; David (Siena, IT) |
Applicant: |
Name |
City |
State |
Country |
Type |
Wu; Tom Yao Hsiang
Li; Yongkai
Cortez; Alex
Yue; Kathy
Zhang; Xiaoyue
Singh; Manmohan
Skibinski; David |
San Diego
San Diego
San Diego
Riverside
San Diego
Lexington
Siena |
CA
CA
CA
CA
CA
MA
N/A |
US
US
US
US
US
US
IT |
|
|
Assignee: |
IRM LLC (Hamilton,
BM)
|
Family
ID: |
43625759 |
Appl.
No.: |
12/874,153 |
Filed: |
September 1, 2010 |
Prior Publication Data
|
|
|
|
Document
Identifier |
Publication Date |
|
US 20110053893 A1 |
Mar 3, 2011 |
|
Related U.S. Patent Documents
|
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
Issue Date |
|
|
61239217 |
Sep 2, 2009 |
|
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61P
29/00 (20180101); A61P 31/00 (20180101); A61P
35/00 (20180101); A61P 11/02 (20180101); C07F
9/6561 (20130101); A61P 1/04 (20180101); A61P
17/00 (20180101); A61P 19/02 (20180101); A61P
37/00 (20180101); A61P 25/00 (20180101); A61P
37/06 (20180101); A61P 11/06 (20180101); C07D
471/04 (20130101); A61P 31/04 (20180101); A61P
31/18 (20180101); A61P 11/00 (20180101); A61P
43/00 (20180101); A61P 17/06 (20180101) |
Current International
Class: |
A01N
61/00 (20060101); A61K 31/00 (20060101); A61K
31/675 (20060101); A01N 57/00 (20060101) |
Field of
Search: |
;514/1,81 |
References Cited
[Referenced By]
U.S. Patent Documents
Foreign Patent Documents
|
|
|
|
|
|
|
WO2004111051 |
|
Dec 2004 |
|
WO |
|
WO 2007109813 |
|
Sep 2007 |
|
WO |
|
WO 2009/111337 |
|
Sep 2009 |
|
WO |
|
WO2009111337 |
|
Sep 2009 |
|
WO |
|
WO 2010/144734 |
|
Dec 2010 |
|
WO |
|
WO2010144734 |
|
Dec 2010 |
|
WO |
|
Other References
Giannini, et al., "Enhanced humoral and memory B cellular immunity
using HPV 16/18 L1 VLP vaccine formulated with the MPL/aluminium
salt combination (AS04) compared to aluminium salt only", Vaccine,
2006, pp. 5937-5949, vol. 24, Issues 33-34, Elsevier Science Ltd.,
US. cited by applicant .
Romanenko, et al., "Fluorinated Phosphonates: Synthesis and
Biomedical Application", Chem. Rev., 2006, pp. 3868-3935, vol. 106,
American Chemical Society, US. cited by applicant .
Hem, et al., "Relationship between physical and chemical properties
of aluminum-containing adjuvants and immunopotentiation", Expert
Rev. Vaccines, 2007, pp. 685-698, vol. 6, Issue 5, Future Drugs,
Ltd., United Kingdom. cited by applicant .
Hansen, et al., "Relationship between the strength of antigen
adsorption to an aluminium-containing adjuvant and the immune
response", Vaccine, 2007, vol. 25, pp. 6618-6624, Elsevier Science
Ltd., US. cited by applicant .
Pichichero, "Improving vaccine delivery using novel adjuvant
systems", Human Vaccines, Jul./Aug. 2008, vol. 4, Issue 4, pp.
262-270, Landes Bioscience, US. cited by applicant .
Zhao, et al., "Surface Phosphophilicity of Aluminum-Containing
Adjuvants Probed by Their Efficiency for Catalyzing the P-O Bond
Cleavage with Chromogenic and Fluorogenic Substrates", Analytical
Biochemistry, 2001, vol. 295, pp. 76-81, Academic Press, US. cited
by applicant .
Morefield, G.L., et al., Effect of phosphorylation of ovalbumin on
adsorption by aluminum-containing adjuvants and elution upon
exposure to interstitial fluid. Vaccine, 2005. 23(12): p. 1502-6.
cited by applicant .
Iyer, S., Hogenesch, H, and Hem, S.L., Effect of the degree of
phosphate substitution in aluminum hydroxide adjuvant on the
adsorption of phosphorylated proteins. Pharm Dev Technol, 2003.
8(1): p. 81-6. cited by applicant .
Didierlaurent, A.M., et al., AS04, an aluminum salt-and TLR4
agonist-based adjuvant system, induces a transient localized innate
immune response leading to enhanced adaptive immunity. The Journal
of Immunology, 2009. 183(10): p. 6186. cited by applicant .
Matheis, W., A. Zott and M. Schwanig, The role of the adsorption
process for production and control combined adsorbed vaccines.
Vaccine, 2001. 20(1-2): p. 67-73. cited by applicant .
Rinella, J.V., et al., Effect of anions on model
aluminum-adjuvant-containing vaccines. Journal of Colloid and
Interface Science, 1995. 172(172): p. 121-130. cited by
applicant.
|
Primary Examiner: Sznaidman; Marcos
Attorney, Agent or Firm: The Genomics Institute of the
Novartis Research Foundation Raymond; Daniel E.
Government Interests
STATEMENT OF GOVERNMENT SUPPORT
This invention was made in part with Government support under DTRA
Grant No. HDTRA1-07-9-0001 awarded by the Department of Defense.
The Government has certain rights in the invention.
Parent Case Text
CROSS-REFERENCE TO RELATED APPLICATIONS
This application claims the benefit of priority under 35 U.S.C.
.sctn.119(e) to U.S. Provisional Patent Application No. 61/239,217,
filed Sep. 2, 2009, the disclosure which is incorporated herein by
reference in its entirety and for all purposes.
Claims
We claim:
1. A compound of Formula (I), or pharmaceutically acceptable salt
thereof: ##STR00084## wherein: R.sup.1 is -L.sup.2R.sup.5,
-L.sup.2R.sup.6, --OL.sup.2R.sup.5, or --OL.sup.2R.sup.6 L.sup.2 is
C.sub.1-C.sub.6alkylene, C.sub.2-C.sub.6alkenylene, or
--((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--, wherein the
C.sub.1-C.sub.6alkylene and C.sub.2-C.sub.6alkenylene of L.sup.2
are optionally substituted with 1 to 4 fluoro groups; each L.sup.3
is independently selected from C.sub.1-C.sub.6alkylene and
--((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--, wherein the
C.sub.1-C.sub.6alkylene of L.sup.3 is optionally substituted with 1
to 4 fluoro groups; R.sup.2 is H or C.sub.1-C.sub.4alkyl; R.sup.3
is selected from -L.sup.3R.sup.5, -L.sup.3R.sup.7,
--OL.sup.3R.sup.7; each R.sup.4 is independently selected from H
and fluoro; R.sup.5 is --P(O)(OH).sub.2, R.sup.6 is
--CF.sub.2P(O)(OH).sub.2 or --C(O)OH; R.sup.7 is
--CF.sub.2P(O)(OH).sub.2 or --C(O)OH; each p is independently
selected from 1, 2, 3, 4, 5 and 6, and q is 1, 2, 3 or 4.
2. A compound of Formula (I), or pharmaceutically acceptable salt
thereof: ##STR00085## wherein: R.sup.1 is -L.sup.2R.sup.6; R.sup.2
is C.sub.i-C.sub.6alkyl; R.sup.3 is --OL.sup.3R.sup.5 or
--OL.sup.3R.sup.7; R.sup.5 is --P(O)(OH).sub.2; R.sup.6 is
--C(O)OH; R.sup.7 is --CF.sub.2P(O)(OH).sub.2; L.sup.2 is
C.sub.1-C.sub.6alkylene, and L.sup.3 is C.sub.1-C.sub.6alkylene
substituted with 1 to 4 fluoro groups.
3. The compound of claim 1, wherein: R.sup.1 is -L.sup.2R.sup.6;
R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is --OL.sup.3R.sup.5 or
--OL.sup.3R.sup.7; R.sup.5 is --P(O)(OH).sub.2; R.sup.6 is
--C(O)OH; R.sup.7 is --CF.sub.2P(O)(OH).sub.2; L.sup.2 is
C.sub.i-C.sub.6alkylene; L.sup.3 is
--((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--; R.sup.4 is H;
q is 1 or 2, and p is 2.
4. The compound of claim 1, wherein R.sup.2 is methyl.
5. The compound of claim 1, wherein the compound is selected from:
3-(5-amino-2-(4-(4,4-difluoro-4-phosphonobutoxy)-2-methylphenethyl)benzo[-
f][1,7]naphthyridin-8-yl)propanoic acid
3-(5-amino-2-(4-(2-(3,3-difluoro-3-phosphonopropoxy)ethoxy)-2-methylphene-
thyl)benzo[f][1,7]naphthyridin-8-yl)propanoic acid;
3-(5-amino-2-(2-methyl-4-(2-(2-(2-phosphonoethoxy)ethoxy)ethoxy)phenethyl-
)benzo[f][1,7]naphthyridin-8-yl)propanoic acid;
3-(5-amino-2-(2-methyl-4-(3-phosphonopropoxy)phenethyl)benzo[f][1,7]napht-
hyridin-8-yl)propanoic acid; and
3-(5-amino-2-(4-(2-(2-(3,3-difluoro-3-phosphonopropoxy)ethoxy)ethoxy)-2-m-
ethylphenethyl)benzo[f][1,7]naphthyridin-8-yl)propanoic acid.
6. A pharmaceutical composition comprising a therapeutically
effective amount of a compound of claim 1 and a pharmaceutically
acceptable carrier.
7. A method for activating a TLR7 receptor, wherein the method
comprises administering to a system or a subject a therapeutically
effective amount of a compound of Formula (I) of claim 1.
Description
FIELD OF THE INVENTION
The invention relates to modulators of Toll-Like Receptors (TLRs),
and methods of using such compounds.
BACKGROUND OF THE INVENTION
Early detection of specific classes of pathogens is accomplished by
the innate immune system with the help of pattern recognition
receptors (PRRs). The detected pathogens include viruses, bacteria,
protozoa and fungi, and each constitutively expresses a set of
class-specific, mutation-resistant molecules called
pathogen-associated molecular patterns (PAMPs). These molecular
markers may be composed of proteins, carbohydrates, lipids, nucleic
acids or combinations thereof, and may be located internally or
externally. Examples of PAMPs include bacterial carbohydrates
(lipopolysaccharide or LPS, mannose), nucleic acids (bacterial or
viral DNA or RNA), peptidoglycans and lipotechoic acids (from Gram
positive bacteria), N-formylmethionine, lipoproteins and fungal
glucans.
Pattern recognition receptors have evolved to take advantage of
three PAMP qualities. First, constitutive expression allows the
host to detect the pathogen regardless of its life cycle stage.
Second, the PAMPs are class specific, which allows the host to
distinguish between pathogens and thereby tailor its response.
Third, mutation resistance allows the host to recognize the
pathogen regardless of its particular strain.
Pattern recognition receptors are involved in more than just
recognition of pathogens via their PAMPs. Once bound, pattern
recognition receptors tend to cluster, recruit other extracellular
and intracellular proteins to the complex, and initiate signaling
cascades that ultimately impact transcription. Additionally,
pattern recognition receptors are involved in activation of
complement, coagulation, phagocytosis, inflammation, and apoptosis
functions in response to pathogen detection.
Pattern recognition receptors (PRRs) may be divided into endocytic
PRRs or signaling PRRs. The signaling PRRs include the large
families of membrane-bound Toll-like receptors (TLRs) and
cytoplasmic NOD-like receptors, while the endocytic PRRs promote
the attachment, engulfment and destruction of microorganisms by
phagocytes without relaying an intracellular signal, are found on
all phagocytes and mediate removal of apoptotic cells. In addition,
endocytic PRRs recognize carbohydrates and include mannose
receptors of macrophages, glucan receptors present on all
phagocytes and scavenger receptors that recognize charged
ligands.
SUMMARY OF THE INVENTION
Provided herein are compounds and pharmaceutical compositions
thereof, which are agonists of toll-like receptor 7 (TLR7). Such
TLR7 agonists are immune potentiators that bind to
aluminum-containing adjuvants, such as, by way of example only,
aluminum hydroxide, aluminum oxyhydroxide and aluminum
hydroxyphosphate. Thus, also provided herein are immunogenic
compositions that contain an antigen and a TLR7 agonist provided
herein that bind to aluminum-containing adjuvants. When such
immunogenic compositions are administered to a subject in need
thereof, such TLR7 agonists enhance the immune response to the
immunogenic composition.
In one aspect provided herein such compounds, and the
pharmaceutically acceptable salts, pharmaceutically acceptable
solvates (e.g. hydrates), the N-oxide derivatives, prodrug
derivatives, protected derivatives, individual isomers and mixture
of isomers thereof, have a structure according to Formula (I):
##STR00001## wherein: R.sup.1 is H, C.sub.1-C.sub.6alkyl,
--C(R.sup.5).sub.2OH, -L.sup.1R.sup.5, -L.sup.1R.sup.6,
-L.sup.2R.sup.5, -L.sup.2R.sup.6, --OL.sup.2R.sup.5, or
--OL.sup.2R.sup.6; L.sup.1 is --C(O)-- or --O--; L.sup.2 is
C.sub.1-C.sub.6alkylene, C.sub.2-C.sub.6alkenylene, arylene,
heteroarylene or
--((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--, wherein the
C.sub.1-C.sub.6alkylene and C.sub.2-C.sub.6alkenylene of L.sup.2
are optionally substituted with 1 to 4 fluoro groups; each L.sup.3
is independently selected from C.sub.1-C.sub.6alkylene and
--((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--, wherein the
C.sub.1-C.sub.6alkylene of L.sup.3 is optionally substituted with 1
to 4 fluoro groups; L.sup.4 is arylene or heteroarylene; R.sup.2 is
H or C.sub.1-C.sub.6alkyl; R.sup.3 is selected from
C.sub.1-C.sub.4alkyl, -L.sup.3R.sup.5, -L.sup.1R.sup.5,
-L.sup.3R.sup.7, -L.sup.3L.sup.4L.sup.3R.sup.7,
-L.sup.3L.sup.4R.sup.5, -L.sup.3L.sup.4L.sup.3R.sup.5,
--OL.sup.3R.sup.5, --OL.sup.3R.sup.7, --OL.sup.3L.sup.4R.sup.7,
--OL.sup.3L.sup.4L.sup.3R.sup.7, --OR.sup.8,
--OL.sup.3L.sup.4R.sup.5, --OL.sup.3L.sup.4L.sup.3R.sup.5 and
--C(R.sup.5).sub.2OH; each R.sup.4 is independently selected from H
and fluoro; R.sup.5 is --P(O)(OR.sup.9).sub.2, R.sup.6 is
--CF.sub.2P(O)(OR.sup.9).sub.2 or --C(O)OR.sup.10; R.sup.7 is
--CF.sub.2P(O)(OR.sup.9).sub.2 or --C(O)OR.sup.10; R.sup.8 is H or
C.sub.1-C.sub.4alkyl; each R.sup.9 is independently selected from H
and C.sub.1-C.sub.6alkyl; R.sup.10 is H or C.sub.1-C.sub.4alkyl;
each p is independently selected from 1, 2, 3, 4, 5 and 6, and q is
1, 2, 3 or 4; with the proviso that when R.sup.3 is C.sub.1-C.sub.4
alkyl or --OR.sup.8, R.sup.1 is --C(R.sup.5).sub.2OH,
-L.sup.1R.sup.5, -L.sup.1R.sup.6, -L.sup.2R.sup.5, -L.sup.2R.sup.6,
--OL.sup.2R.sup.5, or --OL.sup.2R.sup.6, wherein R.sup.6 is
--CF.sub.2P(O)(OR.sup.9).sub.2 and R.sup.7 is
--CF.sub.2P(O)(OR.sup.9).sub.2.
In certain embodiments of the compounds of Formula (I), R.sup.1 is
C.sub.1-C.sub.6 alkyl, in other embodiments R.sup.1 is a methyl. In
certain embodiments, R.sup.1 is H. In other embodiments, R.sup.1 is
--C(R.sup.5).sub.2OH, -L.sup.1R.sup.5, -L.sup.1R.sup.6,
-L.sup.2R.sup.5, -L.sup.2R.sup.6, --OL.sup.2R.sup.5, or
--OL.sup.2R.sup.6.
In certain embodiments of the compounds of Formula (I), when
R.sup.1--C(R.sup.5).sub.2OH, -L.sup.1R.sup.5, -L.sup.1R.sup.6,
-L.sup.2R.sup.5, -L.sup.2R.sup.6, --OL.sup.2R.sup.5, or
--OL.sup.2R.sup.6, then R.sup.3 is --OR.sup.8 or C.sub.1-C.sub.6
alkyl. In certain embodiments, R.sup.1 is --C(R.sup.5).sub.2OH,
-L.sup.1R.sup.5, -L.sup.1R.sup.6, -L.sup.2R.sup.5, -L.sup.2R.sup.6,
--OL.sup.2R.sup.5, or --OL.sup.2R.sup.6, and R.sup.3 is --OMe.
In some embodiments of the compounds of Formula (I), R.sup.3 is
C.sub.1-C.sub.6alkyl. In certain embodiments, R.sup.2 is
methyl.
In some embodiments of the compounds of Formula (I), R.sup.3 is
selected from C.sub.1-C.sub.4 alkyl, -L.sup.3R.sup.5,
-L.sup.1R.sup.5, -L.sup.3R.sup.7, -L.sup.3L.sup.4L.sup.3R.sup.7,
-L.sup.3L.sup.4R.sup.5, and -L.sup.3L.sup.4L.sup.3R.sup.5. In
alternative embodiments, R.sup.3 is selected from
--OL.sup.3R.sup.5, --OL.sup.3R.sup.7, --OL.sup.3L.sup.4R.sup.7,
--OL.sup.3L.sup.4L.sup.3R.sup.7, --OR.sup.8,
--OL.sup.3L.sup.4R.sup.5, --OL.sup.3L.sup.4L.sup.3R.sup.5 and
--C(R.sup.5).sub.2OH. In certain embodiments, R.sup.3 is
--OL.sup.3R.sup.5, wherein --OL.sup.3R.sup.5 is a group of the
formula --O(CH.sub.2).sub.1-5P(O)(OR).sub.2. In other embodiments,
R.sup.3 is --OL.sup.3R.sup.5, wherein --OL.sup.3R.sup.5 is a group
of the formula --O(CH.sub.2).sub.1-5CF.sub.2P(O)(OR).sub.2.
In some embodiments, R.sup.3 is selected from C.sub.1-C.sub.4alkyl,
-L.sup.3R.sup.5, -L.sup.1R.sup.5, -L.sup.3R.sup.7,
-L.sup.3L.sup.4L.sup.3R.sup.7, -L.sup.3L.sup.4R.sup.5,
-L.sup.3L.sup.4L.sup.3R.sup.5, --OL.sup.3R.sup.5,
--OL.sup.3R.sup.7, --OL.sup.3L.sup.4R.sup.7,
--OL.sup.3L.sup.4L.sup.3R.sup.7, --OR.sup.8,
--OL.sup.3L.sup.4R.sup.5, and --OL.sup.3L.sup.4L.sup.3R.sup.5.
Where more than one R.sup.9 is present, as in compounds comprising
a --P(O)(OR.sup.9).sub.2, moiety, the R.sup.9 groups are the same
or are different. In certain embodiments of such compounds of
Formula (I), R.sup.9 is H at each occurrence. In other embodiments,
at least one R.sup.9 is H and the other R.sup.9 is
C.sub.1-C.sub.6alkyl. In other embodiments, at least one R.sup.9 is
H and the other R.sup.9 is methyl. In other embodiments, at least
one R.sup.9 is H and the other R.sup.9 is ethyl. In other
embodiments of such compounds of Formula (I), each R.sup.9 is
C.sub.1-C.sub.6alkyl and in certain embodiments, R.sup.9 is methyl
or ethyl, or a combination thereof.
In certain embodiments of the compounds of Formula (I), L.sup.2
and/or L.sup.3 is a group of the formula
--((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--, and in
certain embodiments, this group is of the formula
--(CH.sub.2CH.sub.2O).sub.1-3(CH.sub.2).sub.1-3--.
In certain embodiments of the compounds of Formula (I), L.sup.2 is
C.sub.1-C.sub.6 alkylene, while in other embodiments L.sup.2 is
C.sub.1-C.sub.6 alkylene substituted with one to four fluoro
groups. In certain embodiments of such compounds of Formula (I),
L.sup.2 is of the formula (CH.sub.2).sub.0-5CF.sub.2, wherein the
fluoro-substituted carbon is not directly attached to the phenyl
ring of Formula I. In certain embodiments of the compounds of
Formula (I), L.sup.2 is C.sub.2-C.sub.6 alkenylene, while in other
embodiments L.sup.2 is C.sub.2-C.sub.6 alkenylene substituted with
one to four fluoro groups.
In certain embodiments of the compounds of Formula (I), L.sup.3 is
C.sub.1-C.sub.6 alkylene while in other embodiments L.sup.3 is
C.sub.1-C.sub.6 alkylene substituted with one to four fluoro
groups. In certain embodiments of such compounds of Formula (I),
L.sup.3 is of the formula (CH.sub.2).sub.0-5CF.sub.2, wherein the
fluoro-substituted carbon is not directly attached to the phenyl
ring of Formula I.
In certain embodiments of the compounds of Formula (I), L.sup.2 is
arylene or heteroarylene. In some of these embodiments, L.sup.2 is
phenylene, such as 1,3-disubstituted phenylene or 1,4-disubstituted
phenylene.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
C.sub.1-C.sub.6alkyl; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3R.sup.5 or --OL.sup.3R.sup.7; R.sup.5 is
--P(O)(OR.sup.9).sub.2; R.sup.7 is --CF.sub.2P(O)(OR.sup.9).sub.2,
and L.sup.3 is C.sub.1-C.sub.6alkylene.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
C.sub.1-C.sub.6alkyl; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3R.sup.5 or --OL.sup.3R.sup.7; R.sup.5 is
--P(O)(OR.sup.9).sub.2; R.sup.7 is --CF.sub.2P(O)(OR.sup.9).sub.2;
L.sup.3 is --((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--;
R.sup.4 is H; q is 1 or 2, and p is 2.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
-L.sup.2R.sup.6; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3R.sup.5 or --OL.sup.3R.sup.7; R.sup.5 is
--P(O)(OR.sup.9).sub.2; R.sup.6 is --C(O)OR.sup.10; R.sup.7 is
--CF.sub.2P(O)(OR.sup.9).sub.2; L.sup.2 is C.sub.1-C.sub.6alkylene,
and L.sup.3 is C.sub.1-C.sub.6alkylene.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
-L.sup.2R.sup.6; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3R.sup.5 or --OL.sup.3R.sup.7; R.sup.5 is
--P(O)(OR.sup.9).sub.2; R.sup.6 is --C(O)OR.sup.10; R.sup.7 is
--CF.sub.2P(O)(OR.sup.9).sub.2; L.sup.2 is C.sub.1-C.sub.6alkylene;
L.sup.3 is --((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--;
R.sup.4 is H; q is 1 or 2, and p is 2.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
--C(R.sup.5).sub.2OH, -L.sup.1R.sup.5, -L.sup.2R.sup.5 or
-L.sup.1R.sup.6; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OR.sup.8; R.sup.8 is C.sub.1-C.sub.6alkyl; R.sup.5 is
--P(O)(OR.sup.9).sub.2; R.sup.6 is --CF.sub.2P(O)(OR.sup.9).sub.2;
L.sup.1 is --C(O)--, and L.sup.2 is C.sub.1-C.sub.6alkylene or
C.sub.2-C.sub.6alkenylene, each optionally substituted with 1 to 4
fluoro groups.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
C.sub.1-C.sub.6alkyl; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3L.sup.4R.sup.5--OL.sup.3L.sup.4L.sup.3R.sup.5, or
--OL.sup.3L.sup.4L.sup.3R.sup.7; R.sup.5 is --P(O)(OR.sup.9).sub.2;
R.sup.7 is --CF.sub.2P(O)(OR.sup.9).sub.2; each L.sup.3 is
independently a C.sub.1-C.sub.6alkylene, and L.sup.4 is
phenylene.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
C.sub.1-C.sub.6alkyl; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--C(R.sup.5).sub.2OH or -L.sup.1R.sup.5; R.sup.5 is
--P(O)(OR.sup.9).sub.2, and L.sup.1 is --C(O)-- or --O--.
In certain embodiments, of such compounds of Formula (I), and the
pharmaceutically acceptable salts, pharmaceutically acceptable
solvates (e.g. hydrates), the N-oxide derivatives, prodrug
derivatives, protected derivatives, individual isomers and mixture
of isomers thereof,
##STR00002## R.sup.1 is C.sub.1-C.sub.4alkyl, --C(R.sup.5).sub.2OH,
-L.sup.1R.sup.5, -L.sup.2R.sup.5, -L.sup.2R.sup.6,
--OL.sup.2R.sup.5, or --OL.sup.2R.sup.6; L.sup.1 is --C(O)-- or
--O--; L.sup.2 is C.sub.1-C.sub.6alkylene,
C.sub.2-C.sub.6alkenylene, arylene, heteroarylene or
--((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--, wherein the
C.sub.1-C.sub.6alkylene and C.sub.2-C.sub.6alkenylene of L.sup.2
are optionally substituted with 1 to 4 fluoro groups; each L.sup.3
is independently selected from C.sub.1-C.sub.6alkylene and
--((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--, wherein the
C.sub.1-C.sub.6alkylene of L.sup.3 is optionally substituted with 1
to 4 fluoro groups; L.sup.4 is arylene or heteroarylene; R.sup.2 is
H or C.sub.1-C.sub.4alkyl; R.sup.3 is selected from
C.sub.1-C.sub.4alkyl, -L.sup.3R.sup.5, -L.sup.1R.sup.5,
-L.sup.3R.sup.7, -L.sup.3L.sup.4L.sup.3R.sup.7,
-L.sup.3L.sup.4R.sup.5, -L.sup.3L.sup.4L.sup.3R.sup.5,
--OL.sup.3R.sup.5, --OL.sup.3R.sup.7, --OL.sup.3L.sup.4R.sup.7,
--OL.sup.3L.sup.4L.sup.3R.sup.7, --OR.sup.8,
--OL.sup.3L.sup.4R.sup.5, --OL.sup.3L.sup.4L.sup.3R.sup.5 and
--C(R.sup.5).sub.2OH; each R.sup.4 is independently selected from H
and fluoro; R.sup.5 is --P(O)(OH).sub.2, R.sup.6 is
--CF.sub.2P(O)(OH).sub.2 or --C(O)OH; R.sup.7 is
--CF.sub.2P(O)(OH).sub.2 or --C(O)OH; R.sup.8 is H or
C.sub.1-C.sub.4alkyl; each p is independently selected from 1, 2,
3, 4, 5 and 6; q is 1, 2, 3 or 4, with the proviso that when
R.sup.3 is --OR.sup.8, R.sup.1 is --C(R.sup.5).sub.2OH,
-L.sup.1R.sup.5, -L.sup.1R.sup.6, -L.sup.2R.sup.5, -L.sup.2R.sup.6,
--OL.sup.2R.sup.5, or --OL.sup.2R.sup.6, wherein R.sup.6 is
--CF.sub.2P(O)(OH).sub.2 and R.sup.7 is
--CF.sub.2P(O)(OH).sub.2.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
C.sub.1-C.sub.6alkyl; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3R.sup.5 or --OL.sup.3R.sup.7; R.sup.5 is
--P(O)(OH).sub.2; R.sup.7 is --CF.sub.2P(O)(OH).sub.2, and L.sup.3
is C.sub.1-C.sub.6alkylene.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
C.sub.1-C.sub.6alkyl; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3R.sup.5 or --OL.sup.3R.sup.7; R.sup.5 is
--P(O)(OH).sub.2; R.sup.7 is --CF.sub.2P(O)(OH).sub.2; L.sup.3 is
--((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--; R.sup.4 is H;
q is 1 or 2, and p is 2.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
-L.sup.2R.sup.6; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3R.sup.5 or --OL.sup.3R.sup.7; R.sup.5 is
--P(O)(OH).sub.2; R.sup.6 is --C(O)OH; R.sup.7 is
--CF.sub.2P(O)(OH).sub.2; L.sup.2 is C.sub.1-C.sub.6alkylene, and
L.sup.3 is C.sub.1-C.sub.6alkylene.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
-L.sup.2R.sup.6; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3R.sup.5 or --OL.sup.3R.sup.7; R.sup.5 is
--P(O)(OH).sub.2; R.sup.6 is --C(O)OH; R.sup.7 is
--CF.sub.2P(O)(OH).sub.2; L.sup.2 is C.sub.1-C.sub.6alkylene;
L.sup.3 is -((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--;
R.sup.4 is H; q is 1 or 2, and p is 2.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
--C(R.sup.5).sub.2OH, -L.sup.1R.sup.5, -L.sup.2R.sup.5 or
-L.sup.1R.sup.6; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OR.sup.8; R.sup.8 is C.sub.1-C.sub.6alkyl; R.sup.5 is
--P(O)(OH).sub.2; R.sup.6 is --CF.sub.2P(O)(OH).sub.2; L.sup.1 is
--C(O)--, and L.sup.2 is C.sub.1-C.sub.6alkylene or
C.sub.2-C.sub.6alkenylene, each optionally substituted with 1 to 4
fluoro groups.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
C.sub.1-C.sub.6alkyl; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3L.sup.4R.sup.5--OL.sup.3L.sup.4L.sup.3R.sup.5, or
--OL.sup.3L.sup.4L.sup.3R.sup.7; R.sup.5 is --P(O)(OH).sub.2;
R.sup.7 is --CF.sub.2P(O)(OH).sub.2; each L.sup.3 is independently
a C.sub.1-C.sub.6alkylene, and L.sup.4 is phenylene.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
C.sub.1-C.sub.6alkyl; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--C(R.sup.5).sub.2OH or -L.sup.1R.sup.5; R.sup.5 is
--P(O)(OR.sup.9).sub.2, and L.sup.1 is --C(O)-- or --O--.
In certain embodiments of the aformentioned compounds of Formula
(I), R.sup.8 is methyl. In certain embodiments of the aformentioned
compounds of Formula (I), R.sup.1 is methyl. In certain embodiments
of the aformentioned compounds of Formula (I), R.sup.2 is
methyl.
In certain embodiments of the compounds of Formula (I) is selected
from:
4-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)-1,1-difluorobutylphosphonic acid;
3-(5-amino-2-(4-(4,4-difluoro-4-phosphonobutoxy)-2-methylphenethyl)benzo[-
f][1,7]naphthyridin-8-yl)propanoic acid;
3-(5-amino-2-(4-(2-(3,3-difluoro-3-phosphonopropoxy)ethoxy)-2-methylphene-
thyl)benzo[f][1,7]naphthyridin-8-yl)propanoic acid;
3-(5-amino-2-(2-methyl-4-(2-(2-(2-phosphonoethoxy)ethoxy)ethoxy)phenethyl-
)benzo[f][1,7]naphthyridin-8-yl)propanoic acid;
4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylpheny-
l dihydrogen phosphate;
(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylphen-
oxy)methylphosphonic acid;
5-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)-1,1-difluoropentylphosphonic acid;
4-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)-1,1-difluorobutylphosphonic acid;
3-(2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methy-
lphenoxy)ethoxy)-1,1-difluoropropylphosphonic acid;
2-(4-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-meth-
ylphenoxy)methyl)phenyl)-1,1-difluoroethylphosphonic acid;
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
-1,1-difluoro-2-oxoethylphosphonic acid;
(E)-2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-
-yl)vinylphosphonic acid;
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
ethylphosphonic acid;
(E)-2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-
-yl)-1-fluorovinylphosphonic acid;
3-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylp-
henoxy)methyl)phenylphosphonic acid;
5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridine-8-carbo-
nylphosphonic acid;
3-(5-amino-2-(2-methyl-4-(3-phosphonopropoxy)phenethyl)benzo[f][1,7]napht-
hyridin-8-yl)propanoic acid;
3-(5-amino-2-(4-(2-(2-(3,3-difluoro-3-phosphonopropoxy)ethoxy)ethoxy)-2-m-
ethylphenethyl)benzo[f][1,7]naphthyridin-8-yl)propanoic acid;
3-(5-amino-2-(2-methyl-4-(2-(2-phosphonoethoxy)ethoxy)phenethyl)benzo[f][-
1,7]naphthyridin-8-yl)propanoic acid;
2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)ethylphosphonic acid;
6-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)hexylphosphonic acid;
6-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)-1,1-difluorohexylphosphonic acid;
4-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylp-
henoxy)methyl)benzylphosphonic acid;
2-(2-(2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-me-
thylphenoxy)ethoxy)ethoxy)ethylphosphonic acid;
3-[5-amino-2-(2-{4-[2-(3,3-difluoro-3-phosphonopropoxy)ethoxy]-2-methylph-
enyl}ethyl)benzo[f]1,7-naphthyridin-8-yl]propanoic acid;
{5-[4-(2-{5-amino-8-methylbenzo[f]1,7-naphthyridin-2-yl}ethyl)-3-methylph-
enoxy]pentyl}phosphonic acid, and
{4-[4-(2-{5-amino-8-methylbenzo[f]1,7-naphthyridin-2-yl}ethyl)-3-methylph-
enoxy]butyl}phosphonic acid. Each of these compounds individually
comprises a preferred embodiment of the compounds, compositions,
and methods described herein.
Another aspect provided herein, is methods of using compounds of
Formula (I), and pharmaceutical compositions comprising such
compounds.
Another aspect provided herein are pharmaceutical compositions that
include a therapeutically effective amount of a compound of Formula
(I), and a pharmaceutically acceptable carrier. In certain
embodiments of such pharmaceutical compositions, the pharmaceutical
composition is formulated for intravenous administration,
intravitrial administration, intramuscular administration, oral
administration, rectal administration inhalation, nasal
administration, topical administration, ophthalmic administration
or otic administration. In other embodiments, the pharmaceutical
compositions are in the form of a tablet, a pill, a capsule, a
liquid, an inhalant, a nasal spray solution, a suppository, a
solution, an emulsion, an ointment, eye drop or ear drop. In other
embodiments, such pharmaceutical compositions further include one
or more additional therapeutic agents.
Another aspect provided herein are pharmaceutical compositions that
include a therapeutically effective amount of a compound of Formula
(I), an aluminum-containing adjuvant, an antigen and a
pharmaceutically acceptable carrier. In such pharmaceutical
compositions the compound of Formula (I) is present in an amount
sufficient to produce an immunostimulatory effect when
administered. In certain embodiments of such pharmaceutical
compositions, the pharmaceutical composition is formulated for
intravenous administration, intravitrial administration or
intramuscular administration. In such compositions the
aluminum-containing adjuvant is selected from aluminum hydroxide,
aluminum oxyhydroxide and aluminum hydroxyphosphate. In certain
embodiments of such compositions, the aluminum-containing adjuvant
is aluminum oxyhydroxide or aluminum hydroxide.
Another aspect provided herein is a pharmaceutical composition that
includes a therapeutically effective amount of a compound of
Formula (I) bound to an aluminum-containing adjuvant and a
pharmaceutically acceptable carrier. In certain embodiments, such a
composition is a dried down solid. In certain embodiments, such a
composition is a lyophilized solid. In such compositions the
aluminum-containing adjuvant is selected from aluminum hydroxide,
aluminum oxyhydroxide and aluminum hydroxyphosphate. In certain
embodiments of such compositions, the aluminum-containing adjuvant
is aluminum oxyhydroxide or aluminum hydroxide.
Another aspect provided herein are immunogenic compositions
comprising a compound of Formula (I), an aluminum-containing
adjuvant and an antigen. In certain embodiments, the compound of
Formula (I) is present in an amount effective to elicit, induce or
enhance an immune response to the antigen in a subject to whom the
composition is administered. In such immunogenic compositions the
compound of Formula (I) is present in an amount sufficient to
produce an immunostimulatory effect when administered. In such
immunogenic compositions the aluminum-containing adjuvant is
selected from aluminum hydroxide, aluminum oxyhydroxide and
aluminum hydroxyphosphate. In certain embodiments of such
immunogenic compositions, the aluminum-containing adjuvant is
aluminum oxyhydroxide or aluminum hydroxide. In certain embodiments
of such immunogenic compositions, the antigen is a bacterial
antigen. In other embodiments of such immunogenic compositions, the
antigen is a viral antigen or a fungal antigen. In certain
embodiments of such immunogenic compositions, the antigen is a
polypeptide. In certain embodiments such immunogenic compositions
further comprise an additional adjuvant. In certain embodiments,
such an immunogenic composition is a dried down solid. In certain
embodiments, such an immunogenic composition is a lyophilized
solid.
In certain embodiments, compounds of the invention are not
bisphosphonates.
Another aspect provided herein is a method for enhancing the
effectiveness of an immunogenic composition, wherein the
immunogenic composition comprises an aluminum-containing adjuvant,
and the method comprises adding an effective amount of a compound
of Formula (I) to the immunogenic composition. In such methods the
aluminum-containing adjuvant is selected from aluminum hydroxide,
aluminum oxyhydroxide and aluminum hydroxyphosphate. In certain
embodiments of such methods, the aluminum-containing adjuvant is
aluminum oxyhydroxide or aluminum hydroxide.
Another aspect provided herein are methods for eliciting or
inducing an immune response in a vertebrate subject comprising
administering to the vertebrate subject an effective amount of an
immunogenic composition of the invention. In some embodiments, the
present invention provides methods for eliciting or inducing a
cytotoxic-T lymphocyte (CTL) response in a vertebrate subject
comprising administering to the vertebrate subject an effective
amount of an immunogenic composition of the invention. In other
embodiments, the present invention provides methods of eliciting or
inducing an antibody-mediated immune response in a vertebrate
subject comprising administering to the vertebrate subject an
effective amount of an immunogenic composition of the
invention.
Another aspect provided herein are methods of making immunogenic
compositions described herein.
Another aspect provided herein are vaccine compositions that
comprise an immunogenic composition of the invention.
Another aspect provided herein are medicaments for treating a
patient with a disease or disorder associated with TLR7 receptor
activity, and such medicaments include a therapeutically effective
amount of a compound of Formula (I) wherein the compound of Formula
(I) is a TLR7 receptor agonist.
Another aspect provided herein is the use of a compound of Formula
(I) in the manufacture of a medicament for treating a disease or
disorder in a patient where modulation of a TLR7 receptor is
implicated.
Another aspect provided herein includes methods for activating a
TLR7 receptor, wherein the method includes administering to a
system or a subject in need thereof, a therapeutically effective
amount of a compound of Formula (I), or pharmaceutically acceptable
salts or pharmaceutical compositions thereof, thereby activating
the TLR receptor. In such methods, the compound of Formula (I) is a
TLR7 receptor agonist. In certain embodiments of such methods, the
methods include administering the compound to a cell or tissue
system or to a human or animal subject.
Another aspect provided herein includes methods for treating a
disease or disorder where modulation of TLR7 receptor is
implicated, wherein the method includes administering to a system
or subject in need of such treatment an effective amount of a
compound of Formula (I), or pharmaceutically acceptable salts or
pharmaceutical compositions thereof, thereby treating the disease
or disorder. In such methods, the compound of Formula (I) is a TLR7
receptor agonist. In certain embodiments of such methods, the
methods include administering the compound to a cell or tissue
system or to a human or animal subject.
In certain embodiments of such methods, the disease or condition is
an infectious disease, an inflammatory disease, a respiratory
disease, a dermatological disease or an autoimmune disease. In
certain embodiments of such methods, the disease or condition is
asthma, chronic obstructive pulmonary disease (COPD), adult
respiratory distress syndrome (ARDS), ulcerative colitis, Crohns
disease, bronchitis, dermatitis, actinic keratosis, basal cell
carcinoma, allergic rhinitis, psoriasis, scleroderma, urticaria,
rheumatoid arthritis, multiple sclerosis, cancer, breast cancer,
HIV or lupus.
Another aspect provided herein includes methods for treating a
cell-proliferative disease, comprising administering to a system or
subject in need of such treatment an effective amount of a compound
of Formula (I), or pharmaceutically acceptable salts or
pharmaceutical compositions thereof; wherein the cell-proliferative
disease is lymphoma, osteosarcoma, melanoma, or a tumor of breast,
renal, prostate, colorectal, thyroid, ovarian, pancreatic,
neuronal, lung, uterine or gastrointestinal tumor.
Another aspect provided herein are pharmaceutical composition that
include a compound of Formula (I), an antigen and a
pharmaceutically acceptable carrier, wherein such pharmaceutical
compositions are immunogenic compositions, and the compound is an
immune potentiator and is present in an amount effective to enhance
an immune response to the antigen, in a subject receiving the
composition. In certain embodiments, such pharmaceutical
compositions, further includes one or more immunoregulatory agents.
In certain embodiments, the one or more immunoregulatory agents
include one or more adjuvants. In certain embodiments, such
adjuvants are selected from adjuvants that are a mineral-containing
composition, an oil emulsion, a saponin formulation, a virosome, a
virus-like particle, a bacterial derivative, a microbial
derivative, a human immunomodulator, a bioadhesive, a mucoadhesive,
a microparticle, a liposome, a polyoxyethylene ether formulation, a
polyoxyethylene ester formulation, a polyphosphazene, a muramyl
peptide, or an imidazoquinolone compound. In certain embodiments,
the adjuvant is an oil emulsion. In certain embodiments the
immunogenic compositions are useful as vaccines, and the compound
is present in an amount sufficient to produce an immunostimulatory
effect upon administration.
Another aspect provided herein is compound for use in a method of
medical treatment, wherein the method of medical treatment is for
treating a disease associated with TLR7 receptor activity, wherein
the disease is selected from an infectious disease, an inflammatory
disease, a respiratory disease, a dermatological disease or an
autoimmune disease, and wherein the compound is a compound of
Formula (I) of claim 1. In certain embodiments of such methods, the
disease or condition is asthma, chronic obstructive pulmonary
disease (COPD), adult respiratory distress syndrome (ARDS),
ulcerative colitis, Crohns disease, bronchitis, dermatitis, actinic
keratosis, basal cell carcinoma, allergic rhinitis, psoriasis,
scleroderma, urticaria, rheumatoid arthritis, multiple sclerosis,
cancer, breast cancer, HIV or lupus.
BRIEF DESCRIPTION OF THE DRAWINGS
FIG. 1 shows the concentration of compound 1 in the supernatant
with and without the addition of aluminum hydroxide. The
concentration was obtained via HPLC analysis.
FIG. 2 shows the effect of the binding of compound 1 to aluminum
hydroxide adjuvant on the binding of antigens of Neisseria
meningitis (MenB) to aluminum hydroxide adjuvant.
DETAILED DESCRIPTION OF THE INVENTION
Definitions
The terms "alkenyl" or "alkene," as used herein, refers to a
partially unsaturated branched or straight chain hydrocarbon having
at least one carbon-carbon double bond. Atoms oriented about the
double bond are in either the cis (Z) or trans (E) conformation. In
certain embodiments such alkenyl or alkene group are optionally
substituted. As used herein, the terms "C.sub.2-C.sub.3alkenyl",
"C.sub.2-C.sub.4alkenyl", "C.sub.2-C.sub.5alkenyl",
"C.sub.2-C.sub.6alkenyl", "C.sub.2-C.sub.7alkenyl", and
"C.sub.2-C.sub.8alkenyl" refer to an alkenyl group containing at
least 2, and at most 3, 4, 5, 6, 7 or 8 carbon atoms, respectively.
If not otherwise specified, an alkenyl group generally is a
C.sub.2-C.sub.6 alkenyl. Non-limiting examples of alkenyl groups,
as used herein, include ethenyl, propenyl, butenyl, pentenyl,
hexenyl, heptenyl, octenyl, nonenyl, decenyl and the like.
The term "alkenylene," as used herein, refers to a partially
unsaturated branched or straight chain divalent hydrocarbon radical
derived from an alkenyl group. In certain embodiments such
alkenylene group are optionally substituted. As used herein, the
terms "C.sub.2-C.sub.3alkenylene", "C.sub.2-C.sub.4alkenylene",
"C.sub.2-C.sub.5alkenylene", "C.sub.2-C.sub.6alkenylene",
"C.sub.2-C.sub.7alkenylene", and "C.sub.2-C.sub.8alkenylene" refer
to an alkenylene group containing at least 2, and at most 3, 4, 5,
6, 7 or 8 carbon atoms respectively. If not otherwise specified, an
alkenylene group generally is a C.sub.2-C.sub.6 alkenylene.
Non-limiting examples of alkenylene groups as used herein include,
ethenylene, propenylene, butenylene, pentenylene, hexenylene,
heptenylene, octenylene, nonenylene, decenylene and the like.
The term "alkyl," as used herein, refers to a saturated branched or
straight chain hydrocarbon. In certain embodiments such alkyl
groups are optionally substituted. As used herein, the terms
"C.sub.1-C.sub.3alkyl", "C.sub.1-C.sub.4alkyl",
"C.sub.1-C.sub.5alkyl", "C.sub.1-C.sub.6alkyl",
"C.sub.1-C.sub.7alkyl" and "C.sub.1-C.sub.8alkyl" refer to an alkyl
group containing at least 1, and at most 3, 4, 5, 6, 7 or 8 carbon
atoms, respectively. If not otherwise specified, an alkyl group
generally is a C.sub.1-C.sub.6 alkyl. Non-limiting examples of
alkyl groups as used herein include methyl, ethyl, n-propyl,
isopropyl, n-butyl, isobutyl, sec-butyl, t-butyl, n-pentyl,
isopentyl, hexyl, heptyl, octyl, nonyl, decyl and the like.
The term "alkylene," as used herein, refers to a saturated branched
or straight chain divalent hydrocarbon radical derived from an
alkyl group. In certain embodiments such alkylene groups are
optionally substituted. As used herein, the terms
"C.sub.1-C.sub.3alkylene", "C.sub.1-C.sub.4alkylene",
"C.sub.1-C.sub.5alkylene", "C.sub.1-C.sub.6alkylene",
"C.sub.1-C.sub.7alkylene" and "C.sub.1-C.sub.8alkylene" refer to an
alkylene group containing at least 1, and at most 3, 4, 5, 6, 7 or
8 carbon atoms respectively. If not otherwise specified, an
alkylene group generally is a C.sub.1-C.sub.6 alkylene.
Non-limiting examples of alkylene groups as used herein include,
methylene, ethylene, n-propylene, isopropylene, n-butylene,
isobutylene, sec-butylene, t-butylene, n-pentylene, isopentylene,
hexylene and the like.
The term "alkoxy," as used herein, refers to the group --OR.sub.a,
where R.sub.a is an alkyl group as defined herein. An alkoxy group
can be optionally substituted. As used herein, the terms
"C.sub.1-C.sub.3alkoxy", "C.sub.1-C.sub.4alkoxy",
"C.sub.1-C.sub.5alkoxy", "C.sub.1-C.sub.6alkoxy",
"C.sub.1-C.sub.7alkoxy" and "C.sub.1-C.sub.8alkoxy" refer to an
alkoxy group wherein the alkyl moiety contains at least 1, and at
most 3, 4, 5, 6, 7 or 8, carbon atoms. Non-limiting examples of
alkoxy groups, as used herein, include methoxy, ethoxy, n-propoxy,
isopropoxy, n-butyloxy, t-butyloxy, pentyloxy, hexyloxy, heptyloxy,
octyloxy, nonyloxy, decyloxy and the like.
The term "aryl," as used herein, refers to monocyclic, bicyclic,
and tricyclic ring systems having a total of five to fourteen ring
members, wherein at least one ring in the system is aromatic and
wherein each ring in the system contains 3 to 7 ring members. In
certain embodiments such aryl groups are optionally substituted.
Non-limiting examples of an aryl group, as used herein, include
phenyl, naphthyl, fluorenyl, indenyl, azulenyl, anthracenyl and the
like. As an optional alternative, the term "aryl" can instead refer
to monocyclic or fused bicyclic ring systems having a total of six,
ten or fourteen carbon atom ring members, optionally substituted
with one or more substituents; non-limiting examples of such aryl
groups include phenyl and naphthyl.
The term "arylene," as used herein means a divalent radical derived
from an aryl group. In certain embodiments such arylene groups are
optionally substituted.
The term "halogen," as used herein, refers to fluorine (F),
chlorine (Cl), bromine (Br), or iodine (I).
The term "halo," as used herein, refers to the halogen radicals:
fluoro (--F), chloro (--Cl), bromo (--Br), and iodo (--I).
The terms "haloalkyl" or "halo-substituted alkyl," as used herein,
refers to an alkyl group as defined herein, substituted with one or
more halogen groups, wherein the halogen groups are the same or
different. A haloalkyl group can be optionally substituted.
Non-limiting examples of such branched or straight chained
haloalkyl groups, as used herein, include methyl, ethyl, propyl,
isopropyl, isobutyl and n-butyl substituted with one or more
halogen groups, wherein the halogen groups are the same or
different, including, but not limited to, trifluoromethyl,
pentafluoroethyl, and the like.
The terms "haloalkenyl" or "halo-substituted alkenyl," as used
herein, refers to an alkenyl group as defined herein, substituted
with one or more halogen groups, wherein the halogen groups are the
same or different. A haloalkenyl group can be optionally
substituted. Non-limiting examples of such branched or straight
chained haloalkenyl groups, as used herein, include ethenyl,
propenyl, butenyl, pentenyl, hexenyl, heptenyl, octenyl, nonenyl,
decenyl and the like substituted with one or more halogen groups,
wherein the halogen groups are the same or different.
The term "heteroaryl," as used herein, refers to monocyclic,
bicyclic, and tricyclic ring systems having a total of five to
fourteen ring members, wherein at least one ring in the system is
aromatic, at least one ring in the system contains one or more
heteroatoms selected from nitrogen, oxygen and sulfur, and wherein
each ring in the system contains 3 to 7 ring members. In certain
embodiments such heteroaryl groups are optionally substituted.
Non-limiting examples of heteroaryl groups, as used herein, include
benzofuranyl, benzofurazanyl, benzoxazolyl, benzopyranyl,
benzthiazolyl, benzothienyl, benzazepinyl, benzimidazolyl,
benzothiopyranyl, benzo[1,3]dioxole, benzo[b]furyl,
benzo[b]thienyl, cinnolinyl, furazanyl, furyl, furopyridinyl,
imidazolyl, indolyl, indolizinyl, indolin-2-one, indazolyl,
isoindolyl, isoquinolinyl, isoxazolyl, isothiazolyl,
1,8-naphthyridinyl, oxazolyl, oxaindolyl, oxadiazolyl, pyrazolyl,
pyrrolyl, phthalazinyl, pteridinyl, purinyl, pyridyl, pyridazinyl,
pyrazinyl, pyrimidinyl, quinoxalinyl, quinolinyl, quinazolinyl,
4H-quinolizinyl, thiazolyl, thiadiazolyl, thienyl, triazinyl,
triazolyl and tetrazolyl. As an optional alternative, the term
"heteroaryl" can instead refer to monocyclic or fused bicyclic ring
systems having a total of 5, 6, 9 or 10 ring members, wherein at
least one ring member is a heteroatom selected from nitrogen,
oxygen and sulfur, optionally substituted with one or more
substituents e.g. benzofuranyl, benzofurazanyl, benzoxazolyl,
benzopyranyl, benzthiazolyl, benzothienyl, benzazepinyl,
benzimidazolyl, benzothiopyranyl, benzo[b]furyl, benzo[b]thienyl,
cinnolinyl, furazanyl, furyl, imidazolyl, indolyl, indolizinyl,
indazolyl, isoindolyl, isoquinolinyl, isoxazolyl, isothiazolyl,
1,8-naphthyridinyl, oxazolyl, oxaindolyl, oxadiazolyl, pyrazolyl,
pyrrolyl, phthalazinyl, pteridinyl, purinyl, pyridyl, pyridazinyl,
pyrazinyl, pyrimidinyl, quinoxalinyl, quinolinyl, quinazolinyl,
thiazolyl, thiadiazolyl, thienyl, triazinyl, triazolyl and
tetrazolyl.
The term "heteroarylene," as used herein means a divalent radical
derived from a heteroaryl group. In certain embodiments such
heteroarylene groups are optionally substituted.
The term "heteroatom," as used herein, refers to one or more of
oxygen, sulfur, nitrogen, phosphorus, or silicon.
The term "hydroxyl," as used herein, refers to the group --OH.
The term "hydroxyalkyl," as used herein refers to an alkyl group as
defined herein substituted with one or more hydroxyl group.
Non-limiting examples of branched or straight chained
"C.sub.1-C.sub.6 hydroxyalkyl groups as used herein include methyl,
ethyl, propyl, isopropyl, isobutyl and n-butyl groups substituted
with one or more hydroxyl groups.
The term "optionally substituted," as used herein, means that the
referenced group may or may not be substituted with one or more
additional group(s) individually and independently selected from
alkyl, alkenyl, alkynyl, cycloalkyl, aryl, heteroaryl,
heterocycloalkyl, hydroxyl, alkoxy, mercaptyl, cyano, halo,
carbonyl, thiocarbonyl, isocyanato, thiocyanato, isothiocyanato,
nitro, perhaloalkyl, perfluoroalkyl, and amino, including mono- and
di-substituted amino groups, and the protected derivatives thereof.
Non-limiting examples of optional substituents include, halo, --CN,
.dbd.O, .dbd.N--OH, .dbd.N--OR, .dbd.N--R, --OR, --C(O)R, --C(O)OR,
--OC(O)R, --OC(O)OR, --C(O)NHR, --C(O)NR.sub.2, --OC(O)NHR,
--OC(O)NR.sub.2, --SR--, --S(O)R, --S(O).sub.2R, --NHR,
--N(R).sub.2, --NHC(O)R, --NRC(O)R, --NHC(O)OR, --NRC(O)OR,
S(O).sub.2NHR, --S(O).sub.2N(R).sub.2, --NHS(O).sub.2NR.sub.2,
--NRS(O).sub.2NR.sub.2, --NHS(O).sub.2R, --NRS(O).sub.2R,
C.sub.1-C.sub.8alkyl, C.sub.1-C.sub.8alkoxy, aryl, heteroaryl,
cycloalkyl, heterocycloalkyl, halo-substituted
C.sub.1-C.sub.8alkyl, and halo-substituted C.sub.1-C.sub.8alkoxy,
where each R is independently selected from H, halo,
C.sub.1-C.sub.8alkyl, C.sub.1-C.sub.8alkoxy, aryl, heteroaryl,
cycloalkyl, heterocycloalkyl, halo-substituted
C.sub.1-C.sub.8alkyl, and halo-substituted C.sub.1-C.sub.8alkoxy.
The placement and number of such substituent groups is done in
accordance with the well-understood valence limitations of each
group, for example .dbd.O is a suitable substituent for an alkyl
group but not for an aryl group.
The term "solvate," as used herein, refers to a complex of variable
stoichiometry formed by a solute (by way of example, a compound of
Formula (I), or a salt thereof, as described herein) and a solvent.
Non-limiting examples of a solvent are water, acetone, methanol,
ethanol and acetic acid.
The term "acceptable" with respect to a formulation, composition or
ingredient, as used herein, means having no persistent detrimental
effect on the general health of the subject being treated.
The term "administration" or "administering" of the subject
compound means providing a compound of Formula (I), a
pharmaceutically acceptable salt, a pharmaceutically acceptable
solvate, or prodrug thereof to a subject in need of treatment.
The term "antigen" refers to a molecule containing one or more
epitopes (e.g., linear, conformational or both) that elicit an
immunological response. The term may be used interchangeably with
the term "immunogen." By "elicit" is meant to induce, promote,
enhance or modulate an immune response or immune reaction. In some
instances, the immune response or immune reaction is a humoral
and/or cellular response. An antigen may induce, promote, enhance
or modulate an immune response or immune reaction in cells in vitro
and/or in vivo in a subject and/or ex vivo in a subject's cells or
tissues. Such immune response or reaction may include, but is not
limited to, eliciting the formation of antibodies in a subject, or
generating a specific population of lymphocytes reactive with the
antigen. Antigens are typically macromolecules (e.g., proteins,
polysaccharides, polynucleotides) that are foreign to the host.
The term "antigen", as used herein, also denotes subunit antigens
(i.e., antigens which are separate and discrete from a whole
organism with which the antigen is associated in nature), as well
as killed, attenuated or inactivated bacteria, viruses, parasites,
parasites or other pathogens or tumor cells, including
extracellular domains of cell surface receptors and intracellular
portions containing T-cell epitopes. Antibodies such as
anti-idiotype antibodies, or fragments thereof, and synthetic
peptide mimotopes, which can mimic an antigen or antigenic
determinant, are also encompassed by the definition of antigen as
used herein. Similarly, an oligonucleotide or polynucleotide that
expresses an immunogenic protein, antigen or antigenic determinant
in vivo, such as in gene therapy or nucleic acid immunization
applications, is also encompassed by the definition of antigen
herein.
The term "epitope" refers to that portion of given species (e.g.,
an antigenic molecule or antigenic complex) that determines its
immunological specificity. An epitope is within the scope of the
present definition of antigen. Commonly, an epitope is a
polypeptide or polysaccharide in a naturally occurring antigen. In
artificial antigens, it can be a low molecular weight substance
such as an arsanilic acid derivative. Normally, a B-cell epitope
will include at least about 5 amino acids but can be as small as
3-4 amino acids. A T-cell epitope, such as a CTL epitope, will
typically include at least about 7-9 amino acids, and a helper
T-cell epitope will typically include at least about 12-20 amino
acids.
The term "cancer," as used herein refers to an abnormal growth of
cells which tend to proliferate in an uncontrolled way and, in some
cases, to metastasize (spread). The types of cancer include, but is
not limited to, solid tumors (such as those of the bladder, bowel,
brain, breast, endometrium, heart, kidney, lung, lymphatic tissue
(lymphoma), ovary, pancreas or other endocrine organ (thyroid),
prostate, skin (melanoma) or hematological tumors (such as the
leukemias).
The term "carrier," as used herein, refers to chemical compounds or
agents that facilitate the incorporation of a compound described
herein into cells or tissues.
The terms "co-administration" or "combined administration" or the
like as used herein are meant to encompass administration of the
selected therapeutic agents to a single patient, and are intended
to include treatment regimens in which the agents are not
necessarily administered by the same route of administration or at
the same time.
The term "dermatological disorder," as used herein refers to a skin
disorder. Such dermatological disorders include, but are not
limited to, proliferative or inflammatory disorders of the skin
such as, atopic dermatitis, bullous disorders, collagenoses,
contact dermatitis eczema, Kawasaki Disease, rosacea,
Sjogren-Larsso Syndrome, actinic keratosis, basal cell carcinoma
and urticaria.
The term "diluent," as used herein, refers to chemical compounds
that are used to dilute a compound described herein prior to
delivery. Diluents can also be used to stabilize compounds
described herein.
The terms "effective amount" or "therapeutically effective amount,"
as used herein, refer to a sufficient amount of a compound
described herein being administered which will relieve to some
extent one or more of the symptoms of the disease or condition
being treated. The result can be reduction and/or alleviation of
the signs, symptoms, or causes of a disease, or any other desired
alteration of a biological system. For example, an "effective
amount" for therapeutic uses is the amount of the composition
comprising a compound as disclosed herein required to provide a
clinically significant decrease in disease symptoms. An appropriate
"effective" amount in any individual case may be determined using
techniques, such as a dose escalation study.
The terms "enhance" or "enhancing," as used herein, means to
increase or prolong either in potency or duration a desired effect.
Thus, in regard to enhancing the effect of therapeutic agents, the
term "enhancing" refers to the ability to increase or prolong,
either in potency or duration, the effect of other therapeutic
agents on a system. An "enhancing-effective amount," as used
herein, refers to an amount adequate to enhance the effect of
another therapeutic agent in a desired system.
The term "excipient" refers to any essentially accessory substance
that may be present in the finished dosage form. For example, the
term "excipient" includes vehicles, binders, disontegrants, fillers
(diluents), lubricants, suspending/dispersing agents, and the
like.
The terms "fibrosis" or "fibrosing disorder," as used herein,
refers to conditions that follow acute or chronic inflammation and
are associated with the abnormal accumulation of cells and/or
collagen and include but are not limited to fibrosis of individual
organs or tissues such as the heart, kidney, joints, lung, or skin,
and includes such disorders as idiopathic pulmonary fibrosis and
cryptogenic fibrosing alveolitis.
The term "iatrogenic," as used herein, means a condition, disorder,
or disease created or worsened by medical or surgical therapy.
The term "immunologically effective amount," as used herein, means
that the administration of a sufficient amount to an individual,
either in a single dose or as part of a series, that is effective
for treatment or prevention of an immunological disease or
disorder. This amount varies depending upon the health and physical
condition of the individual to be treated, age, the taxonomic group
of individual to be treated (e.g. non-human primate, primate,
etc.), the capacity of the individual's immune system to synthesize
antibodies, the degree of protection desired, the formulation of
the vaccine, the treating doctor's assessment of the medical
situation, and other relevant factors. It is expected that the
amount will fall in a relatively broad range that can be determined
through routine trials.
An "immunological response" or "immune response" to an antigen or
composition, as used herein, refers to the development in a subject
of a humoral and/or cellular immune response to the antigen or
composition.
Immune responses include innate and adaptive immune responses.
Innate immune responses are fast-acting responses that provide a
first line of defense for the immune system. In contrast, adaptive
immunity uses selection and clonal expansion of immune cells having
somatically rearranged receptor genes (e.g., T- and B-cell
receptors) that recognize antigens from a given pathogen or
disorder (e.g., a tumor), thereby providing specificity and
immunological memory. Innate immune responses, among their many
effects, lead to a rapid burst of inflammatory cytokines and
activation of antigen-presenting cells (APCs) such as macrophages
and dendritic cells. To distinguish pathogens from self-components,
the innate immune system uses a variety of relatively invariable
receptors that detect signatures from pathogens, known as
pathogen-associated molecular patterns, or PAMPs. The addition of
microbial components to experimental vaccines is known to lead to
the development of robust and durable adaptive immune responses.
The mechanism behind this potentiation of the immune responses has
been reported to involve pattern-recognition receptors (PRRs),
which are differentially expressed on a variety of immune cells,
including neutrophils, macrophages, dendritic cells, natural killer
cells, B cells and some nonimmune cells such as epithelial and
endothelial cells. Engagement of PRRs leads to the activation of
some of these cells and their secretion of cytokines and
chemokines, as well as maturation and migration of other cells. In
tandem, this creates an inflammatory environment that leads to the
establishment of the adaptive immune response. PRRs include
nonphagocytic receptors, such as Toll-like receptors (TLRs) and
nucleotide-binding oligomerization domain (NOD) proteins, and
receptors that induce phagocytosis, such as scavenger receptors,
mannose receptors and .beta.-glucan receptors. Dendritic cells are
recognized as some of the most important cell types for initiating
the priming of naive CD4.sup.+ helper T (T.sub.H) cells and for
inducing CD8.sup.+ T cell differentiation into killer cells. TLR
signaling has been reported to play an important role in
determining the quality of these helper T cell responses, for
instance, with the nature of the TLR signal determining the
specific type of T.sub.H response that is observed (e.g., T.sub.H1
versus T.sub.H2 response). A combination of antibody (humoral) and
cellular immunity are produced as part of a T.sub.H1-type response,
whereas a T.sub.H2-type response is predominantly an antibody
response.
A "humoral immune response" refers to an immune response mediated
by antibody molecules, while a "cellular immune response" refers to
an immune response mediated by T-lymphocytes and/or other white
blood cells. One important aspect of cellular immunity involves an
antigen-specific response by cytolytic T-cells ("CTLs"). CTLs have
specificity for peptide antigens that are presented in association
with proteins encoded by the major histocompatibility complex (MHC)
and expressed on the surfaces of cells. CTLs help induce and
promote the intracellular destruction of intracellular microbes, or
the lysis of cells infected with such microbes. Another aspect of
cellular immunity involves an antigen-specific response by helper
T-cells. Helper T-cells act to help stimulate the function, and
focus the activity of, nonspecific effector cells against cells
displaying peptide antigens in association with MHC molecules on
their surface. A "cellular immune response" also refers to the
production of cytokines, chemokines and other such molecules
produced by activated T-cells and/or other white blood cells,
including those derived from CD4+ and CD8+ T-cells.
A composition such as an as an immunogenic composition or a vaccine
that elicits a cellular immune response may thus serve to sensitize
a vertebrate subject by the presentation of antigen in association
with MHC molecules at the cell surface. The cell-mediated immune
response is directed at, or near, cells presenting antigen at their
surface. In addition, antigen-specific T-lymphocytes can be
generated to allow for the future protection of an immunized host.
The ability of a particular antigen or composition to stimulate a
cell-mediated immunological response may be determined by a number
of assays known in the art, such as by lymphoproliferation
(lymphocyte activation) assays, CTL cytotoxic cell assays, by
assaying for T-lymphocytes specific for the antigen in a sensitized
subject, or by measurement of cytokine production by T cells in
response to restimulation with antigen. Such assays are well known
in the art. See, e.g., Erickson et al. (1993) J. Immunol.
151:4189-4199; Doe et al. (1994) Eur. J. Immunol. 24:2369-2376.
Thus, an immunological response as used herein may be one which
stimulates the production of CTLs and/or the production or
activation of helper T-cells. The antigen of interest may also
elicit an antibody-mediated immune response. Hence, an
immunological response may include, for example, one or more of the
following effects among others: the production of antibodies by,
for example, B-cells; and/or the activation of suppressor T-cells
and/or .gamma..delta. T-cells directed specifically to an antigen
or antigens present in the composition or vaccine of interest.
These responses may serve to neutralize infectivity, and/or mediate
antibody-complement, or antibody dependent cell cytotoxicity (ADCC)
to provide protection to an immunized host. Such responses can be
determined using standard immunoassays and neutralization assays,
well known in the art.
The immunogenic compositions of the invention display "enhanced
immunogenicity" for a given antigen when they possess a greater
capacity to elicit an immune response than the immune response
elicited by an equivalent amount of the antigen in a differing
composition (e.g., wherein the antigen is administered as a soluble
protein). Thus, a composition may display "enhanced
immunogenicity," for example, because the composition generates a
stronger immune response, or because a lower dose or fewer doses of
antigen is necessary to achieve an immune response in the subject
to which it is administered. Such enhanced immunogenicity can be
determined, for example, by administering the compositions of the
invention, and antigen controls, to animals and comparing assay
results of the two.
The term "inflammatory disorders," as used herein, refers to those
diseases or conditions that are characterized by one or more of the
signs of pain (dolor, from the generation of noxious substances and
the stimulation of nerves), heat (calor, from vasodilatation),
redness (rubor, from vasodilatation and increased blood flow),
swelling (tumor, from excessive inflow or restricted outflow of
fluid), and loss of function (functio laesa, which may be partial
or complete, temporary or permanent). Inflammation takes many forms
and includes, but is not limited to, inflammation that is one or
more of the following: acute, adhesive, atrophic, catarrhal,
chronic, cirrhotic, diffuse, disseminated, exudative, fibrinous,
fibrosing, focal, granulomatous, hyperplastic, hypertrophic,
interstitial, metastatic, necrotic, obliterative, parenchymatous,
plastic, productive, proliferous, pseudomembranous, purulent,
sclerosing, seroplastic, serous, simple, specific, subacute,
suppurative, toxic, traumatic, and/or ulcerative. Inflammatory
disorders further include, without being limited to those affecting
the blood vessels (polyarteritis, temporal arthritis); joints
(arthritis: crystalline, osteo-, psoriatic, reactive, rheumatoid,
Reiter's); gastrointestinal tract (Disease); skin (dermatitis); or
multiple organs and tissues (systemic lupus erythematosus).
The term "modulate," as used herein, means to interact with a
target either directly or indirectly so as to alter the activity of
the target, including, by way of example only, to enhance the
activity of the target, to inhibit the activity of the target, to
limit the activity of the target, or to extend the activity of the
target.
The term "modulator," as used herein, refers to a molecule that
interacts with a target either directly or indirectly. The
interactions include, but are not limited to, the interactions of
an agonist or an antagonist.
The terms "ocular disease" or "ophthalmic disease," as used herein,
refer to diseases which affect the eye or eyes and potentially the
surrounding tissues as well. Ocular or ophthalmic diseases include,
but are not limited to, conjunctivitis, retinitis, scleritis,
uveitis, allergic conjunctivitis, vernal conjunctivitis, papillary
conjunctivitis and cytomegalovirus (CMV) retinitis.
The term "oligonucleotide", as used herein, refers to a
polynucleotide having in the range of 5 to 100 nucleotides,
typically 5 to 30 nucleotides in size.
The term "pharmaceutically acceptable," as used herein, refers a
material, such as a carrier or diluent, which does not abrogate the
biological activity or properties of the compounds described
herein. Such materials are administered to an individual without
causing undesirable biological effects or interacting in a
deleterious manner with any of the components of the composition in
which it is contained.
The term "pharmaceutically acceptable salt," as used herein, refers
to a formulation of a compound that does not cause significant
irritation to an organism to which it is administered and does not
abrogate the biological activity and properties of the compounds
described herein.
The terms "combination" or "pharmaceutical combination," as used
herein mean a product that results from the mixing or combining of
more than one active ingredient and includes both fixed and
non-fixed combinations of the active ingredients. The term "fixed
combination" means that the active ingredients, by way of example,
a compound of Formula (I) and an additional therapeutic agent, are
both administered to a patient simultaneously in the form of a
single entity or dosage. The term "non-fixed combination" means
that the active ingredients, by way of example, a compound of
Formula (I) and an additional therapeutic agent, are both
administered to a patient as separate entities either
simultaneously, concurrently or sequentially with no specific time
limits, wherein such administration provides therapeutically
effective levels of the 2 compounds in the body of the patient. The
latter also applies to cocktail therapy, e.g. the administration of
3 or more active ingredients.
The terms "composition" or "pharmaceutical composition," as used
herein, refers to a mixture of at least one compound, such as the
compounds of Formula (I) provided herein, with at least one and
optionally more than one other pharmaceutically acceptable chemical
components, such as carriers, stabilizers, diluents, dispersing
agents, suspending agents, thickening agents, and/or
excipients.
By "physiological pH" or a "pH in the physiological range" is meant
a pH in the range of approximately 7.2 to 8.0 inclusive, more
typically in the range of approximately 7.2 to 7.6 inclusive.
The term "prodrug," as used herein, refers to an agent that is
converted into the parent drug in vivo. A non-limiting example of a
prodrug of the compounds described herein is a compound described
herein administered as an ester which is then metabolically
hydrolyzed to a carboxylic acid, the active entity, once inside the
cell. A further example of a prodrug is a short peptide bonded to
an acid group where the peptide is metabolized to reveal the active
moiety.
The terms "polynucleotide" and "nucleic acid" are used
interchangeably, and refer to a single- or double-stranded polymer
of deoxyribonucleotide or ribonucleotide bases. Single-stranded
polynucleotides include coding strands and antisense strands.
Polynucleotides include RNA and DNA, and may be isolated from
natural sources, synthesized in vitro, or prepared from a
combination of natural and synthetic molecules. Examples of
polynucleotides include, but are not limited to, genes, cDNAs,
mRNAs, self-replicating RNA molecules, self-replicating DNA
molecules, genomic DNA sequences, genomic RNA sequences,
oligonucleotides. Self-replicating RNA molecules and
self-replicating DNA molecules are able to self amplify when
introduced into a host cell.
A polynucleotide can be linear or non-linear (e.g., comprising
circular, branched, etc. elements). The terms "polynucleotide" and
"nucleic acid" encompass modified variants (e.g., sequences with a
deletion, addition and/or substitution). Modified variants may be
deliberate, such as through site-directed mutagenesis, or may be
accidental, such as through natural mutations.
A polynucleotide can be composed of monomers that are
naturally-occurring nucleotides (such as DNA and RNA), or analogs
of naturally-occurring nucleotides, or a combination of both.
Modified nucleotides can have alterations in sugar moieties and/or
in pyrimidine or purine base moieties. Sugar modifications include,
for example, replacement of one or more hydroxyl groups with
halogens, alkyl groups, amines, and azido groups, or sugars can be
functionalized as ethers or esters. Moreover, the entire sugar
moiety can be replaced with sterically and electronically similar
structures, such as aza-sugars and carbocyclic sugar analogs.
Examples of modifications in a base moiety include alkylated
purines and pyrimidines, acylated purines or pyrimidines, or other
well-known heterocyclic substitutes. Polynucleotide monomers can be
linked by phosphodiester bonds or analogs of such linkages. Analogs
of phosphodiester linkages include phosphorothioate,
phosphorodithioate, phosphoroselenoate, phosphorodiselenoate,
phosphoroanilothioate, phosphoranilidate, phosphoramidate, and the
like. The terms "polynucleotide" and "nucleic acid" also include
so-called "peptide nucleic acids", which comprise
naturally-occurring or modified nucleic acid bases attached to a
polyamide backbone.
The term "polynucleotide-containing species", as used herein,
refers to a molecule, at least a portion of which is a
polynucleotide.
The terms "polypeptide", "protein" and "peptide", as used herein,
refer to any polymer formed from multiple amino acids, regardless
of length or posttranslational modification (e.g., phosphorylation
or glycosylation), associated, at least in part, by covalent
bonding (e.g., "protein" as used herein refers both to linear
polymers (chains) of amino acids associated by peptide bonds as
well as proteins exhibiting secondary, tertiary, or quaternary
structure, which can include other forms of intramolecular and
intermolecular association, such as hydrogen and van der Waals
bonds, within or between peptide chain(s)). Examples of
polypeptides include, but are not limited to, proteins, peptides,
oligopeptides, dimers, multimers, variants, and the like. In some
embodiments, the polypeptide can be unmodified such that it lacks
modifications such as phosphorylation and glycosylation. A
polypeptide can contain part or all of a single naturally-occurring
polypeptide, or can be a fusion or chimeric polypeptide containing
amino acid sequences from two or more naturally-occurring
polypeptides.
The term "polypeptide-containing species" refers to a molecule, at
least a potion of which is a polypeptide. Examples include
polypeptides, glycoproteins, metalloproteins, lipoproteins,
saccharide antigens conjugated to carrier proteins, and so
forth.
The term "respiratory disease," as used herein, refers to diseases
affecting the organs that are involved in breathing, such as the
nose, throat, larynx, trachea, bronchi, and lungs. Respiratory
diseases include, but are not limited to, asthma, adult respiratory
distress syndrome and allergic (extrinsic) asthma, non-allergic
(intrinsic) asthma, acute severe asthma, chronic asthma, clinical
asthma, nocturnal asthma, allergen-induced asthma,
aspirin-sensitive asthma, exercise-induced asthma, isocapnic
hyperventilation, child-onset asthma, adult-onset asthma,
cough-variant asthma, occupational asthma, steroid-resistant
asthma, seasonal asthma, seasonal allergic rhinitis, perennial
allergic rhinitis, chronic obstructive pulmonary disease, including
chronic bronchitis or emphysema, pulmonary hypertension,
interstitial lung fibrosis and/or airway inflammation and cystic
fibrosis, and hypoxia.
The term "subject" or "patient," as used herein, encompasses
mammals and non-mammals. Examples of mammals include, but are not
limited to, humans, chimpanzees, apes monkeys, cattle, horses,
sheep, goats, swine; rabbits, dogs, cats, rats, mice, guinea pigs,
and the like. Examples of non-mammals include, but are not limited
to, birds, fish and the like. Frequently the subject is a human,
and may be a human who has been diagnosed as in need of treatment
for a disease or disorder disclosed herein.
The term "TLR7 modulator," as used herein, refers to a compound
which modulates a TLR7 receptor.
The term "TLR7 disease" or a "disease or disorder associated with
TLR7 activity," as used herein, refers to any disease state
associated with a toll-like receptor. Such diseases or disorders
include, but are not limited to, infectious diseases, inflammatory
diseases, respiratory diseases and autoimmune diseases, such as, by
way of example only, asthma, chronic obstructive pulmonary disease
(COPD), adult respiratory distress syndrome (ARDs), Crohns disease,
bronchitis, dermatitis, allergic rhinitis, psoriasis, scleroderma,
urticaria, rheumatoid arthritis, multiple sclerosis, cancer, HIV
and lupus.
The term "therapeutically effective amount," as used herein, refers
to any amount of a compound which, as compared to a corresponding
subject who has not received such amount, results in improved
treatment, healing, prevention, or amelioration of a disease,
disorder, or side effect, or a decrease in the rate of advancement
of a disease or disorder. The term also includes within its scope
amounts effective to enhance normal physiological function.
The terms "treat," "treating" or "treatment," as used herein,
refers to methods of alleviating, abating or ameliorating a disease
or condition symptoms, preventing additional symptoms, ameliorating
or preventing the underlying metabolic causes of symptoms,
inhibiting the disease or condition, arresting the development of
the disease or condition, relieving the disease or condition,
causing regression of the disease or condition, relieving a
condition caused by the disease or condition, or stopping the
symptoms of the disease or condition either prophylactically and/or
therapeutically.
The term "vector construct" generally refers to any assembly that
is capable of directing the expression of a nucleic acid
sequence(s) or gene(s) of interest. A "DNA vector construct" refers
to a DNA molecule that is capable of directing the expression of a
nucleic acid sequence(s) or gene(s) of interest. One specific type
of DNA vector construct is a plasmid, which is a circular episomal
DNA molecule capable of autonomous replication within a host cell.
Typically, a plasmid is a circular double stranded DNA loop into
which additional DNA segments can be ligated. pCMV is one specific
plasmid that is well known in the art. Other DNA vector constructs
are known, which are based on RNA viruses. These DNA vector
constructs typically comprise a promoter that functions in a
eukaryotic cell, 5' of a cDNA sequence for which the transcription
product is an RNA vector construct (e.g., an alphavirus RNA vector
replicon), and a 3' termination region. Other examples of vector
constructs include RNA vector constructs (e.g., alphavirus vector
constructs) and the like. As used herein, "RNA vector construct",
"RNA vector replicon" and "replicon" refer to an RNA molecule that
is capable of directing its own amplification or self-replication
in vivo, typically within a target cell. The RNA vector construct
is used directly, without the requirement for introduction of DNA
into a cell and transport to the nucleus where transcription would
occur. By using the RNA vector for direct delivery into the
cytoplasm of the host cell, autonomous replication and translation
of the heterologous nucleic acid sequence occurs efficiently.
The compound names provided herein were obtained using ChemDraw
Ultra 10.0 (CambridgeSoft.RTM.) or JChem version 5.2.2
(ChemAxon).
Other objects, features and advantages of the methods, compositions
and combinations described herein will become apparent from the
following detailed description. It should be understood, however,
that the detailed description and the specific examples, while
indicating specific embodiments, are given by way of illustration
only.
Description Of The Preferred Embodiments
Provided herein are compounds and pharmaceutical compositions
thereof, which are agonists of toll-like receptor-7 (TLR7). Also
provided herein are compounds, pharmaceutical compositions and
methods for the treatment of diseases and/or disorders associated
with TLR7 activity.
The TLR7 agonists provided herein are compounds having the
structure of Formula (I), and pharmaceutically acceptable salts,
pharmaceutically acceptable solvates (e.g. hydrates), the N-oxide
derivatives, prodrug derivatives, protected derivatives, individual
isomers and mixture of isomers thereof:
##STR00003## wherein: R.sup.1 is H, C.sub.1-C.sub.6alkyl,
--C(R.sup.5).sub.2OH, -L.sup.1R.sup.5, -L.sup.1R.sup.6,
-L.sup.2R.sup.5, -L.sup.2R.sup.6, --OL.sup.2R.sup.5, or
--OL.sup.2R.sup.6; L.sup.1 is --C(O)-- or --O--; L.sup.2 is
C.sub.1-C.sub.6alkylene, C.sub.2-C.sub.6alkenylene, arylene,
heteroarylene or
--((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--, wherein the
C.sub.1-C.sub.6alkylene and C.sub.2-C.sub.6alkenylene of L.sup.2
are optionally substituted with 1 to 4 fluoro groups; each L.sup.3
is independently selected from C.sub.1-C.sub.6alkylene and
--((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--, wherein the
C.sub.1-C.sub.6alkylene of L.sup.3 is optionally substituted with 1
to 4 fluoro groups; L.sup.4 is arylene or heteroarylene; R.sup.2 is
H or C.sub.1-C.sub.6alkyl; R.sup.3 is selected from
C.sub.1-C.sub.4alkyl, -L.sup.3R.sup.5, -L.sup.1R.sup.5,
-L.sup.3R.sup.7, -L.sup.3L.sup.4L.sup.3R.sup.7,
-L.sup.3L.sup.4R.sup.5, -L.sup.3L.sup.4L.sup.3R.sup.5,
--OL.sup.3R.sup.5, --OL.sup.3R.sup.7, --OL.sup.3L.sup.4R.sup.7,
--OL.sup.3L.sup.4L.sup.3R.sup.7, --OR.sup.8,
--OL.sup.3L.sup.4R.sup.5, --OL.sup.3L.sup.4L.sup.3R.sup.5 and
--C(R.sup.5).sub.2OH; each R.sup.4 is independently selected from H
and fluoro; R.sup.5 is --P(O)(OR.sup.9).sub.2, R.sup.6 is
--CF.sub.2P(O)(OR.sup.9).sub.2 or --C(O)OR.sup.10; R.sup.7 is
--CF.sub.2P(O)(OR.sup.9).sub.2 or --C(O)OR.sup.10; R.sup.8 is H or
C.sub.1-C.sub.4alkyl; each R.sup.9 is independently selected from H
and C.sub.1-C.sub.6alkyl; R.sup.10 is H or C.sub.1-C.sub.4alkyl;
each p is independently selected from 1, 2, 3, 4, 5 and 6, and q is
1, 2, 3 or 4; with the proviso that when R.sup.3 is C.sub.1-C.sub.4
alkyl or --OR.sup.8, R.sup.1 is --C(R.sup.5).sub.2OH,
-L.sup.1R.sup.5, -L.sup.1R.sup.6, -L.sup.2R.sup.5, -L.sup.2R.sup.6,
--OL.sup.2R.sup.5, or --OL.sup.2R.sup.6, wherein R.sup.6 is
--CF.sub.2P(O)(OR.sup.9).sub.2 and R.sup.7 is
--CF.sub.2P(O)(OR.sup.9).sub.2
In certain embodiments of the compounds of Formula (I), R.sup.1 is
C.sub.1-C.sub.6 alkyl, in other embodiments R.sup.1 is a methyl. In
certain embodiments, R.sup.1 is H. In other embodiments, R.sup.1 is
--C(R.sup.5).sub.2OH, -L.sup.1R.sup.5, -L.sup.1R.sup.6,
-L.sup.2R.sup.5, -L.sup.2R.sup.6, --OL.sup.2R.sup.5, or
--OL.sup.2R.sup.6.
In certain embodiments of the compounds of Formula (I), when
R.sup.1--C(R.sup.5).sub.2OH, -L.sup.1R.sup.5, -L.sup.1R.sup.6,
-L.sup.2R.sup.5, -L.sup.2R.sup.6, --OL.sup.2R.sup.5, or
--OL.sup.2R.sup.6, then R.sup.3 is --OR.sup.8 or C.sub.1-C.sub.6
alkyl. In certain embodiments, R.sup.1 is --C(R.sup.5).sub.2OH,
-L.sup.1R.sup.5, -L.sup.1R.sup.6, -L.sup.2R.sup.5, -L.sup.2R.sup.6,
--OL.sup.2R.sup.5, or --OL.sup.2R.sup.6, and R.sup.3 is --OMe.
In some embodiments of the compounds of Formula (I), R.sup.2 is
C.sub.1-C.sub.6alkyl. In certain embodiments, R.sup.2 is
methyl.
In some embodiments of the compounds of Formula (I), R.sup.3 is
selected from C.sub.1-C.sub.4 alkyl, -L.sup.3R.sup.5,
-L.sup.1R.sup.5, -L.sup.3R.sup.7, -L.sup.3L.sup.4L.sup.3R.sup.7,
-L.sup.3L.sup.4R.sup.5, and -L.sup.3L.sup.4L.sup.3R.sup.5. In
alternative embodiments, R.sup.3 is selected from
--OL.sup.3R.sup.5, --OL.sup.3R.sup.7, --OL.sup.3L.sup.4R.sup.7,
--OL.sup.3L.sup.4L.sup.3R.sup.7, --OR.sup.8,
--OL.sup.3L.sup.4R.sup.5, --OL.sup.3L.sup.4L.sup.3R.sup.5 and
--C(R.sup.5).sub.2OH. In certain embodiments, R.sup.3 is
--OL.sup.3R.sup.5, wherein --OL.sup.3R.sup.5 is a group of the
formula --O(CH.sub.2).sub.1-5P(O)(OR).sub.2. In other embodiments,
R.sup.3 is --OL.sup.3R.sup.5, wherein --OL.sup.3R.sup.5 is a group
of the formula --O(CH.sub.2).sub.1-5CF.sub.2P(O)(OR).sub.2.
In some embodiments, R.sup.3 is selected from C.sub.1-C.sub.4alkyl,
-L.sup.3R.sup.5, -L.sup.3R.sup.7, -L.sup.3L.sup.4L.sup.3R.sup.7,
-L.sup.3L.sup.4R.sup.5, -L.sup.3L.sup.4L.sup.3R.sup.5,
--OL.sup.3R.sup.5, --OL.sup.3R.sup.7, --OL.sup.3L.sup.4R.sup.7,
--OL.sup.3L.sup.4L.sup.3R.sup.7, --OR.sup.8,
--OL.sup.3L.sup.4R.sup.5, and --OL.sup.3L.sup.4L.sup.3R.sup.5.
Where more than one R.sup.9 is present, as in compounds comprising
a --P(O)(OR.sup.9).sub.2, moiety, the R.sup.9 groups are the same
or are different. In certain embodiments of such compounds of
Formula (I), R.sup.9 is H at each occurrence. In other embodiments,
at least one R.sup.9 is H and the other R.sup.9 is
C.sub.1-C.sub.6alkyl. In other embodiments, at least one R.sup.9 is
H and the other R.sup.9 is methyl. In other embodiments, at least
one R.sup.9 is H and the other R.sup.9 is ethyl. In other
embodiments of such compounds of Formula (I), each R.sup.9 is
C.sub.1-C.sub.6alkyl and in certain embodiments, R.sup.9 is methyl
or ethyl, or a combination thereof.
In certain embodiments of the compounds of Formula (I), L.sup.2
and/or L.sup.3 is a group of the formula
--((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--, and in
certain embodiments, this group is of the formula
--(CH.sub.2CH.sub.2O).sub.1-3(CH.sub.2).sub.1-3--.
In certain embodiments of the compounds of Formula (I), L.sup.2 is
C.sub.1-C.sub.6 alkylene, while in other embodiments L.sup.2 is
C.sub.1-C.sub.6 alkylene substituted with one to four fluoro
groups. In certain embodiments of such compounds of Formula (I),
L.sup.2 is of the formula (CH.sub.2).sub.0-5CF.sub.2, wherein the
fluoro-substituted carbon is not directly attached to the phenyl
ring of Formula I. In certain embodiments of the compounds of
Formula (I), L.sup.2 is C.sub.2-C.sub.6 alkenylene, while in other
embodiments L.sup.2 is C.sub.2-C.sub.6 alkenylene substituted with
one to four fluoro groups.
In certain embodiments of the compounds of Formula (I), L.sup.3 is
C.sub.1-C.sub.6 alkylene while in other embodiments L.sup.3 is
C.sub.1-C.sub.6 alkylene substituted with one to four fluoro
groups. In certain embodiments of such compounds of Formula (I),
L.sup.3 is of the formula (CH.sub.2).sub.0-5CF.sub.2, wherein the
fluoro-substituted carbon is not directly attached to the phenyl
ring of Formula I.
In certain embodiments of the compounds of Formula (I), L.sup.2 is
arylene or heteroarylene. In some of these embodiments, L.sup.2 is
phenylene, such as 1,3-disubstituted phenylene or 1,4-disubstituted
phenylene.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
C.sub.1-C.sub.6alkyl; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3R.sup.5 or --OL.sup.3R.sup.7; R.sup.5 is
--P(O)(OR.sup.9).sub.2; R.sup.7 is --CF.sub.2P(O)(OR.sup.9).sub.2,
and L.sup.3 is C.sub.1-C.sub.6alkylene.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
C.sub.1-C.sub.6alkyl; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3R.sup.5 or --OL.sup.3R.sup.7; R.sup.5 is
--P(O)(OR.sup.9).sub.2; R.sup.7 is --CF.sub.2P(O)(OR.sup.9).sub.2;
L.sup.3 is --((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--;
R.sup.4 is H; q is 1 or 2, and p is 2.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
-L.sup.2R.sup.6; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3R.sup.5 or --OL.sup.3R.sup.7; R.sup.5 is
--P(O)(OR.sup.9).sub.2; R.sup.6 is --C(O)OR.sup.10; R.sup.7 is
--CF.sub.2P(O)(OR.sup.9).sub.2; L.sup.2 is C.sub.1-C.sub.6alkylene,
and L.sup.3 is C.sub.1-C.sub.6alkylene.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
-L.sup.2R.sup.6; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3R.sup.5 or --OL.sup.3R.sup.7; R.sup.5 is
--P(O)(OR.sup.9).sub.2; R.sup.6 is --C(O)OR.sup.10; R.sup.7 is
--CF.sub.2P(O)(OR.sup.9).sub.2; L.sup.2 is C.sub.1-C.sub.6alkylene;
L.sup.3 is -((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--;
R.sup.4 is H; q is 1 or 2, and p is 2.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
--C(R.sup.5).sub.2OH, -L.sup.1R.sup.5, -L.sup.2R.sup.5 or
-L.sup.1R.sup.6; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OR.sup.8; R.sup.8 is C.sub.1-C.sub.6alkyl; R.sup.5 is
--P(O)(OR.sup.9).sub.2; R.sup.6 is --CF.sub.2P(O)(OR.sup.9).sub.2;
L.sup.1 is --C(O)--, and L.sup.2 is C.sub.1-C.sub.6alkylene or
C.sub.2-C.sub.6alkenylene, each optionally substituted with 1 to 4
fluoro groups.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
C.sub.1-C.sub.6alkyl; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3L.sup.4R.sup.5--OL.sup.3L.sup.4L.sup.3R.sup.5, or
--OL.sup.3L.sup.4L.sup.3R.sup.7; R.sup.5 is --P(O)(OR.sup.9).sub.2;
R.sup.7 is --CF.sub.2P(O)(OR.sup.9).sub.2; each L.sup.3 is
independently a C.sub.1-C.sub.6alkylene, and L.sup.4 is
phenylene.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
C.sub.1-C.sub.6alkyl; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--C(R.sup.5).sub.2OH or -L.sup.1R.sup.5; R.sup.5 is
--P(O)(OR.sup.9).sub.2, and L.sup.1 is --C(O)-- or --O--.
In certain embodiments, of such compounds of Formula (I), and
pharmaceutically acceptable salts, pharmaceutically acceptable
solvates (e.g. hydrates), the N-oxide derivatives, prodrug
derivatives, protected derivatives, individual isomers and mixture
of isomers thereof:
##STR00004## R.sup.1 is C.sub.1-C.sub.4alkyl, --C(R.sup.5).sub.2OH,
-L.sup.1R.sup.5, -L.sup.2R.sup.5, -L.sup.2R.sup.6,
--OL.sup.2R.sup.5, or --OL.sup.2R.sup.6; L.sup.1 is --C(O)-- or
--O--; L.sup.2 is C.sub.1-C.sub.6alkylene,
C.sub.2-C.sub.6alkenylene, arylene, heteroarylene or
((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--, wherein the
C.sub.1-C.sub.6alkylene and C.sub.2-C.sub.6alkenylene of L.sup.2
are optionally substituted with 1 to 4 fluoro groups; each L.sup.3
is independently selected from C.sub.1-C.sub.6alkylene and
--((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--, wherein the
C.sub.1-C.sub.6alkylene of L.sup.3 is optionally substituted with 1
to 4 fluoro groups; L.sup.4 is arylene or heteroarylene; R.sup.2 is
H or C.sub.1-C.sub.4alkyl; R.sup.3 is selected from
C.sub.1-C.sub.4alkyl, -L.sup.3R.sup.5, -L.sup.1R.sup.5,
-L.sup.3R.sup.7, -L.sup.3L.sup.4L.sup.3R.sup.7,
-L.sup.3L.sup.4R.sup.5, -L.sup.3L.sup.4L.sup.3R.sup.5,
--OL.sup.3R.sup.5, --OL.sup.3R.sup.7, --OL.sup.3L.sup.4R.sup.7,
--OL.sup.3L.sup.4L.sup.3R.sup.7, --OR.sup.8,
--OL.sup.3L.sup.4R.sup.5, --OL.sup.3L.sup.4L.sup.3R.sup.5 and
--C(R.sup.5).sub.2OH; each R.sup.4 is independently selected from H
and fluoro; R.sup.5 is --P(O)(OH).sub.2, R.sup.6 is
--CF.sub.2P(O)(OH).sub.2 or --C(O)OH; R.sup.7 is
--CF.sub.2P(O)(OH).sub.2 or --C(O)OH; R.sup.8 is H or
C.sub.1-C.sub.4alkyl; each p is independently selected from 1, 2,
3, 4, 5 and 6, and q is 1, 2, 3 or 4, with the proviso that when
R.sup.3 is --OR.sup.8, R.sup.1 is --C(R.sup.5).sub.2OH,
-L.sup.1R.sup.5, L.sup.1R.sup.6, L.sup.2R.sup.5,
L.sup.2R.sup.6,OL.sup.2R.sup.5, or --OL.sup.2R.sup.6, wherein
R.sup.6 is --CF.sub.2P(O)(OH).sub.2 and R.sup.7 is
--CF.sub.2P(O)(OH).sub.2.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
C.sub.1-C.sub.6alkyl; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3R.sup.5 or --OL.sup.3R.sup.7; R.sup.5 is
--P(O)(OH).sub.2; R.sup.7 is --CF.sub.2P(O)(OH).sub.2, and L.sup.3
is C.sub.1-C.sub.6alkylene.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
C.sub.1-C.sub.6alkyl; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3R.sup.5 or --OL.sup.3R.sup.7; R.sup.5 is
--P(O)(OH).sub.2; R.sup.7 is --CF.sub.2P(O)(OH).sub.2; L.sup.3 is
--((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--; R.sup.4 is H;
q is 1 or 2, and p is 2.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
-L.sup.2R.sup.6; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3R.sup.5 or --OL.sup.3R.sup.7; R.sup.5 is
--P(O)(OH).sub.2; R.sup.6 is --C(O)OH; R.sup.7 is
--CF.sub.2P(O)(OH).sub.2; L.sup.2 is C.sub.1-C.sub.6alkylene, and
L.sup.3 is C.sub.1-C.sub.6alkylene.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
-L.sup.2R.sup.6; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3R.sup.5 or --OL.sup.3R.sup.7; R.sup.5 is
--P(O)(OH).sub.2; R.sup.6 is --C(O)OH; R.sup.7 is
--CF.sub.2P(O)(OH).sub.2; L.sup.2 is C.sub.1-C.sub.6alkylene;
L.sup.3 is --((CR.sup.4R.sup.4).sub.pO).sub.q(CH.sub.2).sub.p--;
R.sup.4 is H; q is 1 or 2, and p is 2.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
--C(R.sup.5).sub.2OH, -L.sup.1R.sup.5, -L.sup.2R.sup.5 or
-L.sup.1R.sup.6; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OR.sup.8; R.sup.8 is C.sub.1-C.sub.6alkyl; R.sup.5 is
--P(O)(OH).sub.2; R.sup.6 is --CF.sub.2P(O)(OH).sub.2; L.sup.1 is
--C(O)--, and L.sup.2 is C.sub.1-C.sub.6alkylene or
C.sub.2-C.sub.6alkenylene, each optionally substituted with 1 to 4
fluoro groups.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
C.sub.1-C.sub.6alkyl; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--OL.sup.3L.sup.4R.sup.5--OL.sup.3L.sup.4L.sup.3R.sup.5, or
--OL.sup.3L.sup.4L.sup.3R.sup.7; R.sup.5 is --P(O)(OH).sub.2;
R.sup.7 is --CF.sub.2P(O)(OH).sub.2; each L.sup.3 is independently
a C.sub.1-C.sub.6alkylene, and L.sup.4 is phenylene.
In certain embodiments of such compounds of Formula (I), R.sup.1 is
C.sub.1-C.sub.6alkyl; R.sup.2 is C.sub.1-C.sub.6alkyl; R.sup.3 is
--C(R.sup.5).sub.2OH or -L.sup.1R.sup.5; R.sup.5 is
--P(O)(OR.sup.9).sub.2, and L.sup.1 is --C(O)-- or --O--.
In certain embodiments of the aformentioned compounds of Formula
(I), R.sup.8 is methyl. In certain embodiments of the aformentioned
compounds of Formula (I), R.sup.1 is methyl. In certain embodiments
of the aformentioned compounds of Formula (I), R.sup.2 is
methyl.
In other embodiments of compounds of Formula (I), R.sup.5 is
--P(O)(O.sup.-X.sup.+).sub.2 or --P(O)(O.sup.-).sub.2X.sup.2+;
R.sup.6 is --CF.sub.2P(O)(O.sup.-X.sup.+).sub.2,
--CF.sub.2P(O)(O.sup.-).sub.2X.sup.2+ or --C(O)O.sup.-X.sup.+, and
R.sup.7 is --CF.sub.2P(O)(O.sup.-X.sup.+).sub.2,
--CF.sub.2P(O)(O.sup.-).sub.2X.sup.2+ or --C(O)O.sup.-X.sup.+,
wherein X.sup.+ and X.sup.2+ are pharmaceutically acceptable
cations. In certain embodiments, such pharmaceutically acceptable
cations are selected from sodium, potassium, calcium, zinc, and
magnesium.
In certain embodiments of compounds of Formula (I), R.sup.5 is
--PO.sub.3.sup.-X.sup.3+; R.sup.6 is
--CF.sub.2PO.sub.3.sup.-X.sup.3+, and R.sup.7 is
--CF.sub.2PO.sub.3.sup.-X.sup.3+, wherein X.sup.3+ is
Al.sup.3+.
Aluminum-containing adjuvants, such as aluminum hydroxide, aluminum
oxyhydroxide and aluminum hydroxyphosphate, are used in vaccines to
bind antigens. A discussion of aluminum-containing adjuvants and
their uses in vaccines is given in Expert Rev. Vaccines, 46(5),
2007, 685-698 and Vaccines, 25, 2007, 6618-6624, the disclosures of
which are herein incorporated by references in their entirety.
Compounds of Formula (I) provided herein are TLR7 agonists that
bind to aluminum-containing adjuvants, such as, by way of example
only, aluminum hydroxide, aluminum oxyhydroxide and aluminum
hydroxyphosphate. In certain embodiments, such compounds of Formula
(I) have a phosphate, a phosphonic acid, a phosphonate, a
fluorinated phosphonic acid or a fluorinated phosphonate group.
While in other embodiments, such compounds of Formula (I) have a
phosphate, a phosphonic acid, a phosphonate, a fluorinated
phosphonic acid or fluorinated phosphonate group, and one or more
additional ionizable groups selected from a carboxylic acid and
sulphate.
In certain embodiments compounds of Formula (I) provided herein are
combined with an antigen, an aluminum-containing adjuvant, and
optionally a carrier, pharmaceutically acceptable excipient, to
provide an immunogenic composition. In other embodiments, such
immunogenic composition comprise a compound of Formula (I) and an
antigen, wherein the antigen includes, but is not limited to, a
bacterial antigen, a viral antigen, a fungal antigen, a tumor
antigen, or an antigen associated with an STD, Alzheimer's,
respiratory disorders, autoimmune disorders such as, by way of
example only, rheumatoid arthritis or lupus, pediatric disorders
and obesity, and wherein the amount of the compound is an amount
effective to enhance an immune response to the antigen in a subject
to whom the composition is administered. Suitable antigens for use
in such immunogenic compositions are described herein.
In certain embodiments, such immunogenic compositions include a
bacterial antigen of a strain of Neisseria meningitides, such as
serogroup A, C, W135, Y and/or B. Specific antigens for use in
these compositions are described herein. In other embodiments, such
immunogenic compositions, and others provided herein, are used as
vaccines; their use in the treatment of disorders associated with
the antigen included in the composition is described herein.
The compounds of Formula (I), pharmaceutically acceptable salts,
solvates, N-oxides, prodrugs and isomers thereof, and
pharmaceutical compositions provided herein also includes all
suitable isotopic variations of such compounds, and
pharmaceutically acceptable salts, solvates, N-oxides, prodrugs and
isomers thereof, and pharmaceutical compositions. An isotopic
variation of a compound provided herein or a pharmaceutically
acceptable salt thereof is defined as one in which at least one
atom is replaced by an atom having the same atomic number but an
atomic mass different from the atomic mass usually found in nature.
Examples of isotopes that may be incorporated into the compounds
provided herein and pharmaceutically acceptable salts thereof
include but are not limited to isotopes of hydrogen, carbon,
nitrogen and oxygen such as .sup.2H, .sup.3H, .sup.11C, .sup.13C,
.sup.14C, .sup.15N, .sup.17O, .sup.18O, .sup.35S, .sup.18F,
.sup.36Cl and .sup.123I. Certain isotopic variations of the
compounds provided herein and pharmaceutically acceptable salts
thereof, for example, those in which a radioactive isotope such as
.sup.3H or .sup.14C is incorporated, are useful in drug and/or
substrate tissue distribution studies. In particular examples,
.sup.3H and .sup.14C isotopes may be used for their ease of
preparation and detectability. In other examples, substitution with
isotopes such as .sup.2H may afford certain therapeutic advantages
resulting from greater metabolic stability, such as increased in
vivo half-life or reduced dosage requirements. Isotopic variations
of the compounds, and pharmaceutically acceptable salts, solvates,
N-oxides, prodrugs and isomers thereof, and pharmaceutical
compositions provided herein are prepared by conventional
procedures using appropriate isotopic variations of suitable
reagents.
Processes for Making Compounds of Formula (I)
General procedures for preparing compounds of Formula (I) are
described in the Examples, infra. In the reactions described,
reactive functional groups, for example hydroxy, amino, imino, thio
or carboxy groups, where these are desired in the final product,
may be protected to avoid their unwanted participation in the
reactions. Conventional protecting groups may be used in accordance
with standard practice (see e.g., T. W. Greene and P. G. M. Wuts in
"Protective Groups in Organic Chemistry," John Wiley and Sons,
1991).
In certain embodiments, the compounds of Formula (I) provided
herein are prepared as a pharmaceutically acceptable acid addition
salt by reacting the free base form of the compound of Formula (I)
with a pharmaceutically acceptable organic acid or inorganic acid.
In other embodiments, a pharmaceutically acceptable base addition
salt of compounds of Formula (I) provided herein is prepared by
reacting the free acid form of the compound of Formula (I) with a
pharmaceutically acceptable organic base or inorganic base.
Alternatively, the salt forms of the compounds of Formula (I)
provided herein are prepared using salts of the starting materials
or intermediates. In certain embodiments, the compounds of Formula
(I) provided herein are in the form of other salts including, but
not limited to, oxalates and trifluoroacetates. In certain
embodiments, hemisalts of acids and bases are formed, for example,
hemisulphate and hemicalcium salts.
Such pharmaceutically acceptable acid addition salts of compounds
of Formula (I) include, but are not limited to, a hydrobromide,
hydrochloride, sulfate, nitrate, succinate, maleate, formate,
acetate, adipate, besylatye, bicarbonate/carbonate, propionate,
fumarate, citrate, tartrate, lactate, benzoate, salicylate,
glutamate, aspartate, p-toluenesulfonate, benzenesulfonate,
methanesulfonate, ethanesulfonate, naphthalenesulfonate (e.g.
2-naphthalenesulfonate), hexanoate salt, bisulphate/sulphate,
borate, camsylate, cyclamate, edisylate, esylate, gluceptate,
gluconate, glucuronate, hexafluorophosphate, hibenzate,
hydrochloride/chloride, hydrobromide/bromide, hydroiodide/iodide,
isethionate, lactate, malate, malonate, mesylate, methylsulphate,
naphthylate, 2-napsylate, nicotinate, orotate, oxalate, palmitate,
pamoate, phosphate/hydrogen phosphate/dihydrogen phosphate,
pyroglutamate, saccharate, stearate, tannate, tosylate,
trifluoroacetate and xinofoate salts.
The organic acid or inorganic acids used to form certain
pharmaceutically acceptable acid addition salts of compounds of
Formula (I) include, but are not limited to, hydrobromic,
hydrochloric, sulfuric, nitric, phosphoric, succinic, maleic,
formic, acetic, propionic, fumaric, citric, tartaric, lactic,
benzoic, salicylic, glutamic, aspartic, p-toluenesulfonic,
benzenesulfonic, methanesulfonic, ethanesulfonic,
naphthalenesulfonic such as 2-naphthalenesulfonic, or hexanoic
acid.
Such pharmaceutically acceptable base addition salt of a compound
of Formula (I) include, but are not limited to, aluminium,
arginine, benzathine, calcium, choline, diethylamine, diolamine,
glycine, lysine, magnesium, meglumine, olamine, potassium, sodium,
tromethamine and zinc salts.
In certain embodiments, the free acid or free base forms of the
compounds of Formula (I) provided herein are prepared from the
corresponding base addition salt or acid addition salt from,
respectively. For example a compound Formula (I) in an acid
addition salt form is converted to the corresponding free base by
treating with a suitable base (by way of example only, an ammonium
hydroxide solution, a sodium hydroxide, and the like). For example,
a compound of Formula (I) in a base addition salt form is converted
to the corresponding free acid by treating with a suitable acid (by
way of example only, hydrochloric acid).
In certain embodiments, compounds of Formula (I) in unoxidized form
are prepared from N-oxides of compounds Formula (I) by treating
with a reducing agent (by way of example only, sulfur, sulfur
dioxide, triphenyl phosphine, lithium borohydride, sodium
borohydride, phosphorus trichloride, tribromide, or the like) in a
suitable inert organic solvent (by way of example only,
acetonitrile, ethanol, aqueous dioxane, or the like) at 0 to
80.degree. C.
In certain embodiments, prodrug derivatives of compounds Formula
(I) are prepared using methods known to those of ordinary skill in
the art (e.g., for further details see Saulnier et al., (1994),
Bioorganic and Medicinal Chemistry Letters, Vol. 4, p. 1985). For
example, appropriate prodrugs are prepared by reacting a
non-derivatized compound of Formula (I) with a suitable
carbamylating agent (by way of example only,
1,1-acyloxyalkylcarbanochloridate, para-nitrophenyl carbonate, or
the like).
In certain embodiments, compounds of Formula (I) are prepared as
protected derivatives using methods known to those of ordinary
skill in the art. A detailed description of the techniques
applicable to the creation of protecting groups and their removal
can be found in T. W. Greene, "Protecting Groups in Organic
Chemistry," 3.sup.rd edition, John Wiley and Sons, Inc., 1999.
In certain embodiments, compounds of Formula (I) are prepared or
formed, as solvates (e.g., hydrates). In certain embodiments,
hydrates of compounds of Formula (I) are prepared by
recrystallization from an aqueous/organic solvent mixture, using
organic solvents such as dioxin, tetrahydrofuran or methanol.
In certain embodiments, compounds of Formula (I) are prepared as
their individual stereoisomers. In other embodiments, the compounds
of Formula (I) provided herein are prepared as their individual
stereoisomers by reacting a racemic mixture of the compound with an
optically active resolving agent to form a pair of
diastereoisomeric compounds, separating the diastereomers and
recovering the optically pure enantiomers. In certain embodiments,
resolution of enantiomers is carried out using covalent
diastereomeric derivatives of the compounds of Formula (I), or by
using dissociable complexes (e.g., crystalline diastereomeric
salts). Diastereomers have distinct physical properties (e.g.,
melting points, boiling points, solubility, reactivity, etc.) and
are readily separated by taking advantage of these dissimilarities.
In certain embodiments, the diastereomers are separated by
chromatography, or by separation/resolution techniques based upon
differences in solubility. The optically pure enantiomer is then
recovered, along with the resolving agent, by any practical means
that would not result in racemization. A more detailed description
of the techniques applicable to the resolution of stereoisomers of
compounds from their racemic mixture can be found in Jean Jacques,
Andre Collet, Samuel H. Wilen, "Enantiomers, Racemates and
Resolutions," John Wiley And Sons, Inc., 1981.
Compounds of Formula (I) are made by processes described herein and
as illustrated in the Examples. In certain embodiments, compounds
of Formula (I) are made by: (a) optionally converting a compound of
Formula (I) into a pharmaceutically acceptable salt; (c) optionally
converting a salt form of a compound of Formula (I) to a non-salt
form; (d) optionally converting an unoxidized form of a compound of
Formula (I) into a pharmaceutically acceptable N-oxide; (e)
optionally converting an N-oxide form of a compound of Formula (I)
to its unoxidized form; (f) optionally resolving an individual
isomer of a compound of Formula (I) from a mixture of isomers; (g)
optionally converting a non-derivatized compound of Formula (I)
into a pharmaceutically acceptable prodrug derivative; and (h)
optionally converting a prodrug derivative of a compound of Formula
(I) to its non-derivatized form.
Non-limiting examples of synthetic schemes used to make compounds
of Formula (I) provided herein are illustrated in reaction schemes
(I)-(XI).
Scheme (I) illustrates the synthesis of benzonaphthyridines (I-3)
by coupling 2-(tert-butoxycarbonyl-amino)phenylboronic acids (I-1)
with 3-halopicolinonitrile derivatives (I-2) in the presence of a
palladium catalyst. By way of example only, the halo moiety of the
3-halopicolinonitrile derivatives is bromo or chloro. The R.sub.A
and R.sub.B groups on benzonaphthyridines (I-3) are as described
herein for substituents of Formula (I) at the respective positions,
or R.sub.A and R.sub.B are groups that are further modified to
obtain the respective substituents of Formula (I), as described
herein.
##STR00005##
In certain embodiments, the phenyl boronic acids used in the
synthesis of compounds of Formula (I) were synthesized according to
scheme (II). In scheme (II) aniline (II-1) is Boc-protected under
basic conditions to give (II-2), and then converted into the
boronic acids (I-1) through ortho-lithiation and reaction with
trimethyl borate followed by aqueous workup.
##STR00006##
Boric acids (I-1) are used as in scheme (I) and reacted
cyanopyridines (I-2) to afford benzonaphthyridines (I-3).
In certain embodiments, boronic acid equivalents including, but not
limited to, boronate esters were used in the synthesis of compounds
of Formula (I). Scheme (III) illustrates the synthesis of such
boronate esters (III-3), which were used as boronic acid
equivalents in the synthesis of benzonaphthyridines (I-3). In
scheme (III) 2-haloanilines (III-1) were Boc-protected under basic
conditions to give (III-2), which were then converted into the
boronate esters (III-3) using palladium-mediated catalysis. These
boronate esters (III-3) were used as in scheme (I) and reacted with
cyanopyridines (I-2) to afford substituted or unsubsubstituted
benzonaphthyridines (I-3).
##STR00007##
In certain embodiments, 2-bromoanilines used as in scheme (III)
were synthesized from their corresponding nitrobenzene compounds as
illustrated below:
##STR00008##
In other embodiments, compounds of Formula (I) were synthesized
using the methodologies described in scheme (IV).
##STR00009##
In scheme (IV), 3-chlorobenzaldehyde (IV-1) is first converted to
the corresponding hydroxylamine (IV-2), which is then used to make
the corresponding nitrile (IV-3). Using palladium-mediated
conditions, as in scheme (I), derivatives of nitrile (IV-3) are
coupled with boronic acids (I1) (or boronate esters (III-3) to give
the benzonaphthyridine (I-3).
In other embodiments, certain compounds of Formula (I) having
carbon-linked substituents, including benzonaphthyridines with
various carbon-linked substituents at the 2-position, were prepared
using the synthetic route shown in scheme (V).
##STR00010##
In scheme (V), a 3,5-dihalopicolinonitrile, such as, by way of
example only, 3,5-dichloropicolinonitrile (V-1), is first
mono-substituted using one equivalent of boronic acid/ester thereby
giving the corresponding picolinonitrile (V-2). Using more vigorous
palladium-mediated conditions as in scheme (I), derivatives of
nitrile (V-2) are coupled with boronic acids (I-1) (or boronate
esters (III-3) to give the benzonaphthyridine (V-3) having
carbon-linked substituents at the 2-position. In certain
embodiments the carbon-linked substituent is an alkene, while in
other embodiments such alkenes are further modified by
hydrogenation to give benzonaphthyridines with alkyl groups at the
2-position.
In other embodiments, certain compounds of Formula (I) having
various substituents, including benzonaphthyridines with various
substituents at the 2-position, were synthesized using the
methodologies described in scheme (VI).
##STR00011##
In scheme (VI), a 2,3-dihalopyridines substituted at the 5 position
(VI-1), such as, by way of example only,
(5,6-dichloropyridin-3-yl)methanol, is first converted to the
corresponding nitrile (VI-2). Using palladium-mediated conditions
as in scheme (I), derivatives of nitrile (VI-2) are coupled with
boronic acids (I-1) (or boronate esters (III-3) to give the
benzonaphthyridine (I-3).
In other embodiments, certain compounds of Formula (I) were
synthesized using the methodologies described in scheme (VII).
##STR00012##
In scheme (VII), aryl bromides or aryl iodides (VII-1) are coupled
with triethyl(ethynyl)silane (or its equivalents) using
palladium-mediated conditions to afford (VII-2). After deprotection
of the silyl protection group, acetylene derivatives (VII-3) are
coupled with 3,5-dichloropicolinonitrile (VII-4) using
palladium-mediated conditions to afford 3-chloro-2-cyanopyridines
(VII-5). Derivatives of (VII-5) such as, by way of example only,
3-chloro-5-(phenylethynyl)picolinonitrile are coupled with boronic
acids (I-1) (or boronate esters (III-3) to give the
benzonaphthyridine (VII-6). Compound (VII-6) is then subjected
under hydrogenation conditions to give benzonaphthyridines (VII-7).
R.sub.2 is as described herein and the R.sub.A and R.sub.B groups
on benzonaphthyridines (VII-7) are as described herein for
substituents of Formula (I) at the respective positions, or R.sub.A
and R.sub.B are groups that are further modified to obtain the
respective substituents of Formula (I), as described herein.
In other embodiments, certain compounds of Formula (I) were
synthesized using the methodologies described in scheme (VIII).
##STR00013##
In scheme (VIII), aryl bromides or aryl iodides (VIII-1) are
coupled with triethyl(ethynyl)silane (or its equivalents) using
palladium-mediated conditions to afford (VIII-2). After
deprotection of the silyl protection group, acetylene derivatives
(VIII-3) are coupled with 3,5-dichloropicolinonitrile (VIII-4)
using palladium-mediated conditions to afford
3-chloro-2-cyanopyridines (VIII-5). Derivatives of (VIII-5) such
as, by way of example only,
3-chloro-5-(phenylethynyl)picolinonitrile are reduced to the
corresponding 3-chloro-5-phenethylpicolinonitrile (VIII-6) under
hydrogenation conditions. Compound (VIII-6) is coupled with boronic
acids (I-1) (or boronate esters (III-3) to give benzonaphthyridines
(VIII-7). R.sub.2 is as described herein and the R.sub.A and
R.sub.B groups on benzonaphthyridines (VII-7) are as described
herein for substituents of Formula (I) at the respective positions,
or R.sub.A and R.sub.B are groups that are further modified to
obtain the respective substituents of Formula (I), as described
herein.
In other embodiments, certain compounds of Formula (I) were
synthesized using the methodologies described in scheme (IX).
##STR00014## ##STR00015##
In scheme (IX) compound (IX-1) bearing a phenol group is alkylated
with various electrophiles, where R.sup.1, R.sup.2, L.sup.1,
L.sup.3, L.sup.4, R.sup.5 and R.sup.7 are as defined herein. In
certain examples, analogs containing alkoxy appendages at the
phenol position were prepared as exemplified in Scheme 1, wherein a
compound bearing a phenol group, was alkylated with a
phosphonate-containing electrophile to give a protected
phosphonate, which was treated with a suitable deprotecting agent
to afford the phosphonic acid.
The examples provided herein are offered to illustrate, but not to
limit, the compounds of Formula (I) provided herein, and the
preparation of such compounds. By way of example only, certain
compounds of Formula (I) containing carboxylic acid appendages at
the C-8 position were prepared as exemplified in Scheme 2.
By way of example only, certain compounds of Formula (I) containing
.alpha.,.alpha.'-difluororo phosphonic acid appendages at the C-8
position were prepared as exemplified in Scheme 3, wherein a
primary alcohol was oxidized to an aldehyde and alkylation of this
aldehyde with the appropriate phosphonate reagent yielded a
phosphonate. Additionally, oxidation of the benzylic alcoholgave
the keto moiety and final hydrolysis gave the final phosphonic acid
derivative.
By way of example only, certain compounds of Formula (I) containing
phosphonic acid appendages at the C-8 position were prepared as
shown in Scheme 4, wherein an aldehyde was treated with a Wittig
reagent to provide a vinyl phosphonates. Hydrolysis of phosphonate
with, by way of example only, trimethylsilyl bromide delivers a
phosphonic acid. Allternatively, hydrogenation of the vinyl moiety
provided an alkyl linked phosphonate which was hydrolyzed to give
an alkyl linked phosphonic acid.
By way of example only, certain compounds of Formula (I) containing
aryl phosphate groups were prepared according to Scheme 5, wherein
a compound bearing a phenol group was treated with
1-(bromomethyl)-3-iodobenzene and cesium carbonate resulting in an
intermediate which was palladium catalyzed cross-coupling with
triethyl phosphoate, followed by hydrolysis with trimethylsilyl
bromide giving a compound bearing a phosphonic acid.
By way of example only, certain compounds of Formula (I) containing
.alpha.-keto phosphonic acid appendages at the C-8 position are
prepared as exemplified in Scheme 6, wherein treatment of an
aldehyde with tris(trimethylsilyl) phosphite followed by oxidation
with IBX resulted in the phosphonic acid.
Pharmacology and Utility
When a foreign antigen challenges the immune system it responds by
launching a protective response that is characterized by the
coordinated interaction of both the innate and acquired immune
systems. These two interdependent systems fulfill two mutually
exclusive requirements: speed (contributed by the innate system)
and specificity (contributed by the adaptive system).
The innate immune system serves as the first line of defense
against invading pathogens, holding the pathogen in check while the
adaptive responses are matured. It is triggered within minutes of
infection in an antigen-independent fashion, responding to broadly
conserved patterns in the pathogens (though it is not non-specific,
and can distinguish between self and pathogens). Crucially, it also
generates the inflammatory and co-stimulatory milieu (sometimes
referred to as the danger signal) that potentiates the adaptive
immune system and steers (or polarizes it) towards the cellular or
humoral responses most appropriate for combating the infectious
agent. The development of TLR modulators for therapeutic targeting
of innate immunity has been reviewed (see Nature Medicine, 2007,
13, 552-559; Drug Discovery Today: Therapeutic Stategies, 2006, 3,
343-352 and Journal of Immunology, 2005, 174, 1259-1268).
The adaptive response becomes effective over days or weeks, but
ultimately provides the fine antigenic specificity required for
complete elimination of the pathogen and the generation of
immunologic memory. It is mediated principally by T and B cells
that have undergone germline gene rearrangement and are
characterized by specificity and long-lasting memory. However, it
also involves the recruitment of elements of the innate immune
system, including professional phagocytes (macrophages, neutrophils
etc.) and granulocytes (basophils, eosinophils etc.) that engulf
bacteria and even relatively large protozoal parasites. Once an
adaptive immune response has matured, subsequent exposure to the
pathogen results in its rapid elimination due to highly specific
memory cells have been generated that are rapidly activated upon
subsequent exposure to their cognate antigen.
Autoimmune diseases, are defined by (i) humoral or autoantibody
response to a self antigen (by way of example only, Graves' primary
hyperthyroidism with antibodies to the TSH receptor), or (ii)
cellular response wherein immune cells destroy nonimmune cells from
which the self-antigen is derived (by way of example only, the
thyrocyte (Hashimoto's thyroiditis) or pancreatic .beta.-islet cell
(Type 1 diabetes). Many autoimmune diseases are a combination of
both phenomena, for instance, Hashimoto's and Type 1 diabetes also
have auto-antibodies, anti-thyroid peroxidase (TPO) or
anti-glutamic acid decarboxylase (GAD)/Islet Cell. Autoimmune
diseases often have an inflammatory component including, but not
limited to, increases in adhesion molecules (by way of example
only, vascular cell adhesion molecule-1 (VCAM-1), and altered
leukocyte adhesion to the vasculature such as, by way of example
only, colitis, systemic lupus, systemic sclerosis, and the vascular
complications of diabetes.
Toll-like receptors (TLRs) are type-I transmembrane proteins
characterized by an extracellular N-terminal leucine-rich repeat
(LRR) domain, followed by a cysteine-rich region, a TM domain, and
an intracellular (cytoplasmic) tail that contains a conserved
region named the Toll/IL-1 receptor (TIR) domain. TLRs are pattern
recognition receptors (PRR) that are expressed predominantly on
immune cells including, but not limited to, dendritic cells, T
lymphocytes, macrophages, monocytes and natural killer cells. The
LLR domain is important for ligand binding and associated signaling
and is a common feature of PRRs. The TIR domain is important in
protein-protein interactions and is associated with innate
immunity. The TIR domain also unites a larger IL-1 R/TLR
superfamily that is composed of three subgroups. Members of the
first group possess immunoglobin domains in their extracellular
regions and include IL-1 and IL-18 receptors and accessory proteins
as well as ST2. The second group encompasses the TLRs. The third
group includes intracellular adaptor proteins important for
signaling.
TLRs are a group of pattern recognition receptors which bind to
pathogen-associated molecular patterns (PAMPS) from bacteria,
fungi, protozoa and viruses, and act as a first line of defense
against invading pathogens. TLRs are essential to induce expression
of genes involved in inflammatory responses, and TLRs and the
innate immune system are a critical step in the development of
antigen-specific acquired immunity.
Adaptive (humoral or cell-mediated) immunity is associated with the
TLR signal mechanism of innate immunity. Innate immunity is a
protective immune cell response that functions rapidly to fight
environmental insults including, but not limited to, bacterial or
viral agents. Adaptive immunity is a slower response, which
involves differentiation and activation of naive T lymphocytes into
T helper 1 (Th1) or T helper 2 (Th2) cell types. Th1 cells mainly
promote cellular immunity, whereas Th2 cells mainly promote humoral
immunity. Though primarily a host protective system, pathologic
expression of the innate immunity signals emanating from the TLR
pathway are implicated in initiating autoimmune-inflammatory
diseases.
All TLRs appear to function as either a homodimer or heterodimer in
the recognition of a specific, or set of specific, molecular
determinants present on pathogenic organisms including bacterial
cell-surface lipopolysaccharides, lipoproteins, bacterial
flagellin, DNA from both bacteria and viruses and viral RNA. The
cellular response to TLR activation involves activation of one or
more transcription factors, leading to the production and secretion
of cytokines and co-stimulatory molecules such as interferons,
TNF-, interleukins, MIP-1 and MCP-1 which contribute to the killing
and clearance of the pathogenic invasion.
TLR spatial expression is coincident with the host's environmental
interface. While only a few other Toll-like proteins have been
cloned in Drosophila, the human TLR family is composed of at least
11 members, TLR1 through TLR11, that elicit overlapping yet
distinct biological responses due to differences in cellular
expression and signaling pathways they initiate. Each of the TLRs
is expressed on a different subset of leukocytes and each of the
TLRs is specific in its expression patterns and PAMP sensitivities
and detects different subsets of pathogens allowing vigilant
surveillance by the immune system.
Toll-Like Receptor 1 (TLR1)
TLR1 maps to chromosome 4p14 and its sequence encodes a putative
786 amino acid (aa) protein with 18 N-terminal LRRs and a
calculated molecular weight of 84 kDa. TLR1 is most closely related
to TLR6 and TLR10 with 68% and 48% overall (aa) sequence identity,
respectively.
TLR1 mRNA is ubiquitously expressed and found at higher levels than
the other TLRs. Of the major leukocyte populations, TLR1 is most
highly expressed by monocytes, but is also expressed by
macrophages, dendritic cells, polymorphonuclear leukocytes, B, T,
and NK cells. In vivo, two different sized transcripts for TLR1 are
observed suggesting that the mRNA is alternatively spliced to
generate two different forms of the protein. In vitro, TLR1 mRNA
and protein expression is upregulated in monocytic leukemic (THP-1)
cells upon PMA-induced differentiation. TLR1 expression is
upregulated by autocrine IL-6, and is also elevated by
IFN-.gamma..beta., IL-10, and TNF-.alpha.. However, TLR1 level is
unaffected by exposure to both Gram-positive and Gram-negative
bacteria. Ex vivo, both monocyte and granulocyte TLR1 expression is
downregulated after exposure to Gram-negative bacteria. TLR1 forms
a heterodimer with TLR2. TLR1 also heterodimerizes with TLR4, which
inhibits TLR4 activity.
Toll-Like Receptor 2 (TLR2)
TLR2 maps to chromosome 4q31-32 and encodes a putative 784 (aa)
protein with 19 N-terminal LLRs and a calculated molecular weight
of 84 kDa. TLR2 is most closely related to TLR6 with 31% overall
(aa) sequence identity.
TLR2 mRNA expression is observed in brain, heart, lung, and spleen
tissues and is highest in PBLs, specifically those of
myelomonocytic origin. In vivo, two different sized transcripts for
TLR2 are observed suggesting that the mRNA is alternatively
spliced. In vitro, TLR2 mRNA and protein expression is upregulated
in monocytic leukemic (THP-1) cells upon PMA-induced
differentiation. TLR2 is upregulated by autocrine IL-6 and
TNF-.alpha., IL-1.beta., and IL-10. TLR2 mRNA expression is
elevated after exposure to both Gram-positive and Gram-negative
bacteria. TLR2 forms heterodimers with TLR1, TLR6, and possibly
TLR10, where each complex is particularly sensitive to subsets of
TLR2-associated PAMPs. TLR2 complexes recognize a wide range of
PAMPs, mostly from bacteria. These include, but are not limited to,
lipoarabinomannan (LAM), lipopolysaccharide (LPS), lipoteichoic
acid (LTA), peptidoglycan (PGN), and other glycolipids,
glycoproteins, and lipoproteins. TLR2 complexes are also capable of
detecting viruses, including but not limited to, measles virus
(MV), human cytomegalovirus (HCMV), and hepatitis C virus (HCV) and
fungal PAMPs, including but not limited to, zymosan. TLR2
recognizes a variety of lipoproteins/lipopeptides from various
pathogens such as, by way of example only, Gram-positive bacteria,
mycobacteria, Trypanosoma cruzi, fungi and Treponema. In addition,
TLR2 recognizes LPS preparations from non-enterobacteria such as,
by way of example only, Leptospira interrogans, Porphyromonas
gingivalis and Helicobacter pylori. TLR2 complexes are capable of
both detection of non-self patterns and detecting altered self
patterns, such as those displayed by necrotic cells. TLR2 is
recruited to phagosomes and is involved in the internalization of
microbial products by cells.
Toll-like Receptor 3 (TLR3)
TLR3 maps to chromosome 4q35 and its sequence encodes a putative
904 (aa) protein with 24 N-terminal LRRs and a calculated molecular
weight of 97 kDa. TLR3 is most closely related to TLR5, TLR7, and
TLR8, each with 26% overall (aa) sequence identity.
TLR3 mRNA is expressed at highest levels in the placenta and
pancreas. TLR3 is expressed by dendritic cells, T and NK cells. In
vivo, two different sized transcripts for TLR3 are observed
suggesting that the mRNA is alternatively spliced to generate two
different forms of the protein. In vitro, PMA-differentiated THP-1
TLR3 is moderately upregulated by autocrine IFN-.gamma.,
IL-1.beta., IL-6, IL-10, and TNF-.alpha.. TLR3 mRNA is elevated
after exposure to Gram-negative bacteria and to an even greater
extent in response to Gram-positive bacteria. Ex vivo, TLR3
expression is elevated in both monocytes and granulocytes upon
exposure to Gram-negative bacteria. TLR3 forms a homodimer and
recognizes viral double stranded RNA (dsRNA). While it is generally
assumed that TLRs are expressed on the cell surface, however those
TLRs sensitive to internal PAMPs, such as dsRNA in the case of
TLR3, are localized intracellularly in the lysosomal
compartment.
Toll-Like Receptor 4 (TLR4)
TLR4 maps to chromosome 9q32-33, and shows a high degree of
similarity to dToll over the entire (aa) sequence. The TLR4
sequence encodes an 839 (aa) protein with 22 N-terminal LRR regions
and a calculated molecular weight of 90 kDa. TLR4 is most closely
related to TLR1 and TLR6 each with 25% overall (aa) sequence
identity.
In vivo, TLR4 mRNA is expressed as a single transcript, and found
at highest levels in spleen and PBLs. Of the PBL populations, TLR4
is expressed by B cells, dendritic cells, monocytes, macrophages,
granulocytes, and T cells. TLR4 is also expressed in myelomonocytic
cells and is highest in mononuclear cells. In vitro, TLR4 mRNA and
protein expression is upregulated in THP-1 cells upon PMA-induced
differentiation. TLR4 is moderately upregulated by autocrine
IFN-.gamma., IL-1.beta.. TLR4 mRNA expression in THP-1 cells is
unaffected by exposure to both Gram-positive and Gram-negative
bacteria. Ex vivo, granulocyte, and monocyte, TLR4 expression is
upregulated upon exposure to Gram-negative bacteria.
TLR4 forms a homodimer and requires the extracellular association
of an additional component, MD-2. Although TLR2 complexes are
capable of recognizing lipopolysaccharide (LPS), TLR4 is generally
considered the LPS receptor. MD-2-associated TLR4 homodimers do not
bind LPS directly, however. LPS must first be bound by the soluble
LPS binding protein (LBP). LBP is then bound by either soluble or
GPI-linked CD14. Additional cell type-dependent components required
for LPS detection by TLR4 include CXCR4, GDF-5, CD55, various heat
shock proteins (HSPs), and complement receptors (CRs). The TLR4
complex also recognizes a few other bacterial PAMPs including LTA.
Further, the TLR4 complex recognizes viruses including respiratory
syncytial virus (RSV), hepatitis C virus (HCV), and mouse mammary
tumor virus (MMTV). The TLR4 complex can also recognize endogenous
ligands, for example, heat shock proteins (HSP60 and HSP70),
fibrinogen, domain A of fibronectin, oligosaccharides of hyaluronic
acid, heparan sulfate, surfactant protein A (SP-A), and
.beta.-defensins. TLR4 also forms heterodimers both with TLR5,
which enhances its activity, and also with TLR1, which inhibits its
activity.
Toll-Like Receptor 5 (TLR5)
TLR5 maps to chromosome 1q41-42, and the gene encodes a putative
858 (aa) protein with a calculated molecular weight of 91 kDa. It
is most closely related to TLR3 with 26% overall (aa) sequence
identity.
In vivo, TLR5 mRNA is expressed as a single transcript in ovary,
prostate, and PBLs. TLR5 is expressed by several PBL populations
with the highest expression found in monocytes. TLR5 is also
expressed on the basolateral side of intestinal epithelial cells
and intestinal endothelial cells of the subepithelial compartment.
In vitro, TLR5 is upregulated in PMA-differentiated THP-1 cells by
autocrine IL-6, IL-10, and TNF-.alpha., but is also elevated by
IFN-.gamma..beta.. TLR5 mRNA expression is elevated after exposure
to both Gram-positive and Gram-negative bacteria. Ex vivo,
granulocyte and monocyte TLR5 expression is downregulated upon
exposure to Gram-negative bacteria. TLR5 forms a homodimer as well
as a heterodimer with TLR4. Both complexes function to recognize
the Flagellin protein of flagellated bacteria. Expression of human
TLR5 in CHO cells confers response to flagellin, a monomeric
constituent of bacterial flagella. Flagellin activates lung
epithelial cells to induce inflammatory cytokine production. A stop
codon polymorphism in TLR5 has been associated with susceptibility
to pneumonia caused by the flagellated bacterium Legionella
pneumophila.
Toll-Like Receptor 6 (TLR6)
TLR6 maps to chromosome 4p14, and the TLR6 sequence encodes a 796
(aa) protein containing 20 N-terminal LRR motifs with a calculated
molecular weight of 91 kDa. TLR6 is most closely related to TLR1,
TLR10, and TLR2 with 68%, 46%, and 31% overall (aa) sequence
identity, respectively.
In vivo, TLR6 transcript is observed in thymus, spleen, and lung.
TLR6 mRNA expression is highest in B cells and monocytes. In vitro,
TLR6 mRNA expression is upregulated in THP-1 cells upon PMA-induced
differentiation. TLR6 is moderately upregulated by autocrine
IFN-.gamma., IL-1.beta.. However, TLR6 mRNA expression in THP-1
cells is unaffected by exposure to both Gram-positive and
Gram-negative bacteria. Ex vivo, monocyte andgranulocyte TLR6
expression is downregulated upon exposure to Gram-negative
bacteria. TLR6 forms a heterodimer with TLR2. Like TLR1, TLR6 is
thought to specify or enhance the PAMP sensitivity of TLR2 and
contribute to its signaling capabilities through
heterodimerization.
Toll-Like Receptor 7 (TLR7)
TLR7 maps to human chromosome Xp22, and the TLR7 sequence encodes a
1049 (aa) protein containing 27 N-terminal LRRs with a calculated
molecular weight of 121 kDa. TLR7 is most closely related to TLR8
and TLR9 with 43% and 36% overall (aa) sequence identity,
respectively.
In vivo, TLR7 mRNA is expressed in lung, placenta, spleen, lymph
node, and tonsil. TLR7 mRNA expression is highest in monocytes, B
cells, and plasmocytoid dendritic cells. In vitro, TLR7 mRNA
expression is upregulated in THP-1 cells upon PMA-induced
differentiation. TLR7 is highly upregulated by exposure to IL-6 and
to a slightly lesser extent by autocrine IFN-.gamma., IL-1.beta..
TLR7 mRNA expression in THP-1 cells is elevated after exposure to
both Gram-positive and Gram-negative bacteria. Ex vivo, expression
of TLR7 is elevated after exposure to both Gram-positive and
Gram-negative bacteria in monocytes and to a greater degree in
granulocytes. TLR7 is expressed in the endosome. The role of TLR7,
is to detect the presence of "foreign" single-stranded RNA within a
cell, as a means to respond to viral invasion. TLR7 is a
structurally highly conserved protein which recognizes guanosine-
or uridine-rich, single-stranded RNA (ssRNA) from viruses such as
human immunodeficiency virus, vesicular stomatitis virus and
influenza virus
Toll-Like Receptor 8 (TLR8)
TLR8 maps to chromosome Xp22, and the TLR8 sequence encodes a 1041
(aa) protein containing 26 N-terminal LRRs with a calculated
molecular weight of 120 kDa. TLR8 is most closely related to TLR7
and TLR9 with 43% and 35% overall (aa) sequence identity,
respectively.
In vivo, TLR8 mRNA is expressed in lung, placenta, spleen, lymph
node, bone marrow, and PBLs, with highest expression found in cells
of myeloid origin, such as monocytes, granulocytes and myeloid
dendritic cells. In vitro, TLR8 mRNA expression is upregulated in
THP-1 cells upon PMA-induced differentiation. TLR8 is highly
upregulated by autocrine IL-1.beta., IL-6, IL-10, and TNF-.alpha.,
and is even more enhanced by exposure to IFN-.gamma.. TLR8 mRNA
expression in THP-1 cells is elevated after exposure to both
Gram-positive and Gram-negative bacteria. Ex vivo, monocyte TLR8
expression increases while granulocyte expression decreases on
exposure to Gram-negative bacteria. TLR8 is expressed in the
endosome. The role of TLR8 is to detect the presence of "foreign"
single-stranded RNA within a cell, as a means to respond to viral
invasion. TLR8 is a structurally highly conserved protein which
recognizes guanosine- or uridine-rich, single-stranded RNA (ssRNA)
from viruses such as human immunodeficiency virus, vesicular
stomatitis virus and influenza virus.
Toll-Like Receptor 9 (TLR9)
TLR9 maps to chromosome 3p21, and the TLR9 sequence encodes a 1032
(aa) protein containing 27 N-terminal LRRs with a calculated
molecular weight of 116 kDa. TLR9 is most closely related to TLR7
and TLR8 with 36% and 35% overall (aa) sequence identity,
respectively.
In vivo, TLR9 mRNA is expressed in spleen, lymph node, bone marrow,
and PBLs. Specifically, TLR9 mRNA is expressed at the highest
levels in B cells and dendritic cells. In vitro, TLR9 is moderately
upregulated by autocrine IFN-.gamma., IL-1.beta., IL-6, IL-10, and
TNF-.alpha. in PMA-differentiated THP-1 cells. TLR9 mRNA expression
in THP-1 cells is unaffected by exposure to both Gram-positive and
Gram-negative bacteria. Ex vivo, TLR9 expression in monocytes and
particularly in granulocytes is downregulated in response to
Gram-negative bacteria. TLR9 forms a homodimer and recognizes
unmethylated bacterial DNA. TLR9 is involved in the inflammatory
response to bacterial DNA and oligonucleotides that contain
unmethylated CpG DNA sequences. TLR9 is localized internally,
perhaps in lysosomic or endocytic compartments where it would more
likely encounter PAMPs including unmethylated CpG DNA
sequences.
TLR9 is a receptor for CpG DNA, and recognizes bacterial and viral
CpG DNA. Bacterial and viral DNA contains unmethylated CpG motifs,
which confer its immunostimulatory activity. In vertebrates, the
frequency of CpG motifs is severely reduced and the cytosine
residues of CpG motifs are highly methylated, leading to abrogation
of the immunostimulatory activity. Structurally, there are at least
two types of CpG DNA: B/K-type CpG DNA is a potent inducer of
inflammatory cytokines such as IL-12 and TNF-.alpha.; A/D-type CpG
DNA has a greater ability to induce IFN-.alpha. production from
plasmacytoid dendritic cells (PDC). TLR9 is also involved in
pathogenesis of autoimmune disorders, and may be important in
Graves' autoimmune hyperthyroidism and production of rheumatoid
factor by auto-reactive B cells. Similarly, internalization by the
Fc receptor can cause TLR9 mediated PDC induction of IFN-.alpha. by
immune complexes containing IgG and chromatin, which are implicated
in the pathogenesis of systemic lupus erythematosus (SLE). TLR9 is
involved in the pathogenesis of several autoimmune diseases through
recognition of the chromatin structure.
Toll-Like Receptor 10 (TLR10)
The TLR10 sequence encodes a putative 811 (aa) protein with
molecular weight of 95 kDa. TLR10 is most closely related to TLR1
and TLR6 with 48% and 46% overall (aa) identity, respectively.
In vivo, TLR10 mRNA expression is highest in immune system-related
tissues including spleen, lymph node, thymus, and tonsil. TLR10
mRNA is most highly expressed on B cells and plasmacytoid dendritic
cells (PDCs). In vitro, TLR10 is moderately upregulated by
autocrine IFN-.gamma., IL-1.beta., IL-6, IL-10, and TNF-.alpha. in
PMA-differentiated THP-1 cells. TLR10 mRNA expression in THP-1
cells is elevated after exposure to both Gram-positive and
Gram-negative bacteria. Ex vivo, monocyte TLR10 expression
increases, while granulocyte expression decreases on exposure to
Gram-negative bacteria.
Toll-Like Receptor 11 (TLR11)
TLR11 is expressed in bladder epithelial cells and mediate
resistance to infection by uropathogenic bacteria in mouse.
As presented above, TLR2 and TLR4 recognize Gram-positive and
Gram-negative bacterial cell wall products, respectively; TLR5
recognizes a structural epitope of bacterial flagellin; TLR3, TLR7,
TLR8, and TLR9 recognize different forms of microbial-derived
nucleic acid.
The TIR domains interact with several TIR domain-containing adaptor
molecules (MyD88), TIR domain-containing adaptor protein (TRAP),
TIR domain-containing adaptor-inducing IFN-.beta. (TRIF), and
TRIF-related adaptor molecule (TRAM) which activate a cascade of
events resulting in transcription factor induction.
TLR Signaling Pathways.
TLRs are distributed throughout the cell. TLR1, TLR2, TLR3 and TLR4
are expressed on the cell surface, whereas, TLR3, TLR7, TLR8 and
TLR9 are expressed in intracellular compartments such as endosomes.
TLR3-, TLR7- or TLR9-mediated recognition of their ligands require
endosomal maturation and processing. When macrophages, monocytes,
dendritic cells or nonimmune cells that become antigen presenting
cells engulf bacteria by phagocytosis, the bacteria degrade and CpG
DNA is release into phagosomes-lysosomes or in endosomes-lysosomes
wherein they can interact with TLR9 that has been recruited from
the endoplasmic reticulum upon non-specific uptake of CpG DNA.
Furthermore, when viruses invade cells by receptor-mediated
endocytosis, the viral contents are exposed to the cytoplasm by
fusion of the viral membrane with the endosomal membrane. This
results in exposure of TLR ligands such as dsRNA, ssRNA and CpG DNA
to TLR9 in the phagosomal/lysosomal or endosomal/lysosomal
compartments.
In the signaling pathways downstream of the TIR domain, a TIR
domain-containing adaptor, MyD88, is essential for induction of
inflammatory cytokines such as TNF-.alpha. and IL-12 through all
TLRs. Although TIR domain-containing adaptor molecules (MyD88) are
common to all TLRs, individual TLR signaling pathways are divergent
and activation of specific TLRs leads to slightly different
patterns of gene expression profiles. By way of example only,
activation of TLR3 and TLR4 signaling pathways results in induction
of type I interferons (IFNs), while activation of TLR2- and
TLR5-mediated pathways do not. However, activation of TLR7, TLR8
and TLR9 signaling pathways also leads to induction of Type I IFNs,
although this occurs through mechanisms distinct from
TLR3/4-mediated induction.
Once engaged, TLRs initiate a signal transduction cascade leading
to activation of NF.kappa.B via the adapter protein myeloid
differentiation primary response gene 88 (MyD88) and recruitment of
the IL-1 receptor associated kinase (IRAK). The MyD88-dependent
pathway is analogous to signaling by the IL-1 receptors, and it is
regarded that MyD88, harboring a C-terminal TIR domain and an
N-terminal death domain, associates with the TIR domain of TLRs.
Upon stimulation, MyD88 recruits IRAK-4 to TLRs through interaction
of the death domains of both molecules, and facilitates
IRAK-4-mediated phosphorylation of IRAK-1. Phosphorylation of
IRAK-1 then leads to recruitment of TNF-receptor associated factor
6 (TRAF6), leading to the activation of two distinct signaling
pathways. One pathway leads to activation of AP-1 transcription
factors through activation of MAP kinases. Another pathway
activates the TAK1/TAB complex, which enhances activity of the
I.kappa.B kinase (IKK) complex. Once activated, the IKK complex
induces phosphorylation and subsequent degradation of the
NF.kappa.B inhibitor IKB, which leads to nuclear translocation of
transcription factor NF.kappa.B and the initiation of transcription
of genes whose promoters contain NF.kappa.B binding sites, such as
cytokines. The MyD88-dependent pathway plays a crucial role and is
essential for inflammatory cytokine production through all
TLRs.
Stimulation of TLR8-expressing cells, such as PBMCs results in
production of high levels of IL-12, IFN-.gamma., IL-1, TNF-.alpha.,
IL-6 and other inflammatory cytokines. Similarly, stimulation of
TLR7-expressing cells, such as plasmacytoid dendritic cells,
results in production of high levels of interferon-.alpha.
(IFN.alpha.) and low levels of inflammatory cytokines. Thus,
through activation of dendritic cells and other antigen-presenting
cells, TLR7, TLR8 or TLR9 engagement and cytokine production is
expected to activate diverse innate and acquired immune response
mechanisms leading to the destruction of pathogens, infected cells
or tumor cells.
Compounds of Formula (I), pharmaceutically acceptable salts,
solvates, N-oxides, prodrugs and isomers thereof, pharmaceutical
compositions, and/or combinations provided herein are agonists of
toll-like receptor 7 activity, and are used in the treatment of
diseases and/or disorders associated with such TLR7 receptors.
In certain embodiments, the compounds of Formula (I),
pharmaceutically acceptable salts, solvates, N-oxides, prodrugs and
isomers thereof, pharmaceutical compositions, and/or combinations
provided herein are used in the treatment of respiratory diseases
and/or disorders including, but not limited to, asthma, bronchial
asthma, allergic asthma, intrinsic asthma, extrinsic asthma,
exercise-induced asthma, drug-induced asthma (including aspirin and
NSAID-induced) and dust-induced asthma, chronic obstructive
pulmonary disease (COPD); bronchitis, including infectious and
eosinophilic bronchitis; emphysema; bronchiectasis; cystic
fibrosis; sarcoidosis; farmer's lung and related diseases;
hypersensitivity pneumonitis; lung fibrosis, including cryptogenic
fibrosing alveolitis, idiopathic interstitial pneumonias, fibrosis
complicating anti-neoplastic therapy and chronic infection,
including tuberculosis and aspergillosis and other fungal
infections; complications of lung transplantation; vasculitic and
thrombotic disorders of the lung vasculature, and pulmonary
hypertension; antitussive activity including treatment of chronic
cough associated with inflammatory and secretory conditions of the
airways, and iatrogenic cough; acute and chronic rhinitis including
rhinitis medicamentosa, and vasomotor rhinitis; perennial and
seasonal allergic rhinitis including rhinitis nervosa (hay fever);
nasal polyposis; acute viral infection including the common cold,
and infection due to respiratory syncytial virus, influenza,
coronavirus (including SARS) and adenovirus.
In certain embodiments, the compounds of Formula (I),
pharmaceutically acceptable salts, solvates, N-oxides, prodrugs and
isomers thereof, pharmaceutical compositions, and/or combinations
provided herein are used in the treatment of dermatological
disorders including, but not limited to, psoriasis, atopic
dermatitis, contact dermatitis or other eczematous dermatoses, and
delayed-type hypersensitivity reactions; phyto- and
photodermatitis; seborrhoeic dermatitis, dermatitis herpetiformis,
lichen planus, lichen sclerosus et atrophica, pyoderma gangrenosum,
skin sarcoid, basal cell carcinoma, actinic keratosis, discoid
lupus erythematosus, pemphigus, pemphigoid, epidermolysis bullosa,
urticaria, angioedema, vasculitides, toxic erythemas, cutaneous
eosinophilias, alopecia greata, male-pattern baldness, Sweet's
syndrome, Weber-Christian syndrome, erythema multiforme;
cellulitis, both infective and non-infective; panniculitis;
cutaneous lymphomas, non-melanoma skin cancer and other dysplastic
lesions; drug-induced disorders including fixed drug eruptions.
In certain embodiments, the compounds of Formula (I),
pharmaceutically acceptable salts, solvates, N-oxides, prodrugs and
isomers thereof, pharmaceutical compositions, and/or combinations
provided herein are used in the treatment of ocular diseases and/or
disorders including, but not limited to, blepharitis;
conjunctivitis, including perennial and vernal allergic
conjunctivitis; iritis; anterior and posterior uveitis;
choroiditis; autoimmune, degenerative or inflammatory disorders
affecting the retina; ophthalmitis including sympathetic
ophthalmitis; sarcoidosis; infections including viral, fungal, and
bacterial.
In certain embodiments, the compounds of Formula (I),
pharmaceutically acceptable salts, solvates, N-oxides, prodrugs and
isomers thereof, pharmaceutical compositions, and/or combinations
provided herein are used in the treatment of genitourinary diseases
and/or disorders including, but not limited to, nephritis including
interstitial and glomerulonephritis; nephrotic syndrome; cystitis
including acute and chronic (interstitial) cystitis and Hunner's
ulcer; acute and chronic urethritis, prostatitis, epididymitis,
oophoritis and salpingitis; vulvo-vaginitis; Peyronie's disease;
erectile dysfunction (both male and female).
In certain embodiments, the compounds of Formula (I),
pharmaceutically acceptable salts, solvates, N-oxides, prodrugs and
isomers thereof, pharmaceutical compositions, and/or combinations
provided herein are used in the treatment of allograft rejection
including, but not limited to, acute and chronic following, for
example, transplantation of kidney, heart, liver, lung, bone
marrow, skin or cornea or following blood transfusion; or chronic
graft versus host disease.
In certain embodiments, the compounds of Formula (I),
pharmaceutically acceptable salts, solvates, N-oxides, prodrugs and
isomers thereof, pharmaceutical compositions, and/or combinations
provided herein are used in the treatment of other auto-immune and
allergic disorders including, but not limited to, rheumatoid
arthritis, irritable bowel syndrome, systemic lupus erythematosus,
multiple sclerosis, Hashimoto's thyroiditis, Crohns disease,
inflammatory bowel disease (IBD), Graves' disease, Addison's
disease, diabetes mellitus, idiopathic thrombocytopaenic purpura,
eosinophilic fasciitis, hyper-IgE syndrome, antiphospholipid
syndrome and Sazary syndrome.
In certain embodiments, the compounds of Formula (I),
pharmaceutically acceptable salts, solvates, N-oxides, prodrugs and
isomers thereof, and pharmaceutical compositions provided herein
are used in the treatment of cancer including, but not limited to,
prostate, breast, lung, ovarian, pancreatic, bowel and colon,
stomach, skin and brain tumors and malignancies affecting the bone
marrow (including the leukaemias) and lymphoproliferative systems,
such as Hodgkin's and non-Hodgkin's lymphoma; including the
prevention and treatment of metastatic disease and tumor
recurrences, and paraneoplastic syndromes. In certain embodiments,
the compounds of Formula (I), pharmaceutically acceptable salts,
solvates, N-oxides, prodrugs and isomers thereof, and
pharmaceutical compositions provided herein are useful as
modulators of toll-like receptor activity, and are used in the
treatment of neoplasias including, but not limited to, basal cell
carcinoma, squamous cell carcinoma, actinic keratosis, melanoma,
carcinomas, sarcomas, leukemias, renal cell carcinoma, Kaposi's
sarcoma, myelogeous leukemia, chronic lymphocytic leukemia and
multiple myeloma.
In certain embodiments, the compounds of Formula (I),
pharmaceutically acceptable salts, solvates, N-oxides, prodrugs and
isomers thereof, pharmaceutical compositions, and/or combinations
provided herein are used in the treatment of infectious diseases
including, but not limited to, viral diseases such as genital
warts, common warts, plantar warts, respiratory syncytial virus
(RSV), hepatitis B, hepatitis C, Dengue virus, herpes simplex virus
(by way of example only, HSV-I, HSV-II, CMV, or VZV), molluscum
contagiosum, vaccinia, variola, lentivirus, human immunodeficiency
virus (HIV), human papilloma virus (HPV), cytomegalovirus (CMV),
varicella zoster virus (VZV), rhinovirus, enterovirus, adenovirus,
coronavirus (e.g., SARS), influenza, para-influenza, mumps virus,
measles virus, papovavirus, hepadnavirus, flavivirus, retrovirus,
arenavirus (by way of example only, LCM, Junin virus, Machupo
virus, Guanarito virus and Lassa Fever) and filovirus (by way of
example only, ebola virus or marbug virus).
In certain embodiments, the compounds of Formula (I),
pharmaceutically acceptable salts, solvates, N-oxides, prodrugs and
isomers thereof, pharmaceutical compositions, and/or combinations
provided herein are used in the treatment of bacterial, fungal, and
protozoal infections including, but not limited to, tuberculosis
and mycobacterium avium, leprosy; pneumocystis carnii,
cryptosporidiosis, histoplasmosis, toxoplasmosis, trypanosome
infection, leishmaniasis, infections caused by bacteria of the
genus Escherichia, Enterobacter, Salmonella, Staphylococcus,
Klebsiella, Proteus, Pseudomonas, Streptococcus, and Chlamydia, and
fungal infections such as candidiasis, aspergillosis,
histoplasmosis, cryptococcal meningitis.
In certain embodiments, the compounds of Formula (I),
pharmaceutically acceptable salts, solvates, N-oxides, prodrugs and
isomers thereof, are used as immune potentiators. In certain
embodiments, the compounds provided herein are included in
immunogenic compositions or are used in combination with
immunogenic compositions. In certain embodiments, the immunogenic
compositions are useful as vaccines, and the compound is present in
an amount sufficient to enhance an immune response to the vaccine,
or to an antigen admixed with the compound. The vaccine comprises
at least one antigen, which may be a bacterial antigen or a
cancer-associated antigen, or a viral antigen. In certain
embodiments, the compounds of Formula (I), pharmaceutically
acceptable salts, solvates, N-oxides, prodrugs and isomers thereof,
and pharmaceutical compositions provided herein are included in
therapeutic vaccines or are used in combination with therapeutic
vaccines. In certain embodiments, the compounds of Formula (I),
pharmaceutically acceptable salts, solvates, N-oxides, prodrugs and
isomers thereof, and pharmaceutical compositions provided herein
are included in prophylactic vaccines or used in combination with
prophylactic vaccines. In certain embodiments, the compounds of
Formula (I), pharmaceutically acceptable salts, solvates, N-oxides,
prodrugs and isomers thereof, and pharmaceutical compositions
provided herein are included in, or are used in combination with,
therapeutic viral vaccines. In certain embodiments, the compounds
of Formula (I), pharmaceutically acceptable salts, solvates,
N-oxides, prodrugs and isomers thereof, and pharmaceutical
compositions provided herein are included in, or are used in
combination with, with cancer vaccines.
In other embodiments, the compounds of Formula (I), or a
pharmaceutically acceptable salt or solvate thereof, described
herein are useful for the treatment of damaged or ageing skin such
as scarring and wrinkles.
Administration and Pharmaceutical Compositions
For the therapeutic uses of compounds of Formula (I), or
pharmaceutically acceptable salts, solvates, N-oxides, prodrugs and
isomers thereof, described herein, such compounds are administered
in therapeutically effective amounts either alone or as part of a
pharmaceutical composition. Accordingly, provided herein are
pharmaceutical compositions, which comprise at least one compound
of Formula (I) provided herein, pharmaceutically acceptable salts
and/or solvates thereof, and one or more pharmaceutically
acceptable carriers, diluents, or excipients. In addition, such
compounds and compositions are administered singly or in
combination with one or more additional therapeutic agents. The
method of administration of such compounds and compositions
include, but are not limited to, oral administration, rectal
administration, parenteral, intravenous administration,
intravitreal administration, intramuscular administration,
inhalation, intranasal administration, topical administration,
ophthalmic administration or otic administration.
The therapeutically effective amount will vary depending on, among
others, the disease indicated, the severity of the disease, the age
and relative health of the subject, the potency of the compound
administered, the mode of administration and the treatment desired.
In certain embodiments, the daily dosage of a compound of Formula
(I), satisfactory results are indicated to be obtained systemically
at daily dosages of from about 0.03 to 2.5 mg/kg per body weight.
In certain embodiments, the daily dosage of a compound of Formula
(I), administered by inhalation, is in the range from 0.05
micrograms per kilogram body weight (.mu.g/kg) to 100 micrograms
per kilogram body weight (.mu.g/kg). In other embodiments, the
daily dosage of a compound of Formula (I), administered orally, is
in the range from 0.01 micrograms per kilogram body weight
(.mu.g/kg) to 100 milligrams per kilogram body weight (mg/kg). An
indicated daily dosage in the larger mammal, e.g. humans, is in the
range from about 0.5 mg to about 100 mg of a compound of Formula
(I), conveniently administered, e.g. in divided doses up to four
times a day or in controlled release form. In certain embodiment,
unit dosage forms for oral administration comprise from about 1 to
50 mg of a compound of Formula (I).
Other aspects provided herein are processes for the preparation of
pharmaceutical composition which comprise at least one compound of
Formula (I) provided herein, or pharmaceutically acceptable salts
and/or solvates thereof. In certain embodiments, such processes
include admixing a compound of the Formula (I) provided herein, and
pharmaceutically acceptable salts and solvates thereof, with one or
more pharmaceutically acceptable carriers, diluents or excipients.
In certain embodiments, the pharmaceutical compositions comprising
a compound of Formula (I) in free form or in a pharmaceutically
acceptable salt or solvate form, in association with at least one
pharmaceutically acceptable carrier, diluent or excipient are
manufactured by mixing, granulating and/or coating methods. In
other embodiments, such compositions are optionally contain
excipients, such as preserving, stabilizing, wetting or emulsifying
agents, solution promoters, salts for regulating the osmotic
pressure and/or buffers. In other embodiments, such compositions
are sterilized.
Oral Dosage Forms
In certain embodiments, the pharmaceutical compositions containing
at least one compound of Formula (I) are administered orally as
discrete dosage forms, wherein such dosage forms include, but are
not limited to, capsules, gelatin capsules, caplets, tablets,
chewable tablets, powders, granules, syrups, flavored syrups,
solutions or suspensions in aqueous or non-aqueous liquids, edible
foams or whips, and oil-in-water liquid emulsions or water-in-oil
liquid emulsions.
The capsules, gelatin capsules, caplets, tablets, chewable tablets,
powders or granules, used for the oral administration of at least
one compound of Formula (I) are prepared by admixing at least one
compound of Formula (I) (active ingredient) together with at least
one excipient using conventional pharmaceutical compounding
techniques. Non-limiting examples of excipients used in oral dosage
forms described herein include, but are not limited to, binders,
fillers, disintegrants, lubricants, absorbents, colorants, flavors,
preservatives and sweeteners.
Non-limiting examples of such binders include, but are not limited
to, corn starch, potato starch, starch paste, pre-gelatinized
starch, or other starches, sugars, gelatin, natural and synthetic
gums such as acacia, sodium alginate, alginic acid, other
alginates, tragacanth, guar gum, cellulose and its derivatives (by
way of example only, ethyl cellulose, cellulose acetate,
carboxymethyl cellulose calcium, sodium carboxymethylcellulose,
methyl cellulose, hydroxypropyl methylcellulose and
microcrystalline cellulose), magnesium aluminum silicate, polyvinyl
pyrrolidone and combinations thereof.
Non-limiting examples of such fillers include, but are not limited
to, talc, calcium carbonate (e.g., granules or powder),
microcrystalline cellulose, powdered cellulose, dextrates, kaolin,
mannitol, silicic acid, sorbitol, starch, pre-gelatinized starch,
and mixtures thereof. In certain embodiments, the binder or filler
in pharmaceutical compositions provided herein are present in from
about 50 to about 99 weight percent of the pharmaceutical
composition or dosage form.
Non-limiting examples of such disintegrants include, but are not
limited to, agar-agar, alginic acid, sodium alginate, calcium
carbonate, sodium carbonate, microcrystalline cellulose,
croscarmellose sodium, crospovidone, polacrilin potassium, sodium
starch glycolate, potato or tapioca starch, pre-gelatinized starch,
other starches, clays, other algins, other celluloses, gums, and
combinations thereof. In certain embodiments, the amount of
disintegrant used in the pharmaceutical compositions provided
herein is from about 0.5 to about 15 weight percent of
disintegrant, while in other embodiments the amount is from about 1
to about 5 weight percent of disintegrant.
Non-limiting examples of such lubricants include, but are not
limited to, sodium stearate, calcium stearate, magnesium stearate,
stearic acid, mineral oil, light mineral oil, glycerin, sorbitol,
mannitol, polyethylene glycol, other glycols, sodium lauryl
sulfate, talc, hydrogenated vegetable oil (by way of example only,
peanut oil, cottonseed oil, sunflower oil, sesame oil, olive oil,
corn oil, and soybean oil), zinc stearate, sodium oleate, ethyl
oleate, ethyl laureate, agar, silica, a syloid silica gel (AEROSIL
200, manufactured by W.R. Grace Co. of Baltimore, Md.), a
coagulated aerosol of synthetic silica (marketed by Degussa Co. of
Plano, Tex.), CAB-O-SIL (a pyrogenic silicon dioxide product sold
by Cabot Co. of Boston, Mass.) and combinations thereof. In certain
embodiments, the amount of lubricants used in the pharmaceutical
compositions provided herein is in an amount of less than about 1
weight percent of the pharmaceutical compositions or dosage
forms.
Non-limiting examples of such diluents include, but are not limited
to, lactose, dextrose, sucrose, mannitol, sorbitol, cellulose,
glycine or combinations thereof.
In certain embodiments, tablets and capsules are prepared by
uniformly admixing at least one compound of Formula (I) (active
ingredients) with liquid carriers, finely divided solid carriers,
or both, and then shaping the product into the desired presentation
if necessary. In certain embodiments, tablets are prepared by
compression. In other embodiments, tablets are prepared by
molding.
In certain embodiments, at least one compound of Formula (I) is
orally administered as a controlled release dosage form. Such
dosage forms are used to provide slow or controlled-release of one
or more compounds of Formula (I). Controlled release is obtained
using, for example, hydroxypropylmethyl cellulose, other polymer
matrices, gels, permeable membranes, osmotic systems, multilayer
coatings, microparticles, liposomes, microspheres, or a combination
thereof. In certain embodiments, controlled-release dosage forms
are used to extend activity of the compound of Formula (I), reduce
dosage frequency, and increase patient compliance.
Administration of compounds of Formula (I) as oral fluids such as
solution, syrups and elixirs are prepared in unit dosage forms such
that a given quantity of solution, syrups or elixirs contains a
predetermined amount of a compound of Formula (I). Syrups are
prepared by dissolving the compound in a suitably flavored aqueous
solution, while elixirs are prepared through the use of a non-toxic
alcoholic vehicle. Suspensions are formulated by dispersing the
compound in a non-toxic vehicle. Non-limiting examples of
excipients used in as oral fluids for oral administration include,
but are not limited to, solubilizers, emulsifiers, flavoring
agents, preservatives, and coloring agents. Non-limiting examples
of solubilizers and emulsifiers include, but are not limited to,
water, glycols, oils, alcohols, ethoxylated isostearyl alcohols and
polyoxy ethylene sorbitol ethers. Non-limiting examples of
preservatives include, but are not limited to, sodium benzoate.
Non-limiting examples of flavoring agents include, but are not
limited to, peppermint oil or natural sweeteners or saccharin or
other artificial sweeteners.
Parenteral Dosage Forms
In certain embodiments pharmaceutical compositions containing at
least one compound of Formula (I) are administered parenterally by
various routes including, but not limited to, subcutaneous,
intravenous (including bolus injection), intramuscular, and
intraarterial.
Such parenteral dosage forms are administered in the form of
sterile or sterilizable injectable solutions, suspensions, dry
and/or lyophylized products ready to be dissolved or suspended in a
pharmaceutically acceptable vehicle for injection (reconstitutable
powders) and emulsions. Vehicles used in such dosage forms include,
but are not limited to, Water for Injection USP; aqueous vehicles
such as, but not limited to, Sodium Chloride Injection, Ringer's
Injection, Dextrose Injection, Dextrose and Sodium Chloride
Injection, and Lactated Ringer's Injection; water-miscible vehicles
such as, but not limited to, ethyl alcohol, polyethylene glycol,
and polypropylene glycol; and non-aqueous vehicles such as, but not
limited to, corn oil, cottonseed oil, peanut oil, sesame oil, ethyl
oleate, isopropyl myristate, and benzyl benzoate.
Transdermal Dosage Forms
In certain embodiments pharmaceutical compositions containing at
least one compound of Formula (I) are administered transdemally.
Such transdermal dosage forms include "reservoir type" or "matrix
type" patches, which are applied to the skin and worn for a
specific period of time to permit the penetration of a desired
amount of a compound of Formula (I). By way of example only, such
transdermal devices are in the form of a bandage comprising a
backing member, a reservoir containing the compound optionally with
carriers, optionally a rate controlling barrier to deliver the
compound to the skin of the host at a controlled and predetermined
rate over a prolonged period of time, and means to secure the
device to the skin. In other embodiments, matrix transdermal
formulations are used.
Formulations for transdermal delivery of a compound of Formula (I)
include an effective amount of a compound of Formula (I), a carrier
and an optional diluent. A carrier includes, but is not limited to,
absorbable pharmacologically acceptable solvents to assist passage
through the skin of the host, such as water, acetone, ethanol,
ethylene glycol, propylene glycol, butane-1,3-diol, isopropyl
myristate, isopropyl palmitate, mineral oil, and combinations
thereof.
In certain embodiments, such transdermal delivery systems include
penetration enhancers to assist in delivering one or more compounds
of Formula (I) to the tissue. Such penetration enhancers include,
but are not limited to, acetone; various alcohols such as ethanol,
oleyl, and tetrahydrofuryl; alkyl sulfoxides such as dimethyl
sulfoxide; dimethyl acetamide; dimethyl formamide; polyethylene
glycol; pyrrolidones such as polyvinylpyrrolidone; Kollidon grades
(Povidone, Polyvidone); urea; and various water-soluble or
insoluble sugar esters such as Tween 80 (polysorbate 80) and Span
60 (sorbitan monostearate).
In other embodiments, the pH of such a transdermal pharmaceutical
composition or dosage form, or of the tissue to which the
pharmaceutical composition or dosage form is applied, is adjusted
to improve delivery of one or more compounds of Formula (I). In
other embodiments, the polarity of a solvent carrier, its ionic
strength, or tonicity are adjusted to improve delivery. In other
embodiments, compounds such as stearates are added to
advantageously alter the hydrophilicity or lipophilicity of one or
more compounds of Formula (I) so as to improve delivery. In certain
embodiments, such stearates serve as a lipid vehicle for the
formulation, as an emulsifying agent or surfactant, and as a
delivery-enhancing or penetration-enhancing agent. In other
embodiments, different salts, hydrates or solvates of the compounds
of Formula (I) are used to further adjust the properties of the
resulting composition.
Topical Dosage Forms
In certain embodiments at least one compound of Formula (I) is
administered by topical application of pharmaceutical composition
containing at least one compound of Formula (I) in the form of
lotions, gels, ointments solutions, emulsions, suspensions or
creams. Suitable formulations for topical application to the skin
are aqueous solutions, ointments, creams or gels, while
formulations for ophthalmic administration are aqueous solutions.
Such formulations optionally contain solubilizers, stabilizers,
tonicity enhancing agents, buffers and preservatives.
Such topical formulations include at least one carrier, and
optionally at least one diluent. Such carriers and diluents
include, but are not limited to, water, acetone, ethanol, ethylene
glycol, propylene glycol, butane-1,3-diol, isopropyl myristate,
isopropyl palmitate, mineral oil, and combinations thereof.
In certain embodiments, such topical formulations include
penetration enhancers to assist in delivering one or more compounds
of Formula (I) to the tissue. Such penetration enhancers include,
but are not limited to, acetone; various alcohols such as ethanol,
oleyl, and tetrahydrofuryl; alkyl sulfoxides such as dimethyl
sulfoxide; dimethyl acetamide; dimethyl formamide; polyethylene
glycol; pyrrolidones such as polyvinylpyrrolidone; Kollidon grades
(Povidone, Polyvidone); urea; and various water-soluble or
insoluble sugar esters such as Tween 80 (polysorbate 80) and Span
60 (sorbitan monostearate).
In certain embodiments pharmaceutical compositions containing at
least one compound of Formula (I) are administered by inhalation.
Dosage forms for inhaled administration are formulated as aerosols
or dry powders. Aerosol formulations for inhalation administration
comprise a solution or fine suspension of at least one compound of
Formula (I) in a pharmaceutically acceptable aqueous or non-aqueous
solvent. In addition, such pharmaceutical compositions optionally
comprise a powder base such as lactose, glucose, trehalose,
mannitol or starch, and optionally a performance modifier such as
L-leucine or another amino acid, and/or metals salts of stearic
acid such as magnesium or calcium stearate.
In certain embodiments, compounds of Formula (I) are be
administered directly to the lung by inhalation using a Metered
Dose Inhaler ("MDI"), which utilizes canisters that contain a
suitable low boiling propellant, e.g., dichlorodifluoromethane,
trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide
or other suitable gas, or a Dry Powder Inhaler (DPI) device which
uses a burst of gas to create a cloud of dry powder inside a
container, which is then be inhaled by the patient. In certain
embodiments, capsules and cartridges of gelatin for use in an
inhaler or insufflator are formulated containing a powder mixture
of a compound of Formula (I) and a powder base such as lactose or
starch. In certain embodiments, compounds of Formula (I) are
delivered to the lung using a liquid spray device, wherein such
devices use extremely small nozzle holes to aerosolize liquid drug
formulations that can then be directly inhaled into the lung. In
other embodiments, compounds of Formula (I) are delivered to the
lung using a nebulizer device, wherein a nebulizers creates an
aerosols of liquid drug formulations by using ultrasonic energy to
form fine particles that can be readily inhaled. In other
embodiments, compounds of Formula (I) are delivered to the lung
using an electrohydrodynamic ("EHD") aerosol device wherein such
EHD aerosol devices use electrical energy to aerosolize liquid drug
solutions or suspensions.
In certain embodiments, the pharmaceutical composition containing
at least one compound of Formula (I), or pharmaceutically
acceptable salts and solvates thereof, described herein, also
contain one or more absorption enhancers. In certain embodiments,
such absorption enhancers include, but are not limited to, sodium
glycocholate, sodium caprate, N-lauryl-.beta.-D-maltopyranoside,
EDTA, and mixed micelles.
In certain embodiments pharmaceutical compositions containing at
least one compound of Formula (I) are administered nasally. The
dosage forms for nasal administration are formulated as aerosols,
solutions, drops, gels or dry powders.
In certain embodiments pharmaceutical compositions containing at
least one compound of Formula (I) are administered rectally in the
form of suppositories, enemas, ointment, creams rectal foams or
rectal gels. In certain embodiments such suppositories are prepared
from fatty emulsions or suspensions, cocoa butter or other
glycerides.
In certain embodiments pharmaceutical compositions containing at
least one compound of Formula (I) are administered opthamically as
eye drops. Such formulations are aqueous solutions that optionally
contain solubilizers, stabilizers, tonicity enhancing agents,
buffers and preservatives.
In certain embodiments pharmaceutical compositions containing at
least one compound of Formula (I) are administered otically as ear
drops. Such formulations are aqueous solutions that optionally
contain solubilizers, stabilizers, tonicity enhancing agents,
buffers and preservatives.
In certain embodiments pharmaceutical compositions containing at
least one compound of Formula (I) are formulated as a depot
preparation. Such formulations are administered by implantation
(for example subcutaneously or intramuscularly) or by intramuscular
injection. In certain embodiments, such formulations include
polymeric or hydrophobic materials (for example, as an emulsion in
an acceptable oil) or ion exchange resins, or as sparingly soluble
derivatives, for example, as a sparingly soluble salt.
In a further embodiment, the pharmaceutical compositions comprising
at least one compound of Formula (I) are adapted for oral
administration for the treatment of viral diseases and/or disorders
associated with TLR7 activity.
In a further embodiment, the pharmaceutical compositions comprising
at least one compound of Formula (I) are adapted for oral
administration for the treatment of infectious diseases and/or
disorders associated with TLR7.
In a further embodiment, the pharmaceutical compositions comprising
at least one compound of Formula (I) are adapted for oral
administration for the treatment of bacterial diseases and/or
disorders associated with TLR7.
In a further embodiment, the pharmaceutical compositions comprising
at least one compound of Formula (I) are adapted for oral
administration for the treatment of fungal diseases and/or
disorders associated with TLR7.
In a further embodiment, the pharmaceutical compositions comprising
at least one compound of Formula (I) are adapted for oral
administration for the treatment of cancer associated with
TLR7.
In a further embodiment, the pharmaceutical compositions comprising
at least one compound of Formula (I) are adapted for intravenous
administration for the treatment of cancer associated with
TLR7.
In a further embodiment, the pharmaceutical compositions comprising
at least one compound of Formula (I) are adapted for oral
administration for the treatment of allograft rejection diseases
and/or disorders associated with TLR7.
In a further embodiment, the pharmaceutical compositions comprising
at least one compound of Formula (I) are adapted for oral
administration for the treatment of genitourinary diseases and/or
disorders associated with TLR7.
In a further embodiment, the pharmaceutical compositions comprising
at least one compound of Formula (I) are adapted for administration
as eye drops for the treatment of ophthalmic diseases and/or
disorders associated with TLR7.
In a further embodiment, the pharmaceutical compositions comprising
at least one compound of Formula (I) are adapted for topical
administration for the treatment of dermatological diseases and/or
disorders associated with TLR7.
In a further embodiment, the pharmaceutical compositions comprising
at least one compound of Formula (I) are adapted for topical
administration for the treatment of actinic keratosis. In a further
embodiment, the pharmaceutical compositions comprising at least one
compound of Formula (I) are adapted for topical administration as a
cream for the treatment of actinic keratosis.
In a further embodiment, the pharmaceutical compositions comprising
at least one compound of Formula (I) are adapted for topical
administration for the treatment of basal cell carcinoma. In a
further embodiment, the pharmaceutical compositions comprising at
least one compound of Formula (I) are adapted for topical
administration as a cream for the treatment of basal cell
carcinoma.
In a further embodiment, the pharmaceutical compositions comprising
at least one compound of Formula (I) are adapted for administration
by inhalation for the treatment of respiratory diseases and/or
disorders associated with TLR7. In certain embodiments, the
respiratory disease is allergic asthma.
Provided herein are compounds of Formula (I), pharmaceutically
acceptable salts and solvates thereof, and pharmaceutical
compositions containing at least one compound of Formula (I) and/or
pharmaceutically acceptable salts and solvates thereof, for use in
activating TLR7 activity, and thereby are used to in the prevention
or treatment of diseases and/or disorders associated with TLR7
activity. Such compounds of Formula (I), pharmaceutically
acceptable salts and solvates thereof, and pharmaceutical
compositions are agonists of TLR7.
Also provided herein are methods for the treatment of a subject
suffering from a disease and/or disorder associated with TLR7
activity, wherein the methods include administering to the subject
an effective amount of a compound of Formula (I) or a
pharmaceutically acceptable salt, solvate, either alone or as part
of a pharmaceutical composition as described herein.
Provided herein is the use of a compound of Formula (I), or a
pharmaceutically acceptable salt or solvate thereof, in the
preparation of a medicament for the treatment of a disease or
disorder associated with TLR7 activity.
Combination Treatment
In certain embodiments, a compound of Formula (I) provided herein,
or a pharmaceutically acceptable salt or solvate thereof, or a
pharmaceutical composition containing at least one compound of
Formula (I) provided herein, is administered alone (without an
additional therapeutic agent) for the treatment of one or more of
the disease and/or disorders associated with TLR activity described
herein.
In other embodiments, a compound of Formula (I) provided herein, or
a pharmaceutically acceptable salt or solvate thereof, or a
pharmaceutical composition containing at least one compound of
Formula (I) provided herein, is administered in combination with
one or more additional therapeutic agents, for the treatment of one
or more of the disease and/or disorders associated with TLR7
activity described herein.
In other embodiments, a compound of Formula (I) provided herein, or
a pharmaceutically acceptable salt or solvate thereof, or a
pharmaceutical composition containing at least one compound of
Formula (I) provided herein, is formulated in combination with one
or more additional therapeutic agents and administered for the
treatment of one or more of the disease and/or disorders associated
with TLR7 activity described herein.
In a compound of Formula (I) provided herein, or a pharmaceutically
acceptable salt or solvate thereof, or a pharmaceutical composition
containing at least one compound of Formula (I) provided herein, is
administered sequentially with one or more additional therapeutic
agents, for the treatment of one or more of the disease and/or
disorders associated with TLR7 activity described herein.
In other embodiments, the combination treatments provided herein
include administration of a compound of Formula (I) provided
herein, or a pharmaceutically acceptable salt or solvate thereof,
or a pharmaceutical composition containing a compound of Formula
(I), prior to administration of one or more additional therapeutic
agents, for the treatment of one or more of the disease and/or
disorders associated with TLR7 activity described herein.
In other embodiments, the combination treatments provided herein
include administration of a compound of Formula (I) provided
herein, or a pharmaceutically acceptable salt or solvate thereof,
or a pharmaceutical composition containing a compound of Formula
(I), subsequent to administration of one or more additional
therapeutic agents, for the treatment of one or more of the disease
and/or disorders associated with TLR7 activity described
herein.
In certain embodiments, the combination treatments provided herein
include administration of a compound of Formula (I) provided
herein, or a pharmaceutically acceptable salt or solvate thereof,
or a pharmaceutical composition containing a compound of Formula
(I), concurrently with one or more additional therapeutic agents,
for the treatment of one or more of the disease and/or disorders
associated with TLR7 activity described herein.
In certain embodiments, the combination treatments provided herein
include administration of a compound of Formula (I) provided
herein, or a pharmaceutically acceptable salt or solvate thereof,
or a pharmaceutical composition containing a compound of Formula
(I) formulated with one or more additional therapeutic agents, for
the treatment of one or more of the disease and/or disorders
associated with TLR7 activity described herein.
In certain embodiments of the combination treatments described
herein the compounds of Formula (I), or a pharmaceutically
acceptable salts or solvates thereof, are agonists of TLR7
activity.
In certain embodiments of the combination therapies described
herein, the compounds of Formula (I) provided herein, or a
pharmaceutically acceptable salts or solvates thereof, and the
additional therapeutics agent(s) act additively. In certain
embodiments of the combination therapies described herein, the
compounds of Formula (I) provided herein, or a pharmaceutically
acceptable salts or solvates thereof, and the additional
therapeutics agent(s) act synergistically.
In other embodiments, a compound of Formula (I) provided herein, or
a pharmaceutically acceptable salts or solvates thereof, or a
pharmaceutical composition containing a compound of Formula (I), is
administered to a patient who has not previously undergone or is
not currently undergoing treatment with another therapeutic
agent.
The additional therapeutic agents used in combination with at least
one compound of Formula (I) provided herein, or a pharmaceutically
acceptable salt or solvate thereof, include, but are not limited to
antibiotics or antibacterial agents, antiemetic agents, antifungal
agents, anti-inflammatory agents, antiviral agents,
immunomodulatory agents, cytokines, antidepressants, hormones,
alkylating agents, antimetabolites, antitumour antibiotics,
antimitotic agents, topoisomerase inhibitors, cytostatic agents,
anti-invasion agents, antiangiogenic agents, inhibitors of growth
factor function inhibitors of viral replication, viral enzyme
inhibitors, anticancer agents, .alpha.-interferons,
.beta.-interferons, ribavirin, hormones, cytokines, and other
toll-like receptor modulators.
The antibiotics or antibacterial agents used in combination with at
least one compound of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, include, but
are not limited to, valganciclovir hydrochloride, metronidazole, a
beta-lactam, macrolides (such as, by way of example only,
azithromycin, tobramycin (TOBI.TM.)), cephalosporins (such as, by
way of example only, cefaclor, cefadroxil, cephalexin, cephradine,
cefamandole, cefatrizine, cefazedone, cefixime, cefozopran,
cefpimizole, cefuroxime, cefpiramide, cefprozil, cefpirome,
KEFLEX.TM., VELOSEF.TM., CEFTIN.TM., CEFZIL.TM., CECLOR.TM.,
SUPRAX.TM. and DURICEF.TM.), a clarithromycin (such as, by way of
example only, clarithromycin and BIAXIN.TM.), an erythromycin (such
as, by way of example only, erythromycin and EMYCIN.TM.),
ciprofloxacin, CIPRO.TM., a norfloxacin (such as, by way of example
only, NOROXIN.TM.), aminoglycoside antibiotics (such as, by way of
example only, apramycin, arbekacin, bambermycins, butirosin,
dibekacin, neomycin, neomycin, undecylenate, netilmicin,
paromomycin, ribostamycin, sisomicin, and spectinomycin),
amphenicol antibiotics (such as, by way of example only,
azidamfenicol, chloramphenicol, florfenicol, and thiamphenicol),
ansamycin antibiotics (such as, by way of example only, rifamide
and rifampin), carbacephems (such as, by way of example only,
loracarbef), carbapenems (such as, by way of example only, biapenem
and imipenem), cephamycins (such as, by way of example only,
cefbuperazone, cefinetazole, and cefminox), monobactams (such as,
by way of example only, aztreonam, carumonam, and tigemonam),
oxacephems (such as, by way of example only, flomoxef, and
moxalactam), penicillins (such as, by way of example only,
amdinocillin, amdinocillin pivoxil, amoxicillin, bacampicillin,
benzylpenicillinic acid, benzylpenicillin sodium, epicillin,
fenbenicillin, floxacillin, penamccillin, penethamate hydriodide,
penicillin o-benethamine, penicillin 0, penicillin V, penicillin V
benzathine, penicillin V hydrabamine, penimepicycline,
phencihicillin potassium, V-CILLIN K.TM. and PEN VEE K.TM.),
lincosamides (such as, by way of example only, clindamycin, and
lincomycin), amphomycin, bacitracin, capreomycin, colistin,
enduracidin, enviomycin, tetracyclines (such as, by way of example
only, apicycline, chlortetracycline, clomocycline, and
demeclocycline), 2,4-diaminopyrimidines (such as, by way of example
only, brodimoprim), nitrofurans (such as, by way of example only,
furaltadone, and furazolium chloride), quinolones and analogs
thereof (such as, by way of example only, a fluoroquinolone,
ofloxacin, cinoxacin, clinafloxacin, flumequine, grepagloxacin and
FLOXIN.TM.), sulfonamides (such as, by way of example only, acetyl
sulfamethoxypyrazine, benzylsulfamide, noprylsulfamide,
phthalylsulfacetamide, sulfachrysoidine, and sulfacytine), sulfones
(such as, by way of example only, diathymosulfone, glucosulfone
sodium, and solasulfone), cycloserine, mupirocin, tuberin and
combinations thereof.
The antiemetic agents used in combination with at least one
compound of Formula (I) provided herein, or a pharmaceutically
acceptable salt or solvate thereof, include, but are not limited
to, metoclopromide, domperidone, prochlorperazine, promethazine,
chlorpromazine, trimethobenzamide, ondansetron, granisetron,
hydroxyzine, acethylleucine monoethanolamine, alizapride,
azasetron, benzquinamide, bietanautine, bromopride, buclizine,
clebopride, cyclizine, dimenhydrinate, diphenidol, dolasetron,
meclizine, methallatal, metopimazine, nabilone, oxyperndyl,
pipamazine, scopolamine, sulpiride, tetrahydrocannabinols,
thiethylperazine, thioproperazine, tropisetron, and combinations
thereof.
The antifungal agents used in combination with at least one
compound of Formula (I) provided herein, or a pharmaceutically
acceptable salt or solvate thereof, include, but are not limited
to, amphotericin B, itraconazole, ketoconazole, fluconazole,
fosfluconazole, intrathecal, flucytosine, miconazole, butoconazole,
itraconazole, clotrimazole, nystatin, terconazole, tioconazole,
voriconazole, ciclopirox, econazole, haloprogrin, naftifine,
terbinafine, undecylenate, and griseofulvin.
The anti-inflammatory agents used in combination with at least one
compound of Formula (I) provided herein, or a pharmaceutically
acceptable salt or solvate thereof, include, but are not limited
to, non-steroidal anti-inflammatory drugs such as salicylic acid,
acetylsalicylic acid, methyl salicylate, diflunisal, salsalate,
olsalazine, sulfasalazine, acetaminophen, indomethacin, sulindac,
etodolac, mefenamic acid, meclofenamate sodium, tolmetin,
ketorolac, dichlofenac, ibuprofen, naproxen, naproxen sodium,
fenoprofen, ketoprofen, flurbinprofen, oxaprozin, piroxicam,
meloxicam, ampiroxicam, droxicam, pivoxicam, tenoxicam, nabumetome,
phenylbutazone, oxyphenbutazone, antipyrine, aminopyrine, apazone
and nimesulide, leukotriene antagonists including, but not limited
to, zileuton, aurothioglucose, gold sodium thiomalate and
auranofin, steroids including, but not limited to, alclometasone
diproprionate, amcinonide, beclomethasone dipropionate,
betametasone, betamethasone benzoate, betamethasone diproprionate,
betamethasone sodium phosphate, betamethasone valerate, clobetasol
proprionate, clocortolone pivalate, hydrocortisone, hydrocortisone
derivatives, desonide, desoximatasone, dexamethasone, flunisolide,
flucoxinolide, flurandrenolide, halcinocide, medrysone,
methylprednisolone, methprednisolone acetate, methylprednisolone
sodium succinate, mometasone furoate, paramethasone acetate,
prednisolone, prednisolone acetate, prednisolone sodium phosphate,
prednisolone tebuatate, prednisone, triamcinolone, triamcinolone
acetonide, triamcinolone diacetate, and triamcinolone hexacetonide
and other anti-inflammatory agents including, but not limited to,
methotrexate, colchicine, allopurinol, probenecid, thalidomide or a
derivative thereof, 5-aminosalicylic acid, retinoid, dithranol or
calcipotriol, sulfinpyrazone and benzbromarone.
The antiviral agents used in combination with at least one compound
of Formula (I) provided herein, or a pharmaceutically acceptable
salt or solvate thereof, include, but are not limited to, protease
inhibitors, nucleoside/nucleotide reverse transcriptase inhibitors
(NRTIs), non-nucleoside reverse transcriptase inhibitors (NNRTIs),
CCR1 antagonist, CCR5 antagonists, and nucleoside analogs. The
antiviral agents include but are not limited to fomivirsen,
didanosine, lamivudine, stavudine, zalcitabine, zidovudine,
acyclovir, famciclovir, valaciclovir, ganciclovir, gangcyclovir,
cidofovir, zanamivir, oseltamavir, vidarabine, idoxuridine,
trifluridine, levovirin, viramidine and ribavirin, as well as
foscarnet, amantadine, rimantadine, saquinavir, indinavir,
nelfinavir, amprenavir, lopinavir, ritonavir, the
.alpha.-interferons; .beta.-interferons; adefovir, clevadine,
entecavir, pleconaril, HCV-086, EMZ702, emtricitabine, celgosivir,
valopicitabine, inhibitors of HCV protease, such as BILN 2061,
SCH-503034, ITMN-191 or VX-950, inhibitors of NS5B polymerase such
as NM107 (and its prodrug NM283), R1626, R7078, BILN1941,
GSK625433, GILD9128 or HCV-796, efavirenz, HBY-097, nevirapine,
TMC-120 (dapivirine), TMC-125, BX-471, etravirine, delavirdine,
DPC-083, DPC-961, capravirine, rilpivirine,
5-{[3,5-diethyl-1-(2-hydroxyethyl)-1H-pyrazol-4-yl]oxy}isophthalonitrile,
GW-678248, GW-695634, MW-150, calanolide, TAK-779, SC-351125,
ancriviroc, vicriviroc, maraviroc, PRO-140, aplaviroc 40, Ono-4128,
AK-602), AMD-887 CMPD-167, methyl
1-endo-{8-[(3S)-3-(acetylamino)-3-(3-fluorophenyl)propyl]-8-azabicyclo[3.-
-2.1]oct-3-yl}-2-methyl-4,5,6,7-tetrahydro-1H-imidazo[4,5-c]pyridine-5-car-
boxylate, methyl
3-endo-{8-[(3S)-3-(acetamido)-3-(3-fluorophenyl)propyl]-8-azabicyclo[3.2.-
-1]oct-3-yl}-2-methyl-4,5,6,7-tetrahydro-3H-imidazo[4,5-c]pyridine-5-carbo-
xylate, ethyl
1-endo-{8-[(3S)-3-(acetylamino)-3-(3-fluorophenyl)propyl]-8-azabicyclo[3.-
-2.1]oct-3-yl}-2-methyl-4,5,6,7-tetrahydro-1H-imidazo[4,5-c]pyridine-5-car-
boxylate, and
N-{(1S)-3-[3-endo-(5-Isobutyryl-2-methyl-4,5,6,7-tetrahydro-1H-imidazo[4,-
-5-c]pyridin-1-yl)-8-azabicyclo[3.2.1]oct-8-yl]-1-(3-fluorophenyl)propyl}a-
cetamide), BMS-806, BMS-488043,
5-{(1S)-2-[(2R)-4-benzoyl-2-methyl-piperazin-1-yl]-1-methyl-2-oxo-ethoxy}-
-4-methoxy-pyridine-2-carboxylic acid methylamide and
4-{(1S)-2-[(2R)-4-benzoyl-2-methyl-piperazin-1-yl]-1-methyl-2-oxo-ethoxy}-
-3-methoxy-N-methyl-benzamide, enfuvirtide (T-20), sifuvirtide
SP-01A, T1249, PRO 542, AMD-3100, soluble CD4, HMG CoA reductase
inhibitors, atorvastatin, 3-O-(3'3'-dimethylsuccinyl) betulic acid
(otherwise known as PA-457) and .alpha.HGA.
The immunomodulatory agents used in combination with at least one
compound of Formula (I) provided herein, or a pharmaceutically
acceptable salt or solvate thereof, include, but are not limited
to, azathioprine, tacrolimus, cyclosporin methothrexate,
leflunomide, corticosteroids, cyclophosphamide, cyclosporine A,
cyclosporin G, mycophenolate mofetil, ascomycin, rapamycin
(sirolimus), FK-506, mizoribine, deoxyspergualin, brequinar,
mycophenolic acid, malononitriloamindes (such as, by way of example
only, leflunamide), T cell receptor modulators, and cytokine
receptor modulators, peptide mimetics, and antibodies (such as, by
way of example only, human, humanized, chimeric, monoclonal,
polyclonal, Fvs, ScFvs, Fab or F(ab).sub.2 fragments or epitope
binding fragments), nucleic acid molecules (such as, by way of
example only, antisense nucleic acid molecules and triple helices),
small molecules, organic compounds, and inorganic compounds.
Examples of T cell receptor modulators include, but are not limited
to, anti-T cell receptor antibodies (such as, by way of example
only, anti-CD4 antibodies (such as, by way of example only, cM-T412
(Boehringer), IDEC-CE9.1.TM. (IDEC and SKB), mAB 4162W94,
Orthoclone and OKTcdr4a (Janssen-Cilag)), anti-CD3 antibodies (such
as, by way of example only, Nuvion (Product Design Labs), OKT3
(Johnson & Johnson), or Rituxan (IDEC)), anti-CD5 antibodies
(such as, by way of example only, an anti-CD5 ricin-linked
immunoconjugate), anti-CD7 antibodies (such as, by way of example
only, CHH-380 (Novartis)), anti-CD8 antibodies, anti-CD40 ligand
monoclonal antibodies (such as, by way of example only, IDEC-131
(IDEC)), anti-CD52 antibodies (such as, by way of example only,
CAMPATH 1H (Ilex)), anti-CD2 antibodies, anti-CD11a antibodies
(such as, by way of example only, Xanelim (Genentech)), anti-B7
antibodies (such as, by way of example only, IDEC-114 (IDEC)),
CTLA4-immunoglobulin, and other toll receptor-like (TLR)
modulators. Examples of cytokine receptor modulators include, but
are not limited to, soluble cytokine receptors (such as, by way of
example only, the extracellular domain of a TNF-.alpha. receptor or
a fragment thereof, the extracellular domain of an IL-1.beta.
receptor or a fragment thereof, and the extracellular domain of an
IL-6 receptor or a fragment thereof), cytokines or fragments
thereof (such as, by way of example only, interleukin (IL)-2, IL-3,
IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-15,
TNF-.alpha., interferon (IFN)-.alpha., IFN-.beta., IFN-.gamma., and
GM-CSF), anti-cytokine receptor antibodies (such as, by way of
example only, anti-IFN receptor antibodies, anti-IL-2 receptor
antibodies (such as, by way of example only, Zenapax (Protein
Design Labs)), anti-IL-4 receptor antibodies, anti-IL-6 receptor
antibodies, anti-IL-10 receptor antibodies, and anti-IL-12 receptor
antibodies), anti-cytokine antibodies (such as, by way of example
only, anti-IFN antibodies, anti-TNF-.alpha. antibodies,
anti-IL-1.beta. antibodies, anti-IL-6 antibodies, anti-IL-8
antibodies (such as, by way of example only, ABX-IL-8 (Abgenix)),
and anti-IL-12 antibodies).
The cytokines or modulator of cytokine function used in combination
with at least one compound of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, include, but
are not limited to, interleukin-2 (IL-2), interleukin-3 (IL-3),
interleukin-4 (IL-4), interleukin-5 (IL-5), interleukin-6 (IL-6),
interleukin-7 (IL-7), interleukin-9 (IL-9), interleukin-10 (IL-10),
interleukin-12 (IL-12), interleukin 15 (IL-15), interleukin 18
(IL-18), platelet derived growth factor (PDGF), erythropoietin
(Epo), epidermal growth factor (EGF), fibroblast growth factor
(FGF), granulocyte macrophage stimulating factor (GM-CSF),
granulocyte colony stimulating factor (G-CSF), macrophage colony
stimulating factor (M-CSF), prolactin, alpha-, beta-, and
gamma-interferon, interferon .beta.-1a, interferon .beta.-1b,
interferon .alpha.-1, interferon .alpha.-2a (roferon), interferon
.alpha.-2b, pegylated interferons (by way of example only,
peginterferon .alpha.-2a and peginterferon .alpha.-2b), intron,
Peg-Intron, Pegasys, consensus interferon (infergen),
albumin-interferon cc and albuferon.
The antidepressants used in combination with at least one compound
of Formula (I) provided herein, or a pharmaceutically acceptable
salt or solvate thereof, include, but are not limited to,
binedaline, caroxazone, citalopram, dimethazan, fencamine,
indalpine, indeloxazine hydrocholoride, nefopam, nomifensine,
oxitriptan, oxypertine, paroxetine, sertraline, thiazesim,
trazodone, benmoxine, echinopsidine iodide, etryptamine,
iproclozide, iproniazid, isocarboxazid, mebanazine, metfendrazine,
nialamide, pargyline, octamoxin, phenelzine, pheniprazine,
phenoxypropazine, pivhydrazine, safrazine, selegiline, 1-deprenyl,
cotinine, rolicyprine, rolipram, maprotiline, metralindole,
mianserin, mirtazepine, adinazolam, amitriptyline,
amitriptylinoxide, amoxapine, butriptyline, clomipramine,
demexiptiline, desipramine, dibenzepin, dimetacrine, dothiepin,
doxepin, fluacizine, imipramine, imipramine N-oxide, iprindole,
lofepramine, melitracen, metapramine, nortriptyline, noxiptilin,
opipramol, pizotyline, propizepine, protriptyline, quinupramine,
tianeptine, trimipramine, adrafinil, benactyzine, bupropion,
butacetin, dioxadrol, duloxetine, etoperidone, febarbamate,
femoxetine, fenpentadiol, fluoxetine, fluvoxamine, hematoporphyrin,
hypericin, levophacetoperane, medifoxamine, milnacipran, minaprine,
moclobemide, nefazodone, oxaflozane, piberaline, prolintane,
pyrisuccideanol, ritanserin, roxindole, rubidium chloride,
sulpiride, tandospirone, thozalinone, tofenacin, toloxatone,
tranylcypromine, L-tryptophan, venlafaxine, viloxazine, and
zimeldine.
In certain embodiments, the antidepressants used in combination
with at least one compound of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, are
MAO-inhibitors including, but are not limited to, benmoxin,
echinopsidine iodide, etryptamine, iproclozide, iproniazid,
isocarboxazid, mebanazine, metfendrazine, moclobamide, nialamide,
pargyline, phenelzine, pheniprazine, phenoxypropazine,
pivhydrazine, safrazine, selegiline, 1-deprenyl, toloxatone and
tranylcypromine.
The hormones used in combination with at least one compound of
Formula (I) provided herein, or a pharmaceutically acceptable salt
or solvate thereof, include, but are not limited to, luteinizing
hormone releasing hormone (LHRH), growth hormone (GH), growth
hormone releasing hormone, ACTH, somatostatin, somatotropin,
somatomedin, parathyroid hormone, hypothalamic releasing factors,
insulin, glucagon, enkephalins, vasopressin, calcitonin, heparin,
low molecular weight heparins, heparinoids, thymostimulin,
synthetic and natural opioids, insulin thyroid stimulating
hormones, and endorphins.
The alkylating agents used in combination with at least one
compound of Formula (I) provided herein, or a pharmaceutically
acceptable salt or solvate thereof, include, but are not limited
to, nitrogen mustards, ethylenimines, methylmelamines, alkyl
sulfonates, nitrosoureas, carmustine, lomustine, triazenes,
melphalan, mechlorethamine, cis-platin, oxaliplatin, carboplatin,
cyclophosphamide, ifosfamide, melphalan, chlorambucil,
hexamethylmelaine, thiotepa, busulfan, carmustine, streptozocin,
dacarbazine and temozolomide.
The antimetabolites used in combination with at least one compound
of Formula (I) provided herein, or a pharmaceutically acceptable
salt or solvate thereof, include, but are not limited to,
cytarabile, gemcitabine and antifolates such as, by way of example
only, fluoropyrimidines (by way of example only, 5-fluorouracil and
tegafur), raltitrexed, methotrexate, cytosine arabinoside, and
hydroxyurea.
The antitumour antibiotics in combination with at least one
compound of Formula (I) provided herein, or a pharmaceutically
acceptable salt or solvate thereof, include, but are not limited
to, anthracyclines, bleomycin, doxorubicin, daunomycin, epirubicin,
idarubicin, mitomycin-C, dactinomycin and mithramycin.
The antimitotic agents used in combination with at least one
compound of Formula (I) provided herein, or a pharmaceutically
acceptable salt or solvate thereof, include, but are not limited
to, vinca alkaloids (by way of example only, vincristine,
vinblastine, vindesine and vinorelbine), taxoids (by way of example
only, taxol, paclitaxel and taxotere) and polokinase
inhibitors.
The topoisomerase inhibitors used in combination with at least one
compound of Formula (I) provided herein, or a pharmaceutically
acceptable salt or solvate thereof, include, but are not limited
to, epipodophyllotoxins by way of example only, etoposide and
teniposide, amsacrine, topotecan, irinotecan and camptothecin.
The cytostatic agents used in combination with at least one
compound of Formula (I) provided herein, or a pharmaceutically
acceptable salt or solvate thereof, include, but are not limited
to, antioestrogens (such as, by way of example only, tamoxifen,
fulvestrant, toremifene, raloxifene, droloxifene and iodoxyfene),
antiandrogens (such as, by way of example only, bicalutamide,
flutamide, nilutamide and cyproterone acetate), LHRH antagonists or
LHRH agonists (such as, by way of example only, goserelin,
leuprorelin, leuprolide and buserelin), progestogens (such as, by
way of example only, megestrol acetate), aromatase inhibitors (such
as, by way of example only, as anastrozole, letrozole, vorazole and
exemestane) and inhibitors of 5.alpha.-reductase (such as, by way
of example only, finasteride).
The anti-invasion agents used in combination with at least one
compound of Formula (I) provided herein, or a pharmaceutically
acceptable salt or solvate thereof, include, but are not limited
to, c-Src kinase family inhibitors (such as, by way of example
only,
4-(6-chloro-2,3-methylenedioxyanilino)-7-[2-(4-methylpiperazin-1-yl)ethox-
y]-5-tetrahydropyran-4-yloxyquinazoline (AZD0530) and
N-(2-chloro-6-methylphenyl)-2-{6-[4-(2-hydroxyethyl)piperazin-1-yl]-2-met-
hylpyrimidin-4-ylamino}thiazole-5-carboxamide (dasatinib,
BMS-354825)), and metalloproteinase inhibitors (such as, by way of
example only, marimastat, inhibitors of urokinase plasminogen
activator receptor function andantibodies to Heparanase).
The antiangiogenic agents used in combination with at least one
compound of Formula (I) provided herein, or a pharmaceutically
acceptable salt or solvate thereof, include, but are not limited
to, those which inhibit the effects of vascular endothelial growth
factor such as, by way of example only, anti-vascular endothelial
cell growth factor antibody bevacizumab (AVASTIN.TM.) and VEGF
receptor tyrosine kinase inhibitors such as
4-(4-bromo-2-fluoroanilino)-6-methoxy-7-(1-methylpiperidin-4-ylmethoxy)qu-
inazoline (ZD6474),
4-(4-fluoro-2-methylindol-5-yloxy)-6-methoxy-7-(3-pyrrolidin-1-ylpropoxy)-
quinazoline (AZD2171), vatalanib (PTK787) and SU1 1248 (sunitinib),
linomide, and inhibitors of integrin .alpha.v.beta.3 function and
angiostatin.
The inhibitors of growth factor function used in combination with
at least one compound of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, include, but
are not limited to, growth factor antibodies and growth factor
receptor antibodies (such as, by way of example only, the
anti-erbB2 antibody trastuzumab (HERCEPTIN.TM.), the anti-EGFR
antibody panitumumab, the anti-erbB1 antibody cetuximab (Erbitux,
C225), tyrosine kinase inhibitors, such as, by way of example only,
inhibitors of the epidermal growth factor family (for example EGFR
family tyrosine kinase inhibitors such as, by way of example only,
N-(3-chloro-4-fluorophenyl)-7-methoxy-6-(3-orpholinopropoxy)quinazolin-4--
amine (gefitinib, ZD1 839),
N-(3-ethynylphenyl)-6,7-bis(2-methoxyethoxy)quinazolin-4-amine
(erlotinib, OSI-774) and
6-acrylamido-N-(3-chloro-4-fluorophenyl)-7-(3-morpholinopropoxy)-quinazol-
in-4-amine (CI 1033), erbB2 tyrosine kinase inhibitors such as, by
way of example only, lapatinib, inhibitors of the hepatocyte growth
factor family, inhibitors of the platelet-derived growth factor
family such as imatinib, GLEEVEC.TM. inhibitors of serine/threonine
kinases (such as, by way of example only, Ras/Raf signaling
inhibitors such as farnesyl transferase inhibitors, for example
sorafenib (BAY 43-9006)), inhibitors of cell signalling through MEK
and/or AKT kinases, inhibitors of the hepatocyte growth factor
family, c-kit inhibitors, abl kinase inhibitors, IGF receptor
(insulin-like growth factor) kinase inhibitors; aurora kinase
inhibitors (for example AZD1 152, PH739358, VX-680, MLv8054, R763,
MP235, MP529, VX-528 AND AX39459) and cyclin dependent kinase
inhibitors such as CDK2 and/or CDK4 inhibitors.
In other embodiments, at least one compound of Formula (I) provided
herein, or a pharmaceutically acceptable salt or solvate thereof,
is used in combination with vascular damaging agents such as, by
way of example only, Combretastatin A4.
In other embodiments, at least one compound of Formula (I) provided
herein, or a pharmaceutically acceptable salt or solvate thereof,
is used in combination with antisense therapies, such as, by way of
example only, ISIS 2503, an anti-ras antisense.
In other embodiments, at least one compound of Formula (I) provided
herein, or a pharmaceutically acceptable salt or solvate thereof,
is used in combination with gene therapy approaches, including for
example approaches to replace aberrant genes such as aberrant p53
or aberrant BRCA1 or BRCA2, GDEPT (gene-directed enzyme pro-drug s
therapy) approaches such as those using cytosine deaminase,
thymidine kinase or a bacterial nitroreductase enzyme and
approaches to increase patient tolerance to chemotherapy or
radiotherapy such as multi-drug resistance gene therapy.
In other embodiments, at least one compound of Formula (I) provided
herein, or a pharmaceutically acceptable salt or solvate thereof,
is used in combination with immunotherapy approaches, including for
example ex-vivo and in-vivo approaches to increase the
immunogenicity of patient tumor cells, such as transfection with
cytokines such o as interleukin 2, interleukin 4 or
granulocyte-macrophage colony stimulating factor, approaches to
decrease T-cell anergy, approaches using transfected immune cells
such as cytokine-transfected dendritic cells, approaches using
cytokine-transfected tumor cell lines and approaches using
anti-idiotypic antibodies.
In other embodiments, at least one compound of Formula (I) provided
herein, or a pharmaceutically acceptable salt or solvate thereof,
is used in combination with other treatment methods including, but
not limited to, surgery and radiotherapy (.gamma.-radiation,
neutron beam radiotherapy, electron beam radiotherapy, proton
therapy, brachytherapy, and systemic radioactive isotopes).
In certain embodiments, the compounds of Formula (I) provided
herein, or pharmaceutically acceptable salts and solvates thereof,
are administered or formulated in combination with an absorption
enhancer, including, but not limited to, sodium glycocholate,
sodium caprate, N-lauryl-.beta.-D-maltopyranoside, EDTA, and mixed
micelles. In certain embodiments, such absorption enhancers target
the lymphatic system.
In certain embodiments, the additional therapeutic agent(s) used in
the combination therapies described herein include, but are not
limited to, agents such as tumor necrosis factor alpha
(TNF-.alpha.) inhibitors (such as anti-TNF monoclonal antibodies
(by way of example only, Remicade, CDP-870 and adalimumab) and TNF
receptor immunoglobulin molecules (by way of example only,
Enbrel)); non-selective cyclo-oxygenase COX-1/COX-2 inhibitors (by
way of example only, piroxicam, diclofenac, propionic acids such as
naproxen, flubiprofen, fenoprofen, ketoprofen and ibuprofen,
fenamates such as mefenamic acid, indomethacin, sulindac,
azapropazone, pyrazolones such as phenylbutazone, salicylates such
as aspirin), COX-2 inhibitors (by way of example only, meloxicam,
celecoxib, rofecoxib, valdecoxib, lumarocoxib, parecoxib and
etoricoxib); glucocorticosteroids; methotrexate, lefunomide;
hydroxychloroquine, d-penicillamine, auranofin or other parenteral
or oral gold preparations.
In other embodiments, the combinations described herein include
combination of a compound of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, with a
leukotriene biosynthesis inhibitor, 5-lipoxygenase (5-LO) inhibitor
or 5-lipoxygenase activating protein (FLAP) antagonist such as;
zileuton; ABT-761; fenleuton; tepoxalin; Abbott-79175;
Abbott-85761; a N-(5-substituted)-thiophene-2-alkylsulfonamide;
2,6-di-tert-butylphenolhydrazones; a methoxytetrahydropyrans such
as Zeneca ZD-2138; the compound SB-210661; a pyridinyl-substituted
2-cyanonaphthalene compound such as L-739,010; a 2-cyanoquinoline
compound such as L-746,530; or an indole or quinoline compound such
as MK-591, MK-886, and BAYx1005.
In other embodiments, the combinations described herein include
combination of a compound of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, with a
receptor antagonist for leukotrienes (LT B4, LTC4, LTD4, and LTE4)
selected from the group consisting of the phenothiazin-3-1s such as
L-651,392; amidino compounds such as CGS-25019c; benzoxalamines
such as ontazolast; benzenecarboximidamides such as BIIL 284/260;
and compounds such as zafirlukast, ablukast, montelukast,
SINGULAIR.TM., pranlukast, verlukast (MK-679), RG-12525, Ro-245913,
iralukast (CGP 45715A), and BAYx7195.
In other embodiments, the combinations described herein include
combination of a compound of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, with a
phosphodiesterase (PDE) inhibitor such as a methylxanthanine
including theophylline and aminophylline; a selective PDE isoenzyme
inhibitor including a PDE4 inhibitor, including, but not limited
to, cilomilast or roflumilast, an inhibitor of the isoform PDE4D,
or an inhibitor of PDE5.
In other embodiments, the combinations described herein include
combination of a compound of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, with a
histamine type 1 receptor antagonist such as cetirizine,
loratadine, desloratadine, fexofenadine, acrivastine, terfenadine,
astemizole, azelastine, levocabastine, chlorpheniramine,
promethazine, cyclizine, or mizolastine.
In other embodiments, the combinations described herein include
combination of a compound of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, with a
gastroprotective histamine type 2 receptor antagonist. In other
embodiments, the combinations described herein include combination
of a compound of Formula (I), or a pharmaceutically acceptable salt
or solvate thereof, described herein, with an antagonist of the
histamine type 4 receptor.
In other embodiments, the combinations described herein include
combination of a compound of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, with an
alpha-1/alpha-2 adrenoceptor agonist vasoconstrictor
sympathomimetic agent, such as propylhexedrine, phenylephrine,
phenylpropanolamine, ephedrine, pseudoephedrine, naphazoline
hydrochloride, oxymetazoline hydrochloride, tetrahydrozoline
hydrochloride, xylometazoline hydrochloride, tramazoline
hydrochloride or ethylnorepinephrine hydrochloride.
In other embodiments, the combinations described herein include
combination of a compound of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, with an
anticholinergic agent including muscarinic receptor (M1, M2, and
M3) antagonists such as atropine, hyoscine, glycopyrrrolate,
ipratropium bromide, tiotropium bromide, oxitropium bromide,
pirenzepine or telenzepine.
In other embodiments, the combinations described herein include
combination of a compound of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, with a
beta-adrenoceptor agonist (including beta receptor subtypes 1-4)
such as isoprenaline, salbutamol, albuterol, formoterol,
salmeterol, terbutaline, orciprenaline, bitolterol mesylate, and
pirbuterol.
In other embodiments, the combinations described herein include
combination of a compound of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, with a
chromone, such as sodium cromoglycate or nedocromil sodium.
In other embodiments, the combinations described herein include
combination of a compound of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, with an
insulin-like growth factor type I (IGF-I) mimetic.
In other embodiments, the combinations described herein include
combination of a compound of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, with a
glucocorticoid, such as flunisolide, triamcinolone acetonide,
beclomethasone dipropionate, budesonide, fluticasone propionate,
ciclesonide or mometasone furoate.
In other embodiments, the combinations described herein include
combination of a compound of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, with an
inhibitor of matrix metalloproteases (MMPs), i.e., the
stromelysins, the collagenases, and the gelatinases, as well as
aggrecanase; especially collagenase-1 (MMP-I), collagenase-2
(MMP-8), collagenase-3 (MMP-13), stromelysin-1 (MMP-3),
stromelysin-2 (MMP-IO), and stromelysin-3 (MMP-II) and MMP-9 and
MMP-12.
In other embodiments, the combinations described herein include
combination of a compound of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, with
modulators of chemokine receptor function such as antagonists of
CCR1, CCR2, CCR2A, CCR2B, CCR3, CCR4, CCR5, CCR6, CCR7, CCR8, CCR9,
CCR10 and CCR11 (for the C-C family); CXCR1, CXCR2, CXCR3, CXCR4
and CXCR5 (for the C-X-C family) and CX3CR1 for the C-X3-C
family.
In other embodiments, the combinations described herein include
combination of a compound of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, with an
immunoglobulin (Ig), gamma globulin, Ig preparation or an
antagonist or antibody modulating Ig function such as anti-IgE
(omalizumab).
Compounds of Formula (I) as Immune Potentiators
In certain embodiments, pharmaceutical compositions containing at
least one compound of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, are
immunogenic compositions. In certain embodiments, such immunogenic
compositions are useful as vaccines. In certain embodiments, such
vaccines are prophylactic (i.e. to prevent infection), while in
other embodiments, such vaccines are therapeutic (i.e. to treat
infection).
In other embodiments, the compound(s) of Formula (I) provided
herein, or a pharmaceutically acceptable salt or solvate thereof,
are immune potentiators and impart an immunostimulatory effect upon
administration when compared to immunogenic formulations that do
not contain compound(s) of Formula (I). In certain embodiments,
compounds of Formula (I) impart an immunostimulatory effect upon
administration when included in an immunogenic composition having
one or more immunoregulatory agents, while in other embodiments,
compounds of Formula (I) impart an immunostimulatory effect upon
administration when included in an immunogenic composition without
the presence of other immunoregulatory agents.
The immunostimulatory effect referred to herein is often an
enhancement of the immunogenic composition's effect. In certain
embodiments the enhancement of the efficacy of the immunogenic
composition is by at least 10% relative to the effect of the
immunogenic composition in the absence of the immune potentiator.
In certain embodiments the enhancement of the efficacy of the
immunogenic composition is by at least 20% relative to the effect
of the immunogenic composition in the absence of the immune
potentiator. In certain embodiments the enhancement of the efficacy
of the immunogenic composition is by at least 30% relative to the
effect of the immunogenic composition in the absence of the immune
potentiator. In certain embodiments the enhancement of the efficacy
of the immunogenic composition is by at least 40% relative to the
effect of the immunogenic composition in the absence of the immune
potentiator. In certain embodiments the enhancement of the efficacy
of the immunogenic composition is by at least 50% relative to the
effect of the immunogenic composition in the absence of the immune
potentiator. In certain embodiments the enhancement of the efficacy
of the immunogenic composition is by at least 60% relative to the
effect of the immunogenic composition in the absence of the immune
potentiator. In certain embodiments the enhancement of the efficacy
of the immunogenic composition is by at least 70% relative to the
effect of the immunogenic composition in the absence of the immune
potentiator. In certain embodiments the enhancement of the efficacy
of the immunogenic composition is by at least 80% relative to the
effect of the immunogenic composition in the absence of the immune
potentiator. In certain embodiments the enhancement of the efficacy
of the immunogenic composition is by at least 90% relative to the
effect of the immunogenic composition in the absence of the immune
potentiator. In certain embodiments the enhancement of the efficacy
of the immunogenic composition is by at least 100% relative to the
effect of the immunogenic composition in the absence of the immune
potentiator.
In certain embodiments, the enhancement of the immunogenic
composition's effect is measured by the increased effectiveness of
the immunogenic composition for achieving its protective effects.
In certain embodiments, this increased effectiveness is measured as
a decreased probability that a subject receiving the immunogenic
composition will experience a condition for which the immunogenic
composition is considered protective, or a decrease in duration or
severity of the effects of such condition. In other embodiments,
this increased effectiveness is measured as an increase in a titer
of an antibody elicited by the immunogenic composition in a treated
subject.
Along with one or more compounds of Formula (I) provided herein, or
a pharmaceutically acceptable salt or solvate thereof, such
immunogenic compositions include an effective amount of one or more
antigens, and a pharmaceutically acceptable carrier. Such carriers
are include, but are not limited to, proteins, polysaccharides,
polylactic acids, polyglycolic acids, polymeric amino acids, amino
acid copolymers, sucrose, trehalose, lactose, lipid aggregates
(such as oil droplets or liposomes), and inactive virus particles.
The immunogenic compositions typically also contain diluents, such
as water, saline, and glycerol, and optionally contain other
excipients, such as wetting or emulsifying agents, and pH buffering
substances.
In certain embodiments, immunogenic compositions optionally include
one or more immunoregulatory agents. In certain embodiments, one or
more of the immunoregulatory agents include one or more adjuvants.
Such adjuvants include, but are not limited to, a TH1 adjuvant
and/or a TH2 adjuvant, further discussed below. In certain
embodiments, the adjuvants used in immunogenic compositions provide
herein include, but are not limited to: A. Mineral-Containing
Compositions; B. Oil Emulsions; C. Saponin Formulations; D.
Virosomes and Virus-Like Particles; E. Bacterial or Microbial
Derivatives; F. Human Immunomodulators; G. Bioadhesives and
Mucoadhesives; H. Microparticles; I. Liposomes; J. Polyoxyethylene
Ether and Polyoxyethylene Ester Formulations; K. Polyphosphazene
(PCPP); L. Muramyl Peptides, and M. Imidazoquinolone Compounds.
Mineral-containing compositions suitable for use as adjuvants
include, but are not limited to, mineral salts, such as aluminium
salts and calcium salts. By way of example only, such mineral salts
include, hydroxides (e.g. oxyhydroxides, including aluminium
hydroxides and aluminium oxyhydroxides), phosphates (e.g.
hydroxyphosphates and orthophosphates, including aluminium
phosphates, aluminium hydroxyphosphates, aluminium orthophosphates
and calcium phosphate), sulfates (e.g. aluminium sulfate), or
mixtures of different mineral compounds. Such mineral salts are in
any suitable form, such as, by way of example only, gel,
crystalline, and amorphous forms. In certain embodiments, such
mineral containing compositions are formulated as a particle of the
metal salt. In certain embodiments, components of the immunogenic
compositions described herein are adsorbed to such mineral salts.
In certain embodiments, an aluminium hydroxide and/or aluminium
phosphate adjuvant is used in the immunogenic compositions
described herein. In other embodiments, antigens used in an
immunogenic composition described herein are adsorbed to such
aluminium hydroxide and/or aluminium phosphate adjuvants. In
certain embodiments, a calcium phosphate adjuvant is used in the
immunogenic compositions described herein. In other embodiments,
antigens used in an immunogenic composition described herein are
adsorbed to such calcium phosphate adjuvants.
In certain embodiments, aluminum phosphates are used as an adjuvant
in the immunogenic compositions described herein. In other
embodiments, aluminum phosphates are used as an adjuvant in the
immunogenic compositions described herein, wherein such
compositions include a H. influenzae saccharide antigen. In certain
embodiments, the adjuvant is amorphous aluminium hydroxyphosphate
with a PO.sub.4/Al molar ratio between 0.84 and 0.92, included at
0.6 mg Al.sup.3+/ml. In other embodiments, adsorption with a low
dose of aluminium phosphate is used, by way of example only,
between 50 and 100 .mu.g Al.sup.3+ per conjugate per dose. Where
there is more than one conjugate in a composition, not all
conjugates need to be adsorbed.
Oil emulsions suitable for use as adjuvants include, but are not
limited to, squalene-water emulsions (such as MF59 (5% Squalene,
0.5% Tween 80, and 0.5% Span 85, formulated into submicron
particles using a microfluidizer), Complete Freund's adjuvant (CFA)
and incomplete Freund's adjuvant (IFA).
Saponins are a heterologous group of sterol glycosides and
triterpenoid glycosides that are found in the bark, leaves, stems,
roots and even flowers of a wide range of plant species. Saponin
formulations suitable for use as adjuvants include, but are not
limited to, saponins from the bark of the Quillaia saponaria Molina
tree, from Smilax ornata (sarsaprilla), Gypsophilla paniculata
(brides veil), and Saponaria officianalis (soap root). In certain
embodiments, saponin formulations suitable for use as adjuvants
include, but are not limited to, purified formulations including,
but are not limited to, QS7, QS17, QS18, QS21, QH-A, QH-B and QH-C.
QS21 is marketed as STIMULOM.TM.. In other embodiments, saponin
formulations include sterols, cholesterols and lipid formulations,
such as unique particles formed by the combinations of saponins and
cholesterols called immunostimulating complexes (ISCOMs). In
certain embodiments, the ISCOMs also include a phospholipid such as
phosphatidylethanolamine or phosphatidylcholine. Any known saponin
can be used in ISCOMs. In certain embodiments, the ISCOM includes
one or more of QuilA, QHA & QHC. In other embodiments, the
ISCOMS are optionally devoid of an additional detergent.
Virosomes and virus-like particles (VLPs) suitable for use as
adjuvants include, but are not limited to, one or more proteins
from a virus optionally combined or formulated with a phospholipid.
Such virosomes and VLPs are generally non-pathogenic,
non-replicating and generally do not contain any of the native
viral genome. In certain embodiments, the viral proteins are
recombinantly produced, while in other embodiments the viral
proteins are isolated from whole viruses.
The viral proteins suitable for use in virosomes or VLPs include,
but are not limited to, proteins derived from influenza virus (such
as HA or NA), Hepatitis B virus (such as core or capsid proteins),
Hepatitis E virus, measles virus, Sindbis virus, Rotavirus,
Foot-and-Mouth Disease virus, Retrovirus, Norwalk virus, human
Papilloma virus, HIV, RNA-phages, Q.beta.-phage (such as coat
proteins), GA-phage, fr-phage, AP205 phage, and Ty (such as
retrotransposon Ty protein p1).
Bacterial or microbial derivatives suitable for use as adjuvants
include, but are not limited to, bacterial or microbial derivatives
such as non-toxic derivatives of enterobacterial lipopolysaccharide
(LPS), Lipid A derivatives, immunostimulatory oligonucleotides and
ADP-ribosylating toxins and detoxified derivatives thereof. Such
non-toxic derivatives of LPS include, but are not limited to,
monophosphoryl lipid A (MPL) and 3-O-deacylated MPL (3dMPL). 3dMPL
is a mixture of 3 de-O-acylated monophosphoryl lipid A with 4, 5 or
6 acylated chains. Other non-toxic LPS derivatives include
monophosphoryl lipid A mimics, such as aminoalkyl glucosaminide
phosphate derivatives (e.g. RC-529). Lipid A derivatives include,
but are not limited to, derivatives of lipid A from Escherichia
coli (e.g. OM-174).
Immunostimulatory oligonucleotides used as adjuvants include, but
are not limited to, nucleotide sequences containing a CpG motif (a
dinucleotide sequence containing an unmethylated cytosine linked by
a phosphate bond to a guanosine). Such CpG sequences can be
double-stranded or single-stranded. In certain embodiments, such
nucleotide sequences are double-stranded RNAs or oligonucleotides
containing palindromic or poly(dG) sequences. In other embodiments,
the CpG's include nucleotide modifications/analogs such as
phosphorothioate modifications.
In certain embodiments the CpG sequence are directed to TLR9, and
in certain embodiments the motif is GTCGTT or TTCGTT. In certain
embodiments the CpG sequence is specific for inducing a Th1 immune
response, such as, by way of example only, a CpG-A ODN, or in other
embodiments the CpG sequence is more specific for inducing a B cell
response, such as, by way of example only, a CpG-B ODN. In certain
embodiments the CpG is a CpG-A ODN.
In certain embodiments the CpG oligonucleotide is constructed so
that the 5' end is accessible for receptor recognition. In other
embodiments two CpG oligonucleotide sequences are optionally
attached at their 3' ends to form "immunomers".
A particularly useful adjuvant based around immunostimulatory
oligonucleotides is known as IC-31.TM.. In certain embodiments, an
adjuvant used with immunogenic compositions described herein,
includes a mixture of (i) an oligonucleotide (such as, by way of
example only, between 15-40 nucleotides) including at least one
(and preferably multiple) CpI motifs (such as, by way of example
only, a cytosine linked to an inosine to form a dinucleotide), and
(ii) a polycationic polymer, such as, by way of example only, an
oligopeptide (such as, by way of example only, between 5-20 amino
acids) including at least one (and preferably multiple) Lys-Arg-Lys
tripeptide sequence(s). In certain embodiments, the oligonucleotide
is a deoxynucleotide comprising 26-mer sequence 5'-(IC).sub.13-3'.
In other embodiments, the polycationic polymer is a peptide
comprising 11-mer amino acid sequence KLKLLLLLKLK.
In certain embodiments, bacterial ADP-ribosylating toxins and
detoxified derivatives thereof are used as adjuvants in the
immunogenic compositions described herein. In certain embodiments,
such proteins are derived from E. coli (E. coli heat labile
enterotoxin "LT"), cholera ("CT"), or pertussis ("PT"). In other
embodiments, the toxin or toxoid is in the form of a holotoxin,
comprising both A and B subunits. In other embodiments, the A
subunit contains a detoxifying mutation; whereas the B subunit is
not mutated. In other embodiments, the adjuvant is a detoxified LT
mutant such as LT-K63, LT-R72, and LT-G192.
The human immunomodulators suitable for use as adjuvants include,
but are not limited to, cytokines, such as, by way of example only,
interleukins (IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12),
interferons (such as, by way of example only, interferon-.gamma.),
macrophage colony stimulating factor, and tumor necrosis
factor.
The bioadhesives and mucoadhesives used as adjuvants in the
immunogenic compositions described herein include, but are not
limited to, esterified hyaluronic acid microspheres, and
cross-linked derivatives of poly(acrylic acid), polyvinyl alcohol,
polyvinyl pyrollidone, polysaccharides and carboxymethylcellulose.
In certain embodiments, chitosan and derivatives thereof are used
as in the vaccine compositions described herein adjuvants.
The microparticles suitable for use as adjuvants include, but are
not limited to, microparticles formed from materials that are
biodegradable and non-toxic (e.g. a poly(.alpha.-hydroxy acid), a
polyhydroxybutyric acid, a polyorthoester, a polyanhydride, a
polycaprolactone, etc.), with poly(lactide-co-glycolide). In
certain embodiments, such microparticles are treated to have a
negatively-charged surface (e.g. with SDS) or a positively-charged
surface (e.g. with a cationic detergent, such as CTAB). The
microparticles suitable for use as adjuvants have a particle
diameter of about 100 nm to about 150 .mu.m in diameter. In certain
embodiments, the particle diameter is about 200 nm to about 30
.mu.m, and in other embodiments the particle diameter is about 500
nm to 10 .mu.m.
The polyoxyethylene ether and polyoxyethylene ester formulations
suitable for use as adjuvants include, but are not limited to,
polyoxyethylene sorbitan ester surfactants in combination with an
octoxynol, and polyoxyethylene alkyl ethers or ester surfactants in
combination with at least one additional non-ionic surfactant such
as an octoxynol. In certain embodiments, the polyoxyethylene ethers
are selected from polyoxyethylene-9-lauryl ether (laureth 9),
polyoxyethylene-9-steoryl ether, polyoxytheylene-8-steoryl ether,
polyoxyethylene-4-lauryl ether, polyoxyethylene-35-lauryl ether,
and polyoxyethylene-23-lauryl ether.
The muramyl peptides suitable for use as adjuvants include, but are
not limited to, N-acetyl-muramyl-L-threonyl-D-isoglutamine
(thr-MDP), N-acetyl-normuramyl-L-alanyl-D-isoglutamine (nor-MDP),
and
N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1'-2'-dipalmitoyl-s-
-n-glycero-3-hydroxyphosphoryloxy)-ethylamine MTP-PE).
In certain embodiments, one or more compounds of Formula (I) used
as an immune potentiator are included in compositions having
combinations of one or more of the adjuvants identified above. Such
combinations include, but are not limited to, (1) a saponin and an
oil-in-water emulsion; (2) a saponin (e.g. QS21)+a non-toxic LPS
derivative (e.g. 3dMPL); (3) a saponin (e.g. QS21)+a non-toxic LPS
derivative (e.g. 3dMPL)+a cholesterol; (4) a saponin (e.g.
QS21)+3dMPTL+IL-12 (optionally including a sterol); (5)
combinations of 3dMPL with, for example, QS21 and/or oil-in-water
emulsions; (6) SAF, containing 10% squalane, 0.4% Tween 80.TM., 5%
pluronic-block polymer L121, and thr-MDP, either microfluidized
into a submicron emulsion or vortexed to generate a larger particle
size emulsion. (7) RIBI.TM. adjuvant system (RAS), (Ribi
Immunochem) containing 2% squalene, 0.2% Tween 80, and one or more
bacterial cell wall components from the group consisting of
monophosphorylipid A (MPL), trehalose dimycolate (TDM), and cell
wall skeleton (CWS), preferably MPL+CWS (Detox.TM.) and (8) one or
more mineral salts (such as an aluminum salt)+a non-toxic
derivative of LPS (such as 3dMPL).
In other embodiments, the adjuvant combinations used in the
immunogenic combinations provided herein include combinations of
Th1 and Th2 adjuvants such as, by way of example only, CpG and alum
or resiquimod and alum.
In certain embodiments, the immunogenic compositions provided
herein elicit both a cell mediated immune response as well as a
humoral immune response. In other embodiments, the immune response
induces long lasting (e.g. neutralising) antibodies and a cell
mediated immunity that quickly responds upon exposure to the
infectious agent.
Two types of T cells, CD4 and CD8 cells, are generally thought
necessary to initiate and/or enhance cell mediated immunity and
humoral immunity. CD8 T cells can express a CD8 co-receptor and are
commonly referred to as Cytotoxic T lymphocytes (CTLs). CD8 T cells
are able to recognized or interact with antigens displayed on MHC
Class 1 molecules.
CD4 T cells can express a CD4 co-receptor and are commonly referred
to as T helper cells. CD4 T cells are able to recognize antigenic
peptides bound to MHC class II molecules. Upon interaction with a
MHC class II molecule, the CD4 cells can secrete factors such as
cytokines. These secreted cytokines can activate B cells, cytotoxic
T cells, macrophages, and other cells that participate in an immune
response. Helper T cells or CD4+ cells can be further divided into
two functionally distinct subsets: TH1 phenotype and TH2 phenotypes
which differ in their cytokine and effector function.
Activated TH1 cells enhance cellular immunity (including an
increase in antigen-specific CTL production) and are therefore of
particular value in responding to intracellular infections.
Activated TH1 cells may secrete one or more of IL-2, IFN-.gamma.,
and TNF-.beta.. A TH1 immune response may result in local
inflammatory reactions by activating macrophages, NK (natural
killer) cells, and CD8 cytotoxic T cells (CTLs). A TH1 immune
response may also act to expand the immune response by stimulating
growth of B and T cells with IL-12. TH1 stimulated B cells may
secrete IgG2a.
Activated TH2 cells enhance antibody production and are therefore
of value in responding to extracellular infections. Activated TH2
cells may secrete one or more of IL-4, IL-5, IL-6, and IL-10. A TH2
immune response may result in the production of IgG1, IgE, IgA and
memory B cells for future protection.
An enhanced immune response may include one or more of an enhanced
TH1 immune response and a TH2 immune response.
A TH1 immune response may include one or more of an increase in
CTLs, an increase in one or more of the cytokines associated with a
TH1 immune response (such as IL-2, IFN-.gamma., and TNF-.beta.), an
increase in activated macrophages, an increase in NK activity, or
an increase in the production of IgG2a. Preferably, the enhanced
TH1 immune response will include an increase in IgG2a
production.
TH1 adjuvants can be used to elicit a TH1 immune response. A TH1
adjuvant will generally elicit increased levels of IgG2a production
relative to immunization of the antigen without adjuvant. TH1
adjuvants suitable for use in immunogenic compositions provided
herein include, but are not limited to, saponin formulations,
virosomes and virus like particles, non-toxic derivatives of
enterobacterial lipopolysaccharide (LPS), immunostimulatory
oligonucleotides. In certain embodiments, the immunostimulatory
oligonucleotides used as TH1 adjuvants in the immunogenic
compositions provided herein contain a CpG motif.
A TH2 immune response may include one or more of an increase in one
or more of the cytokines associated with a TH2 immune response
(such as IL-4, IL-5, IL-6 and IL-10), or an increase in the
production of IgG1, IgE, IgA and memory B cells. Preferably, the
enhanced TH2 immune response will include an increase in IgG1
production.
TH2 adjuvants can be used to elicit a TH2 immune response. A TH2
adjuvant will generally elicit increased levels of IgG1 production
relative to immunization of the antigen without adjuvant. TH2
adjuvants suitable for use in immunogenic compositions provided
herein include, but are not limited to, mineral containing
compositions, oil-emulsions, and ADP-ribosylating toxins and
detoxified derivatives thereof. In certain embodiments, the mineral
containing compositions used as TH2 adjuvants in the immunogenic
compositions provided herein are aluminium salts.
In certain embodiments, the immunogenic compositions provided
herein include a TH1 adjuvant and a TH2 adjuvant. In other
embodiments, such compositions elicit an enhanced TH1 and an
enhanced TH2 response, such as, an increase in the production of
both IgG1 and IgG2a production relative to immunization without an
adjuvant. In still other embodiments, such compositions comprising
a combination of a TH1 and a TH2 adjuvant elicit an increased TH1
and/or an increased TH2 immune response relative to immunization
with a single adjuvant (i.e., relative to immunization with a TH1
adjuvant alone or immunization with a TH2 adjuvant alone).
In certain embodiments, the immune response is one or both of a TH1
immune response and a TH2 response. In other embodiments, the
immune response provides for one or both of an enhanced TH1
response and an enhanced TH2 response.
In certain embodiments, the enhanced immune response is one or both
of a systemic and a mucosal immune response. In other embodiments,
the immune response provides for one or both of an enhanced
systemic and an enhanced mucosal immune response. In certain
embodiments, the mucosal immune response is a TH2 immune response.
In certain embodiments, the mucosal immune response includes an
increase in the production of IgA.
In certain embodiments the immunogenic compositions provided herein
are used as vaccines, wherein such compositions include an
immunologically effective amount of one or more antigen).
Antigens for use in the immunogenic compositions provided herein
may be provided in an effective amount (e.g., an amount effective
for use in therapeutic, prophylactic or diagnostic methods). For
example, immunogenic compositions of the invention may be used to
treat or prevent infections caused by any of the below-listed
pathogens.
Antigens for use in the immunogenic compositions provided herein
are typically macromolecules (e.g., polypeptides, polysaccharides,
polynucleotides) that are foreign to the host, and include, but are
not limited to, one or more of the antigens set forth below, or
antigens derived from one or more of the pathogens set forth
below.
Bacterial Antigens
Bacterial antigens suitable for use in immunogenic compositions
provided herein include, but are not limited to, proteins,
polysaccharides, lipopolysaccharides, polynucleotides, and outer
membrane vesicles which are isolated, purified or derived from a
bacteria. In certain embodiments, the bacterial antigens include
bacterial lysates and inactivated bacteria formulations. In certain
embodiments, the bacterial antigens are produced by recombinant
expression. In certain embodiments, the bacterial antigens include
epitopes which are exposed on the surface of the bacteria during at
least one stage of its life cycle. Bacterial antigens are
preferably conserved across multiple serotypes. In certain
embodiments, the bacterial antigens include antigens derived from
one or more of the bacteria set forth below as well as the specific
antigens examples identified below: Neisseria meningitidis:
Meningitidis antigens include, but are not limited to, proteins,
saccharides (including a polysaccharide, oligosaccharide,
lipooligosaccharide or lipopolysaccharide), or outer-membrane
vesicles purified or derived from N. meningitides serogroup such as
A, C, W135, Y, X and/or B. In certain embodiments meningitides
protein antigens are be selected from adhesions, autotransporters,
toxins, Fe acquisition proteins, and membrane associated proteins
(preferably integral outer membrane protein). Streptococcus
pneumoniae: Streptococcus pneumoniae antigens include, but are not
limited to, a saccharide (including a polysaccharide or an
oligosaccharide) and/or protein from Streptococcus pneumoniae. The
saccharide may be a polysaccharide having the size that arises
during purification of the saccharide from bacteria, or it may be
an oligosaccharide achieved by fragmentation of such a
polysaccharide. In the 7-valent PREVNAR.TM. product, for instance,
6 of the saccharides are presented as intact polysaccharides while
one (the 18C serotype) is presented as an oligosaccharide. In
certain embodiments saccharide antigens are selected from one or
more of the following pneumococcal serotypes 1, 2, 3, 4, 5, 6A, 6B,
7F, 8, 9N, 9V, 10A, 11A, 12F, 14, 15B, 17F, 18C, 19A, 19F, 20, 22F,
23F, and/or 33F. An immunogenic composition may include multiple
serotypes e.g. 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16,
17, 18, 19, 20, 21, 22, 23 or more serotypes. 7-valent, 9-valent,
10-valent, 11-valent and 13-valent conjugate combinations are
already known in the art, as is a 23-valent unconjugated
combination. For example, an 10-valent combination may include
saccharide from serotypes 1, 4, 5, 6B, 7F, 9V, 14, 18C, 19F and
23F. An 11-valent combination may further include saccharide from
serotype 3. A 12-valent combination may add to the 10-valent
mixture: serotypes 6A and 19A; 6A and 22F; 19A and 22F; 6A and 15B;
19A and 15B; r 22F and 15B; A 13-valent combination may add to the
11-valent mixture: serotypes 19A and 22F; 8 and 12F; 8 and 15B; 8
and 19A; 8 and 22F; 12F and 15B; 12F and 19A; 12F and 22F; 15B and
19A; 15B and 22F. etc. In certain embodiments, protein antigens may
be selected from a protein identified in WO98/18931, WO98/18930,
U.S. Pat. No. 6,699,703, U.S. Pat. No. 6,800,744, WO97/43303,
WO97/37026, WO 02/079241, WO 02/34773, WO 00/06737, WO 00/06738, WO
00/58475, WO 2003/082183, WO 00/37105, WO 02/22167, WO 02/22168, WO
2003/104272, WO 02/08426, WO 01/12219, WO 99/53940, WO 01/81380, WO
2004/092209, WO 00/76540, WO 2007/116322, LeMieux et al., Infect. 1
mm. (2006) 74:2453-2456, Hoskins et al., J. Bacteriol. (2001)
183:5709-5717, Adamou et al., Infect. Immun. (2001) 69(2):949-958,
Briles et al., J. Infect. Dis. (2000) 182:1694-1701, Talkington et
al., Microb. Pathog. (1996) 21(1):17-22, Bethe et al., FEMS
Microbiol. Lett. (2001) 205(1):99-104, Brown et al., Infect. Immun.
(2001) 69:6702-6706, Whalen et al., FEMS Immunol. Med. Microbiol.
(2005) 43:73-80, Jomaa et al., Vaccine (2006) 24(24):5133-5139. In
other embodiments, Streptococcus pneumoniae proteins may be
selected from the Poly Histidine Triad family (PhtX), the Choline
Binding Protein family (CbpX), CbpX truncates, LytX family, LytX
truncates, CbpX truncate-LytX truncate chimeric proteins,
pneumolysin (Ply), PspA, PsaA, Sp128, SpIO1, Sp130, Sp125, Sp133,
pneumococcal pilus subunits. Streptococcus pyogenes (Group A
Streptococcus): Group A Streptococcus antigens include, but are not
limited to, a protein identified in WO 02/34771 or WO 2005/032582
(including GAS 40), fusions of fragments of GAS M proteins
(including those described in WO 02/094851, and Dale, Vaccine
(1999) 17:193-200, and Dale, Vaccine 14(10): 944-948), fibronectin
binding protein (Sfb1), Streptococcal heme-associated protein
(Shp), and Streptolysin S (SagA). Moraxella catarrhalis: Moraxella
antigens include, but are not limited to, antigens identified in WO
02/18595 and WO 99/58562, outer membrane protein antigens
(HMW-OMP), C-antigen, and/or LPS. Bordetella pertussis: Pertussis
antigens include, but are not limited to, pertussis holotoxin (PT)
and filamentous haemagglutinin (FHA) from B. pertussis, optionally
also combination with pertactin and/or agglutinogens 2 and 3.
Burkholderia: Burkholderia antigens include, but are not limited to
Burkholderia mallei, Burkholderia pseudomallei and Burkholderia
cepacia. Staphylococcus aureus: Staph aureus antigens include, but
are not limited to, a polysaccharide and/or protein from S. aureus.
S. aureus polysaccharides include, but are not limited to, type 5
and type 8 capsular polysaccharides (CP5 and CP8) optionally
conjugated to nontoxic recombinant Pseudomonas aeruginosa exotoxin
A, such as StaphVAX.TM., type 336 polysaccharides (336PS),
polysaccharide intercellular adhesions (PIA, also known as PNAG).
S. aureus proteins include, but are not limited to, antigens
derived from surface proteins, invasins (leukocidin, kinases,
hyaluronidase), surface factors that inhibit phagocytic engulfment
(capsule, Protein A), carotenoids, catalase production, Protein A,
coagulase, clotting factor, and/or membrane-damaging toxins
(optionally detoxified) that lyse eukaryotic cell membranes
(hemolysins, leukotoxin, leukocidin). In certain embodiments, S.
aureus antigens may be selected from a protein identified in WO
02/094868, WO 2008/019162, WO 02/059148, WO 02/102829, WO
03/011899, WO 2005/079315, WO 02/077183, WO 99/27109, WO 01/70955,
WO 00/12689, WO 00/12131, WO 2006/032475, WO 2006/032472, WO
2006/032500, WO 2007/113222, WO 2007/113223, WO 2007/113224. In
other embodiments, S. aureus antigens may be selected from IsdA,
IsdB, IsdC, SdrC, SdrD, SdrE, C1fA, C1fB, SasF, SasD, SasH (AdsA),
Spa, EsaC, EsxA, EsxB, Emp, H1aH35L, CP5, CP8, PNAG, 336PS.
Staphylococcus epidermis: S. epidermidis antigens include, but are
not limited to, slime-associated antigen (SAA). Clostridium tetani
(Tetanus): Tetanus antigens include, but are not limited to,
tetanus toxoid (TT). In certain embodiments such antigens are used
as a carrier protein in conjunction/conjugated with the immunogenic
compositions provided herein. Clostridium perfringens: Antigens
include, but are not limited to, Epsilon toxin from Clostridium
perfringen. Clostridium botulinums (Botulism): Botulism antigens
include, but are not limited to, those derived from C. botulinum.
Cornynebacterium diphtheriae (Diphtheria): Diphtheria antigens
include, but are not limited to, diphtheria toxin, preferably
detoxified, such as CRM.sub.197. Additionally antigens capable of
modulating, inhibiting or associated with ADP ribosylation are
contemplated for combination/co-administration/conjugation with the
immunogenic compositions provided herein. In certain embodiments,
the diphtheria toxoids are used as carrier proteins. Haemophilus
influenzae B (Hib): Hib antigens include, but are not limited to, a
Hib saccharide antigen. Pseudomonas aeruginosa: Pseudomonas
antigens include, but are not limited to, endotoxin A, Wzz protein,
P. aeruginosa LPS, LPS isolated from PAO1 (O5 serotype), and/or
Outer Membrane Proteins, including Outer Membrane Proteins F
(OprF). Legionella pneumophila. Bacterial antigens derived from
Legionella pneumophila. Coxiella burnetii. Bacterial antigens
derived from Coxiella burnetii. Brucella. Bacterial antigens
derived from Brucella, including but not limited to, B. abortus, B.
canis, B. melitensis, B. neotomae, B. ovis, B. suis and B.
pinnipediae. Francisella. Bacterial antigens derived from
Francisella, including but not limited to, F. novicida, F.
philomiragia and F. tularensis. Streptococcus agalactiae (Group B
Streptococcus): Group B Streptococcus antigens include, but are not
limited to, a protein or saccharide antigen identified in WO
02/34771, WO 03/093306, WO 04/041157, or WO 2005/002619 (including
proteins GBS 80, GBS 104, GBS 276 and GBS 322, and including
saccharide antigens derived from serotypes Ia, Ib, Ia/c, II, III,
IV, V, VI, VII and VIII). Neiserria gonorrhoeae: Gonorrhoeae
antigens include, but are not limited to, Por (or porin) protein,
such as PorB (see Zhu et al., Vaccine (2004) 22:660-669), a
transferring binding protein, such as TbpA and TbpB (See Price et
al., Infection and Immunity (2004) 71(1):277-283), a opacity
protein (such as Opa), a reduction-modifiable protein (Rmp), and
outer membrane vesicle (OMV) preparations (see Plante et al, J
Infectious Disease (2000) 182:848-855), also see, e.g., WO99/24578,
WO99/36544, WO99/57280, WO02/079243). Chlamydia trachomatis:
Chlamydia trachomatis antigens include, but are not limited to,
antigens derived from serotypes A, B, Ba and C (agents of trachoma,
a cause of blindness), serotypes L.sub.1, L.sub.2 & L.sub.3
(associated with Lymphogranuloma venereum), and serotypes, D-K. In
certain embodiments, chlamydia trachomas antigens include, but are
not limited to, an antigen identified in WO 00/37494, WO 03/049762,
WO 03/068811, or WO 05/002619, including PepA (CT045), LcrE
(CT089), ArtJ (CT381), DnaK (CT396), CT398, OmpH-like (CT242),
L7/L12 (CT316), OmcA (CT444), AtosS (CT467), CT547, Eno (CT587),
HrtA (CT823), and MurG (CT761). Treponema pallidum (Syphilis):
Syphilis antigens include, but are not limited to, TmpA antigen.
Haemophilus ducreyi (causing chancroid): Ducreyi antigens include,
but are not limited to, outer membrane protein (DsrA). Enterococcus
faecalis or Enterococcus faecium: Antigens include, but are not
limited to, a trisaccharide repeat or other Enterococcus derived
antigens. Helicobacter pylori: H pylori antigens include, but are
not limited to, Cag, Vac, Nap, HopX, HopY and/or urease antigen.
Staphylococcus saprophyticus: Antigens include, but are not limited
to, the 160 kDa hemagglutinin of S. saprophyticus antigen. Yersinia
enterocolitica Antigens include, but are not limited to, LPS. E.
coli: E. coli antigens may be derived from enterotoxigenic E. coli
(ETEC), enteroaggregative E. coli (EAggEC), diffusely adhering E.
coli (DAEC), enteropathogenic E. coli (EPEC), extraintestinal
pathogenic E. coli (ExPEC) and/or enterohemorrhagic E. coli (EHEC).
ExPEC antigens include, but are not limited to, accessory
colonization factor (orf3526), orf353, bacterial Ig-like domain
(group 1) protein (orf405), orf1364, NodT-family
outer-membrane-factor-lipoprotein efflux transporter (orf1767),
gspK (orf3515), gspJ (orf3516), tonB-dependent siderophore receptor
(orf3597), fimbrial protein (orf3613), upec-948, upec-1232, A chain
precursor of the type-1 fimbrial protein (upec-1875), yap H homolog
(upec-2820), and hemolysin A (recp-3768). Bacillus anthracis
(anthrax): B. anthracis antigens include, but are not limited to,
A-components (lethal factor (LF) and edema factor (EF)), both of
which can share a common B-component known as protective antigen
(PA). In certain embodiments, B. anthracis antigens are optionally
detoxified. Yersinia pestis (plague): Plague antigens include, but
are not limited to, F1 capsular antigen, LPS, Yersinia pestis V
antigen. Mycobacterium tuberculosis: Tuberculosis antigens include,
but are not limited to, lipoproteins, LPS, BCG antigens, a fusion
protein of antigen 85B (Ag85B), ESAT-6 optionally formulated in
cationic lipid vesicles, Mycobacterium tuberculosis (Mtb)
isocitrate dehydrogenase associated antigens, and MPT51 antigens.
Rickettsia: Antigens include, but are not limited to, outer
membrane proteins, including the outer membrane protein A and/or B
(OmpB), LPS, and surface protein antigen (SPA). Listeria
monocytogenes: Bacterial antigens include, but are not limited to,
those derived from Listeria monocytogenes. Chlamydia pneumoniae:
Antigens include, but are not limited to, those identified in WO
02/02606. Vibrio cholerae: Antigens include, but are not limited
to, proteinase antigens, LPS, particularly lipopolysaccharides of
Vibrio cholerae II, O1 Inaba O-specific polysaccharides, V. cholera
0139, antigens of IEM108 vaccine and Zonula occludens toxin (Zot).
Salmonella typhi (typhoid fever): Antigens include, but are not
limited to, capsular polysaccharides preferably conjugates (Vi,
i.e. vax-TyVi). Borrelia burgdorferi (Lyme disease): Antigens
include, but are not limited to, lipoproteins (such as OspA, OspB,
Osp C and Osp D), other surface proteins such as OspE-related
proteins (Erps), decorin-binding proteins (such as DbpA), and
antigenically variable VI proteins, such as antigens associated
with P39 and P13 (an integral membrane protein, V1sE Antigenic
Variation Protein. Porphyromonas gingivalis: Antigens include, but
are not limited to, P. gingivalis outer membrane protein (OMP).
Klebsiella: Antigens include, but are not limited to, an OMP,
including OMP A, or a polysaccharide optionally conjugated to
tetanus toxoid.
Other bacterial antigens used in the immunogenic compositions
provided herein include, but are not limited to, capsular antigens,
polysaccharide antigens, protein antigens or polynucleotide
antigens of any of the above. Other bacterial antigens used in the
immunogenic compositions provided herein include, but are not
limited to, an outer membrane vesicle (OMV) preparation.
Additionally, other bacterial antigens used in the immunogenic
compositions provided herein include, but are not limited to, live,
attenuated, and/or purified versions of any of the aforementioned
bacteria. In certain embodiments, the bacterial antigens used in
the immunogenic compositions provided herein are derived from
gram-negative bacteria, while in other embodiments they are derived
from gram-positive bacteria. In certain embodiments, the bacterial
antigens used in the immunogenic compositions provided herein are
derived from aerobic bacteria, while in other embodiments they are
derived from anaerobic bacteria.
In certain embodiments, any of the above bacterial-derived
saccharides (polysaccharides, LPS, LOS or oligosaccharides) are
conjugated to another agent or antigen, such as a carrier protein
(for example CRM.sub.197). In certain embodiments, such
conjugations are direct conjugations effected by reductive
amination of carbonyl moieties on the saccharide to amino groups on
the protein. In other embodiments, the saccharides are conjugated
through a linker, such as, with succinamide or other linkages
provided in Bioconjugate Techniques, 1996 and CRC, Chemistry of
Protein Conjugation and Cross-Linking, 1993.
In certain embodiments useful for the treatment or prevention of
Neisseria infection and related diseases and disorders, recombinant
proteins from N. meningitidis for use in the immunogenic
compositions provided herein may be found in WO99/24578,
WO99/36544, WO99/57280, WO00/22430, WO96/29412, WO01/64920,
WO03/020756, WO2004/048404, and WO2004/032958. Such antigens may be
used alone or in combinations. Where multiple purified proteins are
combined then it is helpful to use a mixture of 10 or fewer (e.g.
9, 8, 7, 6, 5, 4, 3, 2) purified antigens.
A particularly useful combination of antigens for use in the
immunogenic compositions provided herein is disclosed in Giuliani
et al. (2006) Proc Natl Acad Sci USA 103(29):10834-9 and
WO2004/032958, and so an immunogenic composition may include 1, 2,
3, 4 or 5 of: (1) a `NadA` protein (aka GNA1994 and NMB1994); (2) a
`fHBP` protein (aka `741`, LP2086, GNA1870, and NMB1870); (3) a
`936` protein (aka GNA2091 and NMB2091); (4) a `953` protein (aka
GNA1030 and NMB1030); and (5) a `287` protein (aka GNA2132 and
NMB2132). Other possible antigen combinations may comprise a
transferrin binding protein (e.g. TbpA and/or TbpB) and an Hsf
antigen. Other possible purified antigens for use in the
immunogenic compositions provided herein include proteins
comprising one of the following amino acid sequences: SEQ ID NO:650
from WO99/24578; SEQ ID NO:878 from WO99/24578; SEQ ID NO:884 from
WO99/24578; SEQ ID NO:4 from WO99/36544; SEQ ID NO:598 from
WO99/57280; SEQ ID NO:818 from WO99/57280; SEQ ID NO:864 from
WO99/57280; SEQ ID NO:866 from WO99/57280; SEQ ID NO:1196 from
WO99/57280; SEQ ID NO:1272 from WO99/57280; SEQ ID NO:1274 from
WO99/57280; SEQ ID NO:1640 from WO99/57280; SEQ ID NO:1788 from
WO99/57280; SEQ ID NO:2288 from WO99/57280; SEQ ID NO:2466 from
WO99/57280; SEQ ID NO:2554 from WO99/57280; SEQ ID NO:2576 from
WO99/57280; SEQ ID NO:2606 from WO99/57280; SEQ ID NO:2608 from
WO99/57280; SEQ ID NO:2616 from WO99/57280; SEQ ID NO:2668 from
WO99/57280; SEQ ID NO:2780 from WO99/57280; SEQ ID NO:2932 from
WO99/57280; SEQ ID NO:2958 from WO99/57280; SEQ ID NO:2970 from
WO99/57280; SEQ ID NO:2988 from WO99/57280 (each of the forgoing
amino acid sequences is hereby incorporated by reference from the
cited document), or a polypeptide comprising an amino acid sequence
which: (a) has 50% or more identity (e.g., 60%, 70%, 80%, 90%, 95%,
99% or more) to said sequences; and/or (b) comprises a fragment of
at least n consecutive amino acids from said sequences, wherein n
is 7 or more (e.g., 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50,
60, 70, 80, 90, 100, 150, 200, 250 or more). Preferred fragments
for (b) comprise an epitope from the relevant sequence. More than
one (e.g., 2, 3, 4, 5, 6) of these polypeptides may be included in
the immunogenic compositions.
The fHBP antigen falls into three distinct variants
(WO2004/048404). An N. meningitidis serogroup vaccine based upon
the immunogenic compositions disclosed herein utilizing one of the
compounds disclosed herein may include a single fHBP variant, but
is will usefully include an fHBP from each of two or all three
variants. Thus the immunogenic composition may include a
combination of two or three different purified fHBPs, selected
from: (a) a first protein, comprising an amino acid sequence having
at least a % sequence identity to SEQ ID NO: 1 and/or comprising an
amino acid sequence consisting of a fragment of at least x
contiguous amino acids from SEQ ID NO: 1; (b) a second protein,
comprising an amino acid sequence having at least b % sequence
identity to SEQ ID NO: 2 and/or comprising an amino acid sequence
consisting of a fragment of at least y contiguous amino acids from
SEQ ID NO: 2; and/or (c) a third protein, comprising an amino acid
sequence having at least c % sequence identity to SEQ ID NO: 3
and/or comprising an amino acid sequence consisting of a fragment
of at least z contiguous amino acids from SEQ ID NO: 3
TABLE-US-00001 SEQ ID NO: 1
VAADIGAGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTY
GNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALT
AFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAF
GSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAV
ISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ SEQ ID NO: 2
VAADIGAGLADALTAPLDHKDKSLQSLTLDQSVRKNEKLKLAAQGAEKTY
GNGDSLNTGKLKNDKVSRFDFIRQIEVDGQLITLESGEFQIYKQDHSAVV
ALQIEKINNPDKIDSLINQRSFLVSGLGGEHTAFNQLPDGKAEYHGKAFS
SDDAGGKLTYTIDFAAKQGHGKIEHLKTPEQNVELAAAELKADEKSHAVI
LGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKVHEIGIAGKQ SEQ ID NO: 3
VAADIGTGLADALTAPLDHKDKGLKSLTLEDSIPQNGTLTLSAQGAEKTF
KAGDKDNSLNTGKLKNDKISRFDFVQKIEVDGQTITLASGEFQIYKQNHS
AVVALQIEKINNPDKTDSLINQRSFLVSGLGGEHTAFNQLPGGKAEYHGK
AFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTLEQNVELAAAELKADEKSH
AVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIGEKVHEIGIAGK Q.
The value of a is at least 85, e.g., 86, 87, 88, 89, 90, 91, 92,
93, 94, 95, 96, 97, 98, 99, 99.5, or more. The value of b is at
least 85, e.g., 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98,
99, 99.5, or more. The value of c is at least 85, e.g., 86, 87, 88,
89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 99.5, or more. The
values of a, b and c are not intrinsically related to each
other.
The value of x is at least 7, e.g., 8, 9, 10, 11, 12, 13, 14, 15,
16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40,
45, 50, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 225, 250).
The value of y is at least 7, e.g., 8, 9, 10, 11, 12, 13, 14, 15,
16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40,
45, 50, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 225, 250).
The value of z is at least 7, e.g., 8, 9, 10, 11, 12, 13, 14, 15,
16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40,
45, 50, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 225, 250).
The values of x, y and z are not intrinsically related to each
other.
In some embodiments, the immunogenic compositions as disclosed
herein will include fHBP protein(s) that are lipidated, e.g., at a
N-terminal cysteine. In other embodiments they will not be
lipidated
A useful immunogenic composition as disclosed herein includes
purified proteins comprises a mixture of: (i) a first polypeptide
having amino acid sequence SEQ ID NO: 4; (ii) a second polypeptide
having amino acid sequence SEQ ID NO: 5; and (iii) a third
polypeptide having amino acid sequence SEQ ID NO: 6. See Giuliani
et al. (2006) Proc Natl Acad Sci USA 103(29):10834-9 and
WO2004/032958. A useful immunogenic composition as disclosed herein
includes purified proteins comprises a mixture of: (i) a first
polypeptide having at least a % sequence identity to amino acid
sequence SEQ ID NO: 4; (ii) a second polypeptide having at least b
% sequence identity to amino acid sequence SEQ ID NO: 5; and (iii)
a third polypeptide having at least a % sequence identity to amino
acid sequence SEQ ID NO: 6.
TABLE-US-00002 SEQ ID NO: 4
MASPDVKSADTLSKPAAPVVSEKETEAKEDAPQAGSQGQGAPSAQGGQDM
AAVSEENTGNGGAAATDKPKNEDEGAQNDMPQNAADTDSLTPNHTPASNM
PAGNMENQAPDAGESEQPANQPDMANTADGMQGDDPSAGGENAGNTAAQG
TNQAENNQTAGSQNPASSTNPSATNSGGDFGRTNVGNSVVIDGPSQNITL
THCKGDSCSGNNFLDEEVQLKSEFEKLSDADKISNYKKDGKNDGKNDKFV
GLVADSVQMKGINQYIIFYKPKPTSFARFRRSARSRRSLPAEMPLIPVNQ
ADTLIVDGEAVSLTGHSGNIFAPEGNYRYLTYGAEKLPGGSYALRVQGEP
SKGEMLAGTAVYNGEVLHFHTENGRPSPSRGRFAAKVDFGSKSVDGIIDS
GDGLHMGTQKFKAAIDGNGFKGTWTENGGGDVSGKFYGPAGEEVAGKYSY
RPTDAEKGGFGVFAGKKEQDGSGGGGATYKVDEYHANARFAIDHFNTSTN
VGGFYGLTGSVEFDQAKRDGKIDITIPVANLQSGSQHFTDHLKSADIFDA
AQYPDIRFVSTKFNFNGKKLVSVDGNLTMHGKTAPVKLKAEKFNCYQSPM
AKTEVCGGDFSTTIDRTKWGVDYLVNVGMTKSVRIDIQIEAAKQ SEQ ID NO: 5
MVSAVIGSAAVGAKSAVDRRTTGAQTDDNVMALRIETTARSYLRQNNQTK
GYTPQISVVGYNRHLLLLGQVATEGEKQFVGQIARSEQAAEGVYNYITVA
SLPRTAGDIAGDTWNTSKVRATLLGISPATQARVKIVTYGNVTYVMGILT
PEEQAQITQKVSTTVGVQKVITLYQNYVQRGSGGGGVAADIGAGLADALT
APLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKND
KVSRFDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSG
KMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTID
FAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGS
YSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ SEQ ID NO: 6
ATNDDDVKKAATVAIAAAYNNGQEINGFKAGETIYDIDEDGTITKKDATA
ADVEADDFKGLGLKKVVTNLTKTVNENKQNVDAKVKAAESEIEKLTTKLA
DTDAALADTDAALDATTNALNKLGENITTFAEETKTNIVKIDEKLEAVAD
TVDKHAEAFNDIADSLDETNTKADEAVKTANEAKQTAEETKQNVDAKVKA
AETAAGKAEAAAGTANTAADKAEAVAAKVTDIKADIATNKDNIAKKANSA
DVYTREESDSKFVRIDGLNATTEKLDTRLASAEKSIADHDTRLNGLDKTV
SDLRKETRQGLAEQAALSGLFQPYNVG.
Bacterial Vesicle Antigens
The immunogenic compositions as disclosed herein may include outer
membrane vesicles. Such outer membrane vesicles may be obtained
from a wide array of pathogenic bacteria and used as antigenic
components of the immunogenic compositions as disclosed herein.
Vesicles for use as antigenic components of such immunogenic
compositions include any proteoliposomic vesicle obtained by
disrupting a bacterial outer membrane to form vesicles therefrom
that include protein components of the outer membrane. Thus the
term includes OMVs (sometimes referred to as `blebs`),
microvesicles (MVs, see, e.g., WO02/09643) and `native OMVs`
(`NOMVs` see, e.g., Katial et al. (2002) Infect. Immun.
70:702-707). Immunogenic compositions as disclosed herein that
include vesicles from one or more pathogenic bacteria can be used
in the treatment or prevention of infection by such pathogenic
bacteria and related diseases and disorders.
MVs and NOMVs are naturally-occurring membrane vesicles that form
spontaneously during bacterial growth and are released into culture
medium. MVs can be obtained by culturing bacteria such as Neisseria
in broth culture medium, separating whole cells from the smaller
MVs in the broth culture medium (e.g., by filtration or by
low-speed centrifugation to pellet only the cells and not the
smaller vesicles), and then collecting the MVs from the
cell-depleted medium (e.g., by filtration, by differential
precipitation or aggregation of MVs, by high-speed centrifugation
to pellet the MVs). Strains for use in production of MVs can
generally be selected on the basis of the amount of MVs produced in
culture (see, e.g., U.S. Pat. No. 6,180,111 and WO01/34642
describing Neisseria with high MV production).
OMVs are prepared artificially from bacteria, and may be prepared
using detergent treatment (e.g., with deoxycholate), or by non
detergent means (see, e.g., WO04/019977). Methods for obtaining
suitable OMV preparations are well known in the art. Techniques for
forming OMVs include treating bacteria with a bile acid salt
detergent (e.g., salts of lithocholic acid, chenodeoxycholic acid,
ursodeoxycholic acid, deoxycholic acid, cholic acid, ursocholic
acid, etc., with sodium deoxycholate (EP0011243 and Fredriksen et
al. (1991) NIPH Ann. 14(2):67-80) being preferred for treating
Neisseria) at a pH sufficiently high not to precipitate the
detergent (see, e.g., WO01/91788). Other techniques may be
performed substantially in the absence of detergent (see, e.g.,
WO04/019977) using techniques such as sonication, homogenisation,
microfluidisation, cavitation, osmotic shock, grinding, French
press, blending, etc. Methods using no or low detergent can retain
useful antigens such as NspA in Neisserial OMVs. Thus a method may
use an OMV extraction buffer with about 0.5% deoxycholate or lower,
e.g., about 0.2%, about 0.1%, <0.05% or zero.
A useful process for OMV preparation is described in WO05/004908
and involves ultrafiltration on crude OMVs, rather than instead of
high speed centrifugation. The process may involve a step of
ultracentrifugation after the ultrafiltration takes place.
Vesicles can be prepared from any pathogenic strain such as
Neisseria minigtidis for use with the invention. Vessicles from
Neisserial meningitidis serogroup B may be of any serotype (e.g.,
1, 2a, 2b, 4, 14, 15, 16, etc.), any serosubtype, and any
immunotype (e.g., L1; L2; L3; L3,3,7; L10; etc.). The meningococci
may be from any suitable lineage, including hyperinvasive and
hypervirulent lineages, e.g., any of the following seven
hypervirulent lineages: subgroup I; subgroup III; subgroup IV 1; ET
5 complex; ET 37 complex; A4 cluster; lineage 3. These lineages
have been defined by multilocus enzyme electrophoresis (MLEE), but
multilocus sequence typing (MLST) has also been used to classify
meningococci, e.g., the ET 37 complex is the ST 11 complex by MLST,
the ET 5 complex is ST-32 (ET-5), lineage 3 is ST 41/44, etc.
Vesicles can be prepared from strains having one of the following
subtypes: P1.2; P1.2,5; P1.4; P1.5; P1.5,2; P1.5,c; P1.5c,10;
P1.7,16; P1.7,16b; P1.7h,4; P1.9; P1.15; P1.9,15; P1.12,13; P1.13;
P1.14; P1.21,16; P1.22,14.
Vesicles included in the immunogenic compositions disclosed herein
may be prepared from wild type pathogenic strains such as N.
meningitidis strains or from mutant strains. By way of example,
WO98/56901 discloses preparations of vesicles obtained from N.
meningitidis with a modified fur gene. WO02/09746 teaches that nspA
expression should be up regulated with concomitant porA and cps
knockout. Further knockout mutants of N. meningitidis for OMV
production are disclosed in WO02/0974, WO02/062378, and
WO04/014417. WO06/081259 discloses vesicles in which fHBP is
upregulated. Claassen et al. (1996) 14(10):1001-8, disclose the
construction of vesicles from strains modified to express six
different PorA subtypes. Mutant Neisseria with low endotoxin
levels, achieved by knockout of enzymes involved in LPS
biosynthesis, may also be used (see, e.g., WO99/10497 and Steeghs
et al. (2001) i20:6937-6945). These or others mutants can all be
used with the invention.
Thus N. meningitidis serogroup B strains included in the
immunogenic compositions disclosed herein may in some embodiments
express more than one PorA subtype. Six valent and nine valent PorA
strains have previously been constructed. The strain may express 2,
3, 4, 5, 6, 7, 8 or 9 of PorA subtypes: P1.7,16; P1.5-1, 2-2;
P1,19,15-1; P1.5-2,10; P1.12 1,13; P1.7-2,4; P1.22,14; P1.7-1,1
and/or P1.18-1,3,6. In other embodiments a strain may have been
down regulated for PorA expression, e.g., in which the amount of
PorA has been reduced by at least 20% (e.g., >30%, >40%,
>50%, >60%, >70%, >80%, >90%, >95%, etc.), or
even knocked out, relative to wild type levels (e.g., relative to
strain H44/76, as disclosed in WO03/105890).
In some embodiments N. meningitidis serogroup B strains may over
express (relative to the corresponding wild-type strain) certain
proteins. For instance, strains may over express NspA, protein 287
(WO01/52885--also referred to as NMB2132 and GNA2132), one or more
fHBP (WO06/081259 and U.S. Pat. Pub. 2008/0248065--also referred to
as protein 741, NMB1870 and GNA1870), TbpA and/or TbpB
(WO00/25811), Cu,Zn-superoxide dismutase (WO00/25811), etc.
In some embodiments N. meningitidis serogroup B strains may include
one or more of the knockout and/or over expression mutations.
Preferred genes for down regulation and/or knockout include: (a)
Cps, CtrA, CtrB, CtrC, CtrD, FrpB, GalE, HtrB/MsbB, LbpA, LbpB,
LpxK, Opa, Opc, PilC, PorB, SiaA, SiaB, SiaC, SiaD, TbpA, and/or
TbpB (WO01/09350); (b) CtrA, CtrB, CtrC, CtrD, FrpB, GalE,
HtrB/MsbB, LbpA, LbpB, LpxK, Opa, Opc, PhoP, PilC, PmrE, PmrF,
SiaA, SiaB, SiaC, SiaD, TbpA, and/or TbpB (WO02/09746); (c) ExbB,
ExbD, rmpM, CtrA, CtrB, CtrD, GalE, LbpA, LpbB, Opa, Opc, PilC,
PorB, SiaA, SiaB, SiaC, SiaD, TbpA, and/or TbpB (WO02/062378); and
(d) CtrA, CtrB, CtrD, FrpB, OpA, OpC, PilC, PorB, SiaD, SynA, SynB,
and/or SynC (WO04/014417).
Where a mutant strain is used, in some embodiments it may have one
or more, or all, of the following characteristics: (i) down
regulated or knocked-out LgtB and/or GalE to truncate the
meningococcal LOS; (ii) up regulated TbpA; (iii) up regulated Hsf;
(iv) up regulated Omp85; (v) up regulated LbpA; (vi) up regulated
NspA; (vii) knocked-out PorA; (viii) down regulated or knocked-out
FrpB; (ix) down regulated or knocked-out Opa; (x) down regulated or
knocked-out Opc; (xii) deleted cps gene complex. A truncated LOS
can be one that does not include a sialyl-lacto-N-neotetraose
epitope, e.g., it might be a galactose-deficient LOS. The LOS may
have no a chain.
If LOS is present in a vesicle then it is possible to treat the
vesicle so as to link its LOS and protein components ("intra-bleb"
conjugation (WO04/014417)).
The immunogenic compositions as disclosed herein may include
mixtures of vesicles from different strains. By way of example,
WO03/105890 discloses vaccine comprising multivalent meningococcal
vesicle compositions, comprising a first vesicle derived from a
meningococcal strain with a serosubtype prevalent in a country of
use, and a second vesicle derived from a strain that need not have
a serosubtype prevent in a country of use. WO06/024946 discloses
useful combinations of different vesicles. A combination of
vesicles from strains in each of the L2 and L3 immunotypes may be
used in some embodiments.
Vesicle-based antigens can be prepared from N. meningitidis
serogroups other than serogroup B (e.g., WO01/91788 discloses a
process for serogroup A). The immunogenic compositions disclosed
herein accordingly can include vesicles prepared serogroups other
than B (e.g. A, C, W135 and/or Y) and from bacterial pathogens
other than Neisseria.
Viral Antigens
Viral antigens suitable for use in the immunogenic compositions
provided herein include, but are not limited to, inactivated (or
killed) virus, attenuated virus, split virus formulations, purified
subunit formulations, viral proteins which may be isolated,
purified or derived from a virus, Virus Like Particles (VLPs) and
polynucleotide antigens which may be isolated, purified or derived
from a virus or recombinantly synthesized. In certain embodiments,
viral antigens are derived from viruses propagated on cell culture
or other substrate. In other embodiments, viral antigens are
expressed recombinantly. In certain embodiments, viral antigens
preferably include epitopes which are exposed on the surface of the
virus during at least one stage of its life cycle. Viral antigens
are preferably conserved across multiple serotypes or isolates.
Viral antigens suitable for use in the immunogenic compositions
provided herein include, but are not limited to, antigens derived
from one or more of the viruses set forth below as well as the
specific antigens examples identified below. Orthomyxovirus: Viral
antigens include, but are not limited to, those derived from an
Orthomyxovirus, such as Influenza A, B and C. In certain
embodiments, orthomyxovirus antigens are selected from one or more
of the viral proteins, including hemagglutinin (HA), neuraminidase
(NA), nucleoprotein (NP), matrix protein (M1), membrane protein
(M2), one or more of the transcriptase components (PB1, PB2 and
PA). In certain embodiments the viral antigen include HA and NA. In
certain embodiments, the influenza antigens are derived from
interpandemic (annual) flu strains, while in other embodiments, the
influenza antigens are derived from strains with the potential to
cause pandemic a pandemic outbreak (i.e., influenza strains with
new haemagglutinin compared to the haemagglutinin in currently
circulating strains, or influenza strains which are pathogenic in
avian subjects and have the potential to be transmitted
horizontally in the human population, or influenza strains which
are pathogenic to humans). Paramyxoviridae viruses: Viral antigens
include, but are not limited to, those derived from Paramyxoviridae
viruses, such as Pneumoviruses (RSV), Paramyxoviruses (PIV),
Metapneumovirus and Morbilliviruses (Measles). Pneumovirus: Viral
antigens include, but are not limited to, those derived from a
Pneumovirus, such as Respiratory syncytial virus (RSV), Bovine
respiratory syncytial virus, Pneumonia virus of mice, and Turkey
rhinotracheitis virus. Preferably, the Pneumovirus is RSV. In
certain embodiments, pneumovirus antigens are selected from one or
more of the following proteins, including surface proteins Fusion
(F), Glycoprotein (G) and Small Hydrophobic protein (SH), matrix
proteins M and M2, nucleocapsid proteins N, P and L and
nonstructural proteins NS1 and NS2. In other embodiments,
pneumovirus antigens include F, G and M. In certain embodiments,
pneumovirus antigens are also formulated in or derived from
chimeric viruses, such as, by way of example only, chimeric RSV/PIV
viruses comprising components of both RSV and PIV. Paramyxovirus:
Viral antigens include, but are not limited to, those derived from
a Paramyxovirus, such as Parainfluenza virus types 1-4 (PIV),
Mumps, Sendai viruses, Simian virus 5, Bovine parainfluenza virus,
Nipahvirus, Henipavirus and Newcastle disease virus. In certain
embodiments, the Paramyxovirus is PIV or Mumps. In certain
embodiments, paramyxovirus antigens are selected from one or more
of the following proteins: Hemagglutinin-Neuraminidase (HN), Fusion
proteins F1 and F2, Nucleoprotein (NP), Phosphoprotein (P), Large
protein (L), and Matrix protein (M). In other embodiments,
paramyxovirus proteins include HN, F1 and F2. In certain
embodiments, paramyxovirus antigens are also formulated in or
derived from chimeric viruses, such as, by way of example only,
chimeric RSV/PIV viruses comprising components of both RSV and PIV.
Commercially available mumps vaccines include live attenuated mumps
virus, in either a monovalent form or in combination with measles
and rubella vaccines (MMR). In other embodiments, the Paramyxovirus
is Nipahvirus or Henipavirus and the anitgens are selected from one
or more of the following proteins: Fusion (F) protein, Glycoprotein
(G) protein, Matrix (M) protein, Nucleocapsid (N) protein, Large
(L) protein and Phosphoprotein (P). Poxyiridae: Viral antigens
include, but are not limited to, those derived from Orthopoxvirus
such as Variola vera, including but not limited to, Variola major
and Variola minor. Metapneumovirus: Viral antigens include, but are
not limited to, Metapneumovirus, such as human metapneumovirus
(hMPV) and avian metapneumoviruses (aMPV). In certain embodiments,
metapneumovirus antigens are selected from one or more of the
following proteins, including surface proteins Fusion (F),
Glycoprotein (G) and Small Hydrophobic protein (SH), matrix
proteins M and M2, nucleocapsid proteins N, P and L. In other
embodiments, metapneumovirus antigens include F, G and M. In
certain embodiments, metapneumovirus antigens are also formulated
in or derived from chimeric viruses. Morbillivirus: Viral antigens
include, but are not limited to, those derived from a
Morbillivirus, such as Measles. In certain embodiments,
morbillivirus antigens are selected from one or more of the
following proteins: hemagglutinin (H), Glycoprotein (G), Fusion
factor (F), Large protein (L), Nucleoprotein (NP), Polymerase
phosphoprotein (P), and Matrix (M). Commercially available measles
vaccines include live attenuated measles virus, typically in
combination with mumps and rubella (MMR). Picornavirus: Viral
antigens include, but are not limited to, those derived from
Picornaviruses, such as Enteroviruses, Rhinoviruses, Heparnavirus,
Cardioviruses and Aphthoviruses. In certain embodiments, the
antigens are derived from Enteroviruses, while in other embodiments
the enterovirus is Poliovirus. In still other embodiments, the
antigens are derived from Rhinoviruses. In certain embodiments, the
antigens are formulated into virus-like particles (VLPs).
Enterovirus: Viral antigens include, but are not limited to, those
derived from an Enterovirus, such as Poliovirus types 1, 2 or 3,
Coxsackie A virus types 1 to 22 and 24, Coxsackie B virus types 1
to 6, Echovirus (ECHO) virus) types 1 to 9, 11 to 27 and 29 to 34
and Enterovirus 68 to 71. In certain embodiments, the antigens are
derived from Enteroviruses, while in other embodiments the
enterovirus is Poliovirus. In certain embodiments, the enterovirus
antigens are selected from one or more of the following Capsid
proteins VP0, VP1, VP2, VP3 and VP4. Commercially available polio
vaccines include Inactivated Polio Vaccine (IPV) and Oral
poliovirus vaccine (OPV). In certain embodiments, the antigens are
formulated into virus-like particles. Bunyavirus: Viral antigens
include, but are not limited to, those derived from an
Orthobunyavirus, such as California encephalitis virus, a
Phlebovirus, such as Rift Valley Fever virus, or a Nairovirus, such
as Crimean-Congo hemorrhagic fever virus. Rhinovirus: Viral
antigens include, but are not limited to, those derived from
rhinovirus. In certain embodiments, the rhinovirus antigens are
selected from one or more of the following Capsid proteins: VP0,
VP1, VP2, VP2 and VP4. In certain embodiments, the antigens are
formulated into virus-like particles (VLPs). Heparnavirus: Viral
antigens include, but are not limited to, those derived from a
Heparnavirus, such as, by way of example only, Hepatitis A virus
(HAV). Commercially available HAV vaccines include inactivated HAV
vaccine. Togavirus: Viral antigens include, but are not limited to,
those derived from a Togavirus, such as a Rubivirus, an Alphavirus,
or an Arterivirus. In certain embodiments, the antigens are derived
from Rubivirus, such as by way of example only, Rubella virus. In
certain embodiments, the togavirus antigens are selected from E1,
E2, E3, C, NSP-1, NSPO-2, NSP-3 or NSP-4. In certain embodiments,
the togavirus antigens are selected from E1, E2 or E3. Commercially
available Rubella vaccines include a live cold-adapted virus,
typically in combination with mumps and measles vaccines (MMR).
Flavivirus: Viral antigens include, but are not limited to, those
derived from a Flavivirus, such as Tick-borne encephalitis (TBE)
virus, Dengue (types 1, 2, 3 or 4) virus, Yellow Fever virus,
Japanese encephalitis virus, Kyasanur Forest Virus, West Nile
encephalitis virus, St. Louis encephalitis virus, Russian
spring-summer encephalitis virus, Powassan encephalitis virus. In
certain embodiments, the flavivirus antigens are selected from PrM,
M, C, E, NS-1, NS-2a, NS2b, NS3, NS4a, NS4b, and NS5. In certain
embodiments, the flavivirus antigens are selected from PrM, M and
E. Commercially available TBE vaccine includes inactivated virus
vaccines. In certain embodiments, the antigens are formulated into
virus-like particles (VLPs). Pestivirus: Viral antigens include,
but are not limited to, those derived from a Pestivirus, such as
Bovine viral diarrhea (BVDV), Classical swine fever (CSFV) or
Border disease (BDV). Hepadnavirus: Viral antigens include, but are
not limited to, those derived from a Hepadnavirus, such as
Hepatitis B virus. In certain embodiments, the hepadnavirus
antigens are selected from surface antigens (L, M and S), core
antigens (HBc, HBe). Commercially available HBV vaccines include
subunit vaccines comprising the surface antigen S protein.
Hepatitis C virus: Viral antigens include, but are not limited to,
those derived from a Hepatitis C virus (HCV). In certain
embodiments, the HCV antigens are selected from one or more of E1,
E2, E1/E2, NS345 polyprotein, NS 345-core polyprotein, core, and/or
peptides from the nonstructural regions. In certain embodiments,
the Hepatitis C virus antigens include one or more of the
following: HCV E1 and or E2 proteins, E1/E2 heterodimer complexes,
core proteins and non-structural proteins, or fragments of these
antigens, wherein the non-structural proteins can optionally be
modified to remove enzymatic activity but retain immunogenicity. In
certain embodiments, the antigens are formulated into virus-like
particles (VLPs). Rhabdovirus: Viral antigens include, but are not
limited to, those derived from a Rhabdovirus, such as a Lyssavirus
(Rabies virus) and Vesiculovirus (VSV). Rhabdovirus antigens may be
selected from glycoprotein (G), nucleoprotein (N), large protein
(L), nonstructural proteins (NS). Commercially available Rabies
virus vaccine comprise killed virus grown on human diploid cells or
fetal rhesus lung cells. Caliciviridae; Viral antigens include, but
are not limited to, those derived from Calciviridae, such as
Norwalk virus, and Norwalk-like Viruses, such as Hawaii Virus and
Snow Mountain Virus. In certain embodiments, the antigens are
formulated into virus-like particles (VLPs). Coronavirus: Viral
antigens include, but are not limited to, those derived from a
Coronavirus, SARS, Human respiratory coronavirus, Avian infectious
bronchitis (IBV), Mouse hepatitis virus (MHV), and Porcine
transmissible gastroenteritis virus (TGEV). In certain embodiments,
the coronavirus antigens are selected from spike (S), envelope (E),
matrix (M), nucleocapsid (N), and Hemagglutinin-esterase
glycoprotein (HE). In certain embodiments, the coronavirus antigen
is derived from a SARS virus. In certain embodiments, the
coronavirus is derived from a SARS viral antigen as described in WO
04/92360. Retrovirus: Viral antigens include, but are not limited
to, those derived from a Retrovirus, such as an Oncovirus, a
Lentivirus or a Spumavirus. In certain embodiments, the oncovirus
antigens are derived from HTLV-1, HTLV-2 or HTLV-5. In certain
embodiments, the lentivirus antigens are derived from HIV-1 or
HIV-2. In certain embodiments, the antigens are derived from HIV-1
subtypes (or clades), including, but not limited to, HIV-1 subtypes
(or clades) A, B, C, D, F, G, H, J, K, O. In other embodiments, the
antigens are derived from HIV-1 circulating recombinant forms
(CRFs), including, but not limited to, A/B, A/E, A/G, A/G/I, etc.
In certain embodiments, the retrovirus antigens are selected from
gag, pol, env, tax, tat, rex, rev, nef, vif, vpu, and vpr. In
certain embodiments, the HIV antigens are selected from gag (p24gag
and p55gag), env (gp160 and gp41), po1, tat, nef, rev vpu,
miniproteins, (preferably p55 gag and gp140v delete). In certain
embodiments, the HIV antigens are derived from one or more of the
following strains: HIV.sub.IIIb, HIV.sub.SF2, HIV.sub.LAV,
HIV.sub.LAI, HIV.sub.MN, HIV-1.sub.CM235, HIV-1.sub.US4,
HIV-1.sub.SF162, HIV-1.sub.TV1, HIV-1.sub.MJ4. In certain
embodiments, the antigens are derived from endogenous human
retroviruses, including, but not limited to, HERV-K ("old" HERV-K
and "new" HERV-K). Reovirus: Viral antigens include, but are not
limited to, those derived from a Reovirus, such as an
Orthoreovirus, a Rotavirus, an Orbivirus, or a Coltivirus. In
certain embodiments, the reovirus antigens are selected from
structural proteins .lamda.1, .lamda.2, .lamda.3, .mu.1, .mu.2,
.sigma.1, .sigma.2, or .sigma.3, or nonstructural proteins
.sigma.NS, .mu.NS, or .sigma.1s. In certain embodiments, the
reovirus antigens are derived from a Rotavirus. In certain
embodiments, the rotavirus antigens are selected from VP1, VP2,
VP3, VP4 (or the cleaved product VP5 and VP8), NSP 1, VP6, NSP3,
NSP2, VP7, NSP4, or NSP5. In certain embodiments, the rotavirus
antigens include VP4 (or the cleaved product VP5 and VP8), and VP7.
Parvovirus: Viral antigens include, but are not limited to, those
derived from a Parvovirus, such as Parvovirus B19. In certain
embodiments, the Parvovirus antigens are selected from VP-1, VP-2,
VP-3, NS-1 and NS-2. In certain embodiments, the Parvovirus antigen
is capsid protein VP1 or VP-2. In certain embodiments, the antigens
are formulated into virus-like particles (VLPs). Delta hepatitis
virus (HDV): Viral antigens include, but are not limited to, those
derived from HDV, particularly .delta.-antigen from HDV. Hepatitis
E virus (HEV): Viral antigens include, but are not limited to,
those derived from HEV. Hepatitis G virus (HGV): Viral antigens
include, but are not limited to, those derived from HGV. Human
Herpesvirus Viral antigens include, but are not limited to, those
derived from a Human Herpesvirus, such as, by way of example only,
Herpes Simplex Viruses (HSV), Varicella-zoster virus (VZV),
Epstein-Barr virus (EBV), Cytomegalovirus (CMV), Human Herpesvirus
6 (HHV6), Human Herpesvirus 7 (HHV7), and Human Herpesvirus 8
(HHV8). In certain embodiments, the Human Herpesvirus antigens are
selected from immediate early proteins (.alpha.), early proteins
(.beta.), and late proteins (.gamma.). In certain embodiments, the
HSV antigens are derived from HSV-1 or HSV-2 strains. In certain
embodiments, the HSV antigens are selected from glycoproteins gB,
gC, gD and gH, fusion protein (gB), or immune escape proteins (gC,
gE, or gI). In certain embodiments, the VZV antigens are selected
from core, nucleocapsid, tegument, or envelope proteins. A live
attenuated VZV vaccine is commercially available. In certain
embodiments, the EBV antigens are selected from early antigen (EA)
proteins, viral capsid antigen (VCA), and glycoproteins of the
membrane antigen (MA). In certain embodiments, the CMV antigens are
selected from capsid proteins, envelope glycoproteins (such as gB
and gH), and tegument proteins. In other embodiments, CMV antigens
may be selected from one or more of the following proteins: pp65,
IE1, gB, gD, gH, gL, gM, gN, gO, UL128, UL129, gUL130, UL150,
UL131, UL33, UL78, US27, US28, RL5A, RL6, RL10, RL11, RL12, RL13,
UL1, UL2, UL4, UL5, UL6, UL7, UL8, UL9, UL10, UL11, UL14, UL15A,
UL16, UL17, UL18, UL22A, UL38, UL40, UL41A, UL42, UL116, UL119,
UL120, UL121, UL124, UL132, UL147A, UL148, UL142, UL144, UL141,
UL140, UL135, UL136, UL138, UL139, UL133, UL135, UL148A, UL148B,
UL148C, UL148D, US2, US3, US6, US7, USB, US9, US10, US11, US12,
US13, US14, US15, US16, US17, US18, US19, US20, US21, US29, US30
and US34A. CMV antigens may also be fusions of one or more CMV
proteins, such as, by way of example only, pp65/IE1 (Reap et al.,
Vaccine (2007) 25:7441-7449). In certain embodiments, the antigens
are formulated into virus-like particles (VLPs). Papovaviruses:
Antigens include, but are not limited to, those derived from
Papovaviruses, such as Papillomaviruses and Polyomaviruses. In
certain embodiments, the Papillomaviruses include HPV serotypes 1,
2, 4, 5, 6, 8, 11, 13, 16, 18, 31, 33, 35, 39, 41, 42, 47, 51, 57,
58, 63 and 65. In certain embodiments, the HPV antigens are derived
from serotypes 6, 11, 16 or 18. In certain embodiments, the HPV
antigens are selected from capsid proteins (L1) and (L2), or E1-E7,
or fusions thereof. In certain embodiments, the HPV antigens are
formulated into virus-like particles (VLPs). In certain
embodiments, the Polyomyavirus viruses include BK virus and JK
virus. In certain embodiments, the Polyomavirus antigens are
selected from VP1, VP2 or VP3. Adenovirus: Antigens include those
derived from Adenovirus. In certain embodiments, the Adenovirus
antigens are derived from Adenovirus serotype 36 (Ad-36). In
certain embodiments, the antigen is derived from a protein or
peptide sequence encoding an Ad-36 coat protein or fragment thereof
(WO 2007/120362).
Further provided are antigens, compositions, methods, and microbes
included in Vaccines, 4.sup.th Edition (Plotkin and Orenstein ed.
2004); Medical Microbiology 4.sup.th Edition (Murray et al. ed.
2002); Virology, 3rd Edition (W. K. Joklik ed. 1988); Fundamental
Virology, 2nd Edition (B. N. Fields and D. M. Knipe, eds. 1991),
which are contemplated in conjunction with the immunogenic
compositions provided herein.
Fungal Antigens
Fungal antigens for use in the immunogenic compositions provided
herein include, but are not limited to, those derived from one or
more of the fungi set forth below. Fungal antigens are derived from
Dermatophytres, including: Epidermophyton floccusum, Microsporum
audouini, Microsporum canis, Microsporum distortum, Microsporum
equinum, Microsporum gypsum, Microsporum nanum, Trichophyton
concentricum, Trichophyton equinum, Trichophyton gallinae,
Trichophyton gypseum, Trichophyton megnini, Trichophyton
mentagrophytes, Trichophyton quinckeanum, Trichophyton rubrum,
Trichophyton schoenleini, Trichophyton tonsurans, Trichophyton
verrucosum, T. verrucosum var. album, var. discoides, var.
ochraceum, Trichophyton violaceum, and/or Trichophyton faviforme;
and Fungal pathogens are derived from Aspergillus fumigatus,
Aspergillus flavus, Aspergillus niger, Aspergillus nidulans,
Aspergillus terreus, Aspergillus sydowi, Aspergillus flavatus,
Aspergillus glaucus, Blastoschizomyces capitatus, Candida albicans,
Candida enolase, Candida tropicalis, Candida glabrata, Candida
krusei, Candida parapsilosis, Candida stellatoidea, Candida kusei,
Candida parakwsei, Candida lusitaniae, Candida pseudotropicalis,
Candida guilliermondi, Cladosporium carrionii, Coccidioides
immitis, Blastomyces dermatidis, Cryptococcus neoformans,
Geotrichum clavatum, Histoplasma capsulatum, Klebsiella pneumoniae,
Microsporidia, Encephalitozoon spp., Septata intestinalis and
Enterocytozoon bieneusi; the less common are Brachiola spp,
Microsporidium spp., Nosema spp., Pleistophora spp.,
Trachipleistophora spp., Vittaforma spp Paracoccidioides
brasiliensis, Pneumocystis carinii, Pythiumn insidiosum,
Pityrosporum ovale, Sacharomyces cerevisae, Saccharomyces
boulardii, Saccharomyces pombe, Scedosporium apiosperum, Sporothrix
schenckii, Trichosporon beigelii, Toxoplasma gondii, Penicillium
marneffei, Malassezia spp., Fonsecaea spp., Wangiella spp.,
Sporothrix spp., Basidiobolus spp., Conidiobolus spp., Rhizopus
spp, Mucor spp, Absidia spp, Mortierella spp, Cunninghamella spp,
Saksenaea spp., Alternaria spp, Curvularia spp, Helminthosporium
spp, Fusarium spp, Aspergillus spp, Penicillium spp, Monolinia spp,
Rhizoctonia spp, Paecilomyces spp, Pithomyces spp, and Cladosporium
spp.
In certain embodiments, the process for producing a fungal antigen
includes a method wherein a solubilized fraction extracted and
separated from an insoluble fraction obtainable from fungal cells
of which cell wall has been substantially removed or at least
partially removed, characterized in that the process comprises the
steps of: obtaining living fungal cells; obtaining fungal cells of
which cell wall has been substantially removed or at least
partially removed; bursting the fungal cells of which cell wall has
been substantially removed or at least partially removed; obtaining
an insoluble fraction; and extracting and separating a solubilized
fraction from the insoluble fraction.
Protazoan Antigens/Pathogens
Protazoan antigens/pathogens for use in the immunogenic
compositions provided herein include, but are not limited to, those
derived from one or more of the following protozoa: Entamoeba
histolytica, Giardia lambli, Cryptosporidium parvum, Cyclospora
cayatanensis and Toxoplasma.
Plant Antigens/Pathogens
Plant antigens/pathogens for use in the immunogenic compositions
provided herein include, but are not limited to, those derived from
Ricinus communis.
STD Antigens
In certain embodiments, the immunogenic compositions provided
herein include one or more antigens derived from a sexually
transmitted disease (STD). In certain embodiments, such antigens
provide for prophylactis for STD's such as chlamydia, genital
herpes, hepatitis (such as HCV), genital warts, gonorrhea, syphilis
and/or chancroid. In other embodiments, such antigens provide for
therapy for STD's such as chlamydia, genital herpes, hepatitis
(such as HCV), genital warts, gonorrhea, syphilis and/or chancroid.
Such antigens are derived from one or more viral or bacterial
STD's. In certain embodiments, the viral STD antigens are derived
from HIV, herpes simplex virus (HSV-1 and HSV-2), human
papillomavirus (HPV), and hepatitis (HCV). In certain embodiments,
the bacterial STD antigens are derived from Neiserria gonorrhoeae,
Chlamydia trachomatis, Treponema pallidum, Haemophilus ducreyi, E.
coli, and Streptococcus agalactiae. Examples of specific antigens
derived from these pathogens are described above.
Respiratory Antigens
In certain embodiments, the immunogenic compositions provided
herein include one or more antigens derived from a pathogen which
causes respiratory disease. By way of example only, such
respiratory antigens are derived from a respiratory virus such as
Orthomyxoviruses (influenza), Pneumovirus (RSV), Paramyxovirus
(PIV), Morbillivirus (measles), Togavirus (Rubella), VZV, and
Coronavirus (SARS). In certain embodiments, the respiratory
antigens are derived from a bacteria which causes respiratory
disease, such as, by way of example only, Streptococcus pneumoniae,
Pseudomonas aeruginosa, Bordetella pertussis, Mycobacterium
tuberculosis, Mycoplasma pneumoniae, Chlamydia pneumoniae, Bacillus
anthracis, and Moraxella catarrhalis. Examples of specific antigens
derived from these pathogens are described above.
Pediatric Vaccine Antigens
In certain embodiments, the immunogenic compositions provided
herein include one or more antigens suitable for use in pediatric
subjects. Pediatric subjects are typically less than about 3 years
old, or less than about 2 years old, or less than about 1 years
old. Pediatric antigens are administered multiple times over the
course of 6 months, 1, 2 or 3 years. Pediatric antigens are derived
from a virus which may target pediatric populations and/or a virus
from which pediatric populations are susceptible to infection.
Pediatric viral antigens include, but are not limited to, antigens
derived from one or more of Orthomyxovirus (influenza), Pneumovirus
(RSV), Paramyxovirus (PIV and Mumps), Morbillivirus (measles),
Togavirus (Rubella), Enterovirus (polio), HBV, Coronavirus (SARS),
and Varicella-zoster virus (VZV), Epstein Barr virus (EBV).
Pediatric bacterial antigens include antigens derived from one or
more of Streptococcus pneumoniae, Neisseria meningitides,
Streptococcus pyogenes (Group A Streptococcus), Moraxella
catarrhalis, Bordetella pertussis, Staphylococcus aureus,
Clostridium tetani (Tetanus), Cornynebacterium diphtheriae
(Diphtheria), Haemophilus influenzae B (Hib), Pseudomonas
aeruginosa, Streptococcus agalactiae (Group B Streptococcus), and
E. coli. Examples of specific antigens derived from these pathogens
are described above.
Antigens suitable for use in Elderly or Immunocompromised
Individuals
In certain embodiments, the immunogenic compositions provided
herein include one or more antigens suitable for use in elderly or
immunocompromised individuals. Such individuals may need to be
vaccinated more frequently, with higher doses or with adjuvanted
formulations to improve their immune response to the targeted
antigens. Antigens which are targeted for use in Elderly or
Immunocompromised individuals include antigens derived from one or
more of the following pathogens: Neisseria meningitides,
Streptococcus pneumoniae, Streptococcus pyogenes (Group A
Streptococcus), Moraxella catarrhalis, Bordetella pertussis,
Staphylococcus aureus, Staphylococcus epidermis, Clostridium tetani
(Tetanus), Cornynebacterium diphtheriae (Diphtheria), Haemophilus
influenzae B (Hib), Pseudomonas aeruginosa, Legionella pneumophila,
Streptococcus agalactiae (Group B Streptococcus), Enterococcus
faecalis, Helicobacter pylori, Chlamydia pneumoniae, Orthomyxovirus
(influenza), Pneumovirus (RSV), Paramyxovirus (PIV and Mumps),
Morbillivirus (measles), Togavirus (Rubella), Enterovirus (polio),
HBV, Coronavirus (SARS), Varicella-zoster virus (VZV), Epstein Barr
virus (EBV), Cytomegalovirus (CMV). Examples of specific antigens
derived from these pathogens are described above.
Antigens Suitable for Use in Adolescent Vaccines
In certain embodiments, the immunogenic compositions provided
herein include one or more antigens suitable for use in adolescent
subjects. Adolescents are in need of a boost of a previously
administered pediatric antigen. Pediatric antigens which are
suitable for use in adolescents are described above. In addition,
adolescents are targeted to receive antigens derived from an STD
pathogen in order to ensure protective or therapeutic immunity
before the beginning of sexual activity. STD antigens which are
suitable for use in adolescents are described above.
Tumor Antigens
In certain embodiments, a tumor antigen or cancer antigen is used
in conjunction with the immunogenic compositions provided herein.
In certain embodiments, the tumor antigens is a peptide-containing
tumor antigens, such as a polypeptide tumor antigen or glycoprotein
tumor antigens. In certain embodiments, the tumor antigen is a
saccharide-containing tumor antigen, such as a glycolipid tumor
antigen or a ganglioside tumor antigen. In certain embodiments, the
tumor antigen is a polynucleotide-containing tumor antigen that
expresses a polypeptide-containing tumor antigen, for instance, an
RNA vector construct or a DNA vector construct, such as plasmid
DNA.
Tumor antigens appropriate for the use in conjunction with the
immunogenic compositions provided herein encompass a wide variety
of molecules, such as (a) polypeptide-containing tumor antigens,
including polypeptides (which can range, for example, from 8-20
amino acids in length, although lengths outside this range are also
common), lipopolypeptides and glycoproteins, (b)
saccharide-containing tumor antigens, including poly-saccharides,
mucins, gangliosides, glycolipids and glycoproteins, and (c)
polynucleotides that express antigenic polypeptides.
In certain embodiments, the tumor antigens are, for example, (a)
full length molecules associated with cancer cells, (b) homologs
and modified forms of the same, including molecules with deleted,
added and/or substituted portions, and (c) fragments of the same.
In certain embodiments, the tumor antigens are provided in
recombinant form. In certain embodiments, the tumor antigens
include, for example, class I-restricted antigens recognized by
CD8+ lymphocytes or class II-restricted antigens recognized by CD4+
lymphocytes.
In certain embodiments, the tumor antigens include, but are not
limited to, (a) cancer-testis antigens such as NY-ESO-1, SSX2, SCP1
as well as RAGE, BAGE, GAGE and MAGE family polypeptides, for
example, GAGE-1, GAGE-2, MAGE-1, MAGE-2, MAGE-3, MAGE-4, MAGE-5,
MAGE-6, and MAGE-12 (which can be used, for example, to address
melanoma, lung, head and neck, NSCLC, breast, gastrointestinal, and
bladder tumors), (b) mutated antigens, for example, p53 (associated
with various solid tumors, e.g., colorectal, lung, head and neck
cancer), p21/Ras (associated with, e.g., melanoma, pancreatic
cancer and colorectal cancer), CDK4 (associated with, e.g.,
melanoma), MUM1 (associated with, e.g., melanoma), caspase-8
(associated with, e.g., head and neck cancer), CIA 0205 (associated
with, e.g., bladder cancer), HLA-A2-R1701, beta catenin (associated
with, e.g., melanoma), TCR (associated with, e.g., T-cell
non-Hodgkins lymphoma), BCR-abl (associated with, e.g., chronic
myelogenous leukemia), triosephosphate isomerase, KIA 0205, CDC-27,
and LDLR-FUT, (c) over-expressed antigens, for example, Galectin 4
(associated with, e.g., colorectal cancer), Galectin 9 (associated
with, e.g., Hodgkin's disease), proteinase 3 (associated with,
e.g., chronic myelogenous leukemia), WT 1 (associated with, e.g.,
various leukemias), carbonic anhydrase (associated with, e.g.,
renal cancer), aldolase A (associated with, e.g., lung cancer),
PRAME (associated with, e.g., melanoma), HER-2/neu (associated
with, e.g., breast, colon, lung and ovarian cancer),
alpha-fetoprotein (associated with, e.g., hepatoma), KSA
(associated with, e.g., colorectal cancer), gastrin (associated
with, e.g., pancreatic and gastric cancer), telomerase catalytic
protein, MUC-1 (associated with, e.g., breast and ovarian cancer),
G-250 (associated with, e.g., renal cell carcinoma), p53
(associated with, e.g., breast, colon cancer), and carcinoembryonic
antigen (associated with, e.g., breast cancer, lung cancer, and
cancers of the gastrointestinal tract such as colorectal cancer),
(d) shared antigens, for example, melanoma-melanocyte
differentiation antigens such as MART-1/Melan A, gp100, MC.sup.1R,
melanocyte-stimulating hormone receptor, tyrosinase, tyrosinase
related protein-1/TRP1 and tyrosinase related protein-2/TRP2
(associated with, e.g., melanoma), (e) prostate associated antigens
such as PAP, PSA, PSMA, PSH-P1, PSM-P1, PSM-P2, associated with
e.g., prostate cancer, (f) immunoglobulin idiotypes (associated
with myeloma and B cell lymphomas, for example), and (g) other
tumor antigens, such as polypeptide- and saccharide-containing
antigens including (i) glycoproteins such as sialyl Tn and sialyl
Le.sup.x (associated with, e.g., breast and colorectal cancer) as
well as various mucins; glycoproteins are coupled to a carrier
protein (e.g., MUC-1 are coupled to KLH); (ii) lipopolypeptides
(e.g., MUC-1 linked to a lipid moiety); (iii) polysaccharides
(e.g., Globo H synthetic hexasaccharide), which are coupled to a
carrier proteins (e.g., to KLH), (iv) gangliosides such as GM2,
GM12, GD2, GD3 (associated with, e.g., brain, lung cancer,
melanoma), which also are coupled to carrier proteins (e.g.,
KLH).
In certain embodiments, the tumor antigens include, but are not
limited to, p15, Hom/Me1-40, H-Ras, E2A-PRL, H4-RET, IGH-IGK,
MYL-RAR, Epstein Barr virus antigens, EBNA, human papillomavirus
(HPV) antigens, including E6 and E7, hepatitis B and C virus
antigens, human T-cell lymphotropic virus antigens, TSP-180,
p185erbB2, p180erbB-3, c-met, mn-23H1, TAG-72-4, CA 19-9, CA 72-4,
CAM 17.1, NuMa, K-ras, p16, TAGE, PSCA, CT7, 43-9F, 5T4, 791 Tgp72,
beta-HCG, BCA225, BTAA, CA 125, CA 15-3 (CA 27.29\BCAA), CA 195, CA
242, CA-50, CAM43, CD68\KP1, CO-029, FGF-5, Ga733 (EpCAM),
HTgp-175, M344, MA-50, MG7-Ag, MOV18, NB/70K, NY-CO-1, RCAS1,
SDCCAG16, TA-90 (Mac-2 binding protein\cyclophilin C-associated
protein), TAAL6, TAG72, TLP, TPS, and the like.
Polynucleotide-containing antigens used in conjunction with the
immunogenic compositions provided herein include polynucleotides
that encode polypeptide cancer antigens such as those listed above.
In certain embodiments, the polynucleotide-containing antigens
include, but are not limited to, DNA or RNA vector constructs, such
as plasmid vectors (e.g., pCMV), which are capable of expressing
polypeptide cancer antigens in vivo.
In certain embodiments, the tumor antigens are derived from mutated
or altered cellular components. After alteration, the cellular
components no longer perform their regulatory functions, and hence
the cell may experience uncontrolled growth. Representative
examples of altered cellular components include, but are not
limited to ras, p53, Rb, altered protein encoded by the Wilms'
tumor gene, ubiquitin, mucin, protein encoded by the DCC, APC, and
MCC genes, as well as receptors or receptor-like structures such as
neu, thyroid hormone receptor, platelet derived growth factor
(PDGF) receptor, insulin receptor, epidermal growth factor (EGF)
receptor, and the colony stimulating factor (CSF) receptor.
Additionally, bacterial and viral antigens, are used in conjunction
with the immunogenic compositions provided herein for the treatment
of cancer. In certain embodiments, the, carrier proteins, such as
CRM.sub.197, tetanus toxoid, or Salmonella typhimurium antigen are
used in conjunction/conjugation with compounds provided herein for
treatment of cancer. The cancer antigen combination therapies will
show increased efficacy and bioavailability as compared with
existing therapies.
In certain embodiments, the immunogenic compositions containing at
least one compound of Formula (I) include capsular saccharides from
at least two of serogroups A, C, W135 and Y of Neisseria
meningitides. In other embodiments, such vaccines further comprise
an antigen from one or more of the following: (a) serogroup B N.
meningitidis; (b) Haemophilus influenzae type B; and/or (c)
Streptococcus pneumoniae.
In certain embodiments the immunogenic compositions containing at
least one compound of Formula (I) include serogroups C, W135 &
Y of N. meningitides. In certain embodiments the immunogenic
compositions containing at least one compound of Formula (I)
include serogroups A, C, W135 & Y of N. meningitides. In
certain embodiments the immunogenic compositions containing at
least one compound of Formula (I) include serogroups B, C, W135
& Y of N. meningitides. In certain embodiments the immunogenic
compositions containing at least one compound of Formula (I)
include serogroups A, B, C, W135 & Y of N. meningitides. In
certain embodiments the immunogenic compositions containing at
least one compound of Formula (I) include H. influenzae type B and
serogroups C, W135 & Y of N. meningitides. In certain
embodiments the immunogenic compositions containing at least one
compound of Formula (I) include H. influenzae type B and serogroups
A, C, W135 & Y of N. meningitides. In certain embodiments the
immunogenic compositions containing at least one compound of
Formula (I) include H. influenzae type B and serogroups B, C, W135
& Y of N. meningitides. In certain embodiments the immunogenic
compositions containing at least one compound of Formula (I)
include H. influenzae type B and serogroups A, B, C, W135 & Y
of N. meningitides. In certain embodiments the immunogenic
compositions containing at least one compound of Formula (I)
include S. pneumoniae and serogroups C, W135 & Y of N.
meningitides. In certain embodiments the immunogenic compositions
containing at least one compound of Formula (I) include S.
pneumoniae and serogroups A, C, W135 & Y of N. meningitides. In
certain embodiments the immunogenic compositions containing at
least one compound of Formula (I) include S. pneumoniae and
serogroups B, C, W135 & Y of N. meningitides. In certain
embodiments the immunogenic compositions containing at least one
compound of Formula (I) include S. pneumoniae and serogroups A, B,
C, W135 & Y of N. meningitides. In certain embodiments the
immunogenic compositions containing at least one compound of
Formula (I) include H. influenzae type B, S. pneumoniae and
serogroups C, W135 & Y of N. meningitides. In certain
embodiments the immunogenic compositions containing at least one
compound of Formula (I) include H. influenzae type B, S. pneumoniae
and serogroups A, C, W135 & Y of N. meningitides. In certain
embodiments the immunogenic compositions containing at least one
compound of Formula (I) include H. influenzae type B, S. pneumoniae
and serogroups B, C, W135 & Y of N. meningitides. In certain
embodiments the immunogenic compositions containing at least one
compound of Formula (I) include H. influenzae type B, S. pneumoniae
and serogroups A, B, C, W135 & Y of N. meningitidis.
Kits
Also provided herein are pharmaceutical packs or kits that include
one or more containers containing a compound of Formula (I) useful
for the treatment or prevention of a disease or disorder associated
with toll-like receptors. In other embodiments, the such
pharmaceutical packs or kits include one or more containers
containing a compound of Formula (I) useful for the treatment or
prevention of a disease or disorder associated with toll-like
receptors and one or more containers containing an additional
therapeutic agent, including but not limited to those listed above.
In certain embodiments, such pharmaceutical packs or kits
optionally include instructions for its administration of a
compound of Formula (I) as disclosed herein. In some embodiments of
such kits, the compound of Formula (I) is provided in the form of a
vaccine composition as described herein, and optionally includes a
syringe for injecting a subject with the vaccine composition
Methods of Treatment, Prevention and Administration of Vaccines
The immunogenic compositions as disclosed herein may be used in
conjunction with vaccines to improve the immunogenicity of the
vaccine or where the immunogenic composition includes one or more
antigens, the immunogenic composition may be used as a vaccine.
Therefore in certain embodiment, the immunogenic compositions
disclosed herein may be used in a method for raising or enhancing
an immune response in a mammal comprising the step of administering
an effective amount of an immunogenic composition as disclosed
herein. The immune response is preferably protective and preferably
involves antibodies and/or cell-mediated immunity. The method may
raise a booster response.
In certain embodiments, the immunogenic compositions disclosed
herein may be used as a medicament, e.g., for use in raising or
enhancing an immune response in a mammal.
In certain embodiments, the immunogenic compositions disclosed
herein may be used in the manufacture of a medicament for raising
an immune response in a mammal.
The invention also provides a delivery device pre-filled with an
immunogenic composition disclosed herein.
By raising an immune response in the mammal by these uses and
methods, the mammal can be infection by pathogens comprising the
antigen included in the immunogenic composition or administered in
conjunction with the immunogenic composition can be reduced or even
prevented. The mammal is preferably a human, but may be, e.g., a
cow, a pig, a chicken, a cat or a dog, as the pathogens covered
herein may be problematic across a wide range of species. Where the
vaccine is for prophylactic use, the human is preferably a child
(e.g., a toddler or infant) or a teenager; where the vaccine is for
therapeutic use, the human is preferably a teenager or an adult. A
vaccine intended for children may also be administered to adults,
e.g., to assess safety, dosage, immunogenicity, etc.
One way of checking efficacy of therapeutic treatment involves
monitoring pathogen infection after administration of the
immunogenic compositions disclosed herein. One way of checking
efficacy of prophylactic treatment involves monitoring immune
responses, systemically (such as monitoring the level of IgG1 and
IgG2a production) and/or mucosally (such as monitoring the level of
IgA production), against the antigens included in or administered
in conjunction with the immunogenic compositions disclosed herein
after administration of the immunogenic composition (and the
antigen if administered separately). Typically, antigen-specific
serum antibody responses are determined post-immunisation but
pre-challenge whereas antigen-specific mucosal antibody responses
are determined post-immunisation and post-challenge.
Another way of assessing the immunogenicity of the immunogenic
compositions disclosed herein where the antigen is a protein is to
express the proteins recombinantly for screening patient sera or
mucosal secretions by immunoblot and/or microarrays. A positive
reaction between the protein and the patient sample indicates that
the patient has mounted an immune response to the protein in
question. This method may also be used to identify immunodominant
antigens and/or epitopes within protein antigens.
The efficacy of the immunogenic compositions can also be determined
in vivo by challenging appropriate animal models of the pathogen of
interest infection.
The immunogenic compositions disclosed herein will generally be
administered directly to a subject. Direct delivery may be
accomplished by parenteral injection (e.g., subcutaneously,
intraperitoneally, intravenously, intramuscularly, or to the
interstitial space of a tissue), or mucosally, such as by rectal,
oral (e.g., tablet, spray), vaginal, topical, transdermal or
transcutaneous, intranasal, ocular, aural, pulmonary or other
mucosal administration.
The immunogenic compositions may be used to elicit systemic and/or
mucosal immunity, preferably to elicit an enhanced systemic and/or
mucosal immunity.
Preferably the enhanced systemic and/or mucosal immunity is
reflected in an enhanced TH1 and/or TH2 immune response.
Preferably, the enhanced immune response includes an increase in
the production of IgG1 and/or IgG2a and/or IgA.
Dosage can be by a single dose schedule or a multiple dose
schedule. Multiple doses may be used in a primary immunisation
schedule and/or in a booster immunisation schedule. In a multiple
dose schedule the various doses may be given by the same or
different routes, e.g., a parenteral prime and mucosal boost, a
mucosal prime and parenteral boost, etc. Multiple doses will
typically be administered at least 1 week apart (e.g., about 2
weeks, about 3 weeks, about 4 weeks, about 6 weeks, about 8 weeks,
about 10 weeks, about 12 weeks, about 16 weeks, etc.).
The immunogenic compositions disclosed herein that include one or
more antigens or are used in conjunction with one or more antigens
may be used to treat both children and adults. Thus a human subject
may be less than 1 year old, 1-5 years old, 5-15 years old, 15-55
years old, or at least 55 years old. Preferred subjects for
receiving such immunogenic compositions are the elderly (e.g.,
>50 years old, >60 years old, and preferably >65 years),
the young (e.g., <5 years old), hospitalised patients,
healthcare workers, armed service and military personnel, pregnant
women, the chronically ill, or immunodeficient patients. The
immunogenic compositions are not suitable solely for these groups,
however, and may be used more generally in a population.
The immunogenic compositions disclosed herein that include one or
more antigens or are used in conjunction with one or more antigens
may be administered to patients at substantially the same time as
(e.g., during the same medical consultation or visit to a
healthcare professional or vaccination centre) other vaccines,
e.g., at substantially the same time as a measles vaccine, a mumps
vaccine, a rubella vaccine, a MMR vaccine, a varicella vaccine, a
MMRV vaccine, a diphtheria vaccine, a tetanus vaccine, a pertussis
vaccine, a DTP vaccine, a conjugated H. influenzae type b vaccine,
an inactivated poliovirus vaccine, a hepatitis B virus vaccine, a
meningococcal conjugate vaccine (such as a tetravalent A C W135 Y
vaccine), a respiratory syncytial virus vaccine, etc.
Compounds of Formula (I) Formulated with Aluminum-Containing
Adjuvants
In certain embodiments, at least one compound of Formula (I)
provided herein, or a pharmaceutically acceptable salt or solvate
thereof, is combined with an aluminum-containing adjuvant and an
effective amount of one or more antigens, resulting in an
immunogenic composition. In such immunogenic compositions the
compound of Formula (I) is bound to the aluminum-containing
adjuvant. In such immunogenic compositions the antigen is any
antigen provided herein. In such immunogenic compositions, the
antigen and the compound of Formula (I), a TLR7 agonist, are
co-delivered to a desired site.
In such immunogenic composition, the binding of a compound of
Formula (I) to an aluminum-containing adjuvant does not interfere
with the binding of the antigen to the aluminum-containing
adjuvant. By way of example only, FIG. 1 demonstrates that the
adsorption of antigens of Neisseria meningitis to aluminum
hydroxide is not affected by the binding of a compound of Formula
(I) to the aluminum hydroxide adjuvant.
In certain embodiments, such immunogenic compositions are useful as
vaccines. In certain embodiments, such vaccines are prophylactic
(i.e. to prevent infection), while in other embodiments, such
vaccines are therapeutic (i.e. to treat infection).
The compound(s) of Formula (I) provided herein, or a
pharmaceutically acceptable salt or solvate thereof, are TLR7
agonists and are immune potentiators that impart an
immunostimulatory effect upon administration when compared to
immunogenic formulations that do not contain compound(s) of Formula
(I). In certain embodiments, compounds of Formula (I) impart an
immunostimulatory effect upon administration when included in an
immunogenic composition having one or more immunoregulatory agents,
while in other embodiments, compounds of Formula (I) impart an
immunostimulatory effect upon administration when included in an
immunogenic composition without the presence of other
immunoregulatory agents.
In certain embodiments, such immunogenic compositions enhance
immune response through the retention of the compound of Formula
(I) at the site of injection. Rather than binding a TLR agonist to
alum, an alternative strategy for increasing the residence time of
TRL agonists at the site of injection is to modify the
hydrophilicity, hydrophobicity and/or solubility properties of the
TLR agonist. Nononpolar (hydrophobic, or insoluble) compounds can
have increased residence time at a site of injection when
administered intramuscularly, thereby decreasing systemic exposure
levels compared to polar (hydrophilic, or soluble) compounds with
similar potency which show faster injection site clearance and
higher systemic exposure. Similarly, nonpolar compounds of Formula
(I) can display these useful properties.
In certain embodiments, such immunogenic compositions include a
pharmaceutically acceptable carrier such as, but are not limited
to, proteins, polysaccharides, polylactic acids, polyglycolic
acids, polymeric amino acids, amino acid copolymers, sucrose,
trehalose, lactose, lipid aggregates (such as oil droplets or
liposomes), and inactive virus particles. The immunogenic
compositions typically also contain diluents, such as water,
saline, and glycerol, and optionally contain other excipients, such
as wetting or emulsifying agents, and pH buffering substances. In
certain embodiments, such immunogenic compositions include one or
more additional adjuvants provided herein.
EXAMPLES
The following examples were offered to illustrate, but not to
limit, the compounds of Formula (I) provided herein, and the
preparation of such compounds.
SYNTHESIS of STARTING COMPOUNDS
Preparation of tert-butyl
5-methyl-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenylcarbamate
(A-1)
##STR00016##
##STR00017##
Step 1: tert-butyl 2-bromo-5-methylphenylcarbamate
To a solution of 2-bromo-5-methylaniline (1.0 eq.) in
tetrahydrofuran (0.2 M) at 0.degree. C. under N.sub.2 atmosphere
was added dropwise 1M NaHMDS (2.5 eq.). The reaction was stirred
for 15 minutes at 0.degree. C., and a solution of di-tert-butyl
dicarbonate in tetrahydrofuran was added. The reaction was warmed
to room temperature overnight. The solvent was evaporated, and the
resulting residue was quenched with 0.1N HCl aqueous solution. The
aqueous suspension was extracted twice with ethyl acetate. The
combined organic layers were washed with brine, dried over
anhydrous MgSO.sub.4, and concentrated en vacuo. The crude material
was purified by flash chromatography on a COMBIFLASH.RTM. system
(ISCO) using 0-5% ethyl acetate in hexane to give tert-butyl
2-bromo-5-methylphenylcarbamate as a light yellow oil.
Step 2: tert-butyl
5-methyl-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenylcarbamate
Tert-butyl 2-bromo-5-methylphenylcarbamate (from previous step)
(1.0 eq.),
4,4,4',4',5,5,5',5'-octamethyl-2,2'-bi(1,3,2-dioxaborolane) (1.5
eq.), dichloro[1,1'-bis(diphenylphosphino)ferrocene]palladium (II)
(5%), and sodium acetate (4.5 eq.) were mixed in dioxane (0.2 M)
under N.sub.2 atmosphere. The reaction was heated to 100.degree. C.
and stirred overnight. The resulting suspension was cooled to
ambient temperature, diluted with ether, filtered through celite,
and the filtrate was concentrated en vacuo. The crude material was
purified by flash chromatography on a COMBIFLASH.RTM. system (ISCO)
using 0-8% ether in hexane to give tert-butyl
5-methyl-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenylcarbamate
(A-1).
Preparation of
4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylpheno-
l (B-4)
##STR00018##
##STR00019##
Step B-1:
3-chloro-5-((4-methoxy-2-methylphenyl)ethynyl)picolinonitrile
(B-1)
To a round bottom flask capped with septa was added
1-ethynyl-4-methoxy-2-methylbenzene (1.1 eq),
3,5-dichloropicolinonitrile (1 eq.), triethylamine (5 eq.), and
anhydrous DMF (0.2 M). The mixture was degassed (vacuum) and
nitrogen flushed three times. CuI (0.05 eq.) and
bis(triphenylphosphine)dichloro-palladium(II) (0.05 eq) were added
and the septum was replaced with a refluxing condenser and the
flask was heated at 60.degree. C. overnight under nitrogen
atmosphere. Upon completion of the reaction as monitored by TLC,
the content of the flask was loaded onto a large silica gel column
pretreated with hexanes. Flash chromatography (silica gel,
hexanes:EtOAc (1:4%)) afforded the product
3-chloro-5-((4-methoxy-2-methylphenyl)ethynyl)picolinonitrile
(B-1).
Step B-2:
2-((4-methoxy-2-methylphenyl)ethynyl)-8-methylbenzo[f][1,7]napht-
hyridin-5-amine (B-2)
To a round bottom flask with refluxing condenser were added
3-chloro-5-((4-methoxy-2-methylphenyl)ethynyl)picolinonitrile (B-1)
(1 eq.), tert-butyl
5-methyl-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenylcarbamate
(A-1) (1.25 eq.), K.sub.3PO.sub.4 (2 eq.),
tris(dibenzylideneacetone)dipalladium(0) (0.05 eq.), and
2-dicyclohexylphosphino-2',6'-dimethoxybiphenyl (Sphos) (0.1 eq.).
n-butanol and water (5:2, 0.2 M) were added, and the content was
degas sed (vacuum followed by nitrogen flush) for three times. The
reaction mixture was stirred vigorously under nitrogen at
100.degree. C. overnight in an oil bath. The content was cooled and
taken up in 200 mL of water followed by extraction with methylene
chloride. Combined organic layers were dried (Na.sub.2SO.sub.4) and
concentrated. Flash chromatography (silica gel, 0-50% EtOAc in
CH.sub.2Cl.sub.2) afforded the product
2-((4-methoxy-2-methylphenyl)ethynyl)-8-methylbenzo[f][1,7]naphthyridin-5-
-amine (B-2).
Step B-3:
2-(4-methoxy-2-methylphenethyl)-8-methylbenzo[f][1,7]naphthyridi-
n-5-amine (B-3)
2-(4-methoxy-2-methylphenethyl)-8-methylbenzo[f][1,7]naphthyridin-5-amine
was prepared from
2-((4-methoxy-2-methylphenyl)ethynyl)-8-methylbenzo[f][1,7]naphthyridin-5-
-amine (from the previous step). To a round bottom flask was added
2-((4-methoxy-2-methylphenyl)ethynyl)-8-methylbenzo[f][1,7]naphthyridin-5-
-amine (1 eq.) with a stirring bar. Ethanol and methylene chloride
(1:2, 0.2 M) were added, followed by palladium in carbon (activated
powder, wet, 10% on carbon, 0.1 eq.). The content was degassed
(vacuum) followed by hydrogen flush (three times). The reaction
mixture was stirred vigorously at room temperature overnight, under
a hydrogen balloon. Afterwards the reaction mixture was filtered
through a celite pad, and the celite pad was washed subsequently
with methylene chloride and EtOAc until the filtrate had no UV
absorption. Combined organic washes were concentrated. Flash
chromatography (silica gel, 0-50% EtOAc in CH.sub.2Cl.sub.2)
afforded the product
2-(4-methoxy-2-methylphenethyl)-8-methylbenzo[f][1,7]naphthyridin-5-amine-
. .sup.1H NMR (CDCl.sub.3): .delta. 8.53 (d, 1H), 8.29 (d, 1H),
8.01 (d, 1H), 7.44 (s, 1H), 7.12 (dd, 1H), 6.93 (d, 1H), 6.67 (d,
1H), 6.60 (dd, 1H), 5.93 (bs, 2H), 3.70 (s, 3H), 3.05-3.00 (dd,
2H), 2.93-2.88 (dd, 2H), 2.44 (s, 3H), 2.19 (s, 3H). LRMS
[M+H]=358.2
Step B-4:
4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-me-
thylphenol (B-4)
To a stirred solution of
2-(4-methoxy-2-methylphenethyl)-8-methylbenzo[f][1,7]naphthyridin-5-amine
(from the previous step) in methylene chloride (0.2 M) in an
ice-water bath was added 1 N solution of BBr.sub.3 (2 eq) in
CH.sub.2Cl.sub.2 in a drop-wise fashion. In 30 minutes the reaction
was quenched with methanol and was concentrated en vaccuo to obtain
a crude residue. The crude material was purified by flash
chromatography on a COMBIFLASH.RTM. system (ISCO) using 0-20%
methanol in dichloromethane to give
4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylpheno-
l (B-4) as a white solid. .sup.1H NMR (DMSO-d.sub.6): .delta. 8.99
(s, 1H), 8.75 (d, 1H), 8.60 (d, 1H), 8.27 (d, 1H), 7.28 (s, 1H),
7.09 (dd, 1H), 6.99 (bs, 2H), 6.88 (d, 1H), 6.49 (d, 1H), 6.42 (dd,
1H), 3.02-2.96 (dd, 2H), 2.86-2.81 (dd, 2H), 2.38 (s, 3H), 2.13 (s,
3H). LRMS [M+H]=344.2.
Preparation of (5-amino-2-(4-methoxy-2-methylphenethyl)
benzo[f][1,7]naphthyridin-8-yl)methanol (2-1: see scheme 2)
##STR00020##
Step 1: tert-butyl
5-((tert-butyldimethylsilyloxy)methyl)-2-chlorophenylcarbamate
To a solution of
5-((tert-butyldimethylsilyloxy)methyl)-2-chloroaniline
(commercially available) (1.0 equiv.) in THF (0.2 M) at 0.degree.
C. under N.sub.2 atmosphere is added dropwise 1M NaHMDS (2.5
equiv.). The reaction is stirred for 15 minutes at 0.degree. C.,
and a solution of di-tert-butyl dicarbonate in THF is added. The
reaction is warmed to ambient temperature overnight. The solvent is
evaporated, and the resulting residue is quenched with 0.1 N HCl
aqueous solution. The aqueous suspension is extracted twice with
EtOAc. The combined organic layers are washed with brine, dried
over anhydrous MgSO.sub.4, and concentrated in vacuo. The crude
material is purified by flash chromatography on a COMBIFLASH.RTM.
system (ISCO) using 0-30% EtOAc/Hexanes to give tert-butyl
5-((tert-butyldimethylsilyloxy)methyl)-2-chlorophenylcarbamate as a
colorless oil.
Step 2: tert-butyl
5-((tert-butyldimethylsilyloxy)methyl)-2-(4,4,5,5-tetramethyl-1,3,2-dioxa-
borolan-2-yl)phenylcarbamate
Tert-butyl
5-((tert-butyldimethylsilyloxy)methyl)-2-chlorophenylcarbamate
(from the step 1) (1.0 equiv.),
4,4,4',4',5,5,5',5'-octamethyl-2,2'-bi(1,3,2-dioxaborolane) (3.0
equiv.), Pd.sub.2 dba.sub.3 (2.5%), XPhos (10%), and KOAc (3
equiv.) are mixed in dioxane (0.2 M) under N.sub.2 atmosphere. The
reaction is heated to 110.degree. C. and stirred overnight. The
resulting suspension is cooled to ambient temperature, diluted with
ether, filtered through celite, and the filtrate is concentrated in
vacuo. The combined organic layers are washed with brine, dried
over anhydrous MgSO.sub.4, and concentrated in vacuo. The crude
material is purified by flash chromatography on a COMBIFLASH.RTM.
system (ISCO) using 0-20% EtOAc/Hexanes to give tert-butyl
5-((tert-butyldimethylsilyloxy)methyl)-2-(4,4,5,5-tetramethyl-1,3,2-dioxa-
borolan-2-yl)phenylcarbamate as a white foam.
Step 3:
3-Chloro-5-((4-methoxy-2-methylphenyl)ethynyl)picolinonitrile
To a round bottom flask capped with septa was added
1-ethynyl-4-methoxy-2-methylbenzene (commercially available, 1.1
equiv.), 3,5-dichloropicolinonitrile (commercially available, 1
equiv.), triethylamine (5 equiv.), and anhydrous DMF (0.2 M).
Vacuumed and nitrogen flushed for three times. CuI (0.05 equiv.)
and bis(triphenylphosphine)dichloro-palladium(II) (0.05 equiv.)
were added. The septum was replaced with a refluxing condenser and
the flask was heated at 60.degree. C. overnight under nitrogen
atmosphere. Upon completion of the reaction as monitored by TLC,
the content of the flask was loaded onto a large silica gel column
pretreated with hexanes. Flash chromatography (silica gel,
hexanes:EtOAc (1:4%)) afforded
3-chloro-5-((4-methoxy-2-methylphenyl)ethynyl)picolinonitrile.
Step 4:
8-((tert-butyldimethylsilyloxy)methyl)-2-((4-methoxy-2-methylpheny-
l)ethynyl)benzo[f][1,7]naphthyridin-5-amine
To a round bottom flask with refluxing condenser were added
3-chloro-5-((4-methoxy-2-methylphenyl)ethynyl)picolinonitrile (from
the step 3) (1 equiv.), tert-butyl
5-((tert-butyldimethylsilyloxy)methyl)-2-(4,4,5,5-tetramethyl-1,3,2-dioxa-
borolan-2-yl)phenylcarbamate (from step 2) (1.25 equiv.),
K.sub.3PO.sub.4 (2 equiv.),
tris(dibenzylideneacetone)dipalladium(0) (0.05 equiv.), and
2-Dicyclohexylphosphino-2',6'-dimethoxybiphenyl (0.1 equiv.).
n-Butanol and water (5:2, 0.2 M) were added, and the content were
degassed (vacuum followed by nitrogen flush) for three times. The
reaction mixture was stirred vigorously under nitrogen at
100.degree. C. overnight in an oil bath. The contents were cooled
down and were taken up in water followed by extraction with
methylene chloride. Combined organic layers were dried
(Na.sub.2SO.sub.4) and concentrated. Flash chromatography (silica
gel, 0-50% EtOAc in CH.sub.2Cl.sub.2) afforded
8-((tert-butyldimethylsilyloxy)methyl)-2-((4-methoxy-2-methylphenyl)ethyn-
yl)benzo[f][1,7]naphthyridin-5-amine as a solid.
Step 5:
8-((tert-butyldimethylsilyloxy)methyl)-2-(4-methoxy-2-methylphenet-
hyl)benzo[f][1,7]naphthyridin-5-amine
To a round bottom flask was added
8-((tert-butyldimethylsilyloxy)methyl)-2-(4-methoxy-2-methylphenyl)ethyny-
l)benzo[f][1,7]naphthyridin-5-amine (from step 4) (1 equiv.) with a
stirring bar. Ethanol and methylene chloride (1:2, 0.2 M) were
added, followed by palladium in carbon (activated powder, wet, 10%
on carbon, 0.1 equiv.). The contents were vacuumed followed by
hydrogen flush for three times. The reaction mixture was stirred
vigorously under hydrogen balloon at room temperature overnight.
Afterwards the reaction mixture was filtered through a celite pad,
and the celite pad was washed subsequently with methylene chloride
and EtOAc until filtrate has no UV absorption. Combined organic
washes were concentrated. Flash chromatography (silica gel, 0-50%
EtOAc in CH.sub.2Cl.sub.2) afforded
8-((tert-butyldimethylsilyloxy)methyl)-2-(4-methoxy-2-methylphenethyl)ben-
zo[f][1,7]naphthyridin-5-amine as a yellow solid.
Step 6:
5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-
-yl)methanol (2-1)
(Tert-butyldimethylsilyloxy)methyl)-2-(4-methoxy-2-methylphenethyl)benzo[-
f][1,7]naphthyridin-5-amine (from step 5) (1.0 equiv.) and TBAF
(1.1 equiv.) in THF is stirred at ambient temperature overnight.
The reaction is quenched with saturated NaHCO.sub.3. The two phases
are separated, and the aqueous layer is extracted twice with
Et.sub.2O. The combined organic layers are washed with brine, dried
over anhydrous MgSO.sub.4, and concentrated in vacuo. The crude
material is purified by flash chromatography on a COMBIFLASH.RTM.
system (ISCO) using 0-5% MeOH/DCM to give
5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-y-
l)methanol (2-1) as a white solid. .sup.1H NMR (acetone-d.sub.6):
.delta. 8.79 (s, 1H), 8.73 (s, 1H), 8.35 (d, 1H), 7.61 (s, 1H),
7.33 (d, 1H), 7.09 (d, 1H), 6.75 (d, 1H), 6.68 (dd, 1H), 6.57 (br
s, 2H), 4.47 (d, 2H), 4.32 (t, 1H), 3.58 (s, 3H), 3.17 (t, 2H),
3.04 (t, 2H), 2.30 (s, 3H). LRMS [M+H]=374.2.
Synthesis of Exemplary Compounds
Example 1
Table 1: Compound 6
Synthesis of 3 (2 (2 (4 (2 (5
amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylphenoxy)ethox-
y)ethoxy)-1,1-difluoropropylphosphonic acid (6)
##STR00021##
##STR00022##
Step 1: diethyl
1,1-difluoro-3-(2-(2-iodoethoxy)ethoxy)propylphosphonate (I-1)
To a solution of diethyl difluoromethylphosphonate (1.0 equiv.) in
THF (0.8 M) at -78.degree. C. was slowly added a solution of LDA (2
M, 1.1 equiv.) in heptane/THF/ethylbenzene, and the mixture was
vigorously stirred for 30 minutes. In a separate reaction flask, a
solution of 1,2-bis(2-iodoethoxy)ethane (1.0 equiv.) in THF (0.8M)
was cooled to -78.degree. C. To this solution was transferred, by
cannula, the freshly prepared alkyl lithium solution and the
reaction mixture was allowed to stir for 1 hour at -78.degree. C.
At this point, the cooling bath was removed and the reaction
mixture was allowed to warm to room temperature. The reaction
mixture was then quenched with a 1 M aqueous solution of HCl. The
resulting mixture was transferred to a separatory funnel and washed
with CH.sub.2Cl.sub.2 three times. The combined organic layers were
dried over anhydrous Na.sub.2SO.sub.4 and the volatiles were
removed in vacuo. The resulting residue was purified by a
COMBIFLASH.RTM. system (ISCO) using CH.sub.2Cl.sub.2 to provide
diethyl 1,1-difluoro-3-(2-(2-iodoethoxy)ethoxy)propylphosphonate
(I-1) as a yellow oil. .sup.1H NMR (CDCl.sub.3): .delta. 4.23-4.31
(m, 4H), 3.75-3.80 (m, 4H), 3.60-3.67 (m, 4H), 3.26 (t, 2H),
2.33-2.50 (m, 2H), 1.38 (t, 6H).
Step 2: Synthesis of diethyl
2-(2-(2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-me-
thylphenoxy)ethoxy)ethoxy)-1,1-difluoroethylphosphonate (1-2)
To a solution of
4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylpheno-
l (B-4) (1.0 equiv.) in dimethylformamide (0.10 M) at 22.degree. C.
was added 60% dispersion of sodium hydride in mineral oil (1.5
equiv.) and the resulting mixture was allowed to stir for 30
minutes. At this point, diethyl
1,1-difluoro-3-(2-(2-iodoethoxy)ethoxy)propylphosphonate (1.2
equiv.) was added to this mixture. The reaction mixture was then
allowed to stir for 18 hours, after which it was diluted with ethyl
acetate and water. The biphasic layers were separated and the
organic layer was washed twice with water. The organic layer was
dried over anhydrous Na.sub.2SO.sub.4 and the volatiles were
removed in vacuo. The resulting residue was purified by a
COMBIFLASH.RTM. system (ISCO) using 0-50% ethyl acetate in hexanes
gradient to provide diethyl
3-(2-(2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-me-
thylphenoxy)ethoxy)ethoxy)-1,1-difluoropropylphosphonate (1-2) as a
solid.
Step 3: Synthesis of
3-(2-(2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-me-
thylphenoxy)ethoxy)ethoxy)-1,1-difluoroethylphosphonic acid (6)
To a solution of diethyl
3-(2-(2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-me-
thylphenoxy)ethoxy)ethoxy)-1,1-difluoropropylphosphonate (1-2) (1.0
equiv.) in CH.sub.2Cl.sub.2 (0.10 M) at 0.degree. C. was slowly
added trimethylsilyl bromide (10 equiv.). After 1 hour the ice-bath
was removed and the reaction mixture was allowed to stir at
22.degree. C. for 18 hours. At this point, the volatiles were
removed in vacuo and the resulting residue was purified by Reverse
Phase-HPLC using a 20-90% 0.5 mM NH.sub.4OAc (in MeCN) to 10 mM
NH.sub.4OAc (in water) gradient to deliver
3-(2-(2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)eth-
yl)-3-methylphenoxy)ethoxy)ethoxy)-1,1-difluoropropylphosphonic
acid (6) as a solid. .sup.1H NMR (Dimethylsulfoxide-d.sub.6):
.delta. 8.83 (s, 1H), 8.68 (s, 1H), 8.32 (s, 1H), 7.34 (s, 1H),
7.14 (d, 1H), 7.09 (br, 2H), 7.08 (d, 1H), 6.74 (s, 1H), 6.68 (d,
1H), 4.01 (t, 2H), 3.70 (t, 2H), 3.61 (t, 2H), 3.54-3.59 (m, 2H),
3.48-3.50 (m, 2H), 3.07 (t, 2H), 2.94 (t, 2H), 2.43 (s, 3H), 2.25
(s, 3H), 2.06-2.21 (m, 2H). LRMS [M+H]=590.2
Example 2
Table 1: Compound 1
Synthesis of
3-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)propylphosphonic acid (1)
##STR00023##
Step 1: Diethyl
3-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)propylphosphonate
Diethyl
3-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3--
methylphenoxy)propylphosphonate was prepared according to the
procedure described in Example 1--Step 2, but using commercially
available diethyl 3-bromopropylphosphonate as the reagent.
Step 2:
3-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-m-
ethylphenoxy)propylphosphonic acid
3-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)propylphosphonic acid (1) was prepared according to the
procedure described in Example 1--Step 3, but using diethyl
3-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)propylphosphonate from the previous step. TFA was added to
the .sup.1H NMR sample to solubilize the compound for analysis. The
.sup.1H NMR (Dimethylsulfoxide-d.sub.6) obtained for
3-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)propylphosphonic acid (1) was: .delta. 9.72 (br, 1H), 9.01
(s, 1H), 8.96 (br, 1H), 8.85 (s, 1H), 8.54 (d, 1H, J=8.4 Hz), 7.54
(s, 1H), 7.42 (d, 1H, J=8.2 Hz), 7.08 (d, 1H, J=8.4 Hz), 6.74 (s,
1H), 6.66 (d, 1H, J=8.3 Hz), 3.95 (t, 2H, J=6.4 Hz), 3.14 (t, 2H,
J=8.6 Hz), 2.97 (t, 2H, J=8.6 Hz), 2.50 (s, 3H), 2.27 (s, 3H),
1.91-1.81 (m, 2H), 1.67-1.56 (m, 2H). LRMS [M+H]=466.2
Example 3
Table 1: Compound 2
Synthesis of
4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylpheny-
l dihydrogen phosphate (2)
##STR00024##
Step 1:
4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-meth-
ylphenyl dibenzyl phosphate
4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylpheny-
l dibenzyl phosphate was prepared according to the procedure
described in Example 1--Step 2, but using commercially available
dibenzyl phosphorochloridate as the reagent.
Step 2:
4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-meth-
ylphenyl dihydrogen phosphate
4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylpheny-
l dibenzyl phosphate (1.0 equiv.) and 10% Pd/C (20% equiv. by
weight) in MeOH (0.66 M) was allowed to stir for 18 hours under a
balloon of H.sub.2. At this point the reaction mixture was passed
through a pad of Celite, washing with a 2:1 mixture of
CHCl.sub.3:MeOH. The combined organic layers were dried over
anhydrous Na.sub.2SO.sub.4 and the volatiles were removed in vacuo.
The resulting residue was purified by Reverse Phase-HPLC using a
20-90% 0.5 mM NH.sub.4OAc (in MeCN) to 10 mM NH.sub.4OAc (in water)
gradient to give
4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylpheny-
l dihydrogen phosphate (2) as a solid. TFA was added to the .sup.1H
NMR sample to solubilize the compound for analysis. .sup.1H NMR
(Dimethylsulfoxide-d.sub.6): .delta. 9.69 (br, 1H), 9.33 (s, 1H),
9.03 (s, 1H), 8.87 (s, 1H), 8.54 (d, 1H, J=8.4 Hz), 7.51 (s, 1H),
7.42 (d, 1H, J=9.4 Hz), 7.22 (s, 1H), 7.17 (d, 1H, J=8.3 Hz), 7.10
(s, 1H), 6.97 (s, 1H), 6.92 (d, 1H, J=6.1 Hz), 3.15 (t, 2H, J=6.8
Hz), 3.00 (t, 2H, J=6.8 Hz), 2.50 (s, 3H), 2.29 (s, 3H). LRMS
[M+H]=424.1
Example 4
Table 1: Compound 3
Synthesis of
(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylphen-
oxy)methylphosphonic acid (3)
##STR00025##
Step 1: diethyl
(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylphen-
oxy)methylphosphonate
Diethyl
(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-me-
thylphenoxy)methylphosphonate was prepared according to the
procedure described in Example 1--Step 2, but using commercially
available (diethoxyphosphoryl)methyl 4-methylbenzenesulfonate as
the reagent.
Step 2:
(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-met-
hylphenoxy)methylphosphonic acid
(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylphen-
oxy)methylphosphonic acid (3) was prepared according to the
procedure described in Example 1--Step 3, but using diethyl
(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylphen-
oxy)methylphosphonate from the previous step. The .sup.1H NMR
(Dimethylsulfoxide-d.sub.6) obtained for
(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylphen-
oxy)methylphosphonic acid (3) was: .delta. 8.86 (br, 1H), 8.67 (br,
1H), 8.34 (d, 1H, J=10.4 Hz), 7.37 (s, 1H), 7.35 (s, 1H), 7.14 (d,
1H, J=8.4 Hz), 7.05 (d, 1H, J=8.2 Hz), 6.73 (s, 1H), 6.69 (d, 1H,
J=8.6 Hz), 6.60 (s, 1H), 3.70-3.61 (m, 2H), 3.10 (t, 2H, J=8.8 Hz),
2.94 (t, 2H, J=8.8 Hz), 2.45 (s, 3H), 2.25 (s, 3H). LRMS
[M+H]=438.2
Example 5
Table 1: Compound 4
Synthesis of
5-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)-1,1-difluoropentylphosphonic acid (4)
##STR00026##
Step 1: diethyl 5-bromo-1,1-difluoropentylphosphonate
Diethyl 5-bromo-1,1-difluoropentylphosphonate was prepared
according to the procedure described in Example 1--Step 1, but
using commercially available 1,4-dibromobutane as the reagent.
Step 2: diethyl
5-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)-1,1-difluoropentylphosphonate
Diethyl
5-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3--
methylphenoxy)-1,1-difluoropentylphosphonate was prepared according
to the procedure described in Example 1--Step 2, but using diethyl
5-bromo-1,1-difluoropentylphosphonate from the previous step as the
reagent.
Step 3:
5-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-m-
ethylphenoxy)-1,1-difluoropentylphosphonic acid (4)
5-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)-1,1-difluoropentylphosphonic acid (4) was prepared according
to the procedure described in Example 1--Step 3, but using diethyl
5-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)-1,1-difluoropentylphosphonate from step 2. TFA was added to
the .sup.1H NMR sample to solubilize the compound for analysis. The
.sup.1H NMR (Dimethylsulfoxide-d.sub.6) obtained for
5-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)-1,1-difluoropentylphosphonic acid (4) was: .delta. 9.70 (br,
1H), 9.33 (br, 1H), 8.98 (s, 1H), 8.84 (s, 1H), 8.50 (d, 1H, J=8.4
Hz), 7.52 (s, 1H), 7.40 (d, 1H, J=8.4 Hz), 7.06 (d, 1H, J=8.4 Hz),
6.74 (s, 1H), 6.68 (d, 1H, J=10.8 Hz), 3.91 (t, 2H, J=6.2 Hz), 3.14
(t, 2H, J=8.4 Hz), 2.97 (t, 2H, J=8.4 Hz), 2.50 (s, 3H), 2.27 (s,
3H), 2.13-1.94 (m, 2H), 1.78-1.70 (m, 2H), 1.66-1.59 (m, 2H). LRMS
[M+H]=530.2
Example 6
Table 1: Compound 5
Synthesis of
4-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)-1,1-difluorobutylphosphonic acid (5)
##STR00027##
Step 1: diethyl 4-bromo-1,1-difluorobutylphosphonate
Diethyl 4-bromo-1,1-difluorobutylphosphonate was prepared according
to the procedure described in Example 1--Step 1, but using
commercially available 1,3-dibromopropane as the reagent.
Step 2: diethyl
4-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)-1,1-difluorobutylphosphonate
Diethyl
4-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3--
methylphenoxy)-1,1-difluorobutylphosphonate was prepared according
to the procedure described in Example 1--Step 2, but using diethyl
4-bromo-1,1-difluorobutylphosphonate from the previous step as the
reagent.
Step 3:
4-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-m-
ethylphenoxy)-1,1-difluorobutylphosphonic acid (5)
4-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)-1,1-difluorobutylphosphonic acid (5) was prepared according
to the procedure described in Example 1--Step 3, but using diethyl
4-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)-1,1-difluorobutylphosphonate from step 2. TFA was added to
the .sup.1H NMR sample to solubilize the compound for analysis. The
.sup.1H NMR (Dimethylsulfoxide-d.sub.6) obtained for
4-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)-1,1-difluorobutylphosphonic acid (5) was: .delta. 9.71 (br,
1H), 9.33 (br, 1H), 9.00 (s, 1H), 8.85 (s, 1H), 8.54 (d, 1H, J=8.4
Hz), 7.53 (s, 1H), 7.42 (d, 1H, J=8.3 Hz), 7.08 (d, 1H, J=8.4 Hz),
6.76 (s, 1H), 6.70 (d, 1H, J=8.3 Hz), 3.97 (t, 2H, J=6.2 Hz), 3.15
(t, 2H, J=8.5 Hz), 2.98 (t, 2H, J=8.5 Hz), 2.50 (s, 3H), 2.28 (s,
3H), 2.21-2.06 (m, 2H), 1.97-1.87 (m, 2H). LRMS [M+H]=516.2
Example 7
Table 1: Compound 7
Synthesis of 3 (2 (4 (2 (5
amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylphenoxy)ethox-
y)-1,1-difluoropropylphosphonic acid (7)
##STR00028##
Step 1: diethyl 3-(2-bromoethoxy)-1,1-difluoropropylphosphonate
An oven dried round-bottom flask was charged with dry THF (1.07 M)
and diisopropylamine (2.0 equiv.). The flask was cooled in an
acetone-dry ice bath, and was treated with n-butyllithium (1.6
equiv.) solution in cyclohexane (1.52 M) in dropwised fashion via
syringe. The flask was transferred to an ice-water bath upon
completion of the addition, and stirred for 30 minutes. The flask
was then cooled back down to the dry ice-acetone bath, and was
treated with a solution of diethyl difluoromethylphosphonate (1.0
equiv.) in HMPA (1:1 v/v) via syringe. The stirring was allowed to
proceed for an hour. To the above reaction mixture, a cooled
solution of 1-bromo-2-(2-bromoethoxy)ethane (3.0 equiv.) in THF (3
M) was added quickly through a syringe, and the reaction was
allowed to stir for another 3 hours before quenching with 1 N HCl.
The flask was warmed to room temperature, and the pH was adjusted
to <4 with 1 N HCl. The mixture was extracted with EtOAc
(3.times.). The combined organic extracts were dried over anhydrous
Na.sub.2SO.sub.4, and concentrated in vacuo. The crude material was
purified by Combiflash using 0-75% EtOAc in hexanes, followed by
RP-HPLC (0.035% TFA in ACN:0.05% TFA in H.sub.2O, C18 column), to
afford diethyl 3-(2-bromoethoxy)-1,1-difluoropropylphosphonate as a
pale yellow oil.
Step 2: diethyl
3-(2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methy-
lphenoxy)ethoxy)-1,1-difluoropropylphosphonate
Diethyl
3-(2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-
-3-methylphenoxy)ethoxy)-1,1-difluoropropylphosphonate was prepared
according to the procedure described in Example 1--Step 2, but
using diethyl 3-(2-bromoethoxy)-1,1-difluoropropylphosphonate from
the previous step as the reagent.
Step 3:
3-(2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)--
3-methylphenoxy)ethoxy)-1,1-difluoropropylphosphonic acid
3-(2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methy-
lphenoxy)ethoxy)-1,1-difluoropropylphosphonic acid (7) was prepared
according to the procedure described in Example 1--Step 3, but
using Diethyl
3-(2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-
-3-methylphenoxy)ethoxy)-1,1-difluoropropylphosphonate from the
previous step 2. The .sup.1H NMR (Dimethylsulfoxide-d.sub.6)
obtained for
3-(2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methy-
lphenoxy)ethoxy)-1,1-difluoropropylphosphonic acid (7) was: .delta.
8.83 (s, 1H), 8.69 (s, 1H), 8.35 (d, 1H, J=8.3 Hz), 7.36 (s, 1H),
7.26 (br, 2H), 7.16 (d, 1H, J=8.3 Hz), 7.07 (d, 1H, J=8.4 Hz), 6.75
(s, 1H), 6.66 (d, 1H, 8.3 J=Hz), 4.00 (t, 2H, J=4.4 Hz), 3.67 (t,
2H, J=6.7 Hz), 3.08 (t, 2H, J=6.8 Hz), 2.94 (t, 2H, J=6.8 Hz), 2.44
(s, 3H), 2.25 (s, 3H), 2.22-2.09 (m, 2H). LRMS [M+H]=546.2
Example 8
Table 1: Compound 8
Synthesis of
2-(4-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-meth-
ylphenoxy)methyl)phenyl)-1,1-difluoroethylphosphonic acid (8)
##STR00029##
Step 1: diethyl
2-(4-(bromomethyl)phenyl)-1,1-difluoroethylphosphonate
Diethyl 2-(4-(bromomethyl)phenyl)-1,1-difluoroethylphosphonate was
prepared according to the procedure described in Example 1--Step 1,
but using commercially available 1,4-bis(bromomethyl)benzene as the
reagent.
Step 2: diethyl
2-(4-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-meth-
ylphenoxy)methyl)phenyl)-1,1-difluoroethylphosphonate
Diethyl
2-(4-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl-
)-3-methylphenoxy)methyl)phenyl)-1,1-difluoroethylphosphonate was
prepared according to the procedure described in Example 1--Step 2,
but using diethyl
2-(4-(bromomethyl)phenyl)-1,1-difluoroethylphosphonate from the
previous step as the reagent.
Step 3:
2-(4-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-
-3-methylphenoxy)methyl)phenyl)-1,1-difluoroethylphosphonic
acid
2-(4-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-meth-
ylphenoxy)methyl)phenyl)-1,1-difluoroethylphosphonic acid (8) was
prepared according to the procedure described in Example 1--Step 3,
but using diethyl
2-(4-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl-
)-3-methylphenoxy)methyl)phenyl)-1,1-difluoroethylphosphonate from
the previous step 3. TFA was added to the .sup.1H NMR sample to
solubilize the compound for analysis. The .sup.1H NMR
(Dimethylsulfoxide-d.sub.6) obtained for
2-(4-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-meth-
ylphenoxy)methyl)phenyl)-1,1-difluoroethylphosphonic acid (8) was:
.delta. 9.71 (br, 1H), 9.35 (br, 1H), 9.01 (s, 1H), 8.86 (s, 1H),
8.54 (d, 1H, J=8.4 Hz), 7.53 (s, 1H), 7.44 (d, 1H), 7.40 (s, 1H),
7.38 (s, 1H), 7.29 (d, 1H, J=8.0 Hz), 7.24 (s, 1H), 7.11 (s, 1H),
7.09 (s, 1H), 6.99 (s, 1H), 6.85 (s, 1H), 6.76 (d, 1H, J=8.3 Hz),
5.04 (s, 2H), 3.84-3.73 (m, 2H), 3.15 (t, 2H, J=8.5 Hz), 2.99 (t,
2H, J=8.5 Hz), 2.50 (s, 3H), 2.29 (s, 3H). LRMS [M+H]=578.2
Example 9
Table 1: Compound 9
Synthesis of
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
-1,1-difluoro-2-oxoethylphosphonic acid (9)
##STR00030##
##STR00031##
Step 1:
5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridine--
8-carbaldehyde (2-2)
To a solution of
(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)me-
thanol (2-1), 1.0 equiv. in DMSO (0.15 M) at room temperature was
added IBX (1.5 equiv.). The reaction was stirred for 2.5 hours and
then diluted with water. The aqueous layer was extracted with 2%
MeOH/DCM (4.times.). The combined organic layers were dried over
anhydrous MgSO.sub.4 and concentrated in vacuo. The resulting
residue was purified by a COMBIFLASH.RTM. system (ISCO) using a
gradient of 0-5% MeOH/DCM to provide
5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridine-
-8-carbaldehyde (2-2) as a solid.
Step 2: diethyl
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
-1,1-difluoro-2-hydroxyethylphosphonate (2-3)
To a solution of diethyl difluoromethylphosphonate (3.0 equiv.) in
THF (0.3 M) at -78.degree. C. under nitrogen atmosphere was added
dropwise 2M LDA (3.0 equiv., commercial grade). The reaction was
stirred at -78.degree. C. for 25 min, and a solution of
5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridine-8-carba-
ldehyde (2-2) (1.0 equiv.) in THF (0.1 M) was added slowly. The
reaction was stirred at -78.degree. C. for 1 hour, 0.degree. C. for
1 hour, and then warmed to room temperature over 30 minutes. The
reaction was quenched with saturated aqueous ammonium chloride
solution and extracted twice with ethyl acetate. The combined
organic layers were washed with brine, dried over anhydrous
MgSO.sub.4, and concentrated in vacuo. The resulting residue was
purified by a COMBIFLASH.RTM. system (ISCO) using a gradient of
0-5% MeOH/DCM to provide diethyl
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
-1,1-difluoro-2-hydroxyethylphosphonate (2-3) as a solid.
Step 3: diethyl
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
-1,1-difluoro-2-oxoethylphosphonate (2-4)
To a solution of diethyl
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
-1,1-difluoro-2-hydroxyethylphosphonate (2-3) (1.0 equiv.) in 1:1
DMSO/ethyl acetate (0.07 M) was added IBX (1.5 equiv.). The
reaction was heated to 80.degree. C. for 1 hour, and then cooled to
room temperature. The mixture was diluted with ethyl acetate and
filtered through celite. The filtrate was washed with water
(2.times.), brine, dried over anhydrous MgSO.sub.4, and
concentrated in vacuo. The resulting residue was purified by a
COMBIFLASH.RTM. system (ISCO) using a gradient of 0-5% MeOH/DCM to
provide diethyl
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
-1,1-difluoro-2-oxoethylphosphonate (2-4) as a solid.
Step 4:
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridi-
n-8-yl)-1,1-difluoro-2-oxoethylphosphonic acid (9)
To a solution of diethyl
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
-1,1-difluoro-2-oxoethylphosphonate (2-4) (1.0 equiv.) in DCM (0.05
M) at 0.degree. C. was added TMSI (5.0 equiv.). The reaction was
warmed to room temperature over 2 hours, and more TMSI was added
(2.5 equiv.). The reaction was stirred for another 30 minutes, and
then quenched with small amounts of water. The DCM was removed by
evaporation, and then added DMSO/water. The mixture was adjusted to
pH 9 and directly purified on RP-HPLC using a C18 column, eluting
with 10-40% 95:5 (MeCN/5 mM NH.sub.4OAc) in 10 mM NH.sub.4OAc (pH
9) gradient. The fractions containing the product were combined and
concentrated in vacuo to give
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
-1,1-difluoro-2-oxoethylphosphonic acid (9) as a solid. .sup.1H NMR
(Dimethylsulfoxide-d.sub.6): .delta. 8.82 (s, 1H), 8.5 (br, 1H),
8.44 (s, 1H), 8.2 (br, 1H), 7.98 (d, 1H, J=8.2 Hz), 7.2 (br, 2H),
7.05 (d, 1H, J=8.3 Hz), 6.73 (s, 1H), 6.67 (d, 1H, J=8.3 Hz), 3.70
(s, 3H), 2.99-2.87 (m, 4H), 2.25 (s, 3H). LRMS [M+H]=502.2
Example 10
Table 1: Compound 10
Synthesis of
(E)-2-(5-Amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-
-yl)vinylphosphonic acid (10)
##STR00032##
##STR00033##
Step 1: (E)-diethyl
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
vinylphosphonate (3-1)
To a stirred suspension of NaH (1.2 equiv.) in THF (0.1 M) cooled
at 0.degree. C. was added a solution of tetraethyl
methylenediphosphonate (1.3 equiv.) in THF (0.21 M). To the
resulting reaction mixture was added a solution of
5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridine-8-carba-
ldehyde (2-2) (Example 9--Step 1) (1.0 equiv.) in THF (0.08 M). The
reaction was stirred at room temperature for 30 minutes, then
solvents were removed in vacuo, and the resulting residue was
purified by a COMBIFLASH.RTM. system (ISCO) using a gradient of
0-5% MeOH/DCM to provide (E)-diethyl
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
vinylphosphonate (3-1) as a colorless solid.
Step 2:
(E)-2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthy-
ridin-8-yl)vinylphosphonic acid (10)
To a solution of (E)-diethyl
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
vinylphosphonate (3-1) (1.0 equiv.) in DCM (0.095 M) at 0.degree.
C. was added TMSBr (10 equiv.). The reaction was warmed to room
temperature over 2 hours, and then quenched with small amounts of
MeOH. The DCM was removed by evaporation, and then added
DMSO/water. The mixture was adjusted to pH 9 and directly purified
on RP-HPLC using a C18 column, eluting with 10-40% 95:5 (MeCN/5 mM
NH.sub.4OAc) in 10 mM NH.sub.4OAc (pH 9) gradient. The fractions
containing the product were combined and concentrated in vacuo to
give the
(E)-2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-
-yl)vinylphosphonic acid (10) as a solid. .sup.1H NMR
(Dimethylsulfoxide-d.sub.6): .delta. 9.76 (s, 1H), 9.33 (s, 1H),
9.03 (s, 1H), 8.82 (s, 1H), 8.60 (d, 1H, J=8.4 Hz), 7.87 (d, 1H,
J=8.4 Hz), 7.78 (s, 1H), 7.31 (dd, 1H, J=17.6, 21.6 Hz), 7.03 (d,
1H, J=8.4 Hz), 6.69 (m, 2H), 6.61 (dd, 1H, J=2.8, 8.4 Hz), 3.64 (s,
3H), 3.14-3.06 (m, 2H), 2.97-2.91 (m, 2H), 2.23 (s, 3H). LRMS
[M+H]=450.2
Example 11
Table 1: Compound 11
Synthesis of
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
ethylphosphonic acid (11)
##STR00034##
Step 1: diethyl
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
ethylphosphonate (3-3)
To a solution of (E)-diethyl
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
vinylphosphonate (3-1) (Example 10--Step 1) (1.0 equiv.) in DCM
(0.05 M) and EtOH (0.08 M) was added 10% palladium on carbon (0.09
equiv.). A reaction vessel was charged with a hydrogen balloon and
stirred at room temperature overnight. After the reaction was
complete as monitored by LCMS, solvents were removed, and the
resulting residue was purified by a COMBIFLASH.RTM. system (ISCO)
using a gradient of 0-5% MeOH/DCM to provide diethyl
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
ethylphosphonate (3-3).
Step 2:
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridi-
n-8-yl)ethylphosphonic acid (11)
To a solution of diethyl
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
ethylphosphonate (3-3) (1.0 equiv.) in DCM (0.02 M) at 0.degree. C.
was added TMSBr (10 equiv.). The reaction was warmed to room
temperature over 2 hours, and then quenched with small amounts of
MeOH. The DCM was removed by evaporation, and then DMSO/water was
added. The mixture was adjusted to pH 9 and directly purified on
RP-HPLC using a C18 column, eluting with 10-40% 95:5 (MeCN/5 mM
NH.sub.4OAc) in 10 mM NH.sub.4OAc (pH 9) gradient. The fractions
containing the product were combined and concentrated in vacuo to
give
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
ethylphosphonic acid (11) as a solid. .sup.1H NMR
(Dimethylsulfoxide-d.sub.6): .delta. 9.66 (s, 1H), 9.30 (s, 1H),
8.95 (s, 1H), 8.78 (s, 1H), 8.50 (d, 1H, J=8.4 Hz), 7.54 (s, 1H),
7.45 (d, 1H, J=8.4 Hz), 7.02 (d, 1H, J=8.4 Hz), 6.69 (d, 1H, J=2.8
Hz), 6.61 (dd, 1H, J=2.8, 8.4 Hz), 3.64 (s, 3H), 3.14-3.06 (m, 2H),
3.00-2.90 (m, 4H), 2.22 (s, 3H), 2.02-1.92 (m, 2H). LRMS
[M+H]=452.2
Example 12
Table 1: Compound 12
Synthesis of
(E)-2-(5-Amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-
-yl)-1-fluorovinylphosphonic acid (12)
##STR00035##
Step 1: (E)-Diethyl
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
-1-fluorovinylphosphonate (3-2)
To a stirred solution of tetraethyl fluoromethylenediphosphonate
(2.5 equiv.) in THF (0.27 M) cooled at -78.degree. C. was added LDA
solution (1.8 M in ethylbenzene/pentane/hexane, 2.0 equiv.). The
resulting reaction mixture was warmed up to room temperature and
stirred for 30 minutes, before it was cooled back down to
-78.degree. C. A solution of
5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridine-8-carba-
ldehyde (2-2) (Example 9-Step 1) (1.0 equiv.) in THF (0.18 M) was
added, and the reaction mixture was allowed to warm up to room
temperature slowly. The reaction was quenched with saturated
NH.sub.4Cl solution. Aqueous phase was extracted with DCM
(3.times.). The combined organic phases were combined and
concentrated in vacuo. The residue was purified by a
COMBIFLASH.RTM. system (ISCO) using a gradient of 0-5% MeOH/DCM to
provide (E)-Diethyl
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
-1-fluorovinylphosphonate (3-2) as a colorless solid.
Step 2:
(E)-2-(5-Amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthy-
ridin-8-yl)-1-fluorovinylphosphonic acid (12)
To a solution of (E)-diethyl
2-(5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
-1-fluorovinylphosphonate (3-2) (1.0 equiv.) in DCM (0.05 M) at
0.degree. C. was added TMSBr (10 equiv.). The reaction was warmed
to room temperature over 2 hours, and then quenched with small
amounts of MeOH. The DCM was removed by evaporation, and then
DMSO/water was added. The mixture was adjusted to pH 9 and directly
purified on RP-HPLC using a C18 column, eluting with 10-40% 95:5
(MeCN/5 mM NH.sub.4OAc) in 10 mM NH.sub.4OAc (pH 9) gradient. The
fractions containing the product were combined and concentrated in
vacuo to give
(E)-2-(5-Amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-
-yl)-1-fluorovinylphosphonic acid (12) as a solid. .sup.1H NMR
(Dimethylsulfoxide-d.sub.6): .delta. 9.80 (s, 1H), 9.41 (s, 1H),
9.05 (s, 1H), 8.87 (s, 1H), 8.65 (d, 1H, J=8.8 Hz), 8.08 (s, 1H),
7.76 (d, 1H, J=8.4 Hz), 7.08 (d, 1H, J=8.4 Hz), 7.02 (d, 1H, J=8.4
Hz), 6.83-6.65 (m, 2H), 3.69 (s, 3H), 3.18-3.12 (m, 2H), 3.02-2.96
(m, 4H), 2.28 (s, 3H). LRMS [M+H]=468.1
Example 13
Table 1: Compound 13
Synthesis of
3-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylp-
henoxy)methyl)phenylphosphonic acid (13)
##STR00036##
##STR00037##
Step 1:
2-(4-(3-iodobenzyloxy)-2-methylphenethyl)-8-methylbenzo[f][1,7]nap-
hthyridin-5-amine (4-1)
To a solution of
4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylpheno-
l (B-4), 1.0 equiv. in dimethylformamide (0.10 M) at 22.degree. C.
was added cesium carbonate (1.5 equiv.) and the resulting mixture
was allowed to stir for 30 minutes. At this point,
1-(bromomethyl)-3-iodobenzene (1.5 equiv.) was added to this
mixture. The reaction mixture was allowed to stir at 55.degree. C.
for 18 hours, after which it was diluted with ethyl acetate and
water. The biphasic layers were separated and the organic layer was
washed twice with water. The organic layer was dried over anhydrous
Na.sub.2SO.sub.4 and the volatiles were removed in vacuo. The
resulting residue was purified by a COMBIFLASH.RTM. system (ISCO)
using 0-50% ethyl acetate in hexanes gradient to provide
2-(4-(3-iodobenzyloxy)-2-methylphenethyl)-8-methylbenzo[f][1,7]naphthyrid-
in-5-amine (4-1) as a solid.
Step 2:
3-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3--
methylphenoxy)methyl)phenylphosphonic acid (13)
To a stirred solution of
2-(4-(3-iodobenzyloxy)-2-methylphenethyl)-8-methylbenzo[f][1,7]naphthyrid-
in-5-amine (1.0 equiv.) in triethyl phosphate (1.05 eq.) was added
palladium acetate (0.08 eq.). The resulting reaction mixture was
heated at 90.degree. C. overnight. After the reaction was cooled
down to room temperature, the residue was taken up in DCM (0.27 M)
at 0.degree. C., and was treated with TMSBr (11 equiv.). The
reaction was warmed to room temperature over 2 hours, and then
quenched with small amounts of MeOH. The DCM was removed by
evaporation, and then added DMSO/water. The mixture was adjusted to
pH 9 and directly purified on RP-HPLC using a C18 column, eluting
with 10-40% 95:5 (MeCN/5 mM NH.sub.4OAc) in 10 mM NH.sub.4OAc (pH
9) gradient. The fractions containing the product were combined and
concentrated in vacuo to give
3-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylp-
henoxy)methyl)phenylphosphonic acid (13) as a solid. .sup.1H NMR
(Dimethylsulfoxide-d.sub.6): .delta. 8.84 (s, 1H), 8.72 (s, 1H),
8.35 (d, 1H, J=8.4 Hz), 7.67 (d, 1H, J=12 Hz), 7.60-7.54 (m, 1H),
7.30-7.20 (m, 2H), 7.15 (d, 1H, J=8.4 Hz), 7.11 (d, 1 H, J=8.4 Hz),
7.04 (s, 1H), 6.84 (s, 1H), 6.77 (m, 1H), 4.99 (s, 2H), 3.12-2.92
(m, 4H), 2.44 (s, 3 H), 2.27 (s, 3H). LRMS [M+H]=514.2
Example 14
Table 1: Compound 14
Synthesis of
5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridine-8-carbo-
nylphosphonic acid (14)
##STR00038##
##STR00039##
To a stirred suspension of
5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridine-8-carba-
ldehyde (2-2) (Example 9--Step 1) (1.0 equiv.) in toluene (0.27 M)
was added tris(trimethylsilyl) phosphite (1.0 equiv.). The reaction
was stirred at 80.degree. C. for 60 minutes, then solvents were
removed, and the resulting residue was taken up in DMSO (0.27 M),
and IBX (1.5 equiv.) was added. The reaction was stirred at room
temperature for 2.5 hour, and was filtered and directly purified on
RP-HPLC using a C18 column, eluting with 10-40% 95:5 (MeCN/5 mM
NH.sub.4OAc) in 10 mM NH.sub.4OAc (pH 9) gradient. The fractions
containing the product were combined and concentrated in vacuo to
give
5-amino-2-(4-methoxy-2-methylphenethyl)benzo[f][1,7]naphthyridine-8-carbo-
nylphosphonic acid (14) as a solid. .sup.1H NMR
(Dimethylsulfoxide-d.sub.6): .delta. 9.84 (s, 1H), 9.35 (s, 1H),
9.09 (s, 1 H), 8.89 (s, 1 H), 8.76 (d, 1H, J=8.4 Hz), 8.60 (s, 1H),
8.19 (d, 1H, J=8.8 Hz), 7.04 (d, J=8.8 Hz, 1H), 6.70 (d, 1H, J=2.8
Hz), 6.62 (dd, 1H, J=2.8, 8.4 Hz), 3.64 (s, 3H), 3.15-3.09 (m, 2H),
2.97-2.91 (m, 2H), 2.23 (s, 3H). LRMS [M+H]=452.1
Example 15
Table 1: Compound 15
Synthesis of
3-(5-amino-2-(2-methyl-4-(3-phosphonopropoxy)phenethyl)benzo[f][1,7]napht-
hyridin-8-yl)propanoic acid (15)
##STR00040##
Step 1:
3-(5-amino-2-(4-(3-(diethoxyphosphoryl)propoxy)-2-methylphenethyl)-
benzo[f][1,7]naphthyridin-8-yl)propanoic acid
3-(5-amino-2-(4-(3-(diethoxyphosphoryl)propoxy)-2-methylphenethyl)benzo[f-
][1,7]naphthyridin-8-yl)propanoic acid was prepared according to
the procedure described in Example 19--Step 11, but using
commercially available diethyl 3-bromopropylphosphonate as the
reagent.
Step 2:
3-(5-amino-2-(2-methyl-4-(3-phosphonopropoxy)phenethyl)benzo[f][1,-
7]naphthyridin-8-yl)propanoic acid (15)
3-(5-amino-2-(2-methyl-4-(3-phosphonopropoxy)phenethyl)benzo[f][1,7]napht-
hyridin-8-yl)propanoic acid (15) was prepared according to the
procedure described in Example 19--Step 12, but using
3-(5-amino-2-(4-(3-(diethoxyphosphoryl)propoxy)-2-methylphenethyl)benzo[f-
][1,7]naphthyridin-8-yl)propanoic acid from the previous step. The
.sup.1H NMR (MeOD-d4) obtained for
3-(5-amino-2-(2-methyl-4-(3-phosphonopropoxy)phenethyl)benzo[f][1,7]napht-
hyridin-8-yl)propanoic acid (15) was: .delta. 8.60 (s, 1H), 8.27
(s, 1H), 8.07 (d, 1H, J=8.4 Hz), 7.52 (s, 1H), 7.30 (d, 1H, J=8.4
Hz), 6.87 (d, 1H, J=8.4 Hz), 6.67 (s, 1H), 6.60 (d, 1H, J=8.4 Hz),
3.93 (t, J=6.4 Hz, 2H), 3.49-3.47 (m, 2H), 3.14-3.09 (m, 2H),
2.99-2.95 (m, 2H), 2.69-2.64 (m, 2H), 2.17 (s, 3H), 2.02-2.00 (m,
2H), 1.74-0.66 (m, 2H). LRMS [M+H]=524.2
Example 16
Table 1: Compound 16
Synthesis of
3-(5-amino-2-(4-(4,4-difluoro-4-phosphonobutoxy)-2-methylphenethyl)benzo[-
f][1,7]naphthyridin-8-yl)propanoic acid (16)
##STR00041##
Step 1: diethyl 4-bromo-1,1-difluorobutylphosphonate
Diethyl 4-bromo-1,1-difluorobutylphosphonate was prepared according
to the procedure described in Example 1--Step 1, but using
commercially available 1,3-dibromopropane as the reagent.
Step 2:
3-(5-amino-2-(4-(4-(diethoxyphosphoryl)-4,4-difluorobutoxy)-2-meth-
ylphenethyl)benzo[f][1,7]naphthyridin-8-yl)propanoic acid
3-(5-amino-2-(4-(4-(diethoxyphosphoryl)-4,4-difluorobutoxy)-2-methylphene-
thyl)benzo[f][1,7]naphthyridin-8-yl)propanoic acid was prepared
according to the procedure described in Example 19--Step 11, but
using diethyl 4-bromo-1,1-difluorobutylphosphonate from the
previous step 1 as the reagent.
Step 3:
3-(5-amino-2-(4-(4,4-difluoro-4-phosphonobutoxy)-2-methylphenethyl-
)benzo[f][1,7]naphthyridin-8-yl)propanoic acid (16)
3-(5-amino-2-(4-(4,4-difluoro-4-phosphonobutoxy)-2-methylphenethyl)benzo[-
f][1,7]naphthyridin-8-yl)propanoic acid (16) was prepared according
to the procedure described in Example 19--Step 12, but using
3-(5-amino-2-(4-(4-(diethoxyphosphoryl)-4,4-difluorobutoxy)-2-methylphene-
thyl)benzo[f][1,7]naphthyridin-8-yl)propanoic acid from the
previous step 2. The .sup.1H NMR (MeOD-d4) obtained for
3-(5-amino-2-(4-(4,4-difluoro-4-phosphonobutoxy)-2-methylphenethyl)benzo[-
f][1,7]naphthyridin-8-yl)propanoic acid (16) was: .delta. 8.69 (s,
1H), 8.45 (s, 1H), 8.22 (d, 1H, J=8.4 Hz), 7.53 (s, 1H), 7.45 (d,
1H, J=8.4 Hz), 6.89 (d, J=8.4 Hz, 1H), 6.69 (s, 1H), 6.60 (d, 1H,
J=8.4 Hz), 3.95 (t, 2H, J=6.4 Hz), 3.92-3.90 (m, 2H), 3.49-3.47 (m,
2H), 3.20-3.16 (m, 2H), 3.14-3.10 (m, 2H), 3.03-2.99 (m, 2H),
2.74-2.70 (m, 2H), 2.22 (s, 3H). LRMS [M+H]=574.2
Example 17
Table 1: Compound 17
Synthesis of
3-(5-amino-2-(4-(2-(2-(3,3-difluoro-3-phosphonopropoxy)ethoxy)ethoxy)-2-m-
ethylphenethyl)benzo[f][1,7]naphthyridin-8-yl)propanoic acid
(17)
##STR00042##
Step 1: ethyl
3-(5-amino-2-{2-[4-(2-{2-[3-(diethoxyphosphoryl)-3,3-difluoropropoxy]etho-
xy}ethoxy)-2-methylphenyl]ethyl}benzo[f]1,7-naphthyridin-8-yl)propanoate
Ethyl
3-(5-amino-2-{2-[4-(2-{2-[3-(diethoxyphosphoryl)-3,3-difluoropropox-
y]ethoxy}ethoxy)-2-methylphenyl]ethyl}benzo[f]1,7-naphthyridin-8-yl)propan-
oate was prepared according to the procedure described in Example
19--Step 11, but using diethyl
1,1-difluoro-3-(2-(2-iodoethoxy)ethoxy)propylphosphonate (1-1)
(described in Example 1--Step 1) as the reagent.
Step 2:
3-(5-amino-2-(4-(2-(2-(3,3-difluoro-3-phosphonopropoxy)ethoxy)etho-
xy)-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)propanoic acid
(17)
3-(5-amino-2-(4-(2-(2-(3,3-difluoro-3-phosphonopropoxy)ethoxy)ethoxy)-2-m-
ethylphenethyl)benzo[f][1,7]naphthyridin-8-yl)propanoic acid (17)
was prepared according to the procedure described in Example
19--Step 12, but using ethyl
3-(5-amino-2-{2-[4-(2-{2-[3-(diethoxyphosphoryl)-3,3-difluoropropoxy]etho-
xy}ethoxy)-2-methylphenyl]ethyl}benzo[f]1,7-naphthyridin-8-yl)propanoate
from the previous step. The .sup.1H NMR (DMSO-d.sub.6) obtained for
3-(5-amino-2-(4-(2-(2-(3,3-difluoro-3-phosphonopropoxy)ethoxy)ethoxy)-2-m-
ethylphenethyl)benzo[f][1,7]naphthyridin-8-yl)propanoic acid (17)
was: .delta. 9.02 (s, 1H), 8.82 (s, 1H), 8.55 (d, 1H, J=8.4 Hz),
7.58 (s, 1 H), 7.49 (d, 1H, J=8.4 Hz), 7.07 (d, 1H, J=8.4 Hz), 6.75
(s, 1H), 6.68 (d, 1H, J=8.0 Hz), 4.03-4.00 (m, 2H), 3.72-3.70 (m,
2H), 3.66-3.62 (m, 2H), 3.58-3.56 (m, 2H), 3.53-3.52 (m, 2H),
3.16-3.12 (m, 2H), 3.03-2.96 (m, 4H), 2.68-2.64 (m, 2H), 2.31-2.33
(m, 2H), 2.27 (s, 3H). LRMS [M+H]=648.2
Example 18
Table 1: Compound 18
Synthesis of 3-(5-amino-2-(2-methyl-4 (2 (2 (2 (2
phosphonoethoxy)ethoxy)ethoxy)ethoxy)phenethyl)benzo[f][1,7]naphthyridin--
8-yl)propanoic acid (18)
##STR00043##
Step 1: diethyl
2-(2-(2-(2-iodoethoxy)ethoxy)ethoxy)ethylphosphonate
Diethyl 2-(2-(2-(2-iodoethoxy)ethoxy)ethoxy)ethylphosphonate was
prepared according to the procedure described in Example 22--Step
1, but using commercially available
1-iodo-2-(2-(2-(2-iodoethoxy)ethoxy)ethoxy)ethane as the
reagent.
Step 2: ethyl
3-[5-amino-2-(2-{4-[2-(2-{2-[2-(diethoxyphosphoryl)ethoxy]ethoxy}ethoxy)e-
thoxy]-2-methylphenyl}ethyl)benzo[f]1,7-naphthyridin-8-yl]propanoate
Ethyl
3-[5-amino-2-(2-{4-[2-(2-{2-[2-(diethoxyphosphoryl)ethoxy]ethoxy}et-
hoxy)ethoxy]-2-methylphenyl}ethyl)benzo[f]1,7-naphthyridin-8-yl]propanoate
was prepared according to the procedure described in Example
19--Step 11, but using diethyl
2-(2-(2-(2-iodoethoxy)ethoxy)ethoxy)ethylphosphonate from the
previous step 1 as the reagent.
Step 3:
3-(5-amino-2-(2-methyl-4-(2-(2-(2-(2-phosphonoethoxy)ethoxy)ethoxy-
)ethoxy)phenethyl)benzo[f][1,7]naphthyridin-8-yl)propanoic acid
3-(5-amino-2-(2-methyl-4-(2-(2-(2-(2-phosphonoethoxy)ethoxy)ethoxy)ethoxy-
)phenethyl)benzo[f][1,7]naphthyridin-8-yl)propanoic acid (18) was
prepared according to the procedure described in Example 19--Step
12, but using ethyl
3-[5-amino-2-(2-{4-[2-(2-{2-[2-(diethoxyphosphoryl)ethoxy]ethoxy}et-
hoxy)ethoxy]-2-methylphenyl}ethyl)benzo[f]1,7-naphthyridin-8-yl]propanoate
from the previous step 2. The .sup.1H NMR
(Dimethylsulfoxide-d.sub.6) obtained for
3-(5-amino-2-(2-methyl-4-(2-(2-(2-(2-phosphonoethoxy)ethoxy)ethoxy)ethoxy-
)phenethyl)benzo[f][1,7]naphthyridin-8-yl)propanoic acid (18) was:
.delta. 9.02 (s, 1H), 8.82 (s, 1H), 8.56 (d, 1H, J=8.4 Hz), 7.57
(s, 1 H), 7.49 (d, 1H, J=8.4 Hz), 7.07 (d, 1H, J=8.4 Hz), 6.76 (s,
1 H), 6.68 (d, 1H, J=8.4 Hz), 4.03-4.01 (m, 2H), 3.72-3.69 (m, 2H),
3.59-3.47 (m, 10H), 3.16-3.13 (m, 2H), 3.03-2.96 (m, 4H), 2.68-2.64
(m, 2H), 1.87-1.82 (m, 2H), 2.27 (s, 3H). LRMS [M+H]=642.3
Example 19
Table 1: Compound 19
Synthesis of
3-(5-amino-2-(4-(2-(3,3-difluoro-3-phosphonopropoxy)ethoxy)-2-methylphene-
thyl)benzo[f][1,7]naphthyridin-8-yl)propanoic acid (19)
##STR00044##
##STR00045## ##STR00046##
Step 1: (E)-ethyl
3-(3-(tert-butoxycarbonylamino)-4-chlorophenyl)acrylate (6-3)
To a solution of tert-butyl 5-bromo-2-chlorophenylcarbamate (6-1)
(1.0 equiv.) in acetonitrile (0.3 M) and EtOH (0.5 M) was added
K.sub.2CO.sub.3 (2.0 equiv.). The reaction was degassed and flushed
with N.sub.2, then added (E)-ethyl
3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)acrylate (6-2) (1.2
equiv.) and Pd(PPh.sub.3).sub.4 (0.1 equiv.). The reaction was
flushed again with N.sub.2 and stirred at 100.degree. C. overnight.
After cooling to room temperature, hexane was added, and the
mixture was filtered through a pad of silica, eluting with EA/Hex
(1:1) until the product was completely eluted. The filtrate was
concentrated and purified on Combiflash, eluting with 0-15% EA in
Hex to give (E)-ethyl
3-(3-(tert-butoxycarbonylamino)-4-chlorophenyl)acrylate (6-3) as a
white solid.
Step 2: ethyl
3-(3-(tert-butoxycarbonylamino)-4-chlorophenyl)propanoate (6-4)
To a solution of (E)-ethyl
3-(3-(tert-butoxycarbonylamino)-4-chlorophenyl)acrylate (6-3) (1.0
equiv.) in ethyl acetate/ethanol (1:1, 0.3 M) was added Wilkinson's
catalyst (0.10 equiv.). Hydrogen gas was introduced via a ballon,
and the reaction was stirred at room temperature for 24 hours. The
mixture was filtered through a pad of celite, washing with
dichloromethane. The filtrate was concentrated in vacuo and
purified by Combiflash using 0-10% ethyl acetate in hexane to give
ethyl 3-(3-(tert-butoxycarbonylamino)-4-chlorophenyl)propanoate
(6-4) as a solid.
Step 3: ethyl
3-(3-(tert-butoxycarbonylamino)-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-
-2-yl)phenyl)propanoate (6-5)
A solution of ethyl
3-(3-(tert-butoxycarbonylamino)-4-chlorophenyl)propanoate (6-4)
(1.0 equiv.),
4,4,4',4',5,5,5',5'-octamethyl-2,2'-bi(1,3,2-dioxaborolane) (2.0
equiv.), tris(dibenzylideneacetone)dipalladium(0) (0.05 equiv.),
2-dicyclohexylphosphino-2',4',6'-triisopropylbiphenyl (0.20
equiv.), and potassium acetate (2.0 equiv.) in 1,4-dioxane (0.2 M)
was degassed and stirred at 100.degree. C. overnight. After cooling
to ambient temperature, the reaction content was concentrated in
vacuo. The crude material was purified by Combiflash using 0-50%
ethyl acetate in hexane to afford ethyl
3-(3-(tert-butoxycarbonylamino)-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-
-2-yl)phenyl)propanoate (6-5) as a brown oil. The product was
stored at -20.degree. C. and used within a month of synthesis.
Step 4: 1-bromo-4-(methoxymethoxy)-2-methylbenzene (6-7)
To a solution of 4-bromo-3-methylphenol (6-6) (1.0 equiv.) in DMF
(0.5 M) at 0.degree. C. was added portionwise 60% wt NaH (1.5
equiv.). The addition was controlled such that internal reaction
temperature never went above 10.degree. C. The reaction was stirred
at room temperature for 45 minutes, then a solution of
chloro(methoxy)methane (1.2 equiv.) in DMF (3 M) was added dropwise
via additional funnel. The reaction was stirred at room temperature
for 3.5 hours, and then quenched by pouring into ice. The resulting
mixture was stirred at room temperature for 1 hour. Ether was
added, and the two layers were separated. The aqueous layer was
extracted (1.times.) with ether. The combined organic layers were
washed with water (2.times.), brine, dried over MgSO.sub.4, and
concentrated to give 1-bromo-4-(methoxymethoxy)-2-methylbenzene
(6-7) as a colorless oil. The crude material was used in the next
step without further purification.
Step 5:
triethyl((4-(methoxymethoxy)-2-methylphenyl)ethynyl)silane
A solution of 1-bromo-4-(methoxymethoxy)-2-methylbenzene (1.0
equiv.), triethylamine (5.0 equiv.) in DMF (0.5 M) was degassed and
flushed with nitrogen. To the reaction was added TES-acetylene
(1.05 equiv.), CuI (0.098 equiv.), and Pd(PPh.sub.3).sub.2Cl.sub.2
(0.098 equiv.). The reaction was heated to 60.degree. C. and
stirred overnight. After cooling to room temperature, water and
ether were added. The layers were separated, and the organic layer
was washed with water (2.times.). The organic layer was separated
and passed through a pad of silica (packed with hexane). The silica
was eluted with 10% EA in Hex. The fractions were combined and
concentrated to give
triethyl((4-(methoxymethoxy)-2-methylphenyl)ethynyl)silane as a
black oil. The crude material was used in the next step without
further purification.
Step 6: 1-ethynyl-4-(methoxymethoxy)-2-methylbenzene (6-8)
To a solution of
triethyl((4-(methoxymethoxy)-2-methylphenyl)ethynyl)silane (1.0
equiv.) at 0.degree. C. was slowly added tetrabutylammonium
fluoride (1M solution in THF, 0.20 equiv.). At this point, the
ice-bath was removed and the reaction mixture was allowed to stir
at room temperature for 45 minutes. The reaction mixture was then
passed through a pad of silica (packed with hexane) and eluted with
20% EtOAc in Hexanes to remove insoluble salts. The crude product
was then purified by Combiflash using 0-10% EtOAc in Hexanes to
give 1-ethynyl-4-(methoxymethoxy)-2-methylbenzene (6-8) as a
slightly brown liquid.
Step 7:
3-chloro-5-((4-(methoxymethoxy)-2-methylphenyl)ethynyl)picolinonit-
rile (6-10)
A solution of 1-ethynyl-4-(methoxymethoxy)-2-methylbenzene (6-8)
(1.0 equiv.), 3,5-dichloropicolinonitrile (6-9) (0.90 equiv.), CuI
(0.10 equiv.), and Pd(PPh.sub.3).sub.2Cl.sub.2 (0.10 equiv.), and
triethylamine (5.0 equiv.) in DMF (0.25 M) was degassed and flushed
with nitrogen. The reaction mixture was then heated to 60.degree.
C. and stirred overnight. After cooling to room temperature, water
was added. The mixture was extracted with EA (2.times.). The
combined organic layers were washed with 10% aq NH.sub.4OH
(2.times.), brine, and concentrated. The crude material was
filtered through a pad of silica (wetted with hexane). The silica
was eluted with 10% EA in Hex. The fractions were combined and
concentrated. The resulting solids were washed in hot ether and
filtered to give a yellow solid, which was used in the next step
without further purification. The filtrate was concentrated and
purified by Combiflash using 0-10% EtOAc in Hexanes to give
3-chloro-5-((4-(methoxymethoxy)-2-methylphenyl)ethynyl)picolinonitrile
(6-10) as a yellow solid.
Step 8: ethyl
3-(5-amino-2-((4-(methoxymethoxy)-2-methylphenyl)ethynyl)-benzo[f][1,7]na-
phthyridin-8-yl)propanoate (6-11)
A solution of
3-chloro-5-((4-(methoxymethoxy)-2-methylphenyl)ethynyl)picolinonitrile
(6-10) (1.0 equiv.), ethyl
3-(3-(tert-butoxycarbonylamino)-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-
-2-yl)phenyl)propanoate (6-5) (1.25 equiv.),
tris(dibenzylideneacetone)dipalladium(0) (0.10 equiv.),
dicyclohexyl(2',6'-dimethoxybiphenyl-2-yl)phosphine (0.20 equiv.),
and sodium bicarbonate (3.0 equiv.) in n-butanol/H.sub.2O (5:1, 0.2
M) was degassed and stirred at 100.degree. C. overnight. After
cooling to ambient temperature, the reaction content was diluted
with ethyl acetate and water. The two phases were separated, and
the aqueous layer was extracted twice with ethyl acetate. The
combined organic layers were washed with brine, dried over
anhydrous MgSO.sub.4, and concentrated in vacuo. The crude material
was purified by flash chromatography on a COMBIFLASH.RTM. system
(ISCO) using 0-40% ethyl acetate in DCM first to remove the
impurity, then 0-4% MeOH in DCM to give ethyl
3-(5-amino-2-((4-(methoxymethoxy)-2-methylphenyl)ethynyl)-benzo[f][1,7]na-
phthyridin-8-yl)propanoate (6-11). Further purification was
accomplished by precipitating and washing in hot ether.
Step 9: ethyl
3-(5-amino-2-(4-(methoxymethoxy)-2-methylphenethyl)benzo[f][1,7]naphthyri-
din-8-yl)propanoate (6-12)
A solution of ethyl
3-(5-amino-2-((4-(methoxymethoxy)-2-methylphenyl)ethynyl)-benzo[f][1,7]na-
phthyridin-8-yl)propanoate (6-11) (1.0 equiv.) in EtOH/THF (3:1,
0.16 M) was flushed with nitrogen. Then, 10% wt Pd/C (0.20 equiv.
by weight) was added. The reaction was flushed with hydrogen
(2.times.) and stirred under a hydrogen balloon. After 24 hours,
the reaction was filtered through a pad of celite, washing with 5%
MeOH in DCM. The filtrate was checked for the presence of starting
material using LCMS. The hydrogenation reaction was repeated until
no more of the alkyne starting material or alkene intermediate was
detected. The crude product was purified by Combiflash using 0-4%
MeOH in DCM to give ethyl
3-(5-amino-2-(4-(methoxymethoxy)-2-methylphenethyl)benzo[f][1,7]naphthyri-
din-8-yl)propanoate (6-12) as a white solid.
Step 10: ethyl
3-(5-amino-2-(4-hydroxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
propanoate (6-13)
Ethyl
3-(5-amino-2-(4-(methoxymethoxy)-2-methylphenethyl)benzo[f][1,7]nap-
hthyridin-8-yl)propanoate (6-12) (1.0 equiv.) was dissolved in EtOH
(0.2 M), then added a solution of 4M HCl in dioxane (0.2 M). The
product precipitated out as a yellow salt. After stirring for 3
hours, the reaction was poured into a stirring solution of ether.
The mixture was stirred for 10 minutes, then filtered and washed
with ether. Ethyl
3-(5-amino-2-(4-hydroxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
propanoate (6-13) was obtained as a yellow solid which was dried on
vacuum overnight (bis-HCl salt). Alternatively, the crude product
was purified by Combiflash using 0-5% MeOH in DCM to give the free
base.
Step 11: ethyl
3-(5-amino-2-(4-(2-(3-(diethoxyphosphoryl)-3,3-difluoropropoxy)ethoxy)-2--
methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)propanoate
(6-15)
To a solution of ethyl
3-(5-amino-2-(4-hydroxy-2-methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)-
propanoate (6-13) (1.0 equiv.) dissolved in DMF (0.14 M) was added
a solution of diethyl
3-(2-bromoethoxy)-1,1-difluoropropylphosphonate (6-14: described in
Example 7--Step 1) (1.3 equiv.) in DMF (0.7 M) and cesium carbonate
(4 equiv.). The reaction was stirred at 60.degree. C. After 1.5
hours (or until reaction is complete by LCMS), DCM (2 volume
equivalent) was added to the reaction. The solids (inorganic) were
filtered, and the filtrate was concentration. The crude product was
purified by Combiflash using 0-5% MeOH in DCM to give ethyl
3-(5-amino-2-(4-(2-(3-(diethoxyphosphoryl)-3,3-difluoropropoxy)ethoxy)-2--
methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)propanoate (6-15) as
an oil which upon standing became a white solid.
Step 12:
3-(5-amino-2-(4-(2-(3,3-difluoro-3-phosphonopropoxy)ethoxy)-2-met-
hylphenethyl)benzo[f][1,7]naphthyridin-8-yl)propanoic acid (19)
To a solution of ethyl
3-(5-amino-2-(4-(2-(3-(diethoxyphosphoryl)-3,3-difluoropropoxy)ethoxy)-2--
methylphenethyl)benzo[f][1,7]naphthyridin-8-yl)propanoate (6-15)
(1.0 equiv.) in DCM (0.16 M) at 0.degree. C. was added slowly TMSBr
(10 equiv.). The reaction was stirred at room temperature
overnight. Additional TMSBr (5.0 equiv.) was added at 0.degree. C.,
and the reaction was again stirred at room temperature overnight.
The solvent was removed by evaporation and the crude orange solids
dried on hi-vac briefly. The solids were suspended in EtOH (0.5 M)
and added 2.5 N NaOH (10.0 equiv.). The reaction was stirred at
80.degree. C. for 3 hours. After cooling to room temperature, the
mixture was adjusted to pH 9 to 10 and directly purified on RP-HPLC
using a C18 column, eluting with 10-40% 95:5 (MeCN/5 mM
NH.sub.4OAc) in 10 mM NH.sub.4OAc (pH 9) gradient. The fractions
containing the product were combined and concentrated in vacuo. The
resulting white gel was dissolved in refluxing 1:1 EtOH/water (0.04
M) with the addition of a few drops of ammonium hydroxide. While
hot, the mixture was slowly poured into a stirring hot solution of
acetone (0.009 M) preheated at 50.degree. C. The acetone suspension
was slowly cooled to room temperature for 15 minutes with continued
stirring, and then sat in an ice bath for 10 minutes. The solids
were filtered and washed successively with acetone (2.times.) and
ether (2.times.). The solids were dried on hi-vac overnight to give
the
3-(5-amino-2-(4-(2-(3,3-difluoro-3-phosphonopropoxy)ethoxy)-2-methylphene-
thyl)benzo[f][1,7]naphthyridin-8-yl)propanoic acid (19) as a solid.
.sup.1H NMR (Dimethylsulfoxide-d.sub.6): .delta. 9.02 (s, 1H), 8.82
(s, 1H), 8.55 (d, 1H, J=8.4 Hz), 7.58 (s, 1H), 7.48 (d, 1H, J=8.4
Hz), 7.07 (d, 1H, J=8.4 Hz), 6.75 (s, 1 H), 6.68 (d, 1H, J=8.4 Hz),
4.03-4.00 (m, 2H), 3.72-3.68 (m, 4H), 3.16-3.12 (m, 2H), 3.03-2.96
(m, 4H), 2.67-2.64 (m, 2H), 2.33-2.32 (m, 2H), 2.26 (s, 3H). LRMS
[M+H]=604.2
Example 20
Table 1: Compound 20
Synthesis of
3-(5-amino-2-(2-methyl-4-(2-(2-(2-phosphonoethoxy)ethoxy)ethoxy)phenethyl-
)benzo[f][1,7]naphthyridin-8-yl)propanoic acid (20)
##STR00047##
Step 1: diethyl 2-(2-(2-iodoethoxy)ethoxy)ethylphosphonate
A microwave tube was charged with a stirring bar, commercially
available 1,2-bis(2-iodoethoxy)ethane (1.0 equiv.) and
triethylphosphite (1.0 equiv.). The microwave tube was capped and
then irradiated at 160.degree. C. for 40 minutes with stirring. The
reaction mixture was cooled down to room temperature and was
purified by Combiflash using 0-75% EtOAc in hexanes, or
alternatively by RP-HPLC (0.035% TFA in ACN:0.05% TFA in H.sub.2O,
C18 column), to give diethyl
2-(2-(2-iodoethoxy)ethoxy)ethylphosphonate as pale yellow oil.
Step 2: ethyl
3-(5-amino-2-{2-[4-(2-{2-[2-(diethoxyphosphoryl)ethoxy]ethoxy}ethoxy)-2-m-
ethylphenyl]ethyl}benzo[f]1,7-naphthyridin-8-yl)propanoate
Ethyl
3-(5-amino-2-{2-[4-(2-{2-[2-(diethoxyphosphoryl)ethoxy]ethoxy}ethox-
y)-2-methylphenyl]ethyl}benzo[f]1,7-naphthyridin-8-yl)propanoate
was prepared according to the procedure described in Example
19--Step 11, but using diethyl
2-(2-(2-iodoethoxy)ethoxy)ethylphosphonate from the previous step 1
as the reagent.
Step 3:
3-(5-amino-2-(2-methyl-4-(2-(2-(2-phosphonoethoxy)ethoxy)ethoxy)ph-
enethyl)benzo[f][1,7]naphthyridin-8-yl)propanoic acid (20)
3-(5-amino-2-(2-methyl-4-(2-(2-(2-phosphonoethoxy)ethoxy)ethoxy)phenethyl-
)benzo[f][1,7]naphthyridin-8-yl)propanoic acid (20) was prepared
according to the procedure described in Example 19--Step 12, but
using ethyl
3-(5-amino-2-{2-[4-(2-{2-[2-(diethoxyphosphoryl)ethoxy]ethoxy}ethoxy)-2-m-
ethylphenyl]ethyl}benzo[f]1,7-naphthyridin-8-yl)propanoate from the
previous step 2. The .sup.1H NMR (Dimethylsulfoxide-d.sub.6)
obtained for
3-(5-amino-2-(2-methyl-4-(2-(2-(2-phosphonoethoxy)ethoxy)ethoxy)phenethyl-
)benzo[f][1,7]naphthyridin-8-yl)propanoic acid (20) was: .delta.
9.02 (s, 1H), 8.82 (s, 1H), 8.55 (d, 1H, J=8.0 Hz), 7.58 (s, 1 H),
7.49 (d, 1H, J=8.4 Hz), 7.06 (d, 1H, J=8.0 Hz), 6.76 (s, 1 H), 6.68
(d, 1H, J=8.0 Hz), 4.03-4.00 (m, 2H), 3.71-3.69 (m, 2H), 3.60-3.54
(m, 4H), 3.51-3.49 (m, 2H), 3.16-3.12 (m, 2H), 3.03-2.96 (m, 4H),
2.67-2.66 (m, 2H), 2.33-2.32 (m, 2H), 2.26 (s, 3H). LRMS
[M+H]=598.2
Example 21
Table 1: Compound 21
Synthesis of
3-(5-amino-2-(2-methyl-4-(2-(2-phosphonoethoxy)ethoxy)phenethyl)benzo[f][-
1,7]naphthyridin-8-yl)propanoic acid 21
##STR00048##
Step 1: diethyl 2-(2-bromoethoxy)ethylphosphonate
Diethyl 2-(2-bromoethoxy)ethylphosphonate was prepared according to
the procedure described in Example 22--Step 1, but using
commercially available 1-bromo-2-(2-bromoethoxy)ethane as the
reagent.
Step 2:
3-(5-amino-2-(4-(2-(2-(diethoxyphosphoryl)ethoxy)ethoxy)-2-methylp-
henethyl)benzo[f][1,7]naphthyridin-8-yl)propanoic acid
3-(5-amino-2-(4-(2-(2-(diethoxyphosphoryl)ethoxy)ethoxy)-2-methylphenethy-
l)benzo[f][1,7]naphthyridin-8-yl)propanoic acid was prepared
according to the procedure described in Example 19--Step 11, but
using diethyl 2-(2-bromoethoxy)ethylphosphonate from the previous
step 1 as the reagent.
Step 3:
3-(5-amino-2-(2-methyl-4-(2-(2-phosphonoethoxy)ethoxy)phenethyl)be-
nzo[f][1,7]naphthyridin-8-yl)propanoic acid (21)
3-(5-amino-2-(2-methyl-4-(2-(2-phosphonoethoxy)ethoxy)phenethyl)benzo[f][-
1,7]naphthyridin-8-yl)propanoic acid (21) was prepared according to
the procedure described in Example 19--Step 12, but using
3-(5-amino-2-(4-(2-(2-(diethoxyphosphoryl)ethoxy)ethoxy)-2-methylphenethy-
l)benzo[f][1,7]naphthyridin-8-yl)propanoic acid from the previous
step 2. The .sup.1H NMR (MeOD-d4) obtained for
3-(5-amino-2-(2-methyl-4-(2-(2-phosphonoethoxy)ethoxy)phenethyl)benzo[f][-
1,7]naphthyridin-8-yl)propanoic acid (21) was: .delta. 8.59 (s,
1H), 8.45 (s, 1H), 8.18 (d, 1H, J=8.4 Hz), 7.52 (s, 1 H), 7.31 (d,
1H, J=8.0 Hz), 6.93 (d, 1H, J=8.4 Hz), 6.72 (s, 1 H), 6.65 (d, 1H,
J=8.4 Hz), 4.06-4.03 (m, 2H), 3.84-3.76 (m, 4H), 3.15-3.07 (m, 4H),
3.01-2.97 (m, 2H), 2.68-2.64 (m, 2H), 2.22 (s, 3H), 2.03-1.99 (m,
2H). LRMS [M+H]=554.2
Example 22
Table 1: Compound 22
Synthesis of
2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)ethylphosphonic acid (22)
##STR00049##
Step 1: diethyl 2-bromoethylphosphonate
Commercially available 1,2-dibromoethane (1.0 equiv.) and triethyl
phosphite (1.0 equiv.) were heated with microwave irradiation at
160.degree. C. for 20 minutes. The resulting residue was purified
by reverse phase high performance liquid chromatography (HPLC)
(0.035% TFA in ACN: 0.05% TFA in H.sub.2O, C18 column) to give
diethyl 2-bromoethylphosphonate as a colorless liquid.
Step 2: diethyl
2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)ethylphosphonate
Diethyl
2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3--
methylphenoxy)ethylphosphonate was prepared according to the
procedure described in Example 1--Step 2, but using diethyl
2-bromoethylphosphonate from the previous step 1 as the
reagent.
Step 3:
2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-m-
ethylphenoxy)ethylphosphonic acid (22)
2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)ethylphosphonic acid (22) was prepared according to the
procedure described in Example 1--Step 3, but using diethyl
2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)ethylphosphonate from the previous step 2. TFA was added to
the .sup.1H NMR sample to solubilize the compound for analysis. The
.sup.1H NMR (dimethyl sulfoxide) obtained for
2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)ethylphosphonic acid (22) was: .delta. 8.83 (s, 1H), 8.71 (s,
1H), 8.35 (d, 1H, J=8.3 Hz), 7.35 (s, 1H), 7.15 (d, 1H, J=9.6 Hz),
7.08 (d, 1H, J=8.4 Hz), 7.06-7.03 (br, 2H) 6.71 (s, 1H), 6.64 (d,
1H, J=8.1 Hz), 4.09-3.99 (m, 2H), 3.07 (t, 2H, J=6.9), 2.93 (t, 2H,
J=6.7), 2.44 (s, 3 H), 2.26 (s, 3H), 1.72-1.62 (m, 2H). LRMS
[M+H]=452.2
Example 23
Table 1: Compound 23
Synthesis of
6-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)hexylphosphonic acid (23)
##STR00050##
Step 1: diethyl 6-bromohexylphosphonate
Diethyl 6-bromohexylphosphonate was prepared according to the
procedure described in Example 22--Step 1, but using commercially
available 1,6-dibromohexane as the reagent.
Step 2: diethyl
6-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)hexylphosphonate
Diethyl
6-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3--
methylphenoxy)hexylphosphonate was prepared according to the
procedure described in Example 1--Step 2, but using diethyl
6-bromohexylphosphonate from the previous step 1 as the
reagent.
Step 3:
6-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-m-
ethylphenoxy)hexylphosphonic acid (23)
6-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)hexylphosphonic acid (23) was prepared according to the
procedure described in Example 1--Step 3, but using diethyl
6-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)hexylphosphonate. TFA was added to the .sup.1H NMR sample to
solubilize the compound for analysis. The .sup.1H NMR (dimethyl
sulfoxide-d.sub.6) obtained for
6-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)hexylphosphonic acid (23) was: .delta. 8.95 (s, 1H), 8.81 (s,
1H), 8.50 (d, 1H, J=8.4 Hz), 7.52 (s, 1H), 7.40 (d, 1H, J=8.4 Hz),
7.01 (d, 1H, J=8.4 Hz), 6.71 (s, 1H), 6.64 (d, 1H, J=10.9 Hz), 3.87
(t, 2H, J=6.34 Hz), 3.13 (t, 2H, J=7.1 Hz), 2.96 (t, 2H, J=7.0 Hz),
2.69-2.66 (m, 1H), 2.35-2.32 (m, 1H), 2.25 (s, 2H), 1.72-1.62 (m,
2H), 1.62-1.51 (m, 2H), 1.51-1.40 (m, 2H). LRMS [M+H]=508.2
Example 24
Table 1: Compound 24
Synthesis of
6-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)-1,1-difluorohexylphosphonic acid (24)
##STR00051##
Step 1: diethyl 6-bromo-1,1-difluorohexylphosphonate
Diethyl 6-bromo-1,1-difluorohexylphosphonate was prepared according
to the procedure described in Example 1--Step 1, but using
commercially available 1,5-dibromopentane as the reagent.
Step 2: diethyl
6-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)-1,1-difluorohexylphosphonate
Diethyl
6-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3--
methylphenoxy)-1,1-difluorohexylphosphonate was prepared according
to the procedure described in Example 1--Step 2, but using diethyl
6-bromo-1,1-difluorohexylphosphonate from the previous step 1 as
the reagent.
Step 3:
6-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-m-
ethylphenoxy)-1,1-difluorohexylphosphonic acid (24)
6-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)-1,1-difluorohexylphosphonic acid (24) was prepared according
to the procedure described in Example 1--Step 3, but using diethyl
6-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)-1,1-difluorohexylphosphonate from the previous step 2. TFA
was added to the .sup.1H NMR sample to solubilize the compound for
analysis. The .sup.1H NMR (MeOD-d4) obtained for
6-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)-1,1-difluorohexylphosphonic acid (24) was: .delta. 8.73 (s,
1H), 8.60 (s, 1H), 8.31 (d, 1H, J=8.4 Hz), 7.48 (s, 1H), 7.43 (d,
1H, J=8.3 Hz), 6.91 (d, 1H, J=8.4 Hz), 6.70 (s, 1H), 6.61 (d, 1H,
J=11.0 Hz), 3.90 (t, 2H, J=6.3 Hz), 3.20 (t, 2H, J=7.3 Hz), 3.03
(t, 2H, J=7.5 Hz), 2.54 (s, 2H), 2.22 (s, 3H), 1.79-1.71 (m, 2H),
1.69-1.59 (m, 2H), 1.57-1.47 (m, 2H). LRMS [M+H]=544.2
Example 25
Table 1: Compound 25
Synthesis of
4-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylp-
henoxy)methyl)benzylphosphonic acid (25)
##STR00052##
Step 1: diethyl 4-(bromomethyl)benzylphosphonate
Diethyl 4-(bromomethyl)benzylphosphonate was prepared according to
the procedure described in Example 22--Step 1, but using
commercially available 1,4-bis(bromomethyl)benzene as the
reagent.
Step 2: diethyl
4-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylp-
henoxy)methyl)benzylphosphonate
Diethyl
4-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-
-methylphenoxy)methyl)benzylphosphonate was prepared according to
the procedure described in Example 1--Step 2, but using diethyl
4-(bromomethyl)benzylphosphonate from the previous step 1 as the
reagent.
Step 3:
4-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3--
methylphenoxy)methyl)benzylphosphonic acid (25)
4-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylp-
henoxy)methyl)benzylphosphonic acid (25) was prepared according to
the procedure described in Example 1--Step 3, but using diethyl
4-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylp-
henoxy)methyl)benzylphosphonate from the previous step 2. The
.sup.1H NMR (MeOD-d4) obtained for
4-((4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylp-
henoxy)methyl)benzylphosphonic acid (25) was: .delta. 8.72 (s, 1H),
8.58 (s, 1H), 8.30 (d, 1H, J=8.4 Hz), 7.48 (s, 1H), 7.42 (d, 1H,
J=9.5 Hz), 7.36-7.30 (m, 4H), 6.93 (d, 1H, J=8.4 Hz), 6.78 (s, 1H),
6.67 (d, 1H, J=8.4 Hz), 4.98 (s, 2H), 3.96 (s, 2H), 3.20 (t, 2H,
J=7.2 Hz), 3.04 (t, 2H, J=7.2 Hz), 2.54 (s, 3H), 2.23 (s, 3H). LRMS
[M+H]=528.2
Example 26
Table 1: Compound 26
Synthesis of 2 (2 (2 (4 (2 (5
amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylphenoxy)ethox-
y)ethoxy)ethylphosphonic acid (26)
##STR00053##
Step 1: diethyl 2-(2-(2-iodoethoxy)ethoxy)ethylphosphonate
Diethyl 2-(2-(2-iodoethoxy)ethoxy)ethylphosphonate was prepared
according to the procedure described in Example 20--Step 1.
Step 2: diethyl
2-(2-(2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-me-
thylphenoxy)ethoxy)ethoxy)ethylphosphonate
Diethyl
2-(2-(2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)eth-
yl)-3-methylphenoxy)ethoxy)ethoxy)ethylphosphonate was prepared
according to the procedure described in Example 1--Step 2, but
using diethyl 2-(2-(2-iodoethoxy)ethoxy)ethylphosphonate from the
previous step 1 as the reagent.
Step 3:
2-(2-(2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethy-
l)-3-methylphenoxy)ethoxy)ethoxy)ethylphosphonic acid (26)
2-(2-(2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-me-
thylphenoxy)ethoxy)ethoxy)ethylphosphonic acid (26) was prepared
according to the procedure described in Example 1--Step 3, but
using diethyl
2-(2-(2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-me-
thylphenoxy)ethoxy)ethoxy)ethylphosphonate from the previous step
2. The .sup.1H NMR (MeOD-d4) obtained for
2-(2-(2-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-me-
thylphenoxy)ethoxy)ethoxy)ethylphosphonic acid (26) was: .delta.
8.73 (s, 1H), 8.66 (s, 1H), 8.38 (d, 1H, J=8.4 Hz), 7.52 (s, 1H),
7.47 (d, 1H, J=8.3 Hz), 7.36 (s, 1H), 6.93 (d, 1H, J=8.4 Hz), 6.75
(s, 2H), 6.64 (d, 1H, J=10.8 Hz), 4.09-4.06 (m, 2H), 3.80-3.76 (m,
2H), 3.69-3.64 (m, 2H), 3.64-3.59 (m, 2H), 3.53-3.49 (m, 2H), 3.25
(t, 2H, J=7.0 Hz), 3.09 (t, 2H, J=7.5 Hz), 2.58 (s, 3H), 2.28 (s,
3H), 2.13-2.01 (m, 2H). LRMS [M+H]=540.2
Example 27
Table 1: Compound 27
Synthesis of
5-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)pentylphosphonic acid (27)
##STR00054##
Step 1: diethyl 5-bromopentylphosphonate
Diethyl 5-bromopentylphosphonate was prepared according to the
procedure described in Example 22--Step 1, but using commercially
available 1,5-dibromopentane as the reagent.
Step 2: diethyl
5-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)pentylphosphonate
Diethyl
5-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3--
methylphenoxy)pentylphosphonate was prepared according to the
procedure described in Example 1--Step 2, but using diethyl
5-bromopentylphosphonate from the previous step 1 as the
reagent.
Step 3:
5-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-m-
ethylphenoxy)pentylphosphonic acid (27)
5-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)pentylphosphonic acid (27) was prepared according to the
procedure described in Example 1--Step 3, but using diethyl
5-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)pentylphosphonate from the previous step 2. The .sup.1H NMR
(dimethyl sulfoxide-d.sub.6) obtained for
5-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)pentylphosphonic acid (27) was: .delta. 8.99 (s, 1H), 8.83
(s, 1H), 8.53 (d, 1H, J=8.4 Hz), 7.51 (s, 1H), 7.39 (d, 1H, J=8.4
Hz), 7.06 (d, 1H, J=8.4 Hz), 6.71 (s, 1H), 6.65 (d, 1H, J=8.3 Hz),
3.87 (t, 2H, J=6.3 Hz), 3.12 (t, 2H, J=7.0 Hz), 2.96 (t, 2H, J=7.0
Hz), 2.5 (s, 3H), 2.26 (s, 3H), 1.73-1.64 (m, 2H), 1.64-1.58 (m,
2H), 1.58-1.51 (m, 2H), 1.51-1.41 (m, 2H). LRMS [M+H]=494.2
Example 28
Table 1: Compound 28
Synthesis of
4-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)butylphosphonic acid (28)
##STR00055##
Step 1: diethyl 4-bromobutylphosphonate
Diethyl 4-bromobutylphosphonate was prepared according to the
procedure described in Example 22--Step 1, but using commercially
available 1,4-dibromobutane as the reagent.
Step 2: diethyl
4-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)butylphosphonate
Diethyl
4-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3--
methylphenoxy)butylphosphonate was prepared according to the
procedure described in Example 1--Step 2, but using diethyl
4-bromobutylphosphonate from the previous step 1 as the
reagent.
Step 3:
4-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-m-
ethylphenoxy)butylphosphonic acid (28)
4-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)butylphosphonic acid (28) was prepared according to the
procedure described in Example 1--Step 3, but using diethyl
4-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)butylphosphonate from the previous step 2. The .sup.1H NMR
(dimethyl sulfoxide-d.sub.6) obtained for
4-(4-(2-(5-amino-8-methylbenzo[f][1,7]naphthyridin-2-yl)ethyl)-3-methylph-
enoxy)butylphosphonic acid (28) was: .delta. 8.93 (s, 1H), 8.79 (s,
1H), 8.48 (d, 1H, J=8.3 Hz), 7.51 (s, 1H), 7.37 (d, 1H, J=8.5 Hz),
7.04 (d, 1H, J=8.4 Hz), 6.71 (s, 1H), 6.63 (d, 1H, J=8.3 Hz), 3.89
(t, 2H, J=6.09 Hz), 3.12 (t, 2H, J=6.8 Hz), 2.96 (t, 2H, J=6.9 Hz),
2.47 (s, 3H), 2.34-2.31 (m, 2H), 2.24 (s, 3H), 1.80-1.67 (m, 4H),
1.67-1.61 (m, 2H). LRMS [M+H]=480.2
The compounds of Formula (I), prepared following the procedures
described above, are set forth in Table 1 along with [M+H] data and
Human TLR7 EC.sub.50 (nM) data.
TABLE-US-00003 TABLE 1 Physical Data Human TLR7 Compound MS (m/z)
EC.sub.50 (nM) Number Structure [M + H] HEK293 1 ##STR00056## 466.2
226 2 ##STR00057## 424.0 315 3 ##STR00058## 438.0 3170 4
##STR00059## 530.2 559 5 ##STR00060## 516.2 308 6 ##STR00061##
590.2 1640 7 ##STR00062## 546.3 1010 8 ##STR00063## 578.2 375 9
##STR00064## 502.6 390 10 ##STR00065## 450.2 153 11 ##STR00066##
452.2 90 12 ##STR00067## 468.1 201 13 ##STR00068## 514.2 1051 14
##STR00069## 452.2 885 15 ##STR00070## 524.2 65 16 ##STR00071##
574.2 137 17 ##STR00072## 648.2 5 18 ##STR00073## 641.6 964 19
##STR00074## 604.2 360 20 ##STR00075## 598.2 384 21 ##STR00076##
554.2 204 22 ##STR00077## 452.2 1160 23 ##STR00078## 508.2 791 24
##STR00079## 544.2 4260 25 ##STR00080## 528.2 975 26 ##STR00081##
540.2 2592 27 ##STR00082## 494.2 921 28 ##STR00083## 480.2 524
Assays
Compounds of Formula (I) provided herein were assayed to measure
their capacity to modulate toll-like receptor 7.
Human Peripheral Blood Mononuclear Cell Assay
The bioactivity of the compounds of Formula (I) provided herein
were tested in the human peripheral blood assay (human PBMC) using
a panel of independent normal human donors according to approved
guidelines by the institutional review committee. Human PBMC were
isolated from freshly peripheral blood using a Ficoll density
gradient (GE healthcare 17-1440-03). 30-35 mLs of peripheral human
blood were layered onto 15 mLs of Ficoll in 50 ml conical tubes,
followed by centrifugation at 1800 rpm (Eppendorf Centrifuge 5810R
with biohazard caps over the tube buckets) at room temperature for
30 minutes with no acceleration and no brake. The buffy layers were
then collected and transferred onto new 50 ml conical tubes and
washed twice in complete media consisting of RPMI 1640 (11875085
from Invitrogen Corporation, Carlsbad, Calif.) supplemented with
10% heat inactivated fetal bovine serum (Gibco 10099-141), 1%
Pen-Strep (Gibco#15140-122), 1 mM non essential amino acids
(Gibco#11140-050), 1 mM sodium pyruvate (Gibco#11360-070), 2 mM
L-Glutamine (Gibco#25030-081) and 1 mM HEPES (Gibco#15630-080).
Viable cells were then counted using trypan blue staining, plated
in 96 well flat bottom plates (Becton Dickinson #353070) at
2.times.10.sup.5 cells per well in 200 .mu.l total volume of
complete media. Compounds were then added in a 10 point dose
response format starting at 100 .mu.M, 3 fold dilution. Negative
controls wells received equal concentration of DMSO. Culture
supernatants were collected after 18-24 hours incubation at
37.degree. C., 5% CO.sub.2, stored at -20.degree. C. until further
use.
IL-6 levels in the culture supernatants were measured using a
Luminex kit (Biorad). Data analysis is performed using Prism
software from GraphPad (San Diego, Calif.). Dose response curves
are generated for each compound and EC.sub.50 values were
determined as the concentration that gives 50% of the maximal
signal.
Reporter Gene Assay
Human embryonic kidney 293 (HEK 293) cells were stably transfected
with human TLR7 and an NF-kB-driven luciferase reporter vector
(pNifty-Luciferase). As a control assay, normal Hek293 transfected
with pNifty-Luc were used. Cells were cultured in DMEM supplemented
with 2 mM L-glutamine, 10% heart inactivated FBS, 1% penicillin and
streptomycin, 2 .mu.g/ml puromycin (InvivoGen #ant-pr-5) and 5
.mu.g/ml of blasticidin (Invitrogen #46-1120). Bright-Glo.TM.
Luciferase assay buffer and substrate were supplied by Promega
#E263B and #E264B (assay substrate and buffer respectively). 384
well clear-bottom plates were supplied by Greiner bio-one
(#789163-G) and were custom bar-coded plates.
Cells were plated at 25,000 cells/well in 384-well plates in a
final volume of 50 .mu.l of media. Cells were allowed to adhere to
the plates after overnight (18 hours) culture at 37.degree. C. and
5% CO.sub.2. Serially diluted experimental and positive control
compounds were then dispensed to each well and incubated for 7
hours at 37.degree. C. and 5% CO.sub.2. Cells stimulated with DMSO
alone also serve as negative controls. After the incubation, 30
.mu.l of the pre-mix assay buffer and substrate buffer were added
to each well according to manufacturer's instructions. The
luminescence signal was read on a CLIPR machine with an integration
time of 20 seconds per plate.
Dose response curves are generated for each compound and EC.sub.50
values were determined as the concentration that gives 50% of the
maximal signal.
Certain Assay Results
Various compounds of Formula (I) in free form or in
pharmaceutically acceptable salt form, exhibit pharmacological
properties, for example, as indicated by the in vitro tests
described in this application. The EC.sub.50 value in those
experiments is given as that concentration of the test compound in
question that provoke a response halfway between the baseline and
maximum responses. In certain examples compounds of Formula (I)
have EC.sub.50 values in the range from 1 nM to 100 .mu.M. In other
examples, compounds of Formula (I) have EC.sub.50 values in the
range from 1 nM to 50 .mu.M. In other examples, compounds of
Formula (I) have EC.sub.50 values in the range from 1 nM to 25
.mu.M. In other examples, compounds of Formula (I) have EC.sub.50
values in the range from 1 nM to 20 .mu.M. In other examples,
compounds of Formula (I) have EC.sub.50 values in the range from 1
nM to 15 .mu.M. In other examples, compounds of Formula (I) have
EC.sub.50 values in the range from 1 nM to 10 .mu.M. In other
examples, compounds of Formula (I) have EC.sub.50 values in the
range from 1 nM to 5 .mu.M. In other examples, compounds of Formula
(I) have EC.sub.50 values in the range from 1 nM to 2 .mu.M. In
other examples, compounds of Formula (I) have EC.sub.50 values in
the range from 1 nM to 1 .mu.M. In other examples, compounds of
Formula (I) have EC.sub.50 values in the range from 1 nM to 500 nM.
In other examples, compounds of Formula (I) have EC.sub.50 values
in the range from 1 nM to 250 nM. In other examples, compounds of
Formula (I) have EC.sub.50 values in the range from 1 nM to 100 nM.
In other examples, compounds of Formula (I) have EC.sub.50 values
in the range from 1 nM to 50 nM. In other examples, compounds of
Formula (I) have EC.sub.50 values in the range from 1 nM to 25 nM.
In other examples, compounds of Formula (I) have EC.sub.50 values
in the range from 1 nM to 10 nM. Such EC.sub.50 values are obtained
relative to the activity of resiquimod set to 100%.
By way of example only, the EC.sub.50 for TLR-7 stimulation by
certain compounds of Formula (I) are listed in Table 1.
Formulation with Aluminum-Containing Adjuvants
The binding of the compounds of Formula (I) provided herein to
aluminum-containing adjuvants at pH 9 and pH 6.5 was evaluated
using HPLC to monitor the presence of the compound of Formula (I)
in the supernatant.
Evaluation of Binding at pH 9
Compound 1 (0.5 mg/mL) was dissolved in 10 mM NaOH and added to
aluminum hydroxide adjuvant (2 mg/mL) resulting in a 100 .mu.g/dose
formulation. The supernatant was evaluated with HPLC using a
ballistic gradient (from 10% CH.sub.3CN-0.1% TFA to 100%
CH.sub.3CN-0.1% TFA in 2.5 minutes) on a C18 (50 cm.times.4.6 mm)
ACE column at 45.degree. C. To evaluate the effect of supernatant
temperature and incubation time on binding, the supernatant was
evaluated at a supernatant temperature of room temperature and at
37.degree. C. after 1 hour, 5 hours and 24 hours. A control without
aluminum hydroxide was also evaluated. The HPLC chromatograms for
compound 1 formulations with and without aluminum hydroxide, at
either temperature or incubation time, indicated that compound 1
was not present in the supernatant when aluminum hydroxide was
included in the formulation. FIG. 1 shows the concentration of
compound 1 in the supernatant, as measured via HPLC, for compound 1
with alum at room temperature and 37.degree. C., and for compound 1
alone (control).
Compound 5 (1 mg/mL) was dissolved in 10 mM NaOH and added to
aluminum hydroxide adjuvant (2 mg/mL) resulting in a 100 .mu.g/dose
formulation. The supernatant was evaluated with HPLC using a
ballistic gradient (from 10% CH.sub.3CN-0.1% TFA to 100%
CH.sub.3CN-0.1% TFA in 2.5 minutes) on a C18 (50 cm.times.4.6 mm)
ACE column at 45.degree. C. To evaluate the effect of supernatant
temperature and incubation time on binding, the supernatant was
evaluated at a supernatant temperature of room temperature and at
37.degree. C. after 1 hour, 5 hours and 24 hours. A control without
aluminum hydroxide was also evaluated. The HPLC chromatograms for
compound 5 formulations with and without aluminum hydroxide, at
either temperature or incubation time, indicated that compound 5
was not present in the supernatant when aluminum hydroxide was
included in the formulation.
Evaluation of Binding at pH 6.5
Compound 1 (0.5 mg/mL) was dissolved in 10 mM NaOH and added to
aluminum hydroxide adjuvant (2 mg/mL) resulting in a 100 .mu.g/dose
formulation. The pH of the solution was adjusted to pH 6.5 using
HCl. The supernatant was evaluated with HPLC using a ballistic
gradient (from 10% CH.sub.3CN-0.1% TFA to 100% CH.sub.3CN-0.1% TFA
in 2.5 minutes) on a C18 (50 cm.times.4.6 mm) ACE column at
45.degree. C. To evaluate the effect of supernatant temperature and
incubation time on binding, the supernatant was evaluated at a
supernatant temperature of room temperature and at 37.degree. C.
after 1 hour, 5 hours and 24 hours. A control without aluminum
hydroxide was also evaluated. The HPLC chromatograms for compound 1
formulations with and without aluminum hydroxide, at either
temperature or incubation time, indicated that compound 1 was not
present in the supernatant when aluminum hydroxide was included in
the formulation.
Evaluation of Binding at pH 6.7
Compound 5 (1 mg/mL) was dissolved in 10 mM histidine buffer (1
mg/mL) and added to aluminum hydroxide adjuvant (2 mg/mL) resulting
in a 100 .mu.g/dose formulation. The supernatant was evaluated with
HPLC using a ballistic gradient (from 10% CH.sub.3CN-0.1% TFA to
100% CH.sub.3CN-0.1% TFA in 2.5 minutes) on a C18 (50 cm.times.4.6
mm) ACE column at 45.degree. C. To evaluate the effect of
supernatant temperature and incubation time on binding, the
supernatant was evaluated at a supernatant temperature of room
temperature and at 37.degree. C. after 1 hour, 5 hours and 24
hours. A control without aluminum hydroxide was also evaluated. The
HPLC chromatograms for compound 5 formulations with and without
aluminum hydroxide, at either temperature or incubation time,
indicated that compound 5 was not present in the supernatant when
aluminum hydroxide was included in the formulation.
Evaluation of Binding at pH 9 (Histidine Buffer Adjusted to pH
9)
An organic solvent extraction method was used to evaluate whether
compound 1 was covalently bound to aluminum hydroxide. The
formulation was prepared as follows: 2 mg/ml aluminum hydroxide,
100 .mu.g/dose compound 1, 10 mM histidine buffer) and the pH was
adjusted to 9. A control formulation without aluminum hydroxide was
also prepared.
One ml of the formulation containing Alum was mixed with 1 ml of
KH.sub.2PO.sub.4 1M pH 9 (0.5M final conc, pH 9) and was left in
gentle agitation overnight at 37.degree. C. to allow desorption of
compound 1 (compound 5) from the aluminum hydroxide via ligand
exchange with the phosphate anions. Organic extraction was then
performed: 1 ml of each sample was mixed with 1 ml of n-butanol and
vortexed. After the formation of 2 phases, the upper phase
(butanol) was recovered, dried with N.sub.2 and resuspended in
MeOH/10 mM NaOH. HPLC analysis was run both for the formulation
supernatants and for the butanol extracted samples (C18 column;
0-100% B in 2 min; A=0.1% TFA in H.sub.2O; B=0.1% TFA in ACN).
Increased quantities of compound 1 were observed in the supernatant
of the formulation treated with KH.sub.2PO.sub.4, indicating
desorption of compound 1 by the phosphate anions. The same trend
was observed with the extracted samples. The data obtained is given
in the table 2 below:
TABLE-US-00004 TABLE 2 Retention Concentration Time (min) Area
(mg/ml) Compound 1 supernatent 1.9 2687 0.005 +/- 0.001 Compound 1
phosphate 1.9 32303 0.059 +/- 0.001 supernatent Compound 1
supernatant 1.9 180678 0.329 +/- 0.001 control Compound 1 extaract
1.9 15008 0.027 +/- 0.001 Compound 1 phosphate/ 1.9 65427 0.119 +/-
0.001 extract Compound 1 control/extract 1.9 119470 0.217 +/-
0.001
Effect on the Binding of MenB Antigens to Aluminum Hydroxide
SDS PAGE was used to evaluate the effect of the binding of compound
1 to aluminum hydroxide adjuvant on the ability of MenB antigens to
bind to aluminum hydroxide adjuvant. Compound 1 was dissolved in 10
mM NaOH at 0.5 mg/ml final concentration. Alum and Compound 1 were
combined at 1:6 (Compound 1:Alum) weight ratio in the presence of
10 mM Histidine final concentration. The pH was adjusted to 9.2 and
the mixture was gently agitated for 3 hours at room temperature,
allowing the reaction to occur. The mixture was centrifuged at
5000.times.g for 10 minutes and the supernatant discarded. The
pellet (i.e. the compound 1-modified Alum) was resuspended in the
initial Alum buffer to obtain the starting alum concentration. The
pH was adjusted to 6.5. The modified Alum was then used for the
formulation with the MenB antigens.
SDS PAGE analysis of the supernatant of MenB antigens formulated
with aluminum hydroxide adjuvant alone (Alum) or with aluminum
hydroxide adjuvant together with compound 1 is shown in FIG. 1. The
MenB antigens evaluated were 287-953, 936-741 and 961c, which
antigens are described in WO2004/032958 and Giuliani et al. (2006)
Proc. Natl. Acad. Sci. USA 103:10834-10839. Lanes labeled "Sn" and
TCA'' represent analysis of the formulations supernatants after
centrifugation to pellet the aluminum hydroxide adjuvant. Lanes
labeled "Des" represent analysis of antigens recovered after
desorption from the aluminum hydroxide with 0.5 M phosphate buffer.
FIG. 2 shows that the MenB antigens bind to aluminum hydroxide as
effectively with compound 1 as obtained without compound 1.
The adsorption of compound 16 and compound 18 to aluminum hydroxide
was also evaluated using the alum formulation described above for
compound 1. HPLC analysis showed that, for both compounds, no
compound was observed in the supernatant after addition of aluminum
hydroxide. However, compound 16 and compound 18 were recovered
after desorption with 0.5M KH.sub.2PO.sub.4. Note that organic
solvent extraction was not required due to the water solubility of
the two compounds. In addition, SDS PAGE analysis of antigen
binding in the presence of compound 16 or compound 18 was carried
out as described above. For both compounds all the 3 MenB antigens
were completely adsorbed to the compound 16-modified alum and to
the compound 18-modified alum.
Evaluation of Binding to Alum in 10 mM Histidine Buffer
The adsorption of compounds 6, 16, 17, 19 and 20 to aluminum
hydroxide was evaluated as follows: to three volume equivalents of
aqueous aluminum hydroxide (2 mg/mL) was added one volume
equivalent of compound in 10 mM histidine buffer (4 mg/mL) at pH
6.8. The resulting solution was diluted 10-fold with blank
histidine buffer to a final compound concentration of 0.1 mg/mL.
Diluted solutions were incubated at 37.degree. C. for 5 hours. The
samples were centrifuged at 14,000 rpm for 10 minutes to pellet the
insoluble. The supernatant (along with an internal standard) was
then evaluated by LC-MS/MS using a ballistic gradient (from 5%
CH.sub.3CN-0.5% formic acid to 95% CH.sub.3CN-1.0% formic acid in
3.5 minutes) on a Waters Atlantis dC18 (50 mm.times.2.1 mm) column
at room temperature against a calibration curve prepared at known
compound concentrations ranging from 0.005 to 50 .mu.M. The
concentration in the supernatant was calculated as % unbound to
alum compared to control; the % bound to alum was calculated as
100% minus % unbound. Table 3 lists the % binding of the respective
compounds tested.
TABLE-US-00005 TABLE 3 Compound in % Alum bound in Table 1
Histidine buffer 6 98.2 16 94.5 17 96.2 19 96.0 20 97.0
It is understood that the examples and embodiments described herein
are for illustrative purposes only and that various modifications
or changes in light thereof will be suggested to persons skilled in
the art and are to be included within the spirit and purview of
this application and scope of the appended claims. All
publications, patents, and patent applications cited herein are
hereby incorporated by reference for all purposes.
SEQUENCE LISTINGS
1
61248PRTNeisseria meningitidis 1Val Ala Ala Asp Ile Gly Ala Gly Leu
Ala Asp Ala Leu Thr Ala Pro1 5 10 15Leu Asp His Lys Asp Lys Gly Leu
Gln Ser Leu Thr Leu Asp Gln Ser 20 25 30Val Arg Lys Asn Glu Lys Leu
Lys Leu Ala Ala Gln Gly Ala Glu Lys 35 40 45Thr Tyr Gly Asn Gly Asp
Ser Leu Asn Thr Gly Lys Leu Lys Asn Asp 50 55 60Lys Val Ser Arg Phe
Asp Phe Ile Arg Gln Ile Glu Val Asp Gly Gln65 70 75 80Leu Ile Thr
Leu Glu Ser Gly Glu Phe Gln Val Tyr Lys Gln Ser His 85 90 95Ser Ala
Leu Thr Ala Phe Gln Thr Glu Gln Ile Gln Asp Ser Glu His 100 105
110Ser Gly Lys Met Val Ala Lys Arg Gln Phe Arg Ile Gly Asp Ile Ala
115 120 125Gly Glu His Thr Ser Phe Asp Lys Leu Pro Glu Gly Gly Arg
Ala Thr 130 135 140Tyr Arg Gly Thr Ala Phe Gly Ser Asp Asp Ala Gly
Gly Lys Leu Thr145 150 155 160Tyr Thr Ile Asp Phe Ala Ala Lys Gln
Gly Asn Gly Lys Ile Glu His 165 170 175Leu Lys Ser Pro Glu Leu Asn
Val Asp Leu Ala Ala Ala Asp Ile Lys 180 185 190Pro Asp Gly Lys Arg
His Ala Val Ile Ser Gly Ser Val Leu Tyr Asn 195 200 205Gln Ala Glu
Lys Gly Ser Tyr Ser Leu Gly Ile Phe Gly Gly Lys Ala 210 215 220Gln
Glu Val Ala Gly Ser Ala Glu Val Lys Thr Val Asn Gly Ile Arg225 230
235 240His Ile Gly Leu Ala Ala Lys Gln 2452247PRTNeisseria
meningitidis 2Val Ala Ala Asp Ile Gly Ala Gly Leu Ala Asp Ala Leu
Thr Ala Pro1 5 10 15Leu Asp His Lys Asp Lys Ser Leu Gln Ser Leu Thr
Leu Asp Gln Ser 20 25 30Val Arg Lys Asn Glu Lys Leu Lys Leu Ala Ala
Gln Gly Ala Glu Lys 35 40 45Thr Tyr Gly Asn Gly Asp Ser Leu Asn Thr
Gly Lys Leu Lys Asn Asp 50 55 60Lys Val Ser Arg Phe Asp Phe Ile Arg
Gln Ile Glu Val Asp Gly Gln65 70 75 80Leu Ile Thr Leu Glu Ser Gly
Glu Phe Gln Ile Tyr Lys Gln Asp His 85 90 95Ser Ala Val Val Ala Leu
Gln Ile Glu Lys Ile Asn Asn Pro Asp Lys 100 105 110Ile Asp Ser Leu
Ile Asn Gln Arg Ser Phe Leu Val Ser Gly Leu Gly 115 120 125Gly Glu
His Thr Ala Phe Asn Gln Leu Pro Asp Gly Lys Ala Glu Tyr 130 135
140His Gly Lys Ala Phe Ser Ser Asp Asp Ala Gly Gly Lys Leu Thr
Tyr145 150 155 160Thr Ile Asp Phe Ala Ala Lys Gln Gly His Gly Lys
Ile Glu His Leu 165 170 175Lys Thr Pro Glu Gln Asn Val Glu Leu Ala
Ala Ala Glu Leu Lys Ala 180 185 190Asp Glu Lys Ser His Ala Val Ile
Leu Gly Asp Thr Arg Tyr Gly Ser 195 200 205Glu Glu Lys Gly Thr Tyr
His Leu Ala Leu Phe Gly Asp Arg Ala Gln 210 215 220Glu Ile Ala Gly
Ser Ala Thr Val Lys Ile Gly Glu Lys Val His Glu225 230 235 240Ile
Gly Ile Ala Gly Lys Gln 2453250PRTNeisseria meningitidis 3Val Ala
Ala Asp Ile Gly Thr Gly Leu Ala Asp Ala Leu Thr Ala Pro1 5 10 15Leu
Asp His Lys Asp Lys Gly Leu Lys Ser Leu Thr Leu Glu Asp Ser 20 25
30Ile Pro Gln Asn Gly Thr Leu Thr Leu Ser Ala Gln Gly Ala Glu Lys
35 40 45Thr Phe Lys Ala Gly Asp Lys Asp Asn Ser Leu Asn Thr Gly Lys
Leu 50 55 60Lys Asn Asp Lys Ile Ser Arg Phe Asp Phe Val Gln Lys Ile
Glu Val65 70 75 80Asp Gly Gln Thr Ile Thr Leu Ala Ser Gly Glu Phe
Gln Ile Tyr Lys 85 90 95Gln Asn His Ser Ala Val Val Ala Leu Gln Ile
Glu Lys Ile Asn Asn 100 105 110Pro Asp Lys Thr Asp Ser Leu Ile Asn
Gln Arg Ser Phe Leu Val Ser 115 120 125Gly Leu Gly Gly Glu His Thr
Ala Phe Asn Gln Leu Pro Gly Gly Lys 130 135 140Ala Glu Tyr His Gly
Lys Ala Phe Ser Ser Asp Asp Pro Asn Gly Arg145 150 155 160Leu His
Tyr Ser Ile Asp Phe Thr Lys Lys Gln Gly Tyr Gly Arg Ile 165 170
175Glu His Leu Lys Thr Leu Glu Gln Asn Val Glu Leu Ala Ala Ala Glu
180 185 190Leu Lys Ala Asp Glu Lys Ser His Ala Val Ile Leu Gly Asp
Thr Arg 195 200 205Tyr Gly Ser Glu Glu Lys Gly Thr Tyr His Leu Ala
Leu Phe Gly Asp 210 215 220Arg Ala Gln Glu Ile Ala Gly Ser Ala Thr
Val Lys Ile Gly Glu Lys225 230 235 240Val His Glu Ile Gly Ile Ala
Gly Lys Gln 245 2504644PRTNeisseria meningitidis 4Met Ala Ser Pro
Asp Val Lys Ser Ala Asp Thr Leu Ser Lys Pro Ala1 5 10 15Ala Pro Val
Val Ser Glu Lys Glu Thr Glu Ala Lys Glu Asp Ala Pro 20 25 30Gln Ala
Gly Ser Gln Gly Gln Gly Ala Pro Ser Ala Gln Gly Gly Gln 35 40 45Asp
Met Ala Ala Val Ser Glu Glu Asn Thr Gly Asn Gly Gly Ala Ala 50 55
60Ala Thr Asp Lys Pro Lys Asn Glu Asp Glu Gly Ala Gln Asn Asp Met65
70 75 80Pro Gln Asn Ala Ala Asp Thr Asp Ser Leu Thr Pro Asn His Thr
Pro 85 90 95Ala Ser Asn Met Pro Ala Gly Asn Met Glu Asn Gln Ala Pro
Asp Ala 100 105 110Gly Glu Ser Glu Gln Pro Ala Asn Gln Pro Asp Met
Ala Asn Thr Ala 115 120 125Asp Gly Met Gln Gly Asp Asp Pro Ser Ala
Gly Gly Glu Asn Ala Gly 130 135 140Asn Thr Ala Ala Gln Gly Thr Asn
Gln Ala Glu Asn Asn Gln Thr Ala145 150 155 160Gly Ser Gln Asn Pro
Ala Ser Ser Thr Asn Pro Ser Ala Thr Asn Ser 165 170 175Gly Gly Asp
Phe Gly Arg Thr Asn Val Gly Asn Ser Val Val Ile Asp 180 185 190Gly
Pro Ser Gln Asn Ile Thr Leu Thr His Cys Lys Gly Asp Ser Cys 195 200
205Ser Gly Asn Asn Phe Leu Asp Glu Glu Val Gln Leu Lys Ser Glu Phe
210 215 220Glu Lys Leu Ser Asp Ala Asp Lys Ile Ser Asn Tyr Lys Lys
Asp Gly225 230 235 240Lys Asn Asp Gly Lys Asn Asp Lys Phe Val Gly
Leu Val Ala Asp Ser 245 250 255Val Gln Met Lys Gly Ile Asn Gln Tyr
Ile Ile Phe Tyr Lys Pro Lys 260 265 270Pro Thr Ser Phe Ala Arg Phe
Arg Arg Ser Ala Arg Ser Arg Arg Ser 275 280 285Leu Pro Ala Glu Met
Pro Leu Ile Pro Val Asn Gln Ala Asp Thr Leu 290 295 300Ile Val Asp
Gly Glu Ala Val Ser Leu Thr Gly His Ser Gly Asn Ile305 310 315
320Phe Ala Pro Glu Gly Asn Tyr Arg Tyr Leu Thr Tyr Gly Ala Glu Lys
325 330 335Leu Pro Gly Gly Ser Tyr Ala Leu Arg Val Gln Gly Glu Pro
Ser Lys 340 345 350Gly Glu Met Leu Ala Gly Thr Ala Val Tyr Asn Gly
Glu Val Leu His 355 360 365Phe His Thr Glu Asn Gly Arg Pro Ser Pro
Ser Arg Gly Arg Phe Ala 370 375 380Ala Lys Val Asp Phe Gly Ser Lys
Ser Val Asp Gly Ile Ile Asp Ser385 390 395 400Gly Asp Gly Leu His
Met Gly Thr Gln Lys Phe Lys Ala Ala Ile Asp 405 410 415Gly Asn Gly
Phe Lys Gly Thr Trp Thr Glu Asn Gly Gly Gly Asp Val 420 425 430Ser
Gly Lys Phe Tyr Gly Pro Ala Gly Glu Glu Val Ala Gly Lys Tyr 435 440
445Ser Tyr Arg Pro Thr Asp Ala Glu Lys Gly Gly Phe Gly Val Phe Ala
450 455 460Gly Lys Lys Glu Gln Asp Gly Ser Gly Gly Gly Gly Ala Thr
Tyr Lys465 470 475 480Val Asp Glu Tyr His Ala Asn Ala Arg Phe Ala
Ile Asp His Phe Asn 485 490 495Thr Ser Thr Asn Val Gly Gly Phe Tyr
Gly Leu Thr Gly Ser Val Glu 500 505 510Phe Asp Gln Ala Lys Arg Asp
Gly Lys Ile Asp Ile Thr Ile Pro Val 515 520 525Ala Asn Leu Gln Ser
Gly Ser Gln His Phe Thr Asp His Leu Lys Ser 530 535 540Ala Asp Ile
Phe Asp Ala Ala Gln Tyr Pro Asp Ile Arg Phe Val Ser545 550 555
560Thr Lys Phe Asn Phe Asn Gly Lys Lys Leu Val Ser Val Asp Gly Asn
565 570 575Leu Thr Met His Gly Lys Thr Ala Pro Val Lys Leu Lys Ala
Glu Lys 580 585 590Phe Asn Cys Tyr Gln Ser Pro Met Ala Lys Thr Glu
Val Cys Gly Gly 595 600 605Asp Phe Ser Thr Thr Ile Asp Arg Thr Lys
Trp Gly Val Asp Tyr Leu 610 615 620Val Asn Val Gly Met Thr Lys Ser
Val Arg Ile Asp Ile Gln Ile Glu625 630 635 640Ala Ala Lys
Gln5434PRTNeisseria meningitidis 5Met Val Ser Ala Val Ile Gly Ser
Ala Ala Val Gly Ala Lys Ser Ala1 5 10 15Val Asp Arg Arg Thr Thr Gly
Ala Gln Thr Asp Asp Asn Val Met Ala 20 25 30Leu Arg Ile Glu Thr Thr
Ala Arg Ser Tyr Leu Arg Gln Asn Asn Gln 35 40 45Thr Lys Gly Tyr Thr
Pro Gln Ile Ser Val Val Gly Tyr Asn Arg His 50 55 60Leu Leu Leu Leu
Gly Gln Val Ala Thr Glu Gly Glu Lys Gln Phe Val65 70 75 80Gly Gln
Ile Ala Arg Ser Glu Gln Ala Ala Glu Gly Val Tyr Asn Tyr 85 90 95Ile
Thr Val Ala Ser Leu Pro Arg Thr Ala Gly Asp Ile Ala Gly Asp 100 105
110Thr Trp Asn Thr Ser Lys Val Arg Ala Thr Leu Leu Gly Ile Ser Pro
115 120 125Ala Thr Gln Ala Arg Val Lys Ile Val Thr Tyr Gly Asn Val
Thr Tyr 130 135 140Val Met Gly Ile Leu Thr Pro Glu Glu Gln Ala Gln
Ile Thr Gln Lys145 150 155 160Val Ser Thr Thr Val Gly Val Gln Lys
Val Ile Thr Leu Tyr Gln Asn 165 170 175Tyr Val Gln Arg Gly Ser Gly
Gly Gly Gly Val Ala Ala Asp Ile Gly 180 185 190Ala Gly Leu Ala Asp
Ala Leu Thr Ala Pro Leu Asp His Lys Asp Lys 195 200 205Gly Leu Gln
Ser Leu Thr Leu Asp Gln Ser Val Arg Lys Asn Glu Lys 210 215 220Leu
Lys Leu Ala Ala Gln Gly Ala Glu Lys Thr Tyr Gly Asn Gly Asp225 230
235 240Ser Leu Asn Thr Gly Lys Leu Lys Asn Asp Lys Val Ser Arg Phe
Asp 245 250 255Phe Ile Arg Gln Ile Glu Val Asp Gly Gln Leu Ile Thr
Leu Glu Ser 260 265 270Gly Glu Phe Gln Val Tyr Lys Gln Ser His Ser
Ala Leu Thr Ala Phe 275 280 285Gln Thr Glu Gln Ile Gln Asp Ser Glu
His Ser Gly Lys Met Val Ala 290 295 300Lys Arg Gln Phe Arg Ile Gly
Asp Ile Ala Gly Glu His Thr Ser Phe305 310 315 320Asp Lys Leu Pro
Glu Gly Gly Arg Ala Thr Tyr Arg Gly Thr Ala Phe 325 330 335Gly Ser
Asp Asp Ala Gly Gly Lys Leu Thr Tyr Thr Ile Asp Phe Ala 340 345
350Ala Lys Gln Gly Asn Gly Lys Ile Glu His Leu Lys Ser Pro Glu Leu
355 360 365Asn Val Asp Leu Ala Ala Ala Asp Ile Lys Pro Asp Gly Lys
Arg His 370 375 380Ala Val Ile Ser Gly Ser Val Leu Tyr Asn Gln Ala
Glu Lys Gly Ser385 390 395 400Tyr Ser Leu Gly Ile Phe Gly Gly Lys
Ala Gln Glu Val Ala Gly Ser 405 410 415Ala Glu Val Lys Thr Val Asn
Gly Ile Arg His Ile Gly Leu Ala Ala 420 425 430Lys
Gln6327PRTNeisseria meningitidis 6Ala Thr Asn Asp Asp Asp Val Lys
Lys Ala Ala Thr Val Ala Ile Ala1 5 10 15Ala Ala Tyr Asn Asn Gly Gln
Glu Ile Asn Gly Phe Lys Ala Gly Glu 20 25 30Thr Ile Tyr Asp Ile Asp
Glu Asp Gly Thr Ile Thr Lys Lys Asp Ala 35 40 45Thr Ala Ala Asp Val
Glu Ala Asp Asp Phe Lys Gly Leu Gly Leu Lys 50 55 60Lys Val Val Thr
Asn Leu Thr Lys Thr Val Asn Glu Asn Lys Gln Asn65 70 75 80Val Asp
Ala Lys Val Lys Ala Ala Glu Ser Glu Ile Glu Lys Leu Thr 85 90 95Thr
Lys Leu Ala Asp Thr Asp Ala Ala Leu Ala Asp Thr Asp Ala Ala 100 105
110Leu Asp Ala Thr Thr Asn Ala Leu Asn Lys Leu Gly Glu Asn Ile Thr
115 120 125Thr Phe Ala Glu Glu Thr Lys Thr Asn Ile Val Lys Ile Asp
Glu Lys 130 135 140Leu Glu Ala Val Ala Asp Thr Val Asp Lys His Ala
Glu Ala Phe Asn145 150 155 160Asp Ile Ala Asp Ser Leu Asp Glu Thr
Asn Thr Lys Ala Asp Glu Ala 165 170 175Val Lys Thr Ala Asn Glu Ala
Lys Gln Thr Ala Glu Glu Thr Lys Gln 180 185 190Asn Val Asp Ala Lys
Val Lys Ala Ala Glu Thr Ala Ala Gly Lys Ala 195 200 205Glu Ala Ala
Ala Gly Thr Ala Asn Thr Ala Ala Asp Lys Ala Glu Ala 210 215 220Val
Ala Ala Lys Val Thr Asp Ile Lys Ala Asp Ile Ala Thr Asn Lys225 230
235 240Asp Asn Ile Ala Lys Lys Ala Asn Ser Ala Asp Val Tyr Thr Arg
Glu 245 250 255Glu Ser Asp Ser Lys Phe Val Arg Ile Asp Gly Leu Asn
Ala Thr Thr 260 265 270Glu Lys Leu Asp Thr Arg Leu Ala Ser Ala Glu
Lys Ser Ile Ala Asp 275 280 285His Asp Thr Arg Leu Asn Gly Leu Asp
Lys Thr Val Ser Asp Leu Arg 290 295 300Lys Glu Thr Arg Gln Gly Leu
Ala Glu Gln Ala Ala Leu Ser Gly Leu305 310 315 320Phe Gln Pro Tyr
Asn Val Gly 325
* * * * *