U.S. patent number 8,278,331 [Application Number 12/608,578] was granted by the patent office on 2012-10-02 for n-acyl ureas exhibiting anti-cancer and anti-proliferative activities.
This patent grant is currently assigned to Deciphera Pharmaceuticals, LLC. Invention is credited to Daniel L. Flynn, Michael D. Kaufman, Peter A. Petillo.
United States Patent |
8,278,331 |
Flynn , et al. |
October 2, 2012 |
N-acyl ureas exhibiting anti-cancer and anti-proliferative
activities
Abstract
Compounds of the present invention find utility in the treatment
of mammalian cancers and especially human cancers including, but
not limited to, malignant melanomas, solid tumors, glioblastomas,
ovarian cancer, pancreatic cancer, prostate cancer, lung cancers,
breast cancers, kidney cancers, hepatic cancers, cervical
carcinomas, metastasis of primary tumor sites, myeloproliferative
diseases, chronic myelogenous leukemia, leukemias, papillary
thyroid carcinoma, non-small cell lung cancer, mesothelioma,
hypereosinophilic syndrome, gastrointestinal stromal tumors,
colonic cancers, ocular diseases characterized by
hyperproliferation leading to blindness including various
retinopathies, diabetic retinopathy, rheumatoid arthritis, asthma,
chronic obstructive pulmonary disease, mastocytosis, mast cell
leukemia, and diseases caused by PDGFR-.alpha. kinase, PDGFR-.beta.
kinase, c-KIT kinase, cFMS kinase, c-MET kinase, and oncogenic
forms, aberrant fusion proteins and polymorphs of any of the
foregoing kinases.
Inventors: |
Flynn; Daniel L. (Lawrence,
KS), Petillo; Peter A. (Lawrence, KS), Kaufman; Michael
D. (Lawrence, KS) |
Assignee: |
Deciphera Pharmaceuticals, LLC
(Lawrence, KS)
|
Family
ID: |
42129269 |
Appl.
No.: |
12/608,578 |
Filed: |
October 29, 2009 |
Prior Publication Data
|
|
|
|
Document
Identifier |
Publication Date |
|
US 20100120806 A1 |
May 13, 2010 |
|
Related U.S. Patent Documents
|
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
Issue Date |
|
|
61109309 |
Oct 29, 2008 |
|
|
|
|
Current U.S.
Class: |
514/333; 514/269;
514/274; 544/298; 546/268.1 |
Current CPC
Class: |
A61K
31/555 (20130101); C07D 401/14 (20130101); A61P
37/08 (20180101); A61P 19/00 (20180101); A61P
27/02 (20180101); A61P 11/06 (20180101); C07D
403/04 (20130101); A61P 35/00 (20180101); A61P
25/00 (20180101); A61P 25/28 (20180101); A61P
35/02 (20180101); A61P 3/00 (20180101); C07D
413/04 (20130101); A61P 29/00 (20180101); A61P
11/00 (20180101); C07D 401/04 (20130101) |
Current International
Class: |
A61K
31/44 (20060101) |
Field of
Search: |
;544/298 ;546/268.1 |
References Cited
[Referenced By]
U.S. Patent Documents
Foreign Patent Documents
|
|
|
|
|
|
|
4343831 |
|
Jun 1995 |
|
DE |
|
0021228 |
|
Jan 1981 |
|
EP |
|
0025232 |
|
Mar 1981 |
|
EP |
|
0661276 |
|
Jul 1995 |
|
EP |
|
0692483 |
|
Jan 1996 |
|
EP |
|
0739884 |
|
Oct 1996 |
|
EP |
|
0867435 |
|
Sep 1998 |
|
EP |
|
0927555 |
|
Jul 1999 |
|
EP |
|
928790 |
|
Jul 1999 |
|
EP |
|
0956855 |
|
Nov 1999 |
|
EP |
|
1281399 |
|
Feb 2003 |
|
EP |
|
2337554 |
|
Aug 1977 |
|
FR |
|
2396549 |
|
Feb 1979 |
|
FR |
|
971307 |
|
Sep 1964 |
|
GB |
|
1127875 |
|
Sep 1968 |
|
GB |
|
1410279 |
|
Oct 1975 |
|
GB |
|
2220206 |
|
Jan 1990 |
|
GB |
|
59-15247 |
|
Jan 1984 |
|
JP |
|
59177557 |
|
Oct 1984 |
|
JP |
|
9221476 |
|
Aug 1997 |
|
JP |
|
2000275886 |
|
Oct 2000 |
|
JP |
|
20012687 |
|
Jul 2002 |
|
JP |
|
WO 91/19708 |
|
Dec 1991 |
|
WO |
|
WO 92/08693 |
|
May 1992 |
|
WO |
|
WO 94/18176 |
|
Aug 1994 |
|
WO |
|
WO 94/21617 |
|
Sep 1994 |
|
WO |
|
WO 94/24095 |
|
Oct 1994 |
|
WO |
|
WO 95/15954 |
|
Jun 1995 |
|
WO |
|
WO 95/29902 |
|
Nov 1995 |
|
WO |
|
WO 95/34540 |
|
Dec 1995 |
|
WO |
|
WO 96/16046 |
|
May 1996 |
|
WO |
|
WO 96/19477 |
|
Jun 1996 |
|
WO |
|
WO 97/34900 |
|
Sep 1997 |
|
WO |
|
WO 97/40028 |
|
Oct 1997 |
|
WO |
|
WO 98/22103 |
|
May 1998 |
|
WO |
|
WO 98/52558 |
|
Nov 1998 |
|
WO |
|
WO 99/15164 |
|
Apr 1999 |
|
WO |
|
WO 99/23091 |
|
May 1999 |
|
WO |
|
WO 99/23093 |
|
May 1999 |
|
WO |
|
WO 99/32106 |
|
Jul 1999 |
|
WO |
|
WO 99/32110 |
|
Jul 1999 |
|
WO |
|
WO 99/32111 |
|
Jul 1999 |
|
WO |
|
WO 99/32455 |
|
Jul 1999 |
|
WO |
|
WO 99/37622 |
|
Jul 1999 |
|
WO |
|
WO 99/59959 |
|
Nov 1999 |
|
WO |
|
WO 00/06550 |
|
Feb 2000 |
|
WO |
|
WO 00/07980 |
|
Feb 2000 |
|
WO |
|
WO 00/18738 |
|
Apr 2000 |
|
WO |
|
WO 00/21927 |
|
Apr 2000 |
|
WO |
|
WO 00/41698 |
|
Jul 2000 |
|
WO |
|
WO 00/42012 |
|
Jul 2000 |
|
WO |
|
WO 00/43384 |
|
Jul 2000 |
|
WO |
|
WO 00/55139 |
|
Sep 2000 |
|
WO |
|
WO 00/59506 |
|
Oct 2000 |
|
WO |
|
WO 01/12621 |
|
Feb 2001 |
|
WO |
|
WO 01/14372 |
|
Mar 2001 |
|
WO |
|
WO 01/74771 |
|
Oct 2001 |
|
WO |
|
WO 01/96298 |
|
Dec 2001 |
|
WO |
|
WO 02/14291 |
|
Feb 2002 |
|
WO |
|
WO 02/14311 |
|
Feb 2002 |
|
WO |
|
WO 02/28835 |
|
Apr 2002 |
|
WO |
|
WO 02/34727 |
|
May 2002 |
|
WO |
|
WO 02/060869 |
|
Aug 2002 |
|
WO |
|
WO 02/060876 |
|
Aug 2002 |
|
WO |
|
WO 02/062763 |
|
Aug 2002 |
|
WO |
|
WO 02/070662 |
|
Sep 2002 |
|
WO |
|
WO 03/005999 |
|
Jan 2003 |
|
WO |
|
WO 03/053368 |
|
Jul 2003 |
|
WO |
|
WO 03/059373 |
|
Jul 2003 |
|
WO |
|
WO 03/068223 |
|
Aug 2003 |
|
WO |
|
WO 03/072577 |
|
Sep 2003 |
|
WO |
|
WO 03/084539 |
|
Oct 2003 |
|
WO |
|
WO 2004/004720 |
|
Jan 2004 |
|
WO |
|
WO 2004/056783 |
|
Jul 2004 |
|
WO |
|
WO 2004/060306 |
|
Jul 2004 |
|
WO |
|
WO 2004/061084 |
|
Jul 2004 |
|
WO |
|
WO 2004/078128 |
|
Sep 2004 |
|
WO |
|
WO 2004/113352 |
|
Dec 2004 |
|
WO |
|
WO 2005/002673 |
|
Jan 2005 |
|
WO |
|
WO 2005/110994 |
|
Nov 2005 |
|
WO |
|
WO 2006/014290 |
|
Feb 2006 |
|
WO |
|
WO 2006/071940 |
|
Jul 2006 |
|
WO |
|
WO 2006/081034 |
|
Aug 2006 |
|
WO |
|
WO 2007/008917 |
|
Jan 2007 |
|
WO |
|
WO 2007/076473 |
|
Jul 2007 |
|
WO |
|
WO 2008/046003 |
|
Apr 2008 |
|
WO |
|
WO 2008/131276 |
|
Oct 2008 |
|
WO |
|
Other References
Gavezzotti, Accounts of Chemical Research, 27, 309-314 (1994).
cited by examiner .
S.R. Byrn et al, Solid-State Chemistry of Drugs, 516 (2nd ed.,
1999). cited by examiner .
S.L. Morissette et al., Advanced Drug Delivery Reviews, 56,
275-300, 275 (2004). cited by examiner .
J. Aaltonen et al., European Journal of Pharmaceutics and
Biopharmaceutics, 71, 23-37, 26 (2009). cited by examiner .
U.S. Appl. No. 11/721,026, filed Nov. 2, 2008, Flynn et al. cited
by other .
U.S. Appl. No. 12/238,997, filed Nov. 11, 20008, Flynn et al. cited
by other .
"Additions and Corrections", Journal of Medicinal Chemistry,
32(12):2583 (1989). cited by other .
Aklilu, et al., "Increased PTHRP Production by a Tyrosine Kinase
Oncogene, Tpr-Met: Rose of the Ras Signaling Pathway", American
Journal of Physiology--Endocrinology and Metabolism, 271(2) pp.
E277-E283 (1996). cited by other .
Albericio, et al., "Synthesis of a Sulfaydantion Library", J. Comb.
Chem., 3:290-300 (2001). cited by other .
Almerico, et al., "On the Preparation of 1-aryl-2-heteroaryl- and
2-aryl-1-heteroaryl-pyrroles as Useful Building Blocks for
Biologically Interesting Heterocycles", ARKIVOC (vi), Rudy
Abramovitch Issue, pp. 129-142 (2001). cited by other .
Anzai, et al., "Alkyl- and Arylthiation of Uracil and Indole", J.
Heterocyclic Chem., 16:567-569 (1979). cited by other .
Askew, et al., "Molecular Recognition with Convergent Functional
Groups: 6. Synthetic and Structural Studies with a Model Receptor
for Nucleic Acid Components", J. Am. Chem., 111:1082-1090 (1989).
cited by other .
Bais, et al., "Inhibition of Endogenous Wxalate Production:
Biochemical Consideration of the Roles of Glycollate Oxidase and
Lactate Dehydrogenase", Clinical Science, 76:303-309 (1989). cited
by other .
Baker, et al., "Irreversible Enzyme Inhibitors. 188. Inhibition of
Mammalian Thymidine Phosphorylase", Journal of Medicinal Chemistry,
14:812-816 (1971). cited by other .
Barker, et al., "Characterization of pp60c-src Tyrosine Kinase
Activities Using a Continuous Assay: Autoactivation of the Enzyme
is an Intermolecular Autophosphorylation Process", Biochemistry,
35:14843-14851 (1995). cited by other .
Bausch, et al., "Proton-Transfer Chemistry of Urazoles and Related
Imides, and Diacyl Hydrazides", J. Org. Chem., 56:5643-5651 (1991).
cited by other .
Benvenuti, et al., "Crystallization of Soluble Proteins in Vapor
Diffusion for X-Ray Crystallography", Nature Protocols,
2(7):1633-1651 (2007). cited by other .
Bosca, et al., "Circular Dichroism Analysis of Ligand-Induced
Conformational Changes in Protein Kinase C", Biochem J.,
290:827-832 (1993). cited by other .
Boschelli, et al., "4-Anilino-3-quinolinecarbonitriles: An Emerging
Class of Kinase Inhibitors", Current Topics in Medicinal Chemistry,
2:1051-1063 (2002). cited by other .
Bourdonnec, et al., "Synthesis and Pharmacological Evaluation of
New Pyrazolidine-3,5-diones as AT1 Angiotensin II Receptor
Antagonists", J. Med. Chem., 43:2685-2697 (2000). cited by other
.
Boyer, "Small Molecule Inhibitors of KDR (VEGFR-2) Kinase: An
Overview of Structure Activity Relationships", Current Topics in
Medicinal Chemisty, 2:973-1000 (2002). cited by other .
Brady, et al., "Fast Prediction and Visualization of Protein
Binding Pockets with PASS". Journal of Computer-Aided Molecular
Design, 14:383-401 (2000). cited by other .
Brasher, et al., "C-Abul has High Intrinsic Tyrosine Kinase
Activity that is Stimulatad by Mutation of the Src Homology 3
Domain and by Autophosphorylation at Two Distinct Regulatory
Tyrosines", Journal of Biological Chemistry, 275:35631-35637
(2000). cited by other .
Bullock, et al., "Prospects for Kinase Activity Modulators in the
Treatment of Diabetes and Diabetic Complications", Current Topics
in Medicinal Chemistry, 2:915-938 (2002). cited by other .
Byron, et al., "The Synthesis of some Substituted
Biphenyl-4-carboxylic Acids, 4-Biphenylylacetic Acids, and
4-Aminobiphenyls", J. Chem. Soc. (C), Organic, pp. 840-845 (1966).
cited by other .
Cardillo, et al., "Sulle 1,2-difenil-3.5-dichetopirazolidine",
Gazz. Chim., Ital., 9:973-985 (1966)--Italian Language--English
Summary. cited by other .
Charmm "NHLBI LBC Computational Biophysics Section", CHARMM
Documentation Index, http://www.lobos.nih.gov/Charmm/chmdoc.html,
printed Mar. 4, 2005 (1 page). cited by other .
Chen, et al., "Biochemical Evidence for the Autophosphorylation and
Transphosphorylation of Transforming Growth Factor b Receptor
Kinases", Proc. Natl. Acad. Sci. USA, 92:1565-1569 (1995). cited by
other .
Cheng, et al., "Novel Solution Phase Strategy for the Synthesis of
Chemical Libraries Containing Small Organic Molecules", J. Am.
Chem. Soc., 118:2567-2573 (1996). cited by other .
Cheng, et al., "Synthesis and SAR of Heteroaryl-phenyl-substituted
Pyrazole Derivatives as Highly Selective and Potent Canine COX-2
Inhibitors", Bioorganic & Medicinal Chemistry Letters,
16:2076-2080 (2006). cited by other .
Chu, et al., "Using Affinity Capillary Electrophoresis to Determine
Binding Stoichiometries of Protein-Ligand Interactions",
Biochemistry, 33:10616-10621 (1994). cited by other .
Cirillo, et al. "The Non-Diaryl Heterocycle Classes of p38 MAP
Kinase Inhibitors", Current Topics in Medicinal Chemistry,
2:1021-1035 (2002). cited by other .
Closier, et al., "Nitrofuryl Heterocyclics. 1", Journal of
Medicinal Chemistry, 13(4):638-640 (1970). cited by other .
Cockerill, et al., "Small Molecule Inhibitors of the Class 1
Receptor Tyrosine Kinase Family", Current Topics in Medicinal
Chemistry, 2:1001-1010 (2002). cited by other .
Colton, et al., "Affinity Capillary Electrophoresis: A
Physical-Organic Tool for Studying Interactions in Biomolecular
Recognition", Electrophoresis, 19:367-382 (1998). cited by other
.
Cortes, et al., "Results of Imatinib Mesylate Therapy in Patients
with Refractory or Recurrent Acute Myeloid Leukemia, High-Risk
Myelodysplastic Syndrime, and Myeloproliferative Disorders",
Cancer, 97(11):2760-2766 (2003). cited by other .
Cross, et al., "Inhibition of Glycogen Synthase Kinase-3 by Insulin
Mediated by Protein Kinase B", Nature, 378:785-789 (1995). cited by
other .
Dajani, et al., "Crystal Structure of Glycogen Synthase Kinas 3b:
Structural Basis for Phosphate-Primed Substrate Specificity and
Autoinhibition", Cell, 105:721-732 (2001). cited by other .
Dajani, et al., "Structural Basis for Recruitment of Glycogen
Synthase Kinase 3b to the Axin-APC Scaffold Complex", EMBO J.,
22(3):494-501 (2003). cited by other .
Daley, et al., "Induction of Chronic Myelogenous Leukemia in Mice
by the P210bcr/abl Gene of the Philadelphia Chromosome", Science,
247:824-830 (1990) (8 pgs). cited by other .
Davis, et al., "Iterative Size-Exclusion Chromatography Coupled
with Liquid Chromatographic Mass Spectrometry to Enrich and
Identify Tight-Binding Ligands from Complex Mixtures", Tetrahedron,
55:11653-11667 (1999). cited by other .
de Boer, et al., "Synthesis and Characterization of Conjugated
Mono- and Dithiol Oligomers and Characterization of Their
Self-Assembled Monolayers", Langmuir, 19:4272-4284 (2003). cited by
other .
de Silva, et al., "Gastrointestinal Stromal Tumors (GIST): C-kin
Mutations, CD117 Expression, Differential Diagnosis and Targeted
Cancer Therapy with Imatinib", Pathology Oncology Research,
9(1):13-19 (2003). cited by other .
Deng, et al., "Expression, Characterization, and Crystallization of
the Pyrophosphate-Dependent Phosphofructo-1-Kinase of Borrelia
burgdorferi", Archives of Biochemistry and Biophysics,
371(2):326-331 (1999). cited by other .
Dess, et al., "A Useful 12-I-5 Triacetoxyperiodiane (the
Dess-Martin Periodiane) for Selective Oxidation of Primary or
Secondary Alcohols and a Variety of Related 12-I-5 Species", J. Am.
Chem., Soc., 113:7277-7287 (1991). cited by other .
Dumas, "Preface", Current Topics in Medicinal Chemistry 2(9):i
(2002) (1 Page). cited by other .
Dumas, "Protein Kinase Inhibitors: Emerging Pharmacophores", Exp.
Opin. Ther. Patents, 11(3):405-429 (2001). cited by other .
Dumas, et al., "Discovery of a New Class of p38 Kinase Inhibitors",
Bioorganic & Medicinal Chemistry Letters, 10:2047-2050 (2000).
cited by other .
Dumas, et al., "Recent Developments in the Discovery of Protein
Kinase Inhibitors from the Urea Class", Current Opinion in Drug
Discovery & Development, 7(5):600-616 (2004). cited by other
.
Ettmayer, et al., "Lessons Learned from Marketed and
Investigational Prodrugs", Journal of Medicinal Chemistry,
47(10):2393-2404 (2004). cited by other .
Ewing, "Critical Evaluation of Search Algorithms for Automated
Molecular Docking and Database Screening", Journal of Computational
Chemistry, 18(9):1175-1189 (1997). cited by other .
Farooqui, et al., "Interactions Between Neural Membrane
Glycerophospholipid and Sphingolipid Mediators: A Recipe for Neural
Cell Survival or Suicide", Journal of Neuroscience Research,
85:1834-1850 (2007). cited by other .
Fathalla, "Synthesis of New Pyrazolo[1,5-a]pyrimidine Derivative
Using 5-Aminouracil and Ketene Dithiacetal", Arch Pharm Res,
22(6):571-574 (1999). cited by other .
Fathalla, et al., "Synthesis of New Uracil-5-Sulfonamide
Derivatives and Immuno-Stimulatory Effect of a Chemically Modified
Hemolymph of Biomphalaria alexandrina on Schistosoma manosi
Infected Mice", Arch Pharm Res., 26(5):358-366 (2003). cited by
other .
Fathalla, et al., "Synthesis of New Uracil-5-Sulphonamide-p-Phenyl
Derivatives and Their Effect on Biomphalaria alexandrina Snail's
Nucleoproteins", Arch. Pharm. Res., 23(2):128-138 (2000). cited by
other .
Flatt, et al., "Synthesis of Thiol Substituted Oligoanilines for
Molecular Device Candidates", Tetrahedron Letters, 44:6699-6702
(2003). cited by other .
Fletcher, et al., "Diagnosis of Gastrointestinal Stromal Tumors: A
Consensus Approach", Human Pathology 33(5):459-465 (2002). cited by
other .
Frame, et al., "A Common Phosphate Binding Site Explains the Unique
Substrate Specificity of GSK3 and Its Inactivation by
Phosphorylation", Molecular Cell, 7:1321-1327 (2001). cited by
other .
Furyua, et al., "Addition of 4-Ethoxyimidazoles to Dimethyl
Acetylenedicarboxylate and Transformation of the Adducts to
Pyrimidian-5-yl Acetates", Chem. Pharm. Bull., 36(5):1669-1675
(1988). cited by other .
Garcia-Tellado, et al., "Molecular Recognition in the Solid Waste
State: Controlled Assembly of Hydrogen-Bonded Molecular Sheets", J.
Am. Chem. Soc., 113:9265-9269 (1991). cited by other .
Gishizky, et al., "Efficient Transplantation of BCR-ABL-Induced
Chronic Myelogenous Leukemia-Like Syndrome in Mice", Proceedings of
the National Academy of Sciences of the United States of America,
90(8):3755-3759 (1993) (6 pages). cited by other .
Greene, et al., "Chapter 7: Protection for the Amino Group", in
Protective Groups in Organic Synthesis, Third Edition, John Wiley:
New York, pp. 494-653 (1999). cited by other .
Griffith, et al., "TPAP: Tetra-n-propylammonium Perruthenate, A
Mild and Convenient Oxidant for Alcohols", Aldrichimica Acta,
23(1):13-19 (1990). cited by other .
Guzel, "Investigation of the Relationship Between the Inhibitory
Activity of Glycolic Acid Oxidase (GAO) and its Chemical Structure:
Electron-Topological Approach", Journal of Molecular Structure,
366:131-137 (1996). cited by other .
Haar, et al., "Structure of GSK3b Reveals a Primed Phosphorylation
Mechanism", Nature Structural Biology, 8(7):593-596 (2001). cited
by other .
Haesslein, et al., "Recent Advances in Cyclin-Dependent Kinase
Inhibition. Purine-Based Derivatives as Anti-Cancer Agents. Roles
and Perspectives for the Future", Current Topics in Medicinal
Chemistry, 2:1037-1050 (2002). cited by other .
Heegaard, et al., "Affinity Capillary Electrophoresis: Important
Application Areas and Some Recent Developments", Journal of
Chromatography B, 715:29-54 (1998). cited by other .
Honda, et al., "Determination of the Association Constant of
Monovalent Mode Protein-Sugar Interaction by Capillary Zone
Electrophoresis", Journal of Chromatography, 597:377-382 (1992).
cited by other .
Hu, et al., "Capillary Electrophoresis for the Analysis of
Biopolymers", Anal., Chem., 74:2833-2850 (2002). cited by other
.
Huang, et al., "Inhibition of Nucleoside Transport by Protein
Kinase Inhibitors", The Journal of Pharmacology and Experimental
Therapeutics, 304(2):753-760 (2003). cited by other .
Hubbard, "Crystal Structure of the Activated Insulin Receptor
Tyrosine Kinase in Complex with Peptide Substrate and ATP Analog",
EMBO J., 16(18):5573-5581 (1997). cited by other .
Hubbard, et al., "Crystal Structure of the Tyrosine Kinase Domain
of the Human Insulin Receptor", Nature, 372:746-754 (1994). cited
by other .
Hughes, et al., "Modulation of the Glycogen Synthase Kinase-3
Family by Tyrosine Phosphorylation", EMBO J., 12(2):803-808 (1993).
cited by other .
Huse, et al., "Crystal Structure of the Cytoplasmic Domain of the
Type I TGFb Receptor in Complex with FKBP12", Cell, 96:425-436
(1999). cited by other .
Huse, et al., "The Confomational Plasticity of Protein Kinases",
Cell, 109:275-282 (2002). cited by other .
Huse, et al., "The TGFb Receptor Activation Process: An Inhibitor-
to Substrate-Binding Switch", Molecular Cell, 8:671-682 (2001).
cited by other .
Igarashi, et al., "Antimicrobial Activities of
2-arylthio-N-alkylmaleimides", Journal of Industrial Microbiology,
9:91-96 (1992). cited by other .
International Human Genome Sequencing Consortium, "Initial
Sequencing and Analysis of the Human Genome", Nature, 409:860-921
(2001). cited by other .
Ishida, et al., "Molecular Arrangement and Electrical Conduction of
Self-Assembled Monolayers Made from Terphenyl Thiols", Surface
Sciences, 514:187-193 (2002). cited by other .
Islip, et al., "Nitrofuryl Heterocyclics 3", Journal of Medicinal
Chemistry, 16(11):1308-1310 (1973). cited by other .
Jackson, et al., "N-Terminal Mutations Activate the Leukemogenic
Potential of the Myristoylated form of c-abl", EMBO, 8(2):449-456
(1989). cited by other .
Jackson, et al., "Pyridinylimidazole Based p38 MAP Kinase
Inhibitors", Current Topics in Medicinal Chemistry, 2:1011-1020
(2002). cited by other .
Jiang, et al., ""Soft Docking": Matching of Molecular Surface
Cubes", J. Mol. Biol., 219:79-102 (1991). cited by other .
Jiang, et al., "Synthesis and SAR Investigations for Novel
Melanin-Concentrating Hormone 1 Receptor (MCH1) Antagonists Part 1.
The Discovery of Arylacetamides as Viable Replacements for the
Dihydropyrimidione Moiety of an HTS Hit",J. Med. Chem.,50:3870-82,
(2007). cited by other .
Johnson, "Circular Dichroism Spectroscopy and The Vacuum
Ultraviolet Region", Ann. Rev. Phys. Chem., 29:93-114 (1978). cited
by other .
Johnson, "Protein Secondary Structure and Circular Dichroism: A
Practical Guide", Proteins: Structure, Function, and Genetics,
7:205-214 (1990). cited by other .
Johnson, et al., "An Evaluation of the Effect of Light Stabilisers
on the Exterior Durability of Polyester Powder Coatings for the
Architectural Market", Surface Coatings International, 3:134-141
(1999). cited by other .
Johnson, et al., "The Stereochemistry of Oxidation at Sulfur
Oxidation of 2-Thiabicyclo[2.2.1]Hpetane", Tetrahedron,
25:5649-5653 (1969). cited by other .
Kallander, et al., "4-Aryl-1,2,3-triazole: A Novel Template for a
Reversible Methionine Aminopeptidase 2 Inhibitor, Optimized to
Inhibit Angiogenesis in Vivo", J Med Chem 48: 5644-5647 (2005).
cited by other .
Katritzky, et al., "Novel Chromophoric Heterocycles Based on
Maleimide and Naphthoquinone", J. Heterocyclic Chem., 26:885-892
(1989). cited by other .
Kern, et al., "Synthese von Makromolekeln einheitlicher Brobe. II
Mitt: Syntheses neuer Diol-oligo-urethane nach dem
Duplikationsverfahren", Makromolekulara Chemie, 16:89-107
(1955)--German--English Summary (20 pages). cited by other .
Kim, et al., "Solid Phase Synthesis of Benzamidine and
Butylamine-Derived Hydantoin Libraries", Molecular Diversity,
3:129-132 (1998). cited by other .
Klayman, et al., "The Reaction of S-Methiodide Derivatives of
Activated Thioureas with Hydroxylic Compounds. A Novel Synthesis of
Mercaptans", J. Org. Chem., 37(10):1532-1537 (1972). cited by other
.
Kleywegt, et al., "Detection, Delineation, Measurement and Display
of Cavities in Macromolecular Structures", Acta Cryst, D50:178-185
(1994). cited by other .
Koch, et al., "QSAR and Molecular Modelling for a Series of
Isomeric X-Sulfanilamido-1-phenylpyrazoles", Quant. Struct. Act.
Relat., 12:373-382 (1993). cited by other .
Krasovitskii, et al., "Synthesis and Spectral-Luminescence
Properties of Hetarylethylene Derivatives of 2,5-Diphenyloxazole
and 2,5-Diphenyl-1,3,4-Oxadiazole", Khimiya Geterotsiklicheskikh
Soedinenii, 5:617-621 (1982)--English Translation (10. cited by
other .
Kuhn, et al., "The Genesis of High-Throughput Structure-Based Drug
Discovery using Protein Crystallography", Analytical Techniques,
Current Opinion in Chemical Biology, 6:704-710 (2002). cited by
other .
Kumar, et al., "P38 Map Kinases: Key Signalling Molecules as
Therapeutic Targets for Inflammatory Diseases", Nature Reviews Drug
Discovery, 2:717-726 (2003). cited by other .
Kundrot, "Which Strategy for a Protein Crystallization Project",
CMLS, Cell. Mol. Life Sci., 61:525-536 (2004). cited by other .
Kundu, et al., "Depropargylation Under Palladium-Copper Catalysis:
Synthesis of Diaryl Sulfides", Tetrahedron, 57:5885-5895 (2001).
cited by other .
Kurogi, et al., "Discovery of Novel Mesangial Cell Proliferation
Inhibitors Using a Three-Dimensional Database Searching Method", J.
Med. Chem., 44:2304-2307 (2001). cited by other .
Kwong, et al., "A General, Efficient, and Inexpensive Catalyst
System for the Coupling Aryl Iodides and Thiols", Organic Letters,
4(20):3517-3520 (2002). cited by other .
Laskowski, "SURFNET: A Program for Visualizing Molecular Surfaces,
Cavities, and Intermolecular Interactions", Journal of Molecular
Graphics, 13:323-330 (1995). cited by other .
Leca, et al., "A New Practical One-Pot Access to Sulfonimidates",
Organic Letters, 4(23):4093-4095 (2002). cited by other .
Lefevre, et al., "Roles of Stem Cell Factor/c-Kit and Effects of
Gliveca/STI571 in Human Uveal Melanoma Cell Tumorigenesis", Journal
of Biological Chemistry, 279(30):31769-31779 (2004). cited by other
.
Lesort, et al., "Insulin Transiently Increases Tau Phosphorylation:
Involvement of Glycogen Synthase Kinase-3b and Fyn Tyrosine
Kinase", Journal of Neurochemistry, 72(2):576-584 (1999). cited by
other .
Leung, et al., "The Difluoromethylensulfonic Acid Groups as a
Monoanionic Phosphate Surrogate for Obtaining PTP1B Inhibitors",
Bioorganic & Medicinal Chemistry, 10:2309-2323 (2002). cited by
other .
Li, et al., "Targeting Serine/Threonine Protein Kinase B/Akt and
Cell-cycle Checkpoint Kinases for Treating Cancer", Current Topics
in Medicinal Chemistry, 2:939-971 (2002). cited by other .
Li, et al., "The P190, P210, and P230 Forms of the BCR/ABL Oncogene
Induce a Similar Chronic Myeloid Leukemia-like Syndrome in Mice but
Have Different Lymphoid Leukemogenic Activity", J. Exp. Med.,
189(9):1399-1412 (1999). cited by other .
Link, et al., "Synthesis of 8-Substituted 5-Deazaflavins", J.
Heterocyclic Chem, 22:841-848 (1985). cited by other .
Lipinski, et al., "Experimental and Computational Approaches to
Estimate Solubility and Permeability in Drug Discovery and
Development Settings", Advanced Drug Delivery Reviews, 23:3-25
(1997). cited by other .
Lohse, et al., The Palladium Catalyzed Suzuki Coupling of 2- and 4-
Chloropyridines, Synlett 1: 45-48 (1999). cited by other .
Loren, et al., "NH-1,2,3-Triazoles from Azidomethyl Pivalate and
Carbamates: Base-Labile N-Protecting Groups", SYNLETT, 18:2847-2850
(2005). cited by other .
Lorenzi, et al., "Amino Acid Ester Prodrugs of
2-Bromo-5,6-dichloro-1-(b-D-ribofuranosyl)benzimidazole Enhance
Metabolic Stability in Vitro and in Vivo", Journal of Pharmacology
and Experimental Therapeutics, 314(2):883-890 (2005). cited by
other .
Lowinger, et al., "Design and Discovery of Small Molecules
Targeting Raf-1 Kinase", Current Pharmaceutical Design, 8:2269-2278
(2002) (11 pages). cited by other .
Ma, et al., "c-MET Mutational Analysis in Small Cell Lung Cancer:
Novel Juxtamembrane Domain Mutations Regulating Cytoskeletal
Functions", Cancer Research, 63:6272-6281 (2003). cited by other
.
Ma, et al., "c-Met: Structure, Functions and Potential for
Therapeutic Inhibition", Cancer and Metastasis Reviews, 22:309-325
(2003). cited by other .
Mallakpour, et al., "Uncatalyzed Polymerization of
Bistriazolinediones with Electron-Rich Aromatic Compounds via
Electrophilic Aromatic Substitution", Journal of Polymer Science:
Part A: Polymer Chemistry, 27:217-235 (1989). cited by other .
Mamaev, et al., "Synthesis of 2,5'-Bipyrimidines from Substituted
5-Cyanopyrimidines", Khimiya Geterotsiklicheskikh Soedinenni,
24(3):371-375--(1988)--English Translation. cited by other .
Smith, et al. March's Advanced Organic Chemistry: Reactions,
Mechanisms, and Structure, Fifth Edition, Smith and March Editors,
Wiley-Interscience Publication (2001) (4 pages). cited by other
.
Smith, et al., "Tautomerism", from March's Advanced Organic
Chemistry, Fifth Edition, Smith and March Editors,
Wiley-Interscience Publication (2001) pp. 69-74. cited by other
.
Martinez, et al., "First Non-ATP Competitive Glycogen Synthase
Kinase 3b (GSK-3b) Inhibitors: Thiadizolidinones (TDZD) as
Potential Drugs for the Treatment of Alzheimers Disease", J. Med.
Chem., 45(2002)1292-1299 (2002). cited by other .
Mattsson, et al., "Six X-Linked Agammaglobulinemia-Causing Missense
Mutations in the Src Homology 2 Domain of Bruton's Tyrosine Kinase:
Phosphotyrosine-Binding and Circular Dichroism Analysis", Journal
of Immunology, 64: 4170-4177 (2000). cited by other .
McPherson, "Current Approaches to Macromolecular Crystallization",
Eur. J. Biochem, 189:1-23 (1990). cited by other .
Medebielle, et al., "A Convenient Synthesis of Perfluoroalkylated
and Fluorinated-Aryl Nitrogen Bases by Electrochemically Induced
SRN1 Substitution", J. Org. Chem., 61:1331-1340 (1996). cited by
other .
Medebielle, et al., "A New Convenient Synthesis of 5-Aryl Uracils
Using SRN1 Aromatic Nucleophilic Substitution", Tetrahedron
Letters, 34(21):3409-3412 (1993). cited by other .
Mikhaleva, et al., "Relative Reactivities of the Chlorine Atoms of
2,2',4-Trichloro-4',5-Dipyrimidinyl in its Reaction with
Piperidine", Khimiya Geterotsiklicheskikh Soedinenii, 6:821-826
(1979)--English Translation (12 pages). cited by other .
Morris, et al., "Automated Docking of Flexible Ligands to
Macromolecules", AutoDock Website,
www.scripps.edu/mb/olson/doc/autodock/, printed Mar. 3, 2005 (3
pages). cited by other .
Morris, et al., "Automated Docking Using a Lamarckian Genetic
Algorithm and an Empirical Binding Free Energy Function", Journal
of Computational Chemistry , 19(14):1639-1662 (1998). cited by
other .
Morstyn, et al., "Stem Cell Factor Is a Potent Synergistic Factor
in Hematopoiesis", Oncology, 51:205-214 (1994). cited by other
.
Moss, et al., "Basic Terminology of Stereochemistry", Pure &
Appl. Chem., 68(12):2193-2222 (1996). cited by other .
Muller, "Glossary of Terms Used in Physical Organic Chemistry",
Pure & Appl. Chem., 66(5):1077-1184 (1994). cited by other
.
Muller, et al., "A General Synthesis of 4-Substituted
1,1-Dioxo-1,2,5-thiadiazolidin-3-ones Derived from a-Amino Acids",
J. Org. Chem., 54:4471-473 (1989). cited by other .
Murayama, et al., "JNK (c-Jun NH2 Terminal Kinase) and p38 During
Ischemia Reperfusion Injury in the Small Intestine"
Transplantation, 81(9):1325-1330 (2006). cited by other .
Mutlib, et al., "Disposition of
1-[3-(Aminomethyl)pheny1]-N-[3-fluoro-2'-(methylsulfonyl)-[1,1'-biphenyl]-
-4-yl]-3(trifluomethyl)-1H-pyrazole-5-carboxamide (DPC 423) by
Novel Metabolic Pathways. Characterization of Unusual Metabolites
by Liquid Chromatography/Mass Spectrometry and NMR", Chem. Res.
Toxicol., 15:48-62 (2002). cited by other .
Mutlib, et al., "P450-Mediated Metabolism of
1-[3-(Aminomethyl)phenyl]-N-[3-fluoro-2'-(methylsulfonyl)-[1,1'-biphenyl]-
-4-yl]-3(trifluomethyl)-1H-pyrazole-5-carboxamide (DCP 423) and Its
Analogues to Aldoximes. Characterization of Glutathione Conjugates
of Postulated Intermediates Derived from Aloximes", Chem. Res.
Toxicol., 15:63-75 (2002). cited by other .
Nagano, M. et al. "Studies on Organic Sulfur Compounds. XIV. The
Reaction of N-alkoxy-carbonyl-N'-(2-thiazolyl)thioureas with some
oxidants." Chemical and Pharmaceutical Bulletin. vol. 21, No. 11,
pp. 2408-2416. Nov. 1973. cited by other .
Nagar, et al., "Crystal Structures of the Kinase Domain of c-Abl in
Complex with the Small Molecule Inhibitors PD173955 and Imatinib
(STI-571)", Cancer Research, 62:4236-4243 (2002). cited by other
.
Nagar, et al., "Structural Basis for the Autoinhibition of c-Abl
Tyrosine Kinase", Cell, 112:859-871 (2003). cited by other .
Nakopoulou, et al., "c-Met Tyrosine Kinase Receptor Expression is
Associated with Abnormal b-catenin Expression and Favourable
Prognostic Factors in Invasive Breast Carcinoma", Histopathology,
36:313-325 (2000). cited by other .
Nantaka-Namirski, et al., "Condensation Reaction of Ethyl
(4-Uracil)-Acetate with Ethyl Orthoformate", ACTA Polon. Pharm
XXVII(5):455-463 (1971). cited by other .
National Academy of Sciences, "Abstracts of Papers Presented at the
Autumn Meeting, Nov. 14-16, 1960", Science, 132:1488-1501 (1960)
(15 pages). cited by other .
Nicolaou, et al.,"Molecular Design and Chemical Synthesis of a
Highly Potent Epothilone", ChemMedChem, 1:41-44 (2006). cited by
other .
Nikolaev, et al., "Solubility Polytherm in the System
HNO3-H2O-(C4H9O)PO(C4H9)2", Doklady Akademii Nauk SSSR,
160(4):841-844 (1965)--English Translation. cited by other .
Nofal, et al., "Synthesis of Novel Uracil-5-Sulphonamide
Derivatives of Possible Biological Activity", Egypt J. Chem.,
33(4):375-380 (1990). cited by other .
O'Dell, et al., "Treatment of Rheumatoid Arthritis with
Methotrexate Alone, Sulfasalazine and Hydroxychloroquine, or a
Combination of All Three Medications", New England J. Med.,
334(20):1287-1291(1996). cited by other .
O'Neill, "Targeting Signal Transduction as a Strategy to Treat
Inflammatory Diseases", Nature Review Drug Discovery, Published
Online Jun. 9, 2006, www.nature.com/reviews/drugdisc (15 pages).
cited by other .
Okano, et al., "o-Bromophenylzinc Compound: A Readily Available and
Efficient Synthetic Equivalent of o-Phenylene 1-Anion 2-Cation",
Tetrahedron Letters 39:3001-3004 (1998). cited by other .
Okishio, et al., "Differential Ligand Recognition by the Src and
Phosphatidylinositol 3-Kinase Src Homology 3 Domains: Circular
Dichroism and Ultraviolet Resonance Raman Studies", Biochemistry,
42:208-216 (2003). cited by other .
Okishio, et al., "Identification of Tyrosine Residues Involved in
Ligand Recognition by the Phosphatidylinositol 3-Kinase Src
Homology 3 Domain: Circular Dichroism and UV Resonance Raman
Studies", Biochemistry, 40:15797-15804 (2001). cited by other .
Okishio, et al., "Role of the Conserved Acidic Residue Asp21 in the
Structure of Phosphatidylinositol 3-Kinase Src Homolgy 3 Domain:
Circular Dichroism and Nuclear Magnetic Resonance Studies",
Biochemistry 40:119-129 (2001). cited by other .
Parang, et al., "Mechanism-based Design of a Protein Kinase
Inhibitor", Nature Structural Biology, 8(1):37-41 (2001). cited by
other .
Pargellis, et al., "Inhibition of p38 MAP Kinase by Utilizing a
Novel Allosteric Binding Site", Nature Structural Biology,
9(4):268-272 (2002). cited by other .
Park, et al., "Mechanism of met Oncogene Activation", Cell,
45:895-904 (1986). cited by other .
Pearlman, et al., "Assisted Model with Energy Refinement", Amber
Home Page, amber.scripts.edu (9 pages), (Mar. 4, 2005). cited by
other .
Pedersen, "The Preparation of Some N-Methyl-1,2,3-Triazoles", Acta
Chimica Scandinavica, 13(5):888-892 (1959). cited by other .
Peng, et al., "Identification of Novel Inhibitors of BCR-ABL
Tyrosine Kinase via Virtual Screening", Bioorganic & Medicinal
Chemistry Letters, 13:3693-3699 (2003). cited by other .
Pereira, et al., "The Role of c-kit and Imatinib Mesylate in Uveal
Melonoma", Journal of Carcinogenesis, 4:19 (2005) (8 pages). cited
by other .
Picard, et al., "Inhibitors of Acyl-CoA: Cholesterol
O-Acyltrasferase. 17. Structure-Activity Relationships of Several
Series of Compounds Derived from N-Chlorosulfonyl Isocyanate", J.
Med. Chem., 39:1243-1252 (1996). cited by other .
Pluk, et al., "Autoinhibition of c-Abl", Cell, 108:247-259 (2002).
cited by other .
Ponzetto, et al., "A Novel Recognition Motif for
Phosphatidylinositol 3-Kinase Binding Mediates Its Association with
the Hepatocyte Growth Factor/Scatter Factor Receptor", Molecular
and Cellular Biology, 13(8):4600-4608 (1993). cited by other .
Raimbault, et al., "Effects of pH and KCI on the Conformations of
Creatine Kinase from Rabbit Muscle", Eur. J. Biochem., 234:570-578
(1995). cited by other .
Rebek, et al. "Convergent Functional Groups: Synthetic and
Structural Studies", J. Am. Chem. Soc., 107:7476-7481 (1985). cited
by other .
Rebek, et al., "Convergent Functional Groups. 2. Structure and
Selectivity in Olefin Epoxidation with Peracids", J. Org. Chem.,
51:1649-1653 (1986). cited by other .
Reed, et al., "Circular Dichroic Evidence for an Ordered Sequence
Ligand/Binding Site Interactions in the Catalytic Reaction of the
cAMP-Dependent Protein Kinase", Biochemistry, 24:2967-2973 (1985).
cited by other .
Regan, et al., "Pyrazole Urea-Based Inhibitors of p38 MAP Kinase:
From Lead Compound to Clinical Candidate", J. Med. Chem.,
45:2994-3008 (2002). cited by other .
Regan, et al., "Structure-Activity Relationships of the p38a MAP
Kinase Inhibitor
1-(5-tert-Butyl-2-p-tolyl-2H-pyrazol-3-yl)-3-[4-(2-morpholin-4--
yl-ethoxy)naph-thalen-1-yl]urea (BIRB 796)", J. Med. Chem.,
46:4676-4686 (2003). cited by other .
Rooney, et al., "Inhibitors of Gylcolic Acid Oxidase. 4-Substituted
3-Hydroxy-1H-pyrrole-2,5-dione Derivatives", J. Med. Chem.,
26(5):700-714 (1983). cited by other .
Roux, et al., "ERK and p38 MAPK-Activated Protein Kinases: a Family
of Protein Kinases with Diverse Biological Functions", Microbiology
and Molecular Biology Reviews, 68(2):320-344 (2004). cited by other
.
Rowley, "A New Consistent Chromosomal Abnormality in Chronic
Myelogenous Leukaemia Identified by Quinacrine Fluorescence and
Giemsa Staining", Nature, 243:290-293 (1973). cited by other .
Russell, et al., "3-[3-(Piperdin-1-yl)propyl]indoles as Highly
Selective h5-HT1D Receptor", J. Med. Chem., 42:4981-5001 (1999).
cited by other .
Saiga, et al., "Consecutive Cross-Coupling of o-Phenylenedizinc
Compound with Acyl and/or Aryl Halides in the Presence of
Pd(0)-tris(2,4,6-trimethoxyphenyl)phosphine", Tetrahedron Letters,
41:4629-4632 (2000). cited by other .
Sakamoto, et al., "Condensed Heteroaromatic Ring Systems. XIX.
Synthesis and Reactions of 5-(Tributylstannyl)Isoxazoles",
Tetrahedron, 47(28):5111-5118 (1991). cited by other .
Sakuma, et al., "c-kit Gene Mutations in Intracranial Germinomas",
Cancer Sci, 95(9):716-720 (2004). cited by other .
Satsangi, et al., "1-(4-Substituted-thiazol-2-yl)hydatoins as
Anti-inflammatory and CNS-Active Agents", Pharmazie, 38:341-342
(1983). cited by other .
Schiering, et al, "Crystal Structure of the Tyrosine Kinase Domain
of the Hepatocyte Growth Factor Receptor c-Met and its Complex with
the Microbial Alkaloid K-252b", Proc. Nat'l Acad. Sci 100(22):
12654-12659 (2003). cited by other .
Schindler, et al., "Structural Mechanism for STI-571 Inhibition of
Abelson Tyrosine Kinase", Science, 289:1938-1942 (2000). cited by
other .
Schmidt, et al., "Germline and Somatic Mutations in the Tyrosine
Kinase Domain of the MET proto-oncogene in Papillary Renal
Carcinomas", Nature Genetics, 16:68-73 (1997). cited by other .
Schmidt, et al., "Novel Mutations of the MET Proto-oncogene in
Papillary Renal Carcinomas", Oncogene, 18:2343-2350 (1999). cited
by other .
Seimiya, et al., "Telomere Shortening and Growth Inhibition of
Human Cancer Cells by Novel Synthetic Telomerase Inhibitors
MST-312, MST-295, and MST-199", Molecular Cancer Therapeutics,
1:657-665 (2002). cited by other .
Seminario, et al., "Theoretical Study of a Molecular Resonant
Tunneling Diode", J. Am. Chem. Soc., 122:3015-3020 (2000). cited by
other .
Shah, et al., "Circular Dichroic Studies of Protein Kinase C and
its Interactions with Calcium and Lipid Vesicles", Biochimica et
Biophysica Acta, 1119:19-26 (1992). cited by other .
Shi, et al., "Abnormal Diels-Alder Reaction of 5-Alkoxythiazoles
with Highly Reactive Dienophiles;
4-Phenyl-3H-1,2,4-triazole-3,5(4H)-dione, Diethyl Azodicarboxylate,
and Diethyl Oxomalonate", Bull. Chem. Soc. Jpn., 65:3315-3321
(1992). cited by other .
Shinkai, et al., "Coenzyme Models, Part 45. Synthesis of
Atropisomeric Flavins and their Novel Redox-induced Racemisation",
J. Chem. Soc. Perkin Trans., pp. 313-319 (1988). cited by other
.
Shiozaki, et al., "Impaired Differentiation of Endocrine and
Exocrine Cells of the Pancreas in Transgenic Mouse Expressing the
Truncated Type II Activin Receptor", Biochimica et Biophysica Acta,
1450:1-11 (1999). cited by other .
Stout, et al., "High-Throughput Structural Biology in Drug
Discovery: Protein Kinases", Current Pharmaceutical Design,
10:1069-1082 (2004). cited by other .
Sugden, et al., ""Stress-Responsive" Mitogen-Activated Protein
Kinases (c-Jun N-Terminal Kinases and p38 Mitogen-Activated Protein
Kinases) in the Myocardium", Circulation Research--Journal of the
American Heart Association, 83:345-352 (1998). cited by other .
Tanis, et al., "Two Distinct Phosphorylation Pathways Have Additive
Effects on Abl Family Kinase Activation", Molecular and Cellular
Biology, 23(11):3884-3896 (2003). cited by other .
Teague, "Implications of Protein Flexibility for Drug Discovery",
Nature Reviews Drug Discovery, 2:527-541 (2003). cited by other
.
Tominaga, et al., "General model for Estimation of the Inhibition
of Protein Kinases Using Monte Carlo Simulations", J. Med. Chem.,
47:2534-2549 (2004). cited by other .
Tremblay, et al., "Efficient Solid-Phase Synthesis of
Sulfahydantoins", J. Comb. Chem., 4:429-435 (2002). cited by other
.
"Trilateral Project WM4--Comparative Studies in New Technologies:
Report on Comparative Study on Protein 3-Dimensional Structure
Related Claims--Annex 3: Comments of the USPTO", Vienna, Austria,
Nov. 4-8, pp. 58-79 (2002). cited by other .
Tsuzuki, et al., "Synthesis and Structure-Activity Relationships of
Novel 7-Substituted
1,4-Dihydro-4-oxo-1-(2-thiazolyl)-1,8-napthyridine-3-carboxylic
Acids as Antitumor Agents. Part 2", J. Med. Chem., 47:2097-2109
(2004). cited by other .
Van Etten, "Cycling, Stressed-Out and Nervous: Cellular Functions
of c-Abl", Trends in Cell Biology, 9:179-186 (1999). cited by other
.
Venter, et al., "The Sequence of the Human Genome", Science,
291:1304-1351, Feb. 16, 2001; Erratum, Jun. 8, 2001 (49 pages).
cited by other .
Waetzig, et al., "Review Article: Mitogen-Activated Protein Kinases
in Chronic Intestinal Inflammation--Targeting Ancient Pathways to
Treat Modern Diseases", Aliment Pharmacol Ther, 18:17-32 (2003).
cited by other .
Wan, et al., "Mechanism of Activation of the RAF-ERK Signaling
Pathway by Oncogenic Mutations of B-RAF", Cell, 116:855-867 (2004).
cited by other .
Welker, et al., "Glucocorticoid-Induced Modulation of Cytokine
Secretion from Normal and Leukemic Human Myelomonocytic Cells",
Int. Arch. Allergy Immunol, 109:110-115 (1996). cited by other
.
Wentland, et al., "3-Quinolinecarboxamides. A Series of Novel
Orally-Active Antiherpetic Agents", J. Med. Chem., 36:1580-1596
(1993). cited by other .
Wilson, et al., "The Structural Basis for the Specificity of
Pyridinylimidazole Inhibitors of p38 Map Kinase", Chemistry &
Biology, 4(6):423-431 (1997). cited by other .
Wilson, et al., "Laser-Jet Delayed Trapping: Electron-Transfer
Trapping of the Photoenol from 2-Methylbenzophenone", J. Am. Chem.
Soc., 109:4743-4745 (1987). cited by other .
Wolter, et al., "Copper-Catalyzed Coupling of Aryl Iodides with
Aliphatic Alcohols", Organic Letters, 4(6):973-976 (2002). cited by
other .
Wrana, et al., "Mechanism of Activation of the TGF-b Receptor",
Nature, 370:341-347 (1994). cited by other .
Wu, et al., "Discovery of a Novel Family of CDK Inhibitors with the
Program LIDAEUS: Structual Basis for Ligand-Induced Disordering of
the Acivation Loop", Structure, 11:399-410 (2003). cited by other
.
Yang, et al., "Molecular Mechanism for the Regulation of Protein
Kinase B/Akt by Hydrophobic Motif Phosphorylation", Molecular Cell,
9:1227-1240 (2002). cited by other .
Yang, et al., "Palladium-Catalyzed Amination of Arly Halides and
Sulfonates", Journal of Organometallic Chemistry, 576:125-146
(1999). cited by other .
Yarden, et al., "Human Proto-oncogene c-kit: a New Cell Surface
Receptor Tyrosine Kinase for an Unidentified Ligand", The EMBO
Journal, 6(11):3341-3351 (1987). cited by other .
Yoneda, et al., "A New Synthesis of Purines", J.C.S. Chem. Comm.,
p. 551 (1974). cited by other .
Yonezawa, et al., "Synthesis of Sequentially Controlled Isomeric,
Wholly aromatic Polyketones Composed of
2-trifluoromethylbiphenylene and 2,2'-dimethoxybiphenylene Units",
Reactive & Functional Polymers, 52:19-30 (2002). cited by other
.
Yoshimoto, et al., "Correlation Analysis of Baker's Studies on
Enzyme Inhibition. 2. Chymotrypsin, Trypsin, Thymidine
Phosphorylase, Uridine Phosphorylase, Thimidylate Synthetase,
Cytosine Nucleoside Deaminase, Dihodrofolate Reductase, Malate
Dehydrogenase, Glutamate Dehydrogenase, Lactate Dehydrogenase, and
Glyceraldehyde-phosphate Dehydrogenase", Journal of Medicinal
Chemistry, 19(1):71-98 (1976). cited by other .
Yoshino, et al., "Organic Phosphorous Compounds. 2. Synthesis and
Coronary Vasodilator Activity of (Benzothiazolybenzyl) Phosphonate
Derivatives", J. Med. Chem., 32:1528-1532 (1989). cited by other
.
Yu, et al., "Frequency of TPR-MET Rearrangement in Patients with
Gastric Carcinoma and in First-Degree Relatives", Cancer,
88(8):1801-1806 (2000). cited by other .
Zaidi, et al., "New Anti-Mycobacterial Hydantoins", Pharmazie,
35:755-756 (1980). cited by other .
Zhen, et al., "Structural and Functional Domains Critical for
Constitutive Activation of the HGF-Receptor (Met)", Oncogene,
9(6):1691-1697 (1994). cited by other .
Zvilichovsky, et al., "Aminolysis and Polymerization of
3-(p-Toluenesulfonoxy) Hydantoin", Israel Journal of Chemistry,
7:547-554 (1969). cited by other .
International Preliminary Search Report on Patentability for
PCT/US2009/62575, mailed Dec. 24, 2009 (6 pages). cited by
other.
|
Primary Examiner: Wilson; James O
Assistant Examiner: Pagano; Alexander R
Parent Case Text
CROSS-REFERENCE TO RELATED APPLICATIONS
This application claims the benefit of U.S. Provisional Application
No. 61/109,309 filed Oct. 29, 2008. This provisional application is
incorporated by reference herein in its entirety.
Claims
What is claimed is:
1. A compound of formula Ia ##STR00113## or a pharmaceutically
acceptable salt or tautomer thereof; wherein Q1 and Q2 are each
individually and independently selected from the group consisting
of N and CH and wherein at least one of Q1 and Q2 are N; each D is
individually taken from the group consisting of C, CH, C--R20,
N--Z3, N, and O, such that the resultant ring is taken from the
group consisting of pyrazolyl, isoxazolyl, triazolyl and
imidazolyl; W is a direct bond, or --[C(R13)R14].sub.m--; A is
selected from the group consisting of phenyl, pyridinyl, thienyl,
indanyl, tetrahydronapthyl, naphthyl, pyrazinyl, pyridazinyl,
triazinyl, and pyrimidinyl; when A has one or more substitutable
sp2-hybridized carbon atoms, each respective sp2 hybridized carbon
atom may be optionally substituted with a Z1B substituent; when A
has one or more substitutable sp3-hybridized carbon atoms, each
respective sp3 hybridized carbon atom may be optionally substituted
with a Z2B substituent; each Z1B is independently and individually
selected from the group consisting of hydrogen, halogen, C1-6alkyl,
branched C3-C7alkyl, fluoroC1-C6alkyl wherein the alkyl moiety can
be partially or fully fluorinated, C1-C6alkoxy, fluoroC1-C6alkoxy
wherein the alkyl moiety can be partially or fully fluorinated, and
--(CH.sub.2).sub.nCN; each Z2B is independently and individually
selected from the group consisting of hydrogen, C1-C6alkyl, and
branched C3-C7alkyl; each Z3 is independently and individually
selected from the group consisting of C1-C6alkyl, hydrogen,
branched C3-C7alkyl, C3-C8cycloalkyl, fluoroC1-C6alkyl wherein the
alkyl moiety can be partially or fully fluorinated,
hydroxyC2-C6alkyl-, R5C(O)(CH.sub.2).sub.n--,
(R4).sub.2NC(O)C1-C6alkyl-, R8C(O)N(R4)(CH.sub.2).sub.q--,
--(CH.sub.2).sub.qCN, --(CH.sub.2).sub.qR5, and
--(CH.sub.2).sub.qN(R4).sub.2; each R2 is selected from the group
consisting of hydrogen, R17-substituted aryl-, C1-C6alkyl, branched
C3-C8alkyl, R19 substituted C3-C8cycloalkyl-, and fluoroC1-C6alkyl-
wherein the alkyl is fully or partially fluorinated; wherein each
R3 is independently and individually selected from the group
consisting of hydrogen, C1-C6alkyl, branched C3-C7alkyl, and
C3-C8cycloalkyl; each R4 is independently and individually selected
from the group consisting of hydrogen, C1-C6alkyl,
hydroxyC1-C6alkyl-, dihydroxyC1-C6alkyl-, C1-C6alkoxyC1-C6alkyl-,
branched C3-C7alkyl, hydroxyl substituted branched C3-C6alkyl-,
C1-C6alkoxy branched C3-C6alkyl-, dihydroxy substituted branched
C3-C6alkyl-, --(CH.sub.2).sub.pN(R7).sub.2, --(CH.sub.2).sub.pR5,
--(CH.sub.2).sub.pC(O)N(R7).sub.2, --(CH.sub.2).sub.nC(O)R5,
--(CH.sub.2).sub.nC(O)OR3, and R19 substituted C3-C8cycloalkyl-;
each R5 is independently and individually selected from the group
consisting of ##STR00114## and wherein the symbol (##) is the point
of attachment to respective R4, R7, R8, R20 or Z3 moieties
containing a R5 moiety; each R7 is independently and individually
selected from the group consisting of hydrogen, C1-C6alkyl,
hydroxyC2-C6alkyl-, dihydroxyC2-C6alkyl-, C1-C6alkoxyC2-C6alkyl-,
branched C3-C7alkyl, hydroxy substituted branched C3-C6alkyl-,
C1-C6alkoxy branched C3-C6alkyl-, dihydroxy substituted branched
C3-C6alkyl-, --(CH.sub.2).sub.qR5, --(CH.sub.2).sub.nC(O)R5,
--(CH.sub.2).sub.nC(O)OR3, R19 substituted C3-C8cycloalkyl- and
--(CH.sub.2).sub.nR17; each R8 is independently and individually
selected from the group consisting of C1-C6alkyl, branched
C3-C7alkyl, fluoroC1-C6alkyl- wherein the alkyl moiety is partially
or fully fluorinated, R19 substituted C3-C8cycloalkyl-, phenyl,
phenylC1-C6alkyl-, OH, C1-C6alkoxy, --N(R3).sub.2, --N(R4).sub.2,
and R5; each R10 is independently and individually selected from
the group consisting of --CO.sub.2H, --CO.sub.2C1-C6alkyl,
--C(O)N(R4).sub.2, OH, C1-C6alkoxy, and --N(R4).sub.2; R13 and R14
are each individually and independently selected from the group
consisting of hydrogen, C1-C6alkyl, branched C3-C8alkyl,
fluoroC1-C6alkyl- wherein the alkyl is fully or partially
fluorinated, hydroxyl substituted C1-C6alkyl-, C1-C6alkoxy
substituted C1-C6alkyl-, hydroxyl substituted branched C3-C8alkyl-,
and alkoxy substituted branched C3-C8alkyl; each R16 is
independently and individually selected from the group consisting
of hydrogen, C1-C6alkyl, branched C3-C7alkyl, R19 substituted
C3-C8cycloalkyl-, halogen, fluoroC1-C6alkyl- wherein the alkyl
moiety can be partially or fully fluorinated, cyano, hydroxyl,
C1-C6alkoxy, fluoroC1-C6alkoxy- wherein the alkyl moiety can be
partially or fully fluorinated, --N(R3).sub.2, --N(R4).sub.2, R3
substituted C2-C3alkynyl- and nitro; each R17 is independently and
individually selected from the group consisting of hydrogen,
C1-C6alkyl, branched C3-C7alkyl, hydroxyC2-C6alkyl-, R19
substituted C3-C8cycloalkyl-, halogen, fluoroC1-C6alkyl- wherein
the alkyl moiety can be partially or fully fluorinated, cyano,
hydroxyl, C1-C6alkoxy, fluoroC1-C6alkoxy- wherein the alkyl moiety
can be partially or fully fluorinated, --N(R3).sub.2,
--N(R4).sub.2, and nitro; each R19 is independently and
individually selected from the group consisting of hydrogen, OH and
C1-C6alkyl; each R20 is independently and individually selected
from the group consisting of hydrogen, C1-C6alkyl, branched
C3-C7alkyl, R19 substituted C3-C8cycloalkyl-, halogen,
fluoroC1-C6alkyl- wherein the alkyl moiety can be partially or
fully fluorinated, cyano, hydroxyl, hydroxyC1-C6alkyl-,
C1-C6alkoxyC1-C6alkyl-, C1-C6alkoxy, fluoroC1-C6alkoxy- wherein the
alkyl moiety can be partially or fully fluorinated, --N(R3).sub.2,
--N(R4).sub.2, --(CH.sub.2).sub.nR5, --(CH.sub.2).sub.nN(R3)C(O)R3,
--(CH.sub.2).sub.nC(O)N(R3).sub.2 and nitro; each m is
independently and individually 1-3, each n is independently and
individually 0-6; each p is independently and individually 1-4;
each q is independently and individually 2-6; each v is
independently and individually 1 or 2; each x is independently and
individually 0-2.
2. The compound of claim 1 wherein ##STR00115## is selected from
the group consisting of ##STR00116## wherein the symbol (**)
indicates the point of attachment to the heteroaryl Q1, Q2
containing ring.
3. The compound of claim 2 having formula Ii ##STR00117##
4. The compound of claim 2 having formula Iu ##STR00118##
5. The compound of claim 2 having formula Igg ##STR00119##
6. A compound selected from the group consisting of
2-(4-fluorophenyl)-N-(5-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pyri-
din-2-ylcarbamoyl)acetamide,
2-(4-fluorophenyl)-N-(4-methyl-5-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-y-
loxy)pyridin-2-ylcarbamoyl)acetamide and pharmaceutically
acceptable salts and tautomers thereof.
7. A pharmaceutical composition comprising a compound of claim 1,
together with a pharmaceutically acceptable carrier, optionally
containing an additive selected from the group consisting of
adjuvants, excipients, diluents, and stabilizers.
Description
SEQUENCE LISTING
The instant application contains a Sequence Listing which has been
submitted via EFS-Web and is hereby incorporated by reference in
its entirety. Said ASCII copy, created on Dec. 14, 2009, is named
22035111.txt, and is 13,485 bytes in size.
FIELD OF THE INVENTION
The present invention relates to novel kinase inhibitors and
modulator compounds useful for the treatment of various diseases.
More particularly, the invention is concerned with such compounds,
methods of treating diseases, and methods of synthesis of the
compounds. Preferably, the compounds are useful for the modulation
of kinase activity of VEGFR-2 (KDR), c-MET, FLT-3c-KIT,
PDGFR.alpha., PDGFR.beta., c-FMS kinase, and disease causing
polymorphs and fusion proteins thereof.
BACKGROUND OF THE INVENTION
Several members of the protein kinase family have been clearly
implicated in the pathogenesis of various proliferative and
myeloproliferative diseases and thus represent important targets
for treatment of these diseases. Some of the proliferative diseases
relevant to this invention include cancer, rheumatoid arthritis,
atherosclerosis, and retinopathies. Important examples of kinases
which have been shown to cause or contribute to the pathogenesis of
these diseases include c-ABL kinase and the oncogenic fusion
protein BCR-ABL kinase, c-KIT kinase, c-MET, FGFR kinase family,
PDGF receptor kinase, VEGF receptor kinases, FLT kinase family, the
HER family and the cFMS kinase family. When such kinases are
implicated in human disease, a kinase may present as an amplified
kinase (i.e. overexpression of HER1 or HER2), a mutated kinase
(i.e. c-KIT D816V) or an aberrant fusion protein (i.e.
BCR-ABL).
c-KIT (KIT, CD117, stem cell factor receptor) is a 145 kDa
transmembrane tyrosine kinase protein that acts as a type-III
receptor (Pereira et al. J Carcin. (2005), 4: 19). The c-KIT
proto-oncogene, located on chromosome 4q11-21, encodes the c-KIT
receptor, whose ligand is the stem cell factor (SCF, steel factor,
kit ligand, mast cell growth factor, Morstyn G, et al. Oncology
(1994) 51(2):205; Yarden Y, et al. Embo J (1987) 6(11):3341). The
receptor has tyrosine-protein kinase activity and binding of the
ligands leads to the autophosphorylation of KIT and its association
with substrates such as phosphatidylinositol 3-kinase (PI3K).
Tyrosine phosphorylation by protein tyrosine kinases is of
particular importance in cellular signalling and can mediate
signals for major cellular processes, such as proliferation,
survival, differentiation, apoptosis, attachment, invasiveness and
migration. Defects in KIT are a cause of piebaldism, an autosomal
dominant genetic developmental abnormality of pigmentation
characterized by congenital patches of white skin and hair that
lack melanocytes. Gain-of-function mutations of the c-KIT gene and
the expression of phosphorylated KIT are found in most
gastrointestinal stromal tumors and mastocytosis. Further, almost
all gonadal seminomas/dysgerminomas exhibit KIT membranous
staining, and several reports have clarified that some (10-25%)
have a c-KIT gene mutation (Sakuma, Y. et al. Cancer Sci (2004)
95(9): 716). KIT defects have also been associated with testicular
tumors including germ cell tumors (GCT) and testicular germ cell
tumors (TGCT).
The role of c-KIT expression has been studied in hematologic and
solid tumours, such as acute leukemias (Cortes J. et al. Cancer
(2003) 97(11): 2760) and gastrointestinal stromal tumors (GIST,
Fletcher J. et al. Hum Pathol (2002) 33(5): 459). The clinical
importance of c-KIT expression in malignant tumors relies on
studies with Gleevec.RTM. (imatinib mesylate, STI571, Novartis
Pharma AG Basel, Switzerland) that specifically inhibits tyrosine
kinase receptors (Lefevre G. et al. J Biol Chem (2004) 279(30):
31769). Moreover, a clinically relevant breakthrough has been the
finding of anti-tumor effects of this compound in GIST, a group of
tumors regarded as being generally resistant to conventional
chemotherapy (de Silva C M, Reid R Pathol Oncol Res (2003) 9(1):
13-19). GIST most often become Gleevec resistant and molecularly
targeted small therapies that target c-KIT secondary mutations
remain elusive.
c-MET is a unique receptor tyrosine kinase (RTK) located on
chromosome 7p and activated via its natural ligand hepatocyte
growth factor. c-MET is found mutated in a variety of solid tumors
(Ma P. C. et al. Cancer Metastasis (2003) 22: 309). Mutations in
the tyrosine kinase domain are associated with hereditary papillary
renal cell carcinomas (Schmidt L et al. Nat. Genet. (1997) 16: 68;
Schmidt L, et al. Oncogene (1999) 18: 2343), whereas mutations in
the sema and juxtamembrane domains are often found in small cell
lung cancers (Ma P. C. et al. Cancer Res (2003) 63: 6272). Many
activating mutations are also found in breast cancers (Nakopoulou
et al. Histopath (2000) 36(4): 313). The panoply of tumor types for
which c-MET mediated growth has been implicated suggests this is a
target ideally suited for modulation by specific c-MET small
molecule inhibitors.
The TPR-MET oncogene is a transforming variant of the c-MET RTK and
was initially identified after treatment of a human osteogenic
sarcoma cell line transformed by the chemical carcinogen
N-methyl-N'-nitro-N-nitrosoguanidine (Park M. et al. Cell (1986)
45: 895). The TPR-MET fusion oncoprotein is the result of a
chromosomal translocation, placing the TPR3 locus on chromosome 1
upstream of a portion of the c-MET gene on chromosome 7 encoding
only for the cytoplasmic region. Studies suggest that TPR-MET is
detectable in experimental cancers (e.g. Yu J. et al. Cancer (2000)
88: 1801). Dimerization of the M.sub.r65,000 TPR-MET oncoprotein
through a leucine zipper motif encoded by TPR leads to constitutive
activation of the c-MET kinase (Zhen Z. et al. Oncogene (1994) 9:
1691). TPR-MET activates wild-type c-MET RTK and can activate
crucial cellular growth pathways, including the Ras pathway (Aklilu
F. et al. Am J Physiol (1996) 271: E277) and the
phosphatidylinositol 3-kinase (PI3K)/AKT pathway (Ponzetto C. et
al. Mol Cell Biol (1993) 13: 4600). Conversely, in contrast to
c-MET RTK, TPR-MET is ligand independent, lacks the CBL-like SH2
domain binding site in the juxtamembrane region in c-MET, and is
mainly cytoplasmic. c-MET immunohistochemical expression seems to
be associated with abnormal .beta.-catenin expression, a hallmark
feature of epithelial to mesynchemal transition (EMT) and provides
good prognostic and predictive factors in breast cancer
patients.
The majority of small molecule kinase inhibitors that have been
reported have been shown to bind in one of three ways. Most of the
reported inhibitors interact with the ATP binding domain of the
active site and exert their effects by competing with ATP for
occupancy. Other inhibitors have been shown to bind to a separate
hydrophobic region of the protein known as the
"DFG-in-conformation" pocket wherein such a binding mode by the
inhibitor causes the kinase to adopt the "DFG-out" conformation,
and still others have been shown to bind to both the ATP domain and
the "DFG-in-conformation" pocket again causing the kinase to adopt
the "DGF-out" conformation. Examples that induce the kinase to
adopt the "DGF-out" conformation can be found in Lowinger et al,
Current Pharmaceutical Design (2002) 8: 2269; Dumas, J. et al.,
Current Opinion in Drug Discovery & Development (2004) 7: 600;
Dumas, J. et al, WO 2003068223 A1 (2003); Dumas, J., et al, WO
9932455 A1 (1999), and Wan, P. T. C., et al, Cell (2004) 116:
855.
Physiologically, kinases are regulated by a common
activation/deactivation mechanism wherein a specific activation
loop sequence of the kinase protein binds into a specific pocket on
the same protein which is referred to as the switch control pocket.
Such binding occurs when specific amino acid residues of the
activation loop are modified for example by phosphorylation,
oxidation, or nitrosylation. The binding of the activation loop
into the switch pocket results in a conformational change of the
protein into its active form (Huse, M. and Kuriyan, J. Cell (2002)
109: 275).
SUMMARY OF THE INVENTION
Compounds of the present invention find utility in the treatment of
mammalian cancers and especially human cancers including, but not
limited to, solid tumors, melanomas, glioblastomas, ovarian cancer,
pancreatic cancer, prostate cancer, lung cancers, breast cancers,
kidney cancers, cervical carcinomas, metastasis of primary tumor
sites, myeloproliferative diseases, leukemias, papillary thyroid
carcinoma, non small cell lung cancer, mesothelioma,
hypereosinophilic syndrome, gastrointestinal stromal tumors,
colonic cancers, ocular diseases characterized by
hyperproliferation leading to blindness including various
retinopathies, rheumatoid arthritis, asthma, chronic obstructive
pulmonary disorder, mastocytosis, mast cell leukemia, and diseases
caused by PDGFR-.alpha. kinase, PDGFR-.beta. kinase, c-KIT kinase,
cFMS kinase, c-MET kinase, and oncogenic forms, aberrant fusion
proteins and polymorphs of any of the foregoing kinases.
In a first aspect, compounds the formula Ia are described
herein:
##STR00001## and pharmaceutically acceptable salts, hydrates,
solvates, prodrugs, and tautomers thereof; wherein Q1, Q2, and Q3,
are each individually and independently selected from the group
consisting of N and CH and wherein at least one of Q1 and Q2 are N;
and wherein the ring containing Q1 and Q2 may be optionally
substituted with (R20).sub.x moieties; each D is individually taken
from the group consisting of C, CH, C--R20, N--Z3, N, and O, such
that the resultant ring is taken from the group consisting of
pyrazolyl, isoxazolyl, triazolyl and imidazolyl; and wherein the
ring containing Q3 may be optionally substituted with one to three
R16 moieties; V is NR4, or
##STR00002## each Q5 is C(Z2B).sub.2; W is a direct bond,
--[C(R13)R14].sub.m--, --[C(R13)R14].sub.mNR4-, or NR4; A is
selected from the group consisting of indanyl, tetrahydronapthyl,
thienyl, phenyl, naphthyl, pyrazinyl, pyridazinyl, triazinyl,
pyridinyl, and pyrimidinyl; X2 is --O--; when A has one or more
substitutable sp2-hybridized carbon atoms, each respective sp2
hybridized carbon atom may be optionally substituted with a Z1B
substituent; when A has one or more substitutable sp3-hybridized
carbon atoms, each respective sp3 hybridized carbon atom may be
optionally substituted with a Z2B substituent; each Z1B is
independently and individually selected from the group consisting
of hydrogen, C1-6alkyl, branched C3-C7alkyl, halogen,
fluoroC1-C6alkyl wherein the alkyl moiety can be partially or fully
fluorinated, C1-C6alkoxy, fluoroC1-C6alkoxy wherein the alkyl
moiety can be partially or fully fluorinated, and
--(CH.sub.2).sub.nCN; each Z2B is independently and individually
selected from the group consisting of hydrogen, C1-C6alkyl, and
branched C3-C7alkyl; each Z3 is independently and individually
selected from the group consisting of hydrogen, C1-C6alkyl,
branched C3-C7alkyl, C3-C8cycloalkyl, fluoroC1-C6alkyl wherein the
alkyl moiety can be partially or fully fluorinated,
hydroxyC2-C6alkyl-, R5C(O)(CH.sub.2).sub.n--,
(R4).sub.2NC(O)C1-C6alkyl-, R8C(O)N(R4)(CH.sub.2).sub.q--,
--(CH.sub.2).sub.qCN, --(CH.sub.2).sub.q--R5, and
--(CH.sub.2).sub.qN(R4).sub.2; each R2 is selected from the group
consisting of hydrogen, R17-substituted aryl-, C1-C6alkyl, branched
C3-C8alkyl, R19 substituted C3-C8cycloalkyl-, and fluoroC1-C6alkyl-
wherein the alkyl is fully or partially fluorinated; each R3 is
independently and individually selected from the group consisting
of hydrogen, C1-C6alkyl, branched C3-C7alkyl, and C3-C8cycloalkyl;
each R4 is independently and individually selected from the group
consisting of hydrogen, C1-C6alkyl, hydroxyC1-C6alkyl-,
dihydroxyC1-C6alkyl-, C1-C6alkoxyC1-C6alkyl-, branched C3-C7alkyl,
hydroxyl substituted branched C3-C6alkyl-, C1-C6alkoxy branched
C3-C6alkyl-, dihydroxy substituted branched C3-C6alkyl-,
--(CH.sub.2).sub.pN(R7).sub.2, --(CH.sub.2).sub.pR5,
--(CH.sub.2).sub.pC(O)N(R7).sub.2, --(CH.sub.2)C(O)R5,
--(CH.sub.2).sub.nC(O)OR3, and R19 substituted C3-C8 cycloalkyl-;
each R5 is independently and individually selected from the group
consisting of
##STR00003## and wherein the symbol (##) is the point of attachment
to respective R4, R7, R8, R20 or Z3 moieties containing a R5
moiety; each R7 is independently and individually selected from the
group consisting of hydrogen, C1-C6alkyl, hydroxyC2-C6alkyl-,
dihydroxyC2-C6alkyl-, C1-C6alkoxyC2-C6alkyl-, branched C3-C7alkyl,
hydroxy substituted branched C3-C6alkyl-, C1-C6alkoxy branched
C3-C6alkyl-, dihydroxy substituted branched C3-C6alkyl-,
--(CH.sub.2).sub.qR5, --(CH.sub.2).sub.nC(O)R5,
--(CH.sub.2).sub.nC(O)OR3, R19 substituted C3-C8cycloalkyl- and
--(CH.sub.2).sub.nR17; each R8 is independently and individually
selected from the group consisting of C1-C6alkyl, branched
C3-C7alkyl, fluoroC1-C6alkyl- wherein the alkyl moiety is partially
or fully fluorinated, R19 substituted C3-C8cycloalkyl-, phenyl,
phenylC1-C6alkyl-, OH, C1-C6alkoxy, --N(R3).sub.2, --N(R4).sub.2,
and R5; each R10 is independently and individually selected from
the group consisting of --CO.sub.2H, --CO.sub.2C1-C6alkyl,
--C(O)N(R4).sub.2, OH, C1-C6alkoxy, and --N(R4).sub.2; R13 and R14
are each individually and independently selected from the group
consisting of hydrogen, C1-C6alkyl, branched C3-C8alkyl,
fluoroC1-C6alkyl- wherein the alkyl is fully or partially
fluorinated, hydroxyl substituted C1-C6alkyl-, C1-C6alkoxy
substituted C1-C6alkyl-, hydroxyl substituted branched C3-C8alkyl-,
and alkoxy substituted branched C3-C8alkyl; each R16 is
independently and individually selected from the group consisting
of hydrogen, C1-C6alkyl, branched C3-C7alkyl, R19 substituted
C3-C8cycloalkyl-, halogen, fluoroC1-C6alkyl- wherein the alkyl
moiety can be partially or fully fluorinated, cyano, hydroxyl,
C1-C6alkoxy, fluoroC1-C6alkoxy- wherein the alkyl moiety can be
partially or fully fluorinated, --N(R3).sub.2, --N(R4).sub.2, R3
substituted C2-C3alkynyl- and nitro; each R17 is independently and
individually selected from the group consisting of hydrogen,
C1-C6alkyl, branched C3-C7alkyl, hydroxyC2-C6alkyl-, R19
substituted C3-C8cycloalkyl-, halogen, fluoroC1-C6alkyl- wherein
the alkyl moiety can be partially or fully fluorinated, cyano,
hydroxyl, C1-C6alkoxy, fluoroC1-C6alkoxy- wherein the alkyl moiety
can be partially or fully fluorinated, --N(R3).sub.2,
--N(R4).sub.2, and nitro; each R19 is independently and
individually selected from the group consisting of hydrogen, OH and
C1-C6alkyl; each R20 is independently and individually selected
from the group consisting of hydrogen, C1-C6alkyl, branched
C3-C7alkyl, R19 substituted C3-C8cycloalkyl-, halogen,
fluoroC1-C6alkyl- wherein the alkyl moiety can be partially or
fully fluorinated, cyano, hydroxyl, hydroxyC1-C6alkyl-,
C1-C6alkoxyC1-C6alkyl-, C1-C6alkoxy, fluoroC1-C6alkoxy- wherein the
alkyl moiety can be partially or fully fluorinated, --N(R3).sub.2,
--N(R4).sub.2, --(CH.sub.2).sub.nR5, --(CH.sub.2).sub.nN(R3)C(O)R3,
--(CH.sub.2).sub.nC(O)N(R3).sub.2 and nitro; each m is
independently and individually 1-3, each n is independently and
individually 0-6; each p is independently and individually 1-4;
each q is independently and individually 2-6; each v is
independently and individually 1 or 2; each x is independently and
individually 0-2; stereoisomers, regioisomers and tautomers of such
compounds.
In some embodiments,
##STR00004## is selected from the group consisting of
##STR00005## wherein the symbol (**) indicates the point of
attachment to the heteroaryl Q1, Q2 containing ring.
In another embodiment, the compounds have formula Ib
##STR00006##
In another embodiment, the compounds have formula Ic
##STR00007##
In another embodiment, the compounds have formula Id
##STR00008##
In another embodiment, the compounds have formula Ie
##STR00009##
In another embodiment, the compounds have formula If
##STR00010##
In another embodiment, the compounds have formula Ig
##STR00011##
In another embodiment, the compounds have formula Ih
##STR00012##
In another embodiment, the compounds have formula Ii
##STR00013##
In another embodiment, the compounds have formula Ij
##STR00014##
In another embodiment, the compounds have formula Ik
##STR00015##
In another embodiment, the compounds have formula Il
##STR00016##
In another embodiment, the compounds have formula Im
##STR00017##
In another embodiment, the compounds have formula In
##STR00018##
In another embodiment, the compounds have formula Io
##STR00019##
In another embodiment, the compounds have formula Ip
##STR00020##
In another embodiment, the compounds have formula Iq
##STR00021##
In another embodiment, the compounds have formula Ir
##STR00022##
In another embodiment, the compounds have formula Is
##STR00023##
In another embodiment, the compounds have formula It
##STR00024##
In another embodiment, the compounds have formula Iu
##STR00025##
In another embodiment, the compounds have formula Iv
##STR00026##
In another embodiment, the compounds have formula Iw
##STR00027##
In another embodiment, the compounds have formula Ix
##STR00028##
In another embodiment, the compounds have formula Iy
##STR00029##
In another embodiment, the compounds have formula Iz
##STR00030##
In another embodiment, the compounds have formula Iaa
##STR00031##
In another embodiment, the compounds have formula Ibb
##STR00032##
In another embodiment, the compounds have formula Icc
##STR00033##
In another embodiment, the compounds have formula Idd
##STR00034##
In another embodiment, the compounds have formula Iee
##STR00035##
In another embodiment, the compounds have formula Iff
##STR00036##
In another embodiment, the compounds have formula Igg
##STR00037##
In another embodiment, the compounds have formula Ihh
##STR00038##
In another embodiment, the compounds have formula Iii
##STR00039##
In another embodiment, the compounds have formula Ijj
##STR00040##
In another embodiment, the compounds have formula Ikk
##STR00041##
In another aspect, pharmaceutical compositions are described which
comprise a compound of the invention, together with a
pharmaceutically acceptable carrier, optionally containing an
additive selected from the group consisting of adjuvants,
excipients, diluents, and stabilizers.
Compounds of the present invention find utility in the treatment of
mammalian cancers, hyperproliferative diseases, metabolic diseases,
neurodegenerative diseases, or diseases characterized by
angiogenesis including, but not limited to, solid tumors,
melanomas, glioblastomas, ovarian cancer, pancreatic cancer,
prostate cancer, lung cancers, breast cancers, renal cancers,
hepatic cancers, cervical carcinomas, metastasis of primary tumor
sites, myeloproliferative diseases, chronic myelogenous leukemia,
leukemias, papillary thyroid carcinoma, non-small cell lung cancer,
mesothelioma, hypereosinophilic syndrome, gastrointestinal stromal
tumors, colonic cancers, ocular diseases characterized by
hyperproliferation leading to blindness including retinopathies,
diabetic retinopathy, age-related macular degeneration and
hypereosinophilic syndrome, rheumatoid arthritis, asthma, chronic
obstructive pulmonary, mastocytosis, mast cell leukemia, and
diseases caused by PDGFR-.alpha. kinase, PDGFR-.beta. kinase, c-KIT
kinase, cFMS kinase, c-MET kinase, and oncogenic forms, aberrant
fusion proteins and polymorphs of any of the foregoing kinases.
In some embodiments, the kinase is c-MET protein kinase, and any
fusion protein, mutation and polymorphs thereof.
In some embodiments, the compound is administered by a method
selected from the group consisting of oral, parenteral, inhalation,
and subcutaneous.
SECTION 1--DETAILED DESCRIPTION OF THE INVENTION
Throughout this disclosure, various patents, patent applications
and publications are referenced. The disclosures of these patents,
patent applications and publications in their entireties are
incorporated into this disclosure by reference in order to more
fully describe the state of the art as known to those skilled
therein as of the date of this disclosure. This disclosure will
govern in the instance that there is any inconsistency between the
patents, patent applications and publications and this
disclosure.
For convenience, certain terms employed in the specification,
examples and claims are collected here. Unless defined otherwise,
all technical and scientific terms used in this disclosure have the
same meanings as commonly understood by one of ordinary skill in
the art to which this disclosure belongs. The initial definition
provided for a group or term provided in this disclosure applies to
that group or term throughout the present disclosure individually
or as part of another group, unless otherwise indicated.
The compounds of this disclosure include any and all possible
isomers, stereoisomers, enantiomers, diastereomers, tautomers,
pharmaceutically acceptable salts, and solvates thereof. Thus, the
terms "compound" and "compounds" as used in this disclosure refer
to the compounds of this disclosure and any and all possible
isomers, stereoisomers, enantiomers, diastereomers, tautomers,
pharmaceutically acceptable salts, and solvates thereof.
The following descriptions refer to various compounds and moieties
thereof.
The term "cycloalkyl" refers to monocyclic saturated carbon rings
taken from cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
cycloheptanyl and cyclooctanyl.
The term "alkyl" refers to straight or branched chain
C1-C6alkyls.
The term "halogen" refers to fluorine, chlorine, bromine, and
iodine.
The term "alkoxy" refers to --O-(alkyl) wherein alkyl is defined as
above.
The term "alkoxylalkyl" refers to -(alkyl)-O-(alkyl) wherein alkyl
is defined as above.
The term "alkoxylcarbonyl" refers to --C(O)O-(alkyl) wherein alkyl
is defined as above.
The term "carboxylC1-C6alkyl" refers to --(C1-C6alkyl)CO.sub.2H
wherein alkyl is defined as above.
The term "substituted" in connection with a moiety refers to the
fact that a further substituent may be attached to the moiety to
any acceptable location on the moiety.
The term "salts" embraces pharmaceutically acceptable salts
commonly used to form alkali metal salts of free acids and to form
addition salts of free bases. The nature of the salt is not
critical, provided that it is pharmaceutically-acceptable. Suitable
pharmaceutically-acceptable acid addition salts may be prepared
from an inorganic acid or from an organic acid. Examples of such
inorganic acids are hydrochloric, hydrobromic, hydroiodic, nitric,
carbonic, sulfuric and phosphoric acid. Appropriate organic acids
may be selected from aliphatic, cycloaliphatic, aromatic,
arylaliphatic, and heterocyclyl containing carboxylic acids and
sulfonic acids, examples of which are formic, acetic, propionic,
succinic, glycolic, gluconic, lactic, malic, tartaric, citric,
ascorbic, glucuronic, maleic, fumaric, pyruvic, aspartic, glutamic,
benzoic, anthranilic, mesylic, stearic, salicylic,
p-hydroxybenzoic, phenylacetic, mandelic, embonic (pamoic),
methanesulfonic, ethanesulfonic, benzenesulfonic, pantothenic,
toluenesulfonic, 2-hydroxyethanesulfonic, sulfanilic,
cyclohexylaminosulfonic, algenic, 3-hydroxybutyric, galactaric and
galacturonic acid. Suitable pharmaceutically-acceptable salts of
free acid-containing compounds of Formula I include metallic salts
and organic salts. More preferred metallic salts include, but are
not limited to appropriate alkali metal (group Ia) salts, alkaline
earth metal (group IIa) salts and other physiological acceptable
metals. Such salts can be made from aluminum, calcium, lithium,
magnesium, potassium, sodium and zinc. Preferred organic salts can
be made from primary amines, secondary amines, tertiary amines and
quaternary ammonium salts, including in part, tromethamine,
diethylamine, tetra-N-methylammonium, N,N'-dibenzylethylenediamine,
chloroprocaine, choline, diethanolamine, ethylenediamine, meglumine
(N-methylglucamine) and procaine.
The terms "administer", "administering", or "administration" as
used in this disclosure refer to either directly administering a
compound or pharmaceutically acceptable salt of the compound or a
composition to a subject, or administering a prodrug derivative or
analog of the compound or pharmaceutically acceptable salt of the
compound or composition to the subject, which can form an
equivalent amount of active compound within the subject's body.
The term "carrier", as used in this disclosure, encompasses
carriers, excipients, and diluents and means a material,
composition or vehicle, such as a liquid or solid filler, diluent,
excipient, solvent or encapsulating material, involved in carrying
or transporting a pharmaceutical agent from one organ, or portion
of the body, to another organ, or portion of the body.
The term "disorder" is used in this disclosure to mean, and is used
interchangeably with, the terms disease, condition, or illness,
unless otherwise indicated.
The terms "effective amount" and "therapeutically effective amount"
are used interchangeably in this disclosure and refer to an amount
of a compound that, when administered to a subject, is capable of
reducing a symptom of a disorder in a subject. The actual amount
which comprises the "effective amount" or "therapeutically
effective amount" will vary depending on a number of conditions
including, but not limited to, the particular disorder being
treated, the severity of the disorder, the size and health of the
patient, and the route of administration. A skilled medical
practitioner can readily determine the appropriate amount using
methods known in the medical arts.
The terms "isolated" and "purified" as used in this disclosure
refer to a component separated from other components of a reaction
mixture or a natural source. In certain embodiments, the isolate
contains at least about 50%, at least about 55%, at least about
60%, at least about 65%, at least about 70%, at least about 75%, at
least about 80%, at least about 85%, at least about 90%, at least
about 95%, or at least about 98% of the compound or
pharmaceutically acceptable salt of the compound by weight of the
isolate.
The phrase "pharmaceutically acceptable" is employed in this
disclosure to refer to those compounds, materials, compositions,
and/or dosage forms which are, within the scope of sound medical
judgment, suitable for use in contact with the tissues of human
beings and animals without excessive toxicity, irritation, allergic
response, or other problem or complication, commensurate with a
reasonable benefit/risk ratio.
The term "prodrug" refers to derivatives of active compounds which
revert in vivo into the active form. For example, a carboxylic acid
form of an active drug may be esterified to create a prodrug, and
the ester is subsequently converted in vivo to revert to the
carboxylic acid form. See Ettmayer et. al, J. Med. Chem (2004) 47:
2393 and Lorenzi et. al, J. Pharm. Exp. Therpeutics (2005) 883 for
reviews.
As used in this disclosure, the term "subject" includes, without
limitation, a human or an animal. Exemplary animals include, but
are not limited to, mammals such as mouse, rat, guinea pig, dog,
cat, horse, cow, pig, monkey, chimpanzee, baboon, or rhesus
monkey.
The term "treating" with regard to a subject, refers to improving
at least one symptom of the subject's disorder. Treating can be
curing, improving, or at least partially ameliorating the
disorder.
The term "hydrate" refers to a compound as described herein which
is associated with water in the molecular form, i.e., in which the
H--OH bond is not split, and may be represented, for example, by
the formula R.H.sub.2O, where R is a compound as described herein.
A given compound may form more than one hydrate including, for
example, monohydrates (R.H.sub.2O), dihydrates (R.2H.sub.2O),
trihydrates (R.3H.sub.2O), and the like.
The term "solvate" refers to a compound of the present invention
which is associated with solvent in the molecular form, i.e. in
which the solvent is coordinatively bound, and may be represented,
for example, by the formula R(solvent), where R is a compound of
the invention. A given compound may form more than one solvate
including, for example, monosolvates (R(solvent)) or polysolvates
(Rn(solvent)) wherein n is an integer>1) including, for example,
disolvates (R2(solvent)), trisolvates (R3(solvent)), and the like,
or hemisolvates, such as, for example, Rn/2(solvent),
Rn/3(solvent), Rn/4(solvent) and the like wherein n is an integer.
Solvents herein include mixed solvents, for example,
methanol/water, and as such, the solvates may incorporate one or
more solvents within the solvate.
The term "acid hydrate" refers to a complex that may be formed
through association of a compound having one or more base moieties
with at least one compound having one or more acid moieties or
through association of a compound having one or more acid moieties
with at least one compound having one or more base moieties, said
complex being further associated with water molecules so as to form
a hydrate, wherein said hydrate is as previously defined and R
represents the complex herein described above.
Structural, chemical and stereochemical definitions are broadly
taken from IUPAC recommendations, and more specifically from
Glossary of Terms used in Physical Organic Chemistry (IUPAC
Recommendations 1994) as summarized by P. Muller, Pure Appl. Chem.,
(1994) 66: 1077-1184 and Basic Terminology of Stereochemistry
(IUPAC Recommendations 1996) as summarized by G. P. Moss Pure and
Applied Chemistry, (1996) 68: 2193-2222). Specific definitions are
as follows:
Atropisomers are defined as a subclass of conformers which can be
isolated as separate chemical species and which arise from
restricted rotation about a single bond.
Regioisomers or structural isomers are defined as isomers involving
the same atoms in different arrangements.
Enantiomers are defined as one of a pair of molecular entities
which are mirror images of each other and non-superimposable.
Diastereomers or diastereoisomers are defined as stereoisomers
other than enantiomers. Diastereomers or diastereoisomers are
stereoisomers not related as mirror images. Diastereoisomers are
characterized by differences in physical properties, and by some
differences in chemical behavior towards achiral as well as chiral
reagents.
The term "tautomer" as used in this disclosure refers to compounds
produced by the phenomenon wherein a proton of one atom of a
molecule shifts to another atom. (March, Advanced Organic
Chemistry: Reactions, Mechanisms and Structures, 4th Ed., John
Wiley & Sons, pp. 69-74 (1992)).
Tautomerism is defined as isomerism of the general form
G-X--Y.dbd.ZX.dbd.Y--Z-G where the isomers (called tautomers) are
readily interconvertible; the atoms connecting the groups X, Y, Z
are typically any of C, H, O, or S, and G is a group which becomes
an electrofuge or nucleofuge during isomerization. The most common
case, when the electrofuge is H.sup.+, is also known as
"prototropy".
Tautomers are defined as isomers that arise from tautomerism,
independent of whether the isomers are insoluble.
ChemDraw version 8.0 or 10. (CambridgeSoft Corporation, Cambridge,
Mass.) was used to name structures.
1.1 First Aspect of the Invention--Compounds, Methods, and
Preparations
Compounds of the formula Ia
##STR00042## and pharmaceutically acceptable salts, hydrates,
solvates, prodrugs, and tautomers thereof; wherein Q1, Q2, and Q3,
are each individually and independently selected from the group
consisting of N and CH and wherein at least one of Q1 and Q2 are N;
and wherein the ring containing Q1 and Q2 may be optionally
substituted with (R20).sub.x moieties; each D is individually taken
from the group consisting of C, CH, C--R20, N--Z3, N, and O, such
that the resultant ring is taken from the group consisting of
pyrazolyl, isoxazolyl, triazolyl and imidazolyl; and wherein the
ring containing Q3 may be optionally substituted with one to three
R16 moieties; V is NR4, or
##STR00043## each Q5 is C(Z2B).sub.2; W is a direct bond,
--[C(R13)R14].sub.m--, --[C(R13)R14].sub.mNR4-, or NR4; A is
selected from the group consisting of indanyl, tetrahydronapthyl,
thienyl, phenyl, naphthyl, pyrazinyl, pyridazinyl, triazinyl,
pyridinyl, and pyrimidinyl; X2 is --O--; when A has one or more
substitutable sp2-hybridized carbon atoms, each respective sp2
hybridized carbon atom may be optionally substituted with a Z1B
substituent; when A has one or more substitutable sp3-hybridized
carbon atoms, each respective sp3 hybridized carbon atom may be
optionally substituted with a Z2B substituent; each Z1B is
independently and individually selected from the group consisting
of hydrogen, C1-6alkyl, branched C3-C7alkyl, halogen,
fluoroC1-C6alkyl wherein the alkyl moiety can be partially or fully
fluorinated, C1-C6alkoxy, fluoroC1-C6alkoxy wherein the alkyl
moiety can be partially or fully fluorinated, and
--(CH.sub.2).sub.nCN; each Z2B is independently and individually
selected from the group consisting of hydrogen, C1-C6alkyl, and
branched C3-C7alkyl; each Z3 is independently and individually
selected from the group consisting of hydrogen, C1-C6alkyl,
branched C3-C7alkyl, C3-C8cycloalkyl, fluoroC1-C6alkyl wherein the
alkyl moiety can be partially or fully fluorinated,
hydroxyC2-C6alkyl-, R5C(O)(CH.sub.2).sub.n--,
(R4).sub.2NC(O)C1-C6alkyl-, R8C(O)N(R4)(CH.sub.2).sub.q--,
--(CH.sub.2).sub.qCN, --(CH.sub.2).sub.qR5, and
--(CH.sub.2).sub.qN(R4).sub.2; each R2 is selected from the group
consisting of hydrogen, R17-substituted aryl-, C1-C6alkyl, branched
C3-C8alkyl, R19 substituted C3-C8cycloalkyl-, and fluoroC1-C6alkyl-
wherein the alkyl is fully or partially fluorinated; wherein each
R3 is independently and individually selected from the group
consisting of hydrogen, C1-C6alkyl, branched C3-C7alkyl, and
C3-C8cycloalkyl; each R4 is independently and individually selected
from the group consisting of hydrogen, C1-C6alkyl,
hydroxyC1-C6alkyl-, dihydroxyC1-C6alkyl-, C1-C6alkoxyC1-C6alkyl-,
branched C3-C7alkyl, hydroxyl substituted branched C3-C6alkyl-,
C1-C6alkoxy branched C3-C6alkyl-, dihydroxy substituted branched
C3-C6alkyl-, --(CH.sub.2).sub.pN(R7).sub.2, --(CH.sub.2).sub.pR5,
--(CH.sub.2).sub.pC(O)N(R7).sub.2, --(CH.sub.2).sub.nC(O)R5,
--(CH.sub.2).sub.nC(O)OR3, and R19 substituted C3-C8cycloalkyl-;
each R5 is independently and individually selected from the group
consisting of
##STR00044## and wherein the symbol (##) is the point of attachment
to respective R4, R7, R8, R20 or Z3 moieties containing a R5
moiety; each R7 is independently and individually selected from the
group consisting of hydrogen, C1-C6alkyl, hydroxyC2-C6alkyl-,
dihydroxyC2-C6alkyl-, C1-C6alkoxyC2-C6alkyl-, branched C3-C7alkyl,
hydroxy substituted branched C3-C6alkyl-, C1-C6alkoxy branched
C3-C6alkyl-, dihydroxy substituted branched C3-C6alkyl-,
--(CH.sub.2).sub.qR5, --(CH.sub.2).sub.nC(O)R5,
--(CH.sub.2).sub.nC(O)OR3, R19 substituted C3-C8cycloalkyl- and
--(CH.sub.2).sub.nR17; each R8 is independently and individually
selected from the group consisting of C1-C6alkyl, branched
C3-C7alkyl, fluoroC1-C6alkyl- wherein the alkyl moiety is partially
or fully fluorinated, R19 substituted C3-C8cycloalkyl-, phenyl,
phenylC1-C6alkyl-, OH, C1-C6alkoxy, --N(R3).sub.2, --N(R4).sub.2,
and R5; each R10 is independently and individually selected from
the group consisting of --CO.sub.2H, --CO.sub.2C1-C6alkyl,
--C(O)N(R4).sub.2, OH, C1-C6alkoxy, and --N(R4).sub.2; R13 and R14
are each individually and independently selected from the group
consisting of hydrogen, C1-C6alkyl, branched C3-C8alkyl,
fluoroC1-C6alkyl- wherein the alkyl is fully or partially
fluorinated, hydroxyl substituted C1-C6alkyl-, C1-C6alkoxy
substituted C1-C6alkyl-, hydroxyl substituted branched C3-C8alkyl-,
and alkoxy substituted branched C3-C8alkyl; each R16 is
independently and individually selected from the group consisting
of hydrogen, C1-C6alkyl, branched C3-C7alkyl, R19 substituted
C3-C8cycloalkyl-, halogen, fluoroC1-C6alkyl- wherein the alkyl
moiety can be partially or fully fluorinated, cyano, hydroxyl,
C1-C6alkoxy, fluoroC1-C6alkoxy- wherein the alkyl moiety can be
partially or fully fluorinated, --N(R3).sub.2, --N(R4).sub.2, R3
substituted C2-C3alkynyl- and nitro; each R17 is independently and
individually selected from the group consisting of hydrogen,
C1-C6alkyl, branched C3-C7alkyl, hydroxyC2-C6alkyl-, R19
substituted C3-C8cycloalkyl-, halogen, fluoroC1-C6alkyl- wherein
the alkyl moiety can be partially or fully fluorinated, cyano,
hydroxyl, C1-C6alkoxy, fluoroC1-C6alkoxy- wherein the alkyl moiety
can be partially or fully fluorinated, --N(R3).sub.2,
--N(R4).sub.2, and nitro; each R19 is independently and
individually selected from the group consisting of hydrogen, OH and
C1-C6alkyl; each R20 is independently and individually selected
from the group consisting of hydrogen, C1-C6alkyl, branched
C3-C7alkyl, R19 substituted C3-C8cycloalkyl-, halogen,
fluoroC1-C6alkyl- wherein the alkyl moiety can be partially or
fully fluorinated, cyano, hydroxyl, hydroxyC1-C6alkyl-,
C1-C6alkoxyC1-C6alkyl-, C1-C6alkoxy, fluoroC1-C6alkoxy- wherein the
alkyl moiety can be partially or fully fluorinated, --N(R3).sub.2,
--N(R4).sub.2, --(CH.sub.2).sub.nR5, --(CH.sub.2).sub.nN(R3)C(O)R3,
--(CH.sub.2).sub.nC(O)N(R3).sub.2 and nitro; each m is
independently and individually 1-3, each n is independently and
individually 0-6; each p is independently and individually 1-4;
each q is independently and individually 2-6; each v is
independently and individually 1 or 2; each x is independently and
individually 0-2; stereoisomers, regioisomers and tautomers of such
compounds.
In the aforementioned compounds of formula Ia, subscript letters
are frequently used to define variations in moiety and substituent
structure. For instance, in the case where R4 on the amide nitrogen
is --(CH.sub.2).sub.nC(O)R5, and the R20 on the Q1/Q2 ring is
--(CH.sub.2).sub.nR5, each "n" subscript can be individually and
independently varied from zero to six. For example, the situation
wherein the R4 "n" subscript is 2 and the R20 "n" subscript is 6
results in a R4 substituent of --CH.sub.2CH.sub.2C(O)R5 and a R20
substituent of --CH.sub.2CH.sub.2CH.sub.2CH.sub.2CH.sub.2CH.sub.2R5
(see molecule 3 below). By extension, a subscript definition may be
variably used to define different moieties residing within the same
compound of formula Ia.
##STR00045##
In the case where a specific moiety (e.g. R4) is used in more than
one place within a molecule, each instance of R4 is individually
and independently varied according to the definition of R4. As
shown below, generic molecule Ia can be elaborated to "molecule "4"
which has two instances of R4, each of which can be different (R4=H
& R4=CH.sub.3) as shown is "molecule 5".
##STR00046## 1.1.1 Compounds of Formula Ia which Exemplify
##STR00047## Moieties
##STR00048## wherein the symbol (**) indicates the point of
attachment to the heteroaryl Q1, Q2 containing ring. 1.1.2
Compounds of 1.1.1 which Exemplify Q1-Q3 Moieties
##STR00049## 1.1.3 Compounds of 1.1.2 Having Formula Ic
##STR00050## 1.1.4 Compounds of 1.1.2 Having Formula Id
##STR00051## 1.1.5 Compounds of 1.1.2 Having Formula Ie
##STR00052## 1.2 Compounds of 1.1.1 which Exemplify Q1-Q3
Moieties
##STR00053## 1.2.1 Compounds of 1.2 Having Formula Ig
##STR00054## 1.2.2 Compounds of 1.2 Having Formula Ih
##STR00055## 1.2.3 Compounds of 1.2 Having Formula Ii
##STR00056## 1.3 Compounds of 1.1.1 which Exemplify Q1-Q3
Moieties
##STR00057## 1.3.1 Compounds of 1.3 Having Formula Ik
##STR00058## 1.3.2 Compounds of 1.3 Having Formula Il
##STR00059## 1.3.3 Compounds of 1.3 Having Formula Im
##STR00060## 1.4 Compounds of 1.1.1 which Exemplify Q1-Q3
Moieties
##STR00061## 1.4.1 Compounds of 1.4 Having Formula Io
##STR00062## 1.4.2 Compounds of 1.4 Having Formula Ip
##STR00063## 1.4.3 Compounds of 1.4 Having Formula Iq
##STR00064## 1.5 Compounds of 1.1.1 which Exemplify Q1-Q3
Moieties
##STR00065## 1.5.1 Compounds of 1.5 Having Formula Is
##STR00066## 1.5.2 Compounds of 1.5 Having Formula It
##STR00067## 1.5.3 Compounds of 1.5 Having Formula Iu
##STR00068## 1.6 Compounds of 1.1.1 which Exemplify Q1-Q3
Moieties
##STR00069## 1.6.1 Compounds of 1.6 Having Formula Iw
##STR00070## 1.6.2 Compounds of 1.6 Having Formula Ix
##STR00071## 1.6.3 Compounds of 1.6 Having Formula Iy
##STR00072## 1.7 Compounds of 1.1.1 which Exemplify Q1-Q3
Moieties
##STR00073## 1.7.1 Compounds of 1.7 Having Formula Iaa
##STR00074## 1.7.2 Compounds of 1.7 Having Formula Ibb
##STR00075## 1.7.3 Compounds of 7 Having Formula Icc
##STR00076## 1.8 Compounds of 1.1.1 which Exemplify Q1-Q3
Moieties
##STR00077## 1.8.1 Compounds of 1.8 Having Formula Iee
##STR00078## 1.8.2 Compounds of 1.8 Having Formula Iff
##STR00079## 1.8.3 Compounds of 1.8 Having Formula Igg
##STR00080## 1.9 Compounds of 1.1.1 which Exemplify Q1-Q3
Moieties
##STR00081## 1.9.1 Compounds of 1.9 Having Formula Iii
##STR00082## 1.9.2 Compounds of 1.9 Having Formula Ijj
##STR00083## 1.9.3 Compounds of 1.9 Having Formula Ikk
##STR00084## 1.10 Illustrative Compounds of Formula Ia
Illustrative compounds of formula Ia include, but are not limited
to,
N-(2,3-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-
-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide,
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(4--
fluorophenyl)cyclopropane-1,1-dicarboxamide,
N-benzyl-N'-(2,3-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)-
phenyl)cyclopropane-1,1-dicarboxamide,
N-benzyl-N'-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phen-
yl)cyclopropane-1,1-dicarboxamide,
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-phe-
nylcyclopropane-1,1-dicarboxamide,
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(3--
(trifluoromethyl)phenyl)cyclopropane-1,1-dicarboxamide,
N-(2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(4--
fluorophenyl)cyclopropane-1,1-dicarboxamide,
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(4--
methoxyphenyl)cyclopropane-1,1-dicarboxamide,
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(3--
methoxyphenyl)cyclopropane-1,1-dicarboxamide,
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(3--
fluorophenyl)cyclopropane-1,1-dicarboxamide,
N-(4-fluorophenyl)-N'-(3-methyl-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4--
yloxy)phenyl)cyclopropane-1,1-dicarboxamide,
1-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-3-(2-(-
4-fluorophenyl)acetyl)urea,
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(py-
ridin-4-yl)cyclopropane-1,1-dicarboxamide,
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(py-
ridin-3-yl)cyclopropane-1,1-dicarboxamide,
N-(3-chlorobenzyl)-N'-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4--
yloxy)phenyl)cyclopropane-1,1-dicarboxamide,
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-((S-
)-1-phenylethyl)cyclopropane-1,1-dicarboxamide,
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-((R-
)-1-phenylethyl)cyclopropane-1,1-dicarboxamide,
N-(4-fluorobenzyl)-N'-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4--
yloxy)phenyl)cyclopropane-1,1-dicarboxamide,
N-(4-(2-(1-ethyl-1H-pyrazol-4-yl)pyridin-4-yloxy)-3-fluorophenyl)-N'-(4-f-
luorophenyl)cyclopropane-1,1-dicarboxamide,
N-(3-fluoro-4-(2-(1-propyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(4--
fluorophenyl)cyclopropane-1,1-dicarboxamide,
N-(3-fluoro-4-(2-(1-(2-hydroxyethyl)-1H-pyrazol-4-yl)pyridin-4-yloxy)phen-
yl)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide,
N-(4-chlorophenyl)-N'-(2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4--
yloxy)phenyl)cyclopropane-1,1-dicarboxamide,
N-(2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-p-t-
olylcyclopropane-1,1-dicarboxamide,
N-(3,4-difluorophenyl)-N'-(2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridi-
n-4-yloxy)phenyl)cyclopropane-1,1-dicarboxamide,
N-(2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(4--
(trifluoromethyl)phenyl)cyclopropane-1,1-dicarboxamide,
N-(3-cyano-4-fluorophenyl)-N'-(2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)py-
ridin-4-yloxy)phenyl)cyclopropane-1,1-dicarboxamide,
N-(2,4-difluorophenyl)-N'-(2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridi-
n-4-yloxy)phenyl)cyclopropane-1,1-dicarboxamide,
N-(4-cyanophenyl)-N'-(2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-y-
loxy)phenyl)cyclopropane-1,1-dicarboxamide,
N-(2-chloro-4-fluorophenyl)-N'-(2-fluoro-4-(2-(1-methyl-1-pyrazol-4-yl)py-
ridin-4-yloxy)phenyl)cyclopropane-1,1-dicarboxamide,
N-(3-chloro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(4--
fluorophenyl)cyclopropane-1,1-dicarboxamide,
N-(4-(2-(1H-pyrazol-4-yl)pyridin-4-yloxy)-3-fluorophenyl)-N'-(4-fluorophe-
nyl)cyclopropane-1,1-dicarboxamide,
N-(2-fluoro-3-methyl-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pheny-
l)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide,
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-((S-
)-1-(4-fluorophenyl)ethyl)cyclopropane-1,1-dicarboxamide
hydrochloride,
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-((S-
)-1-(4-fluorophenyl)propyl)cyclopropane-1,1-dicarboxamide
hydrochloride,
N-(2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(th-
iophen-2-yl)cyclopropane-1,1-dicarboxamide,
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-((R-
)-1-(4-fluorophenyl)-2-methoxyethyl)cyclopropane-1,1-dicarboxamide,
N-(4-fluorophenyl)-N-(4-(2-(4-(trifluoromethyl)-1H-imidazol-2-yl)pyridin--
4-yloxy)phenyl)cyclopropane-1,1-dicarboxamide,
N-(4-fluorophenyl)-N'-(6-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pyr-
idin-3-yl)cyclopropane-1,1-dicarboxamide,
2-(4-fluorophenyl)-N-(4-(2-(4-(trifluoromethyl)-1H-imidazol-2-yl)pyridin--
4-yloxy)phenylcarbamoyl)acetamide,
N-(2,5-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-
-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide,
N-(4-fluorophenyl)-N'-(5-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pyr-
idin-2-yl)cyclopropane-1,1-dicarboxamide,
N-(2,5-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenylcarb-
amoyl)-2-(4-fluorophenyl)acetamide,
N-(2,3-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenylcarb-
amoyl)-2-(4-fluorophenyl)acetamide,
2-(4-fluorophenyl)-N-(5-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pyri-
din-2-ylcarbamoyl)acetamide,
N-(2,5-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N--
phenylcyclopropane-1,1-dicarboxamide,
N-(5-chloro-2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pheny-
lcarbamoyl)-2-(4-fluorophenyl)acetamide,
N-(5-chloro-2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pheny-
l)-N-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide,
N-(3,5-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenylcarb-
amoyl)-2-(4-fluorophenyl)acetamide,
N-(4-(2-(1,3-dimethyl-1H-pyrazol-4-yl)pyridin-4-yloxy)-2,5-difluorophenyl-
)-N-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide,
N-(4-fluorophenyl)-N-(4-(2-(4-(trifluoromethyl)-1H-imidazol-2-yl)pyridin--
4-yloxy)phenyl)cyclopropane-1,1-dicarboxamide,
N-(2-fluoro-5-methyl-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pheny-
l)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide,
N-(2-fluoro-4-methyl-5-(4-(1-methyl-1H-pyrazol-4-yl)pyrimidin-2-yloxy)phe-
nyl)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide,
N-(2-fluoro-5-(4-(1-methyl-1H-pyrazol-4-yl)pyrimidin-2-yloxy)phenyl)-N'-(-
4-fluorophenyl)cyclopropane-1,1-dicarboxamide,
N-(5-(4-(1H-pyrazol-4-yl)pyrimidin-2-yloxy)-2-fluoro-4-methylphenyl)-N-(4-
-fluorophenyl)cyclopropane-1,1-dicarboxamide,
N-(5-(4-(1H-pyrazol-4-yl)pyrimidin-2-yloxy)-2-fluorophenyl)-N'-(4-fluorop-
henyl)cyclopropane-1,1-dicarboxamide,
2-(4-fluorophenyl)-N-(4-methyl-5-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-y-
loxy)pyridin-2-ylcarbamoyl)acetamide,
N-(2,5-difluoro-4-(3-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-
-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide,
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N-(4-f-
luorophenyl)-N-methylcyclopropane-1,1-dicarboxamide,
N-(2-fluoro-4-(2-(3-methylisoxazol-5-yl)pyridin-4-yloxy)phenyl)-N'-(4-flu-
orophenyl)cyclopropane-1,1-dicarboxamide, and
N-(4-(2-(1H-1,2,3-triazol-4-yl)pyridin-4-yloxy)-2-fluorophenyl)-N'-(4-flu-
orophenyl)cyclopropane-1,1-dicarboxamide.
1.11 Methods
1.11a Methods of Protein Modulation
The invention includes methods of modulating kinase activity of a
variety of kinases, e.g. VEGFR-2 (KDR) kinase, c-MET kinase, FLT-3
kinase, c-KIT kinase, PDGFR-.alpha. kinase, PDGFR-.beta. kinase,
and c-FMS kinase. The kinases may be wildtype kinases, oncogenic
forms thereof, aberrant fusion proteins thereof or polymorphs of
any of the foregoing. The method comprises the step of contacting
the kinase species with compounds of the invention and especially
those set forth in section 1. The kinase species may be activated
or unactivated, and the species may be modulated by
phosphorylations, sulfation, fatty acid acylations glycosylations,
nitrosylation, cystinylation (i.e. proximal cysteine residues in
the kinase react with each other to form a disulfide bond) or
oxidation. The kinase activity may be selected from the group
consisting of catalysis of phospho transfer reactions, inhibition
of phosphorylation, oxidation or nitrosylation of said kinase by
another enzyme, enhancement of dephosphorylation, reduction or
denitrosylation of said kinase by another enzyme, kinase cellular
localization, and recruitment of other proteins into signaling
complexes through modulation of kinase conformation.
1.11b Treatment Methods
The methods of the invention also include treating individuals
suffering from a condition selected from the group consisting of
cancer, hyperproliferative diseases, metabolic diseases,
neurodegenerative diseases or diseases characterized by
angiogenesis. These methods comprise administering to such
individuals compounds of the invention, and especially those of
section 1, said diseases including, but not limited to, solid
tumors, malignant melanomas, glioblastomas, ovarian cancer,
pancreatic cancer, prostate cancer, lung cancers, breast cancers,
kidney cancers, hepatic cancers, cervical carcinomas, metastasis of
primary tumor sites, myeloproliferative diseases, chronic
myelogenous leukemia, leukemias, papillary thyroid carcinoma,
non-small cell lung cancer, mesothelioma, hypereosinophilic
syndrome, gastrointestinal stromal tumors, colonic cancers, ocular
diseases characterized by hyperproliferation leading to blindness
including various retinopathies, diabetic retinopathy and
age-related macular degeneration and hypereosinophilic syndrome,
rheumatoid arthritis, asthma, chronic obstructive pulmonary
disorder, mastocytosis, mast cell leukemia, a disease caused by
PDGFR-.alpha. kinase, a disease caused by PDGFR-.beta. kinase, a
disease caused by c-KIT kinase, a disease caused by cFMS kinase, a
disease caused by c-MET kinase and oncogenic forms, aberrant fusion
proteins and polymorphs thereof. The administration method is not
critical, and may be from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
1.12 Pharmaceutical Preparations
The compounds of the invention, especially those of Section 1 may
form a part of a pharmaceutical composition by combining one or
more such compounds with a pharmaceutically acceptable carrier.
Additionally, the compositions may include an additive selected
from the group consisting of adjuvants, excipients, diluents, and
stabilizers.
SECTION 2. SYNTHESIS OF COMPOUNDS OF THE PRESENT INVENTION
The compounds of the invention are available by the general
synthetic methods illustrated in the Schemes below and the
accompanying examples.
In one aspect of the invention, compounds of general formula Ia
contain an aminergic "W" group and a cyclopropyl "V" group, and are
represented by general formula 1. Compounds of general formula 1
can be readily prepared by the union of amines of general formula
3, amines of general formula 4 (t=0-3), and a cyclopropane
dicarboxylic acid of formula 2. As indicated below in Scheme 1,
compounds of formula 1 can arise from the sequence
2.fwdarw.5.fwdarw.1 or alternately from the sequence
2.fwdarw.6.fwdarw.1. It will be recognized by those skilled in the
art that the reaction arrows in Scheme 1 represent either a single
reaction or a multi-step reaction sequence. Bis-acid 2 can be
coupled in a step-wise manner with amines 3 and 4 through the use
of standard peptide coupling agents known to those skilled in the
art. Alternately, it will be understood in Scheme 1 that acid 2 may
be joined with amines 3 or 4 by pre-activation of one or both
carboxylic acid moieties as an activated acid halide, anhydride,
mixed anhydride or an activated ester (such as a pentafluorophenyl
ester or a p-nitrophenyl ester). Such activated intermediates (not
shown) may or may not be isolated prior to reaction with amines 3
or 4. Those skilled in the art will further recognize that the
carboxylic acid moieties of 2 may enter the reaction Scheme 1
masked as esters and the reaction sequences in Scheme 1 allow for
additional de-protection steps, if necessary, to convert an ester
derivative of 5, or 6 into acids 5 or 6 to facilitate the formation
of the second amide bond.
##STR00085##
Non-limiting examples of Scheme 1 are shown in Schemes 2-4. Scheme
2 illustrates the preparation of compound II, an example of general
formula 1 (wherein A is 4-fluorophenyl, t is 0, Z2B is H, Q3 is CH,
the Q3 ring is substituted with fluorine, and the D-containing ring
is pyrazole) by the general sequence of 2.fwdarw.5.fwdarw.1 (Scheme
1). Thus, as indicated below, the union of 1,1-cyclopropane
bis-carboxylic acid (7, an example of general intermediate 2, vide
supra), with amine 8 (an example of general amine 3) provides the
amide/acid 9, an example of general intermediate 5. Conditions for
the transformation include the in situ activation of bis-acid 7 by
treatment with thionyl chloride in the presence of a tertiary base,
such as triethylamine, followed by reaction with amine 8. Further
reaction of 9 with amine 10 (an example of general intermediate 4)
in the presence of a peptide coupling agent provides bis-amide 11.
Coupling agents for the later transformation include TBTU
(O-(benzotriazol-1-yl)-N,N,N',N'-tetramethyluronium
tetrafluoroborate), PyBOP
(benzotriazol-1-yloxy)tripyrrolidinophosphonium
hexafluorophosphate), EDC
(1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride) and
BOP--Cl (bis(2-oxo-3-oxazolidinyl)phosphonic chloride).
##STR00086##
Similarly, Scheme 3 illustrates an additional example of the
general sequence of 2.fwdarw.5.fwdarw.1 (Scheme 1) commencing with
the mono-ester 12. Thus, acid/ester 12 is combined amine 13 to
provide ester/amide 14. Saponification of the ester of 14 with
lithium hydroxide provides the lithium carboxylate 15. Treatment of
15 with 10 and a peptide coupling reagent, for example TBTU,
provides bis-amide 16, a further example of general formula 1
##STR00087##
Scheme 4 illustrates the preparation of 19 as a non-limiting
example of the general sequence 2.fwdarw.6.fwdarw.1 of Scheme 1.
Thus, bis-acid 7 is first coupled with amine 10 to provide the
amide/acid 17, which is in turn coupled with amine 18 to provide
19.
##STR00088##
In another aspect of the invention, the "V" moiety of formula Ia is
NR4. In these instances, compounds of formula 20 can be prepared as
indicated in Scheme 5 by the reaction of general amine 3 with
general intermediate 21, or, in the instance when R4 is H, with
isocyanate 22.
##STR00089##
General intermediate 21 is available from 23 by reaction with
phosgene or a phosgene surrogate such as diphosgene or triphosgene,
as indicated in Scheme 6. Non-commercially-available isocyanates 22
can be prepared by the treatment of general acid chloride 24 with
silver isocyanate. Acid chlorides 24 in turn are prepared from the
corresponding acids by conditions familiar to those skilled in the
art. Alternately, 22 can be prepared from amide 25 by treatment
with oxalyl chloride or phosgene, optionally with heating.
##STR00090##
A non-limiting example of Schemes 5 and 6 is illustrated by the
preparation of 29 in Scheme 7. Thus, acid 26 (see: Jiang, Y., et
al., J. Med. Chem. (2007) 50(16): 3870) is converted to acid
chloride 27 upon treatment with oxalyl chloride in toluene
containing a catalytic amount of dimethylformamide. Further
treatment of 27 with silver isocyanate provides isocyanate 28, an
example of general intermediate 22 (Scheme 6). Finally, reaction of
28 with amine 18 provides N-acyl urea 29, an example of general
formula 20 (wherein A is 4-fluorophenyl, W is --CH(CH.sub.3)--, R4
is H, Q3 is CH, the Q3 ring is substituted with fluorine, Q2 is CH,
Q1 is N, and the D-containing ring is pyrazole).
##STR00091##
An additional example illustrating the general methods of Schemes 5
and 6 is the synthesis of 33 shown in Scheme 8. Thus,
4-fluorophenylacetamide 30, readily prepared from
4-fluorophenylacetic acid and ammonia, is first treated with oxalyl
chloride with heating to provide 2-(4-fluorophenyl)acetyl
isocyanate 31. Further treatment of isocyanate 31 with amine 32
provides the N-acyl urea 33, an example of general intermediate 20
(wherein A is 4-fluorophenyl, W is --CH.sub.2--, R4 is H, Q3 is N,
Q2 is CH, Q1 is N, and the D-containing ring is pyrazole).
##STR00092##
Amines 3 useful for the invention can be synthesized according to
methods commonly known to those skilled in the art. One general
preparation of amines of formula 3 involves the stepwise union of
three monocyclic subunits by formation of a C--O bond between the
Q1/Q2 and Q3 rings and the formation of a bond between the Q1/Q2
ring and the 5-membered D-ring. Variations of this method are shown
in the following schemes.
Scheme 9 illustrates one general mode of assembly of 3 in which the
ether oxygen atom of 3 is derived from a hydroxyl moiety on the
Q3-containing subunit 34. The union of fragment 34 with the
Q1/Q2-containing ring 35 is accomplished by treatment of 34 with a
base, for example potassium tert-butoxide, and fragment 35 with
optional heating to form the ether 36. In Scheme 9, the "LG" of
monocycle 35 represents a moiety that can be directly displaced in
a nucleophilic substitution reaction (with or without additional
activation), for example a halide, sulfonate, sulfone or sulfoxide.
The "X" group of monocycle 35 or bicycle 36 represents a moiety
that allows the attachment of a 5-membered heterocyclic moiety. In
one aspect, the "X" group represents a halogen atom that will
participate in a transition-metal-mediated coupling with a
pre-formed heterocyclic (D-ring) reagent (for example a boronic
acid or ester, or heteroaryl stannane) to give rise to amine 3. In
another aspect, the "X" group represents a leaving group to be
displaced by a nitrogen atom of a pyrazole, imidazole or triazole
to install the D-ring. In another aspect, the X group represents a
moiety through which to construct the 5-membered D-ring (pyrazole,
isoxazole, triazole, imidazole), for example a carboxylic acid or
ester, alkyne, or aldehyde that can be transformed into a
5-membered ring.
##STR00093##
Some non-limiting examples of general Scheme 9 are illustrated in
the Schemes below. Scheme 10 illustrates the preparation of
pyrazole 8, an example of general amine 3 (wherein R4 is H, Q3 is
CH, the Q3 ring is substituted with fluorine, Q2 is CH, Q1 is N,
and the D-containing ring is pyrazole). In Scheme 10, commercially
available 3-fluoro-4-aminophenol (37) is reacted with potassium
tert-butoxide and 2,4-dichloropyridine 38 (an example of 35 wherein
LG and X are both chloro) to provide chloropyridine 39, an example
of general intermediate 36. Possible conditions for this
transformation are dimethylacetamide at a temperature between 80
and 100.degree. C. The subsequent reaction of chloropyridine 39
with the commercially available pyrazole-4-boronic acid pinacol
ester 40 in the presence of a palladium catalyst, for example
tetrakis(triphenylphosphine) palladium(0), provides pyrazole amine
8.
##STR00094##
Scheme 11 illustrates the preparation of additional non-limiting
examples of amine 3 using the general methods of Scheme 9 and
Scheme 10. Thus, general intermediate 36 (X=halogen) can be
converted to compounds 46-50 using a palladium-catalyzed cross
coupling with reagents 41 (Milestone PharmTech), 42 (Alfa), 43
(see: Nicolaou, et. al., Chem Med Chem, (2006), 1(1): 41), 44
(Frontier Scientific), 45 (see: Sakamoto, et al. Tetrahedron,
(1991), 47(28): 5111), respectively. Suitable palladium catalysts
for the reactions of Scheme 11 include
dichlorobis(triphenylphosphine)palladium,
dichloro[11'-bis(diphenylphosphino) ferrocene]palladium and
tetrakis(triphenylphosphine) palladium.
##STR00095## ##STR00096##
Additional heteroaryl boronates and stannanes useful for the
invention can be prepared form the corresponding heteroaryl
halides. For example, the known triazole bromides 51-53 (See:
Pedersen, C. Acta Chem. Scand. (1959) 5: 888-892) in Scheme 12 can
be converted to the corresponding tributylstannanes 54-56. Suitable
conditions for this transformation include reaction with
hexabutyldistannane and palladiumtetrakis(triphenylphosphine) at
elevated temperatures, for example between 60 and 180.degree. C.
Alternative conditions for the transformation include treatment of
the bromides 51-53 with n-butyllithium at low temperature and
subsequent treatment of the resultant organolithium intermediates
with tributyltin chloride. Stannanes 54-56 in turn can undergo
reaction with general halide 36 in the presence of a palladium
catalyst to form triazole-containing amines 57-59, examples of
general amine 3.
##STR00097##
Schemes 13-16 illustrate the preparation of non-limiting examples
general amine 3 wherein the D-ring is a pyrazole, imidazole or
triazole ring linked to the Q1/Q2 ring through a nitrogen atom.
Schemes 13-16 are examples of general Scheme 9 wherein the "X"
group of 36 is a leaving group for nucleophilic aromatic
substitution. Suitable X groups for Schemes 13-16 include halogen,
including chlorine. Suitable conditions for Schemes 13-16 include
the use of polar aprotic solvents such as 1-methyl-2-pyrrolidinone,
dimethylacetamide, or dimethylsulfoxide in the presence of
non-nucleophilic bases such as potassium carbonate, sodium hydride,
1,8-diazabicyclo[5.4.0]undec-7-ene (DBU), and the like. Possible
temperatures are from ambient temperature up to about 250.degree.
C. and may optionally include the use of microwave irradiation or
sonication.
Scheme 13 illustrates the reaction of general intermediate 36 with
pyrazole 60 (example commercially available pyrazoles include those
with R20=H, CH.sub.3, CN, and CF.sub.3), or pyrazole 61 (example
commercially available pyrazoles include those with R20=CH.sub.3,
and CF.sub.3) to provide pyrazoles 62, 63 or 64, non-limiting
examples of general amine 3 wherein the D-ring is pyrazole.
##STR00098##
Similarly, Scheme 14 illustrates the reaction of general
intermediate 36 with imidazole 65 (example commercially available
imidazoles include those with R20=H, CH.sub.3, CN, CF.sub.3, and
2-hydroxyethyl) to provide 66 and 67, non-limiting examples of
general amine 3 wherein the D-ring is imidazole.
##STR00099##
Scheme 15 illustrates the reaction of general intermediate 36 with
triazole 68 (example commercially available triazoles include those
with R20=H, CH.sub.3, and CN) to provide 69, 70, and 71,
non-limiting examples of general amine 3 wherein the D-ring is a
1,2,4-triazole.
##STR00100##
Scheme 16 illustrates the reaction of general intermediate 36 with
triazole 72 (example commercially available triazoles include those
with R20=H, hydroxymethyl) to provide 73, 74, and 75, non-limiting
examples of general amine 3 wherein the D-ring is a
1,2,3-triazole.
##STR00101##
Scheme 17 illustrates the preparation of amines 78 and 79,
non-limiting examples of general amines 3, as an example of Scheme
9 wherein an annulation sequence is employed to construct a
triazole ring (D-ring). Thus, conversion of chloropyridine 39 into
alkyne 76 is accomplished by Sonogashira cross-coupling with
trimethylsilylacetylene, followed by removal of the trimethylsilyl
group by conditions familiar to those skilled in the art, for
example K.sub.2CO.sub.3 in methanol. Further reaction of alkyne 76
with azidomethyl pivalate (77) in the presence of copper sulfate
and sodium ascorbate provides the N-pivaloylymethyl triazole amine
78 (see Loren, et. al. Synlett, (2005), 18: 2847). The pivalate 78
is a masked equivalent of NH-triazole 79. Removal of the pivalate
moiety with NaOH provides 79. Alternately, 78 can be used directly
in general Schemes 1 or 5 to provide compound of Formula 1 or 20
wherein the D-ring triazole is masked with the pivaloylymethyl
group. Further treatment of such product with NaOH provides
NH-triazoles of Formula 1 or 20.
##STR00102##
As an extension of Scheme 17, Z3-substituted triazoles of formula
81 and R20-substituted isoxazole of formula 83 can also be prepared
by analogous 1,3-dipolar cycloadditions as shown in Scheme 18.
Thus, combination of Z3-substituted azides 80, readily prepared
from commercial alkyl halides and sodium azide, with alkyne 76,
sodium ascorbate, and Cu(SO.sub.4) pentahydrate (See: Rostotsev,
et. al. Angew. Chem. Int. Ed, (2002) 41 (14): 2596-2599) gives rise
to Z3-substituted triazoles 81. In a similar sequence, the
combination of R20-substituted oximes 82, readily prepared from
aldehydes and hydroxylamine, with N-chlorosuccinimide in the
presence of alkyne 76 with heating, or optional microwave
irradiation, provides isoxazoles of formula 83, additional examples
of general amine 3.
##STR00103##
An additional example of Scheme 9 wherein an annulation sequence is
employed to construct an imidazole D-ring is shown in Scheme 19 for
the synthesis of imidazole 93, an example of general amine 3
(wherein R4 is H, Q3 is CH, Q2 is CH, Q1 is N, and the D-containing
ring is substituted imidazole (R20=CF.sub.3)). Conversion of
pyridine-2-carboxylic acid (84) to chloro-pyridine 85 is
accomplished by treatment with thionyl chloride and sodium bromide
with heating. Reaction of 85 with tert-butanol provides the
chloro-ester 86, an example of general intermediate 35 (Scheme 9,
wherein LG is chloro and X is tert-butoxycarbonyl). Treatment of 86
with the sodium salt of 4-aminophenol 87, prepared from 87 with
sodium hydride, and heating the resultant mixture to 80.degree. C.
provides ether-ester 88, an example of general intermediate 36
(Scheme 9, wherein X is tert-butoxycarbonyl). The further
conversion of 88 to 93 illustrates the potential multi-step nature
of the second reaction arrow of general Scheme 9. Thus, treatment
of 88 with di-tert-butyl dicarbonate provides the Boc-protected
intermediate 89. Reduction of the ester moiety of 89 with
LiAlH.sub.4 provides the alcohol 90, which in turn is oxidized with
MnO.sub.2 to provide aldehyde 91, a further example of general
intermediate 36 (wherein X is formyl). Further reaction of 91 with
3,3-dibromo-1,1,1-trifluoro-propan-2-one, sodium acetate, and
ammonium hydroxide provides the imidazole 92. Removal of the Boc
group of 92 using aqueous HCl provides 93, an example of general
amine 3.
##STR00104##
Scheme 20 illustrates the general preparation of additional
pyrazole and isoxazole isomers by an annulation sequence. Thus,
aldehyde 91, a representative example of general intermediate 36
(wherein R4 is a Boc protecting group, Q3 is H, Q2 is H, Q1 is N
and X is formyl), is converted to ketone 94 by sequential treatment
with methyl magnesium bromide followed by oxidation using standard
conditions familiar to those skilled in the art. Subsequent
treatment of 94 with the dimethylacetal of dimethylformamide
affords 95. Further treatment of 95 with Z3-substituted hydrazine
96 provides a mixture of 97 and 99 containing an N-Boc protecting
group. Removal of the Boc protecting group under standard acidic
conditions provides 98 and 100, examples of general amine 3 wherein
the D-ring is Z3-substituted pyrazole. In a similar fashion,
treatment of intermediate 95 with hydroxylamine provides isoxazoles
101 and 103 containing an N-Boc protecting group. Removal of the
Boc protecting group under standard acidic conditions provides 102
and 104, examples of general amine 3 wherein the D-ring is
isoxazole.
##STR00105##
In a similar manner, Scheme 21 illustrates the preparation of
R20-substituted pyrazole and isoxazole rings. Thus, ketone 94, a
representative example of general intermediate 36 (wherein R4 is a
Boc protecting group, Q3 is H, Q2 is H, Q1 is N and X is acetyl),
is converted to di-ketone 105 by sequential treatment with a strong
base and an R20-substituted acylation reagent, for example an acid
halide or ester. Further treatment of 105 with Z3-substituted
hydrazine 96 provides a mixture of 106 and 107 containing an N-Boc
protecting group. Removal of the Boc protecting group under
standard acidic conditions provides 108 and 109, examples of
general amine 3 wherein the D-ring is an R20- and Z3-substituted
pyrazole. In a similar fashion, treatment of intermediate 105 with
hydroxylamine provides isoxazoles 110 and 111 containing an N-Boc
protecting group. Removal of the Boc protecting group under
standard acidic conditions provides 112 and 113, examples of
general amine 3 wherein the D-ring is an R20-substituted
isoxazole.
##STR00106##
Scheme 22 illustrates another general mode of assembly of 3 in
which the ether oxygen atom of 3 is derived from a hydroxyl moiety
on the Q1/Q2-containing subunit 115. The union of intermediate 114
with the Q1/Q2-containing ring 115 is accomplished by treatment of
115 with a base, for example potassium tert-butoxide, and fragment
114 with optional heating to form the ether 116. In Scheme 22, the
"LG" of monocycle 114 represents a moiety that can be directly
displaced in a nucleophilic substitution reaction (with or without
additional activation), for example a halide, sulfonate, sulfone,
sulfoxide or nitro. The "X" group of monocycle 115 or bicycle 116
represents a moiety that allows the attachment of a 5-membered
heterocyclic moiety. In one aspect, the "X" group represents a
halogen atom that will participate in a transition-metal-mediated
coupling with a pre-formed heterocyclic (D-ring) reagent (for
example a boronic acid or ester, or heteroaryl stannane) to give
rise to amine 118. In another aspect, the "X" group represents a
leaving group to be displaced by a nitrogen atom of a pyrazole,
imidazole or triazole to install the D-ring. In another aspect, the
X group represents a moiety through which to construct the
5-membered D-ring (pyrazole, isoxazole, triazole, imidazole), for
example a carboxylic acid or ester, alkyne, or aldehyde, that can
be transformed into a 5-membered ring-containing intermediate 118.
Subsequent to the formation of nitro ether 116, the nitro moiety is
converted to an amino moiety by subjecting 116 to reducing
conditions known to those skilled in the art, for example iron
powder, zinc powder, indium powder, stannous chloride, or
hydrogenation in the presence of a metallic catalyst, for example a
nickel or palladium catalyst which affords amine 117. Conversion of
the "X" group-containing intermediate 117 to the 5-membered
D-ring-containing intermediate 118 is thus accomplished by the
methods described in the schemes above to provide 118, an example
of general amine 3 wherein R4 is H. If desired, amine 118 can be
alkylated with an R4 moiety by standard conditions to provide
general amine 3.
##STR00107##
A non-limiting example of Scheme 22 is shown below for the
preparation of 32 (Scheme 23), an example of general amine 118
(wherein Q3 is N, Q2 is CH, Q1 is N, and the D-containing ring is
pyrazole). In Scheme 23, commercially available
5-bromo-2-nitropyridine (119) is reacted with
2-chloro-4-hydroxypyridine (120) and a base, for example cesium
carbonate, at elevated temp, for example 80.degree. C., to afford
nitropyridine 121, an example of general intermediate 116. Possible
conditions for this transformation are dimethylformamide at a
temperature between 80 and 100.degree. C. Further reaction of
nitropyridine 121 with zinc dust in the presence of ammonium
chloride provides aminopyridine 122. Further reaction of 122 with
pyrazole-4-boronic acid pinacol ester 40 by the conditions
described previously provide the pyrazole amine 32, an example of
general amine 118.
##STR00108##
Scheme 24 illustrates another general method of preparing amines 3
by first attaching the 5-membered heterocycle to the Q1/Q2 ring
(35). As described for Scheme 9, the "LG" of monocycle 35
represents a moiety that can be directly displaced in a
nucleophilic substitution reaction (with or without additional
activation). The "X" group of monocycle 35 represents a moiety that
allows the attachment of a 5-membered heterocycle. In one aspect,
the "X" group represents a halogen atom that will participate in a
transition-metal-mediated coupling with a pre-formed heterocyclic
reagent (for example, a boronic acid or ester, or heteroaryl
stannane) to give rise to amine 3. In another aspect, the "X" group
of 35 represents a functional group that can be converted to a
five-membered heterocycle by an annulation reaction. Additionally,
the "X" group of 35 may represent a leaving group (halogen,
sulfoxide, sulfone, sulfonate) that can be displaced by a
nucleophilic nitrogen atom of a pyrazole, triazole or imidazole
ring. After conversion of 35 to 123, the "LG" moiety can be
displaced by a hydroxyl group on the Q3-containing ring to provide
the tricylic ether-amine 3. Those skilled in the art will recognize
that each reaction arrow in Scheme 24 may represent a single
transformation or a series of transformations.
##STR00109##
A specific, non-limiting example of Scheme 24 is illustrated in
Scheme 25 by the preparation of amine 128, an example of general
amine 3 (wherein Q3 is CH and the Q3 ring is substituted with
fluoro, Q2 is N, Q1 is N, and the D-containing ring is pyrazole).
Thus, commercially available pyrimidine 124, an example of general
intermediate 35, undergoes a palladium-catalyzed coupling with the
commercially available pyrazole boronate 40 to provide the bicycle
125, an example of general intermediate 123 (Scheme 24). Oxidation
of the sulfide moiety of 125 (The "LG" group of general
intermediate 123) with m-chloroperbenzoic acid further activates
this moiety toward nucleophilic displacement and gives rise to
intermediate 126. Treatment of sulfone 126 with phenol 127 in the
presence of a base provides tricylic amine 128, an example of
general amine 3. Possible bases for the later transformation
include potassium carbonate and potassium tert-butoxide in polar
aprotic solvents such as dimethylformamide or
dimethylacetamide.
##STR00110##
An additional non-limiting example of general Scheme 24 is
illustrated in Scheme 26 by the preparation of 131, an additional
example of general amine 3 (wherein Q3 is CH and the Q3 ring is
substituted with fluoro, Q2 is N, Q1 is N, and the D-containing
ring is pyrazole). Thus, commercially available dichloropyrimidine
129, an example of general intermediate 35 wherein both "LG" and
"X" are chloro, undergoes a palladium-catalyzed coupling with the
commercially available pyrazole boronate 40 to provide the bicycle
130, an example of general intermediate 123 (Scheme 24). Addition
of phenol 37 in the presence of a base at elevated temperature then
provides amine 131.
##STR00111##
Scheme 27 illustrates the preparation amine 134 as an additional
non-limiting example of general Scheme 9. Thus, by direct analogy
to Scheme 10, 2,4-dichloropyrimidine (132) can be reacted with
phenol 37 in the presence of a base to provide 133, an example of
general intermediate 36 (Scheme 9). Further reaction of
chloropyrimidine 133 with pyrazole boronate 40 in the presence of
palladium catalyst provides amine 134, an example of general amine
3.
##STR00112##
Additional preferred synthetic methods for the preparation of
compounds of formula 1 are found in the following examples.
SECTION 3. EXAMPLES
The disclosure is further illustrated by the following examples,
which are not to be construed as limiting this disclosure in scope
or spirit to the specific procedures herein described. It is to be
understood that the examples are provided to illustrate certain
embodiments and that no limitation to the scope of the disclosure
is intended thereby. It is to be further understood that resort may
be had to various other embodiments, modifications, and equivalents
thereof which may suggest themselves to those skilled in the art
without departing from the spirit of the present disclosure and/or
scope of the appended claims.
Example A1
A suspension of 3-fluoro-4-aminophenol (8.0 g, 63.0 mmol) in
dimethylacetamide (80 mL) was de-gassed in vacuo and treated with
potassium tert-butoxide (7.3 g, 65 mmol). The resultant mixture was
stirred at RT for 30 min. 2,4-Dichloropyridine (8 g, 54 mmol) was
added and the mixture was heated to 80.degree. C. for 12 h. The
solvent was removed under reduced pressure to give a residue which
was partitioned between water and EtOAc (3.times.100 mL). The
organic layers were washed with saturated brine, dried
(MgSO.sub.4), concentrated in vacuo and purified by silica gel
column chromatography to give
4-(2-chloropyridin-4-yloxy)-2-fluorobenzenamine (11 g, 86% yield).
.sup.1H NMR (300 MHz, DMSO-d6): .delta. 8.24 (d, J=5.7 Hz, 1H),
7.00 (dd, J=9.0, 2.7 Hz, 1H), 6.89-6.73 (m, 4H), 5.21 (br s, 2H);
MS (ESI) m/z: 239.2 (M+H.sup.+).
A solution of 4-(2-chloropyridin-4-yloxy)-2-fluorobenzenamine (3 g,
12.6 mmol),
1-methyl-3-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-1H-pyraz-
ole (5.2 g, 25.2 mmol), and Na.sub.2CO.sub.3 (2.7 g, 25.2 mmol) in
DME (18 mL)/water (6 mL) was sparged with nitrogen for 20 min.
Pd(PPh.sub.3).sub.4 (729 mg, 0.63 mmol) was added and the resulting
mixture was heated to 100.degree. C. for 16 h. The solvent was
removed under reduced pressure and the crude product was suspended
in water and extracted with EtOAc. The organic layer was washed
with brine, dried (Na.sub.2SO.sub.4), concentrated in vacuo. and
purified via silica gel chromatography to give
2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)benzenamine
(2 g, 56% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 8.31
(d, J=5.7 Hz, 1H), 8.21 (s, 1H), 7.92 (s, 1H), 7.12 (d, J=2.4 Hz,
1H), 6.96 (m, 1H), 6.85-6.72 (m, 2H), 6.56 (m, 1H), 5.15 (s, 2H),
3.84 (s, 3H); MS (ESI) m/z: 285.0 (M+H.sup.+).
Example A2
Using a procedure analogous to Example A1, 2-fluoro-4-aminophenol
(2.6 g, 24 mmol) and 2,4-dichloropyridine (2.88 g, 20 mol) were
combined to provide 4-(2-chloropyridin-4-yloxy)-3-fluoroaniline
(3.2 g, 67% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.25 (d, J=5.6 Hz, 1H), 6.99 (m, 1H), 6.90 (m, 2H), 6.50 (d, J=1.6
Hz, 1H), 6.41 (d, J=10.4 Hz, 1H), 5.51 (s, 2H); MS (ESI) m/z: 239.1
(M+H.sup.+).
Using a procedure analogous to Example A1,
4-(2-chloropyridin-4-yloxy)-3-fluoroaniline (3 g, 11.6 mmol),
1-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole
(3.4 g, 16.4 mmol), Na.sub.2CO.sub.3 (2.7 g, 25.2 mmol) and
Pd(Ph.sub.3).sub.4 (1.5 g, 0.1 eq) were combined to give
3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)aniline
(1.1 g, 34% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
(8.31 (d, J=5.6 Hz, 1H), 8.22 (s, 1H), 7.93 (s, 1H), 7.14 (s, 1H),
6.98 (m, 1H), 6.55-6.49 (m, 2H), 6.42 (d, J=7.2 Hz, 1H), 5.44 (s,
2H), 3.86 (s, 3H); MS (ESI) m/z: (M+H.sup.+): 285.2.
Example A3
1,2,3-Trifluoro-4-nitrobenzene (30 g, 0.17 mol), benzyl alcohol
(18.4 g, 0.17 mol) and K.sub.2CO.sub.3 (35 g, 0.25 mol) were
combined in DMF (300 mL) and were stirred at RT for 8 h. Water (300
mL) was added, and the mixture was extracted with EtOAc
(3.times.500 mL). The combined organic layers were washed with
brine, dried (MgSO.sub.4), concentrated in vacuo and purified by
column chromatography on silica gel to give
1-benzyloxy-2,3-difluoro-4-nitrobenzene (16 g, 36% yield). .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .delta. 8.06 (m, 1H), 7.49-7.30 (m,
6H), 5.37 (s, 2H).
A solution of 1-benzyloxy-2,3-difluoro-4-nitrobenzene (14 g, 52.8
mmol) in MeOH (200 mL) was stirred with Pd/C (10%, 1.4 g, 1.3 mmol)
under a hydrogen atmosphere (30 psi) for 2 h. The catalyst was
removed by filtration, and the filtrate was concentrated in vacuo
to afford 4-amino-2,3-difluorophenol (7 g, 92% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 9.05 (s, 1H), 6.45 (t, J=8.8 Hz,
1H), 6.34 (t, J=9.2 Hz, 1H), 4.67 (s, 2H); MS (ESI) m/z: 146.1
[M+H].sup.+.
4-amino-2,3-difluorophenol (6 g, 41.4 mmol) and potassium
tert-butoxide (4.9 g, 43.5 mmol) were suspended in DMAc (200 mL)
and stirred at RT for 30 min under Ar atmosphere.
2,4-Dichloropyridine (6.1 g, 41.4 mmol) was added, and the
resulting mixture was heated to 70.degree. C. for 8 h. The reaction
mixture was filtered, concentrated in vacuo and purified by silica
gel chromatography to afford
4-(2-chloro-pyridin-4-yloxy)-2,3-difluoro-phenylamine (7 g, 66%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.27 (d, J=6.0
Hz, 1H), 7.05 (s, 1H), 6.95 (m, 1H), 6.92 (m, 1H), 6.62 (m, 1H),
5.60 (s, 2H); MS (ESI) m/z: 257.1 [M+H].sup.+.
Nitrogen was bubbled though a solution of
4-(2-chloro-pyridin-4-yloxy)-2,3-difluoro-phenylamine (2 g, 7.8
mmol),
1-methyl-4-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-1H-pyrazole
(1.6 g, 7.8 mmol) and Na.sub.2CO.sub.3 (1.65 g, 15.6 mmol) in DME
(12 mL)/H.sub.2O (4 mL) for 20 min. Pd(PPh.sub.3).sub.4 (450 mg,
0.4 mmol), was added and then resulting mixture was degassed in
vacuo, blanketed with nitrogen and heated to 70.degree. C. for 16
h. The reaction was concentrated to dryness under reduced pressure.
The crude product was suspended in water and extracted with EtOAc
(3.times.10 mL). The organic layer was washed with brine, dried
(Na.sub.2SO.sub.4), concentrated in vacuo and purified by silica
gel chromatography to give
2,3-difluoro-4-[2-(1-methyl-1H-pyrazol-4-yl)-pyridin-4-yloxy]-phenylamine
(1.3 g, 55% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.40 (d, J=6.0 Hz, 1H), 8.32 (s, 1H), 8.02 (s, 1H), 7.26 (s, 1H),
6.96 (t, J=8.8 Hz, 1H), 6.71-6.68 (m, 2H), 5.62 (s, 2H), 3.92 (s,
3H); MS (ESI) m/z: 303.2 [M+H].sup.+.
Example A4
A solution of 4-amino-2-methyl-phenol (4.25 g, 34.5 mmol) in
dimethylacetamide (50 mL) was degassed in vacuo and blanketed with
argon. Potassium tert-butoxide (5.0 g, 44.6 mmol) was added and the
reaction mixture was de-gassed a second time and stirred at RT
under argon for 30 min. 2,4-Dichloro-pyridine (4.6 g, 31.3 mmol)
was added and the mixture was heated to 100.degree. C. overnight.
The solvent was removed under reduced pressure and the residue was
purified by silica gel chromatography to give
4-(2-chloropyridin-4-yloxy)-3-methylbenzenamine (4.5 g, 56% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.21 (d, J=5.2 Hz,
1H), 6.75-6.80 (m, 3H), 6.45-6.50 (m, 2H), 5.15 (s, 2H), 1.92 (s,
3H); MS (ESI) m/z: 235.1 (M+H.sup.+).
A solution of 4-(2-chloropyridin-4-yloxy)-3-methylbenzenamine (595
mg, 2.54 mmol),
1-methyl-4-(4,4,5,5-tetramethyl)-[1,3,2]dioxaborolan-2-yl)-4H-pyrazole
(790 mg, 3.80 mmol) and Cs.sub.2CO.sub.3 (2.53 g, 7.77 mmol) in 10
mL of DMF (10 mL)/water (3 mL) was de-gassed under vacuum and
blanketed with nitrogen. Pd(PPh.sub.3).sub.4 (295 mg, 0.26 mmol)
was added and the reaction mixture was heated to 90.degree. C.
overnight. The reaction mixture was diluted with EtOAc (30 mL) and
washed with water (2.times.10 mL) and brine (2.times.10 mL). The
aqueous portion was extracted with EtOAc (2.times.15 mL) and the
combined organics were washed with brine (10 mL), concentrated in
vacuo and purified on silica gel to provide
3-methyl-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)benzenamine
as a pale yellow foam (627 mg, 88% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.27 (d, J=6.0 Hz, 1H), 8.18 (s, 1H), 7.90
(d, J=0.7 Hz, 1H), 7.07 (d, J=2.2 Hz, 1H), 6.74 (d, J=8.6 Hz, 1H),
6.49 (d, J=2.5 Hz, 1H), 6.46-6.40 (m, 2H), 5.02 (s, 2H), 3.84 (s,
3H), 1.94 (s, 3H); MS (ESI) m/z: 281.2 (M+H.sup.+).
Example A5
KOtBu (1.016 g, 9.05 mmol) was added to a solution of
4-amino-2-chlorophenol (1.00 g, 6.97 mmol) in DMF (35 ml) at RT and
the resultant mixture was stirred 45 min. 2,4-Dichloropyridine
(1.340 g, 9.05 mmol) was then added and the reaction was stirred
with heating at 90.degree. C. overnight. The reaction was cooled to
RT and diluted generously with H.sub.2O and EtOAc. The layers were
separated. The aqueous was extracted with EtOAc (3.times.). The
combined organics were washed with H.sub.2O (1.times.) and brine
(2.times.), dried (MgSO.sub.4), concentrated in vacuo and purified
by silica gel chromatography (EtOAc/hexanes) to afford
3-chloro-4-(2-chloropyridin-4-yloxy)benzenamine (0.89 g, 50% yield)
as a waxy yellow solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 8.24 (d, J=5.7 Hz, 1H), 7.02 (d, J=8.7 Hz, 1H), 6.87-6.82
(m, 2H), 6.73-6.72 (m, 1H), 6.58-6.56 (m, 1H), 5.50 (br s, 2H); MS
(ESI) m/z: 254.9 (M+H.sup.+); 256.9 (M+2+H.sup.+).
3-Chloro-4-(2-chloropyridin-4-yloxy)benzenamine (0.89 g, 3.49
mmol),
1-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-pyrazole
(0.871 g, 4.19 mmol) and K.sub.2CO.sub.3 (1.302 g, 9.42 mmol) were
combined in DME (6 ml)/H.sub.2O (7.5 ml) and the headspace was
flushed with Ar for 10 min. Pd(Ph.sub.3P).sub.4 (0.202 g, 0.174
mmol) was then added and the biphasic reaction was stirred with
heating at 90.degree. C. overnight. The reaction was cooled to RT
and filtered to remove insoluble material. The filtrate was diluted
with THF and washed with brine (3.times.). The combined aqueous
phases were extracted with THF (2.times.). The combined organics
were washed with brine (1.times.), dried (MgSO.sub.4), concentrated
in vacuo and purified by silica gel chromatography
(MeOH/CHCl.sub.3) to afford
3-chloro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)benzenamine
(1.10 g, 83% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.30-8.29 (m, 1H), 8.22 (s, 1H), 7.92 (s, 1H), 7.12 (m, 1H),
7.00-6.98 (m, 1H), 6.72 (br s, 1H), 6.58-6.54 (m, 1H), 6.47-6.44
(m, 1H), 5.44 (s, 2H), 3.84 (s, 3H); MS (ESI) m/z: 301.1
(M+H.sup.+): 303.0 (M+2+H.sup.+).
Example A6
To a solution of 4-(2-chloropyridin-4-yloxy)-3-fluoroaniline (3.0
g, 12.6 mmol, from Example A2) in a solvent comprised of
toluene/ethanol/water (4:4:1, 50 mL) was added
4-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-1H-pyrazole (3.17
g, 16.4 mmol), sodium carbonate (4.01 g, 37.8 mmol) and
tetrakis(triphenylphosphine)palladium (0.73 g, 0.63 mmol). The
headspace was evacuated and back-filled with nitrogen (3.times.)
and then the reaction mixture was heated to 100.degree. C.
overnight. The reaction was concentrated under reduced pressure,
and the residue was purified by silica gel column chromatography
(ethyl acetate/petroleum ether) to give
4-(2-(1H-pyrazol-4-yl)pyridin-4-yloxy)-3-fluoroaniline (2.66 g, 78%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 13.03 (brs,
1H), 8.28-8.31 (m, 2H), 7.99 (s, 1H), 7.24 (s, 1H), 6.95-7.00 (m,
1H), 6.39-6.50 (m, 3H), 5.43 (brs, 2H); MS (ESI): m/z 271.1
[M+H].sup.+.
Example A7
A solution of 1,3-difluoro-2-methyl-benzene (15 g, 0.12 mol) in
H.sub.2SO.sub.4 (100 mL) was treated dropwise with 65% HNO.sub.3
(11.4 g, 0.12 mol) at -10.degree. C. and the resultant mixture was
stirred for about 30 min. The mixture was poured into ice-water and
extracted with ethyl acetate (3.times.200 mL). The combined organic
layers were washed with brine, dried (Na.sub.2SO.sub.4) and
concentrated in vacuo to give 1,3-difluoro-2-methyl-4-nitro-benzene
(16 g, 78% yield). .sup.1H NMR (400 MHz, CDCl.sub.3): .delta. 7.80
(m, 1H), 6.95 (m, 1H), 2.30 (s, 3H).
1,3-Difluoro-2-methyl-4-nitro-benzene (16 g, 0.092 mol), benzyl
alcohol (10 g, 0.092 mol) and K.sub.2CO.sub.3 (25.3 g, 0.18 mol),
were combined in DMF (300 mL) and heated to 100.degree. C.
overnight. The mixture was poured into water and extracted with
ethyl acetate (3.times.200 mL). The combined organic layers were
washed with brine, dried (Na.sub.2SO.sub.4), concentrated in vacuo
and purified by silica gel chromatography to give
1-benzyloxy-3-fluoro-2-methyl-4-nitro-benzene (8 g, 33% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.04 (t, J=8.8 Hz,
1H), 7.30-7.46 (m, 5H), 7.08 (d, J=9.2 Hz, 1H), 5.28 (s, 2H), 2.13
(s, 3H).
Using a procedure analogous to Example
A3,1-benzyloxy-3-fluoro-2-methyl-4-nitro-benzene (8 g, 0.031 mol)
was hydrogenated to give 4-amino-3-fluoro-2-methyl-phenol (4.2 g,
96% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 8.61 (s,
1H), 6.36 (m, 2H), 4.28 (s, 2H), 1.96 (s, 3H); MS (ESI) m/z: 142.1
[M+H].sup.+.
Potassium tert-butoxide (3.5 g, 31 mmol) was added to a solution of
4-amino-3-fluoro-2-methyl-phenol (4.2 g, 30 mmol) in
dimethylacetamide. The mixture was stirred at RT for 30 min. A
solution of 2,4-dichloropyridine (4.38 g, 30 mmol) in
dimethylacetamide was added and the mixture was heated at
100.degree. C. overnight. The reaction mixture was concentrated in
vacuo and the residue was dissolved in ethyl acetate (200 mL) and
filtered through silica gel. The filter cake was washed with ethyl
acetate, the combined filtrates were concentrated in vacuo and
purified by silica gel chromatography to give
4-(2-chloro-pyridin-4-yloxy)-2-fluoro-3-methyl-phenylamine (3.2 g,
42% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.21 (d,
J=6.4 Hz, 1H), 6.84 (d, J=2.0 Hz, 1H), 6.81 (dd, J=5.6, 2.4 Hz,
1H), 6.67-6.65 (m, 2H), 5.13 (s, 2H), 1.91 (s, 3H); MS (ESI): m/z
253.2 [M+H].sup.+.
Using a procedure analogous to Example A1,
4-(2-chloro-pyridin-4-yloxy)-2-fluoro-3-methyl-phenylamine (1.0 g,
3.3 mmol),
1-methyl-4-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-1H-pyraz-
ole (1 g, 4.8 mmol), Na.sub.2CO.sub.3 (0.84 g, 6.6 mmol) and
Pd(PPh.sub.3).sub.4 (0.25 g, 0.2 mmol) were combined to give
2-fluoro-3-methyl-4-[2-(1-methyl-1H-pyrazol-4-yl)-pyridin-4-yloxy]-phenyl-
amine (0.74 g, 75% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 8.27 (d, J=6.4 Hz, 1H), 8.18 (s, 1H), 7.90 (s, 1H), 7.07
(s, 1H), 6.68-6.61 (m, 2H), 6.45 (dd, J=5.6, 2.4 Hz, 1H), 5.06 (s,
2H), 3.82 (s, 3H), 1.95 (s, 3H); MS (ESI) m/z: 299.2
[M+H].sup.+.
Example A8
To a stirred solution of NaBr (4.2 g, 0.04 mol) in SOCl.sub.2 (300
ml, 4.0 mol) was added pyridine-2-carboxylic acid (101 g, 0.81 mol)
portion-wise, and the resultant mixture was heated to reflux
overnight. The reaction mixture was concentrated to remove the
solvent to give a crude 4-chloro-pyridine-2-carbonyl chloride (101
g) which was used in the next step reaction without further
purification.
A solution of 4-chloro-pyridine-2-carbonyl chloride (150 g, 0.857
mol) in DCM (750 ml) was slowly added to a solution of
2-methyl-propan-2-ol (158.8 g, 2.14 mol) and DMAP (21 g, 0.171 mol)
in DCM (750 mL) and pyridine (750 mL). The resultant mixture was
stirred at 30.degree. C. overnight. The reaction mixture was
concentrated in vacuo and the residue was purified by
chromatography to give 4-chloro-pyridine-2-carboxylic acid t-butyl
ester (90 g, 49% yield) as a yellow solid. .sup.1H NMR
(CDCl.sub.3): .delta. 8.63 (d, J=8.0 Hz, 1H), 8.03 (s, 1H), 7.44
(d, J=8.0 Hz 1H), 1.63 (s, 9H); MS (ESI) m/z: 214 (M+H.sup.+).
A mixture of 4-aminophenol (2.6 g, 24 mmol) and NaH (1.1 g, 28
mmol) in dry DMF (50 ml) was stirred at RT for 30 min.
4-Chloro-pyridine-2-carboxylic acid t-butyl ester (5.0 g, 24 mmol)
was added and the resulting mixture was stirred in a sealed tube at
80.degree. C. for 12 h. The reaction mixture was concentrated in
vacuo and was purified on silica gel to give
5-(4-amino-phenoxy)-pyridine-2-carboxylic acid t-butyl ester as a
yellow solid (2.4 g, 35% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 8.48 (d, J=5.7 Hz, 1H), 7.33 (d, J=1.8 Hz,
1H), 7.03 (m, 1H), 6.84 (d, J=8.4 Hz, 1H), 6.62 (d, J=8.4 Hz, 1H),
5.18 (s, 2H), 1.50 (s, 9H); MS (ESI) m/z: 287.2 (M+H.sup.+).
To a solution of 5-(4-amino-phenoxy)-pyridine-2-carboxylic acid
t-butyl ester (1.0 g, 3.5 mmol) in THF (10 ml) was added aqueous
NaOH (1 M, 7 ml, 7 mol) followed by (Boc).sub.2O (0.76 g, 3.5
mmol). The resulting mixture was heated to reflux for 2 h. The
reaction mixture was concentrated, the residue diluted with water
(20 mL) and extracted with dichloromethane (3.times.100 mL). The
combined organic layers were washed with brine, dried
(Na.sub.2SO.sub.4), concentrated and purified via chromatography to
provide 5-(4-t-butoxycarbonylamino-phenoxy)-pyridine-2-carboxylic
acid t-butyl ester (1.2 g, 89% yield). MS (ESI) m/z: (M+H.sup.+)
387.3.
A solution of
5-(4-t-butoxycarbonylamino-phenoxy)-pyridine-2-carboxylic acid
t-butyl ester (0.5 g, 1.3 mmol) in THF (2.0 ml) was added dropwise
to a 0.degree. C. suspension of LiAlH.sub.4 (0.1 g, 2.6 mmol) in
dry THF (5.0 ml). The reaction was stirred at 0.degree. C. for 2 h
and was quenched with 10% aqueous NaOH (1.0 mL). The mixture was
filtered and the filtrate was concentrated in vacuo to give
[4-(6-hydroxymethyl-pyridin-3-yloxy)-phenyl]-carbamic acid t-butyl
ester (0.38 g, 92% yield). MS (ESI) m/z: (M+H.sup.+) 317.2.
A solution of [4-(6-hydroxymethyl-pyridin-3-yloxy)-phenyl]-carbamic
acid t-butyl ester (0.25 g, 0.8 mmol) in DCM (3.0 ml) was treated
with activated MnO.sub.2 (0.42 g, 4.8 mmol) and the suspension was
stirred at RT for 2 h. The reaction suspension was filtered and the
filtrate was concentrated in vacuo to provide
[4-(6-formyl-pyridin-3-yloxy)-phenyl]-carbamic acid t-butyl ester
(0.24 g, 95% yield). MS (ESI) m/z: 315.0 (M+H.sup.+).
A solution of NaOAc (0.6 g, 7.4 mmol) in water (1.5 mL) was treated
with 3,3-dibromo-1,1,1-trifluoro-propan-2-one (2.2 g, 8.3 mmol) and
the resulting mixture was heated to reflux for 30 min. After
cooling, the solution was added to
[4-(6-formyl-pyridin-3-yloxy)-phenyl]-carbamicacid t-butyl ester
(2.3 g, 7.4 mmol) in ammonium hydroxide (30%, 23 mL). The reaction
mixture was stirred at RT for 5 h, concentrated in vacuo and
purified via chromatography to give
{4-[3-(4-trifluoromethyl-1H-imidazol-2-yl)-phenoxy]-phenyl}-carbamic
acid t-butyl ester (2.1 g, 67% yield). MS (ESI) m/z: (M+H.sup.+)
421.1.
A mixture of
{4-[3-(4-trifluoromethyl-1H-imidazol-2-yl)-phenoxy]-phenyl}-carbamic
acid t-butyl ester (2.1 g, 2.2 mmol) and aqueous HCl (1M, 30 mL) in
isopropanol (20 ml) was stirred at 90.degree. C. for 2 h. After
cooling to RT, the reaction mixture was concentrated, and the
residue was partitioned with water and dichloromethane. The organic
layer was washed with brine, dried (Na.sub.2SO.sub.4), and
concentrated to yield an HCl salt which was further neutralized to
give
4-(2-(4-(trifluoromethyl)-1H-imidazol-2-yl)pyridin-4-yloxy)benzenamine
(600 mg, 85% yield). .sup.1H NMR (400 MHz, CDCl.sub.3): .delta.
13.48 (br s, 1H), 8.46 (d, J=5.6 Hz, 1H), 7.81 (s, 1H), 7.34 (m,
1H), 6.97 (m, 1H), 6.86 (d, J=8.8 Hz, 2H), 6.66 (d, J=8.8 Hz, 2H),
5.15 (s, 2H); MS (ESI) m/z: 320 (M+H.sup.+). MS (ESI) m/z:
(M+H.sup.+) 321.2.
Example A9
To 60% NaH in mineral oil (0.119 g, 2.97 mmol), under an atmosphere
of argon, was added anhydrous DMF (3 mL) and the slurry was cooled
in an ice bath. To this suspension was added, in portions, a
solution of 2-chloropyridin-4-ol (0.35 g, 2.70 mmol) in DMF (2 mL).
The reaction mixture was stirred cold for 5 minutes and then
allowed to warm to RT and stirred for 20 minutes.
1,5-difluoro-2-methyl-4-nitrobenzene (0.514 g, 2.97 mmol) was added
and the reaction mixture heated at 90.degree. C. for 3 hours,
cooled to RT, quenched with water and the mixture was extracted
with EtOAc (3.times.). The combined organic phases were washed with
brine, dried (Na.sub.2SO.sub.4), concentrated in vacuo and purified
by silica gel column chromatography (EtOAc/hexanes) to obtain
2-chloro-4-(5-fluoro-2-methyl-4-nitrophenoxy)pyridine (0.48 g, 63%
yield) MS (ESI) m/z: 283.0 (M+H.sup.+).
To a solution of
2-chloro-4-(5-fluoro-2-methyl-4-nitrophenoxy)pyridine (0.48 g,
1.698 mmol) in ethanol (20 mL) was added Raney Ni (0.4 g). The
mixture was stirred under a hydrogen atmosphere (1 atm) overnight
at RT. The reaction mixture was filtered through a pad of
Celite.RTM. and the filtrate was concentrated to obtain the crude
4-(2-chloropyridin-4-yloxy)-2-fluoro-5-methylbenzenamine (assuming
a 100% yield).
To a solution of
4-(2-chloropyridin-4-yloxy)-2-fluoro-5-methylbenzenamine (0.43 g,
1.702 mmol) and
1-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole
(0.389 g, 1.872 mmol) in DMF (20 ml) was added
tetrakis(triphenylphosphine)palladium (0.197 g, 0.170 mmol) and an
aqueous solution of potassium phosphate (1.084 g, 5.11 mmol). The
reaction mixture was flushed with N.sub.2 and then heated overnight
at 90.degree. C. Water was added and the solution was extracted
with EtOAc (3.times.). The combined organic phases were washed with
brine, dried (Na.sub.2SO.sub.4), concentrated in vacuo and purified
by silica gel column chromatography (EtOAc/hexanes) to obtain
5-fluoro-2-methyl-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)benzenam-
ine (0.13 g, 25.6% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 8.29 (m, 1H), 8.21 (s, 1H), 7.92 (s, 2H), 7.09 (m, 1H),
6.87 (m, 1H), 6.69 (m, 1H), 6.46 (m, 1H), 5.10 (s, 2H), 3.84 (s,
3H), 1.93 (s, 3H); MS (ESI) m/z: 299.1 (M+H.sup.+).
Example A10
Potassium carbonate (7.8 g, 56.4 mmol) was added to a solution of
1,2,3-trifluoro-5-nitrobenzene (5 g, 28.2 mmol) and benzyl alcohol
(3.2 g, 29.6 mmol) in N,N-dimethylformamide (70 mL). The resultant
mixture was stirred at RT overnight. The reaction mixture was
concentrated under reduced pressure and the residue was partitioned
between ethyl acetate and water. The organic layer was separated
and washed with brine, dried (Na.sub.2SO.sub.4), concentrated under
reduced pressure and purified by column chromatography to give
2-(benzyloxy)-1,3-difluoro-5-nitrobenzene (5.3 g, 71% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.15 (d, J=8.4 Hz,
2H), 7.46-7.37 (m, 5H), 5.39 (s, 2H).
To a solution of 2-(benzyloxy)-1,3-difluoro-5-nitrobenzene (5.3 g,
20 mol) in ethanol (100 mL) was added 10% palladium on activated
carbon (1.5 g). The mixture was hydrogenated (1 atm) at RT
overnight. The reaction mixture was filtered and the filtrate was
concentrated under reduced pressure to give
4-amino-2,6-difluorophenol (2.9 g, 95% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 8.68 (brs, 1H), 6.19 (d, J=10.8 Hz,
2H), 5.01 (s, 2H).
Potassium tert-butoxide (2.4 g, 22 mmol) was added to a solution of
4-amino-2,6-difluorophenol (2.9 g, 20 mmol) in
N,N-dimethyl-acetamide (50 mL) and the mixture was stirred at RT
under nitrogen for 0.5 h. A solution of 2,4-dichloro-pyridine (2.9
g, 20 mmol) in N,N-dimethyl-acetamide was added, and the reaction
was heated to 100.degree. C. under nitrogen for 10 h. After cooling
to RT, the reaction was poured into water (100 mL) and the aqueous
solution was extracted with ethyl acetate (3.times.70 mL). The
combined organics were washed with brine, dried (Na.sub.2SO.sub.4),
concentrated in vacuo and purified by silica gel chromatography to
give 4-(2-chloropyridin-4-yloxy)-3,5-difluoroaniline (3.0 g, 59%
yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 8.31 (d, J=5.7
Hz, 1H), 7.10 (d, J=2.1 Hz, 1H), 7.01 (dd, J=5.7 Hz, 2.1 Hz, 1H),
6.38 (d, J=10.8 Hz, 2H), 5.86 (s, 2H).
To a solution of 4-(2-chloropyridin-4-yloxy)-3,5-difluoroaniline
(3.0 g, 11.7 mmol) in a mixture of N,N-dimethyl-formamide and water
(v/v=3:1, 80 mL) was added
1-methyl-4-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-1H-pyrazole
(3.6 g, 17.5 mmol), potassium phosphate (4.9 g, 23.4 mmol) and
tetrakis(triphenylphosphine) palladium (0.7 g, 0.6 mmol). The
mixture was degassed thoroughly, heated to 100.degree. C. and
stirred under nitrogen overnight. The solvent was removed under
reduced pressure and the residue was purified by silica gel
chromatography to give
3,5-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)aniline
(2.6 g, 74% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.36 (d, J=5.6 Hz, 1H), 8.28 (s, 1H), 7.98 (s, 1H), 7.24 (d, J=2.4
Hz, 1H), 6.64 (dd, J=5.6 Hz, J=2.4 Hz, 1H), 6.37 (d, J=10.8 Hz,
2H), 5.81 (s, 2H), 3.87 (s, 3H); MS (ESI): m/z 303.1
[M+H].sup.+.
Example A11
4-Fluoro-2-methyl-phenol (25 g, 0.2 mol) was added to a solution of
sodium hydroxide (9.7 g, 0.24 mol) in water (160 mL) and the
resultant solution was cooled to 0.degree. C. Methyl chloroformate
(24.2 g, 0.26 mol) was added dropwise at 0.degree. C. At the
completion of the reaction, the pH was adjusted to pH 8 with
saturated aqueous Na.sub.2CO.sub.3 and then the mixture was
extracted with ethyl acetate (3.times.300 mL). The combined organic
extracts were washed with water and brine, dried (MgSO.sub.4) and
concentrated under reduced pressure to provide carbonic acid
4-fluoro-2-methyl-phenyl ester methyl ester (30 g, 82% yield).
.sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 7.22-7.13 (m, 2H),
7.05 (m, 1H), 3.81 (s, 3H), 2.12 (s, 3H).
To a solution of carbonic acid 4-fluoro-2-methyl-phenyl ester
methyl ester (15 g, 81.5 mmol) in conc. sulfuric acid (100 mL) at
0.degree. C. was added powdered KNO.sub.3 (8.3 g, 82.2 mmol) in
several portions. The reaction mixture was stirred for 1 hour at
0.degree. C. and was then poured into ice water and extracted with
ethyl acetate (3.times.100 mL). The extracts were washed with water
and brine, dried (MgSO.sub.4), concentrated in vacuo and purified
by silica gel chromatography to provide carbonic acid
4-fluoro-2-methyl-5-nitrophenyl ester methyl ester (2.0 g, 11%
yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 8.14 (d,
J=6.9, 1H), 7.60 (d, J=12.0 Hz, 1H), 3.86 (s, 3H), 2.25 (s,
3H).
To a solution of aqueous sodium hydroxide (1.2 N, 20 mL, 24 mmol)
was added 4-fluoro-2-methyl-5-nitro-phenyl ester methyl ester (2.0
g, 8.7 mmol), and the resultant mixture was refluxed for 2 hours.
The reaction was cooled to RT and partitioned between EtOAc and
water. The organic layer was washed with water and brine, dried
(MgSO.sub.4), and concentrated in vacuo to provide
4-fluoro-2-methyl-5-nitro-phenol (1.4 g, 93% yield). .sup.1H NMR
(300 MHz, DMSO-d.sub.6) .delta. 10.33 (s, 1H), 7.45 (d, J=6.6, 1H),
7.32 (d, J=12.3 Hz, 1H), 2.19 (s, 3H).
A mixture of 4-fluoro-2-methyl-5-nitro-phenol (1.4 g, 8.2 mmol) and
10% Pd/C (0.3 g, 20%/w) in MeOH (80 mL) was stirred under H.sub.2
(30 psi) for 2 h. The Pd/C was removed by filtration and the
filtrate was concentrated to give 5-amino-4-fluoro-2-methyl-phenol
(0.68 g, 62% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6) .delta.
8.75 (s, 1H), 6.62 (d, J=12.0 Hz, 1H), 6.21 (d, J=8.1 Hz, 1H), 4.69
(s, 2H), 1.93 (s, 3H).
A mixture of
2-methanesulfonyl-4-(1-methyl-1H-pyrazol-4-yl)-pyrimidine and
2-methanesulfinyl-4-(1-methyl-1H-pyrazol-4-yl)-pyrimidine from
Example A16 (1 g, 4.2 mmol), 5-amino-4-fluoro-2-methylphenol (1.2
g, 8.5 mmol) and K.sub.2CO.sub.3 (1.2 g, 8.6 mmol) were combined in
DMF (10 mL) using a procedure analogous to Example A10 to provide
2-fluoro-4-methyl-5-(4-(1-methyl-1H-pyrazol-4-yl)pyrimidin-2-yloxy)benzen-
amine (420 mg). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.42
(d, J=5.2 Hz, 1H), 8.39 (s, 1H), 8.07 (s, 1H), 7.40 (d, J=5.2 Hz,
1H), 6.90 (d, J=9.6 Hz, 1H), 6.47 (d, J=8.4 Hz, 1H), 5.02 (br s,
2H), 3.88 (s, 3H), 1.88 (s, 3H); MS (ESI) m/z: 300.2
(M+H.sup.+).
Example A12
Anhydrous N,N-dimethylformamide (150 mL) was added to 60% NaH in
mineral oil (2.72 g, 67.9 mmol) under an atmosphere of argon. The
mixture was cooled in an ice bath and stirred. To this suspension
was added, portion-wise, a solution of 2-chloropyridin-4-ol (8 g,
61.8 mmol) in DMF (30.0 mL). The reaction mixture was stirred cold
for 5 minutes and the cooling bath was removed. The reaction
mixture was warmed to RT and stirred for 20 minutes.
1,2,4-trifluoro-5-nitrobenzene (13.12 g, 74.1 mmol) was added and
the reaction mixture heated at 90.degree. C. for 3 hours. The
reaction mixture was cooled to RT. The mixture was concentrated to
dryness. EtOH (50 mL) and MeOH (20 mL) were added and the sample
was stirred with gentle warming and then cooled to RT. The yellow
solid was collected by filtration, and rinsed with EtOH (50 mL) and
hexanes (20 mL). The solid was dried under vacuum overnight to
provide 2-chloro-4-(2,5-difluoro-4-nitrophenoxy)pyridine as a
yellow solid (11.68 g, 63% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.48 (dd, J=10.2, 7.0 Hz, 1H), 8.41 (d,
J=5.6 Hz, 1H), 7.90 (dd, J=11.6, 6.7 Hz, 1H), 7.41 (d, J=2.1 Hz,
1H), 7.26 (dd, J=5.6, 2.4 Hz, 1H); MS (ESI): m/z 287.0
[M+H].sup.+
In a Parr Shaker flask was combined
2-chloro-4-(2,5-difluoro-4-nitrophenoxy)pyridine (11.68 g, 40.8
mmol) and MeOH (200 ml) under argon. Raney Ni (50% wet, 0.955 g,
8.15 mmol) was added. The argon atmosphere was removed and replaced
with hydrogen (10-20 psi) and the reaction mixture shaken under
hydrogen for 4 hours. The completed reaction mixture was filtered
through a pad of Celite.RTM. and the filtrate was concentrated to
dryness to provide 4-(2-chloropyridin-4-yloxy)-2,5-difluoroaniline
(8.2 g, 72% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.28 (d, J=5.9 Hz, 1H), 7.25 (dd, J=11.2, 7.5 Hz, 1H), 7.02 (dd,
J=2.2 Hz, 1H), 6.95 (dd, J=5.8, 2.0 Hz, 1H), 6.74 (dd, J=12.3, 8.3
Hz, 1H), 5.57 (s, 2H); MS (ESI): m/z 257.0 [M+H].sup.+
To a solution of 4-(2-chloropyridin-4-yloxy)-2,5-difluoroaniline
(450 mg, 1.76 mmol) and
1-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole
(400 mg, 1.9 mmol) in N,N-dimethylformamide (30 mL) was added
tetrakis(triphenylphosphine)palladium (105 mg, 0.09 mmol) and an
aqueous solution of potassium phosphate (2 M, 1.8 mL). The mixture
was flushed with nitrogen for 10 min, and then stirred with heating
at 90.degree. C. under nitrogen overnight. After cooling to RT, the
reaction mixture was partitioned between water and ethyl acetate.
The aqueous layer was extracted with ethyl acetate (50 mL.times.3).
The combined organic layers were washed with brine, dried
(Na.sub.2SO.sub.4), concentrated under reduced pressure and
purified by column chromatography on silica gel to give
2,5-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)aniline
(335 mg, 63% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
8.35 (d, J=5.7 Hz, 1H), 8.27 (s, 1H), 7.98 (s, 1H), 7.24-7.18 (m,
2H), 6.75 (dd, J=12.3, 8.1 Hz, 1H), 6.62 (dd, J=5.4, 2.1 Hz, 1H),
5.53 (br s, 2H), 3.87 (s, 3H); MS (ESI): m/z 303.1 [M+1].sup.+.
Example A13
5-Bromo-2-nitropyridine (1 g, 4.93 mmol) was dissolved in DMF (32
ml) and cooled to 0.degree. C. Cesium carbonate (2.408 g, 7.39
mmol) was added, followed by 2-chloro-4-hydroxypyridine (0.702 g,
5.42 mmol). The mixture was stirred in an 80.degree. C. oil bath
for 24 hours. The reaction mixture was then cooled to RT, diluted
with ethyl acetate (150 mL), washed with water (2.times.100 mL) and
brine (50 mL), dried (MgSO.sub.4), evaporated under reduced
pressure and purified via silica gel chromatography (ethyl
acetate-hexanes) to yield
2-chloro-4-(6-nitropyridin-3-yloxy)pyridine as a clear oil (0.540
g, 44% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.62
(d, 1H), 8.41 (m, 2H), 8.06 (d, 1H), 7.37 (d, 1H), 7.23 (dd, 1H);
MS (ESI) m/z: 252.0 (M+H.sup.+).
2-Chloro-4-(6-nitropyridin-3-yloxy)pyridine (0.540 g, 2.146 mmol)
was dissolved in THF (54 ml) and MeOH (54 ml). Ammonium chloride
(1.148 g, 21.46 mmol) was then added, followed by zinc dust (1.403
g, 21.46 mmol). The reaction was stirred at RT for 45 minutes,
filtered over Celite.RTM. and concentrated under reduced pressure
to yield 5-(2-chloropyridin-4-yloxy)pyridin-2-amine as a brown
solid (0.49 g, 99%). It was used as is in the next reaction.
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.46 (d, 1H), 7.81 (d,
1H), 7.30 (dd, 1H), 6.90 (m, 2H), 6.50 (d, 1H), 6.08 (s, 2H); MS
(ESI) m/z: 222.0 (M+H.sup.+).
5-(2-Chloropyridin-4-yloxy)pyridin-2-amine (0.47 g, 2.121 mmol) was
dissolved in DMF (11 ml). Water (3.67 ml) was added to the mixture,
followed by
1-methyl-4(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)1H-pyrazole
(0.662 g, 3.18 mmol), and cesium carbonate (2.63 g, 8.06 mmol).
Argon was bubbled through the mixture for several minutes, and then
palladium tetrakistriphenylphosphine (0.245 g, 0.212 mmol) was
added. The flask was fitted with a condenser and argon was flushed
through the system. The reaction mixture was then placed in a
90.degree. C. oil bath under a balloon of argon and heated for 23
hours. The solution was then cooled to RT and diluted with THF (75
mL) and washed with brine (2.times.50 mL). The combined aqueous
layers were then back extracted with THF (40 mL). The combined
organic layers were dried (MgSO.sub.4), concentrated under reduced
pressure and purified via silica gel chromatography (THF-ethyl
acetate) to yield
5-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pyridin-2-amine as
an off-white solid (0.357 g, 63% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.31 (d, 1H), 8.22 (s, 1H), 7.92 (s, 1H),
7.80 (d, 1H), 7.27 (dd, 1H), 7.14 (d, 1H), 6.85 (s, 1H), 6.57 (dd,
1H), 6.01 (s, 2H), 3.84 (s, 3H); MS (ESI) m/z: 268.1
(M+H.sup.+).
Example A14
Sodium hydride (60% in mineral oil) (0.620 g, 15.5 mmol) was placed
in a 100 mL round bottom flask under argon. Dry DMF (30 mL) was
added, followed by portion wise addition of
2-chloro-4-hydroxypyridine (1.339 g, 10.33 mmol) at 0.degree. C.
The mixture was stirred at 0.degree. C. for 30 minutes, and then
slowly warmed to RT. A solution of
5-chloro-2,4-difluoronitrobenzene (2 g, 10.33 mmol) in DMF (4.4 mL)
was added to the suspension, and the mixture was placed in a
90.degree. C. oil bath to heat for 15 hours under argon. The
reaction mixture was then cooled to RT and diluted with ethyl
acetate (100 mL), washed with 10% aqueous LiCl (3.times.100 mL) and
brine (2.times.100 mL), dried (MgSO.sub.4) and purified via silica
gel chromatography (ethyl acetate/hexanes) to yield
2-chloro-4-(2-chloro-5-fluoro-4-nitrophenoxy)pyridine as a bright
yellow oil (1.415 g, 45% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.56 (dd, 1H), 8.35 (dd, 1H), 7.88 (dd, 1H),
7.32 (dd, 1H), 7.18 (m, 1H); MS (ESI) m/z: 303.0 (M+H.sup.+).
2-Chloro-4-(2-chloro-5-fluoro-4-nitrophenoxy)pyridine (1.306 g,
4.31 mmol) was dissolved in THF (108 ml) and MeOH (108 ml).
Ammonium chloride (2.305 g, 43.1 mmol) was then added, followed by
zinc dust (2.82 g, 43.1 mmol). The reaction mixture was stirred for
1 hour at RT. The solids were filtered over Celite.RTM. and the
solution was concentrated under reduced pressure to yield
5-chloro-4-(2-chloropyridin-4-yloxy)-2-fluorobenzenamine as a brown
solid which was used without purification assuming a 100% yield. MS
(ESI) m/z: 273.0 (M+H.sup.+).
5-Chloro-4-(2-chloropyridin-4-yloxy)-2-fluorobenzenamine (1.177 g,
4.31 mmol) and
1-methyl(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazo- le
(1.166 g, 5.60 mmol) were dissolved in DMF (16.16 ml), cesium
carbonate (4.21 g, 12.93 mmol) was added, followed by water (5.39
ml). Argon was bubbled through the mixture for 5 minutes, and then
palladium tetrakistriphenylphosphine (0.249 g, 0.215 mmol) was
added. The flask was fitted with a reflux condenser, flushed with
argon, and heated in a 90.degree. C. oil bath under a balloon of
argon for 4 hours. The reaction mixture was then cooled to RT and
diluted with a 4:1 mixture of ethyl acetate and THF. The solution
was extracted with 10% aqueous LiCl (2.times.150 mL) and brine (100
mL), dried (MgSO.sub.4), evaporated under reduced pressure and
purified via silica gel chromatography (ethyl acetate/hexanes) to
yield
5-chloro-2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)benzenam-
ine as a tan solid (1.062 g, 77% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.31 (d, 1H), 8.24 (s, 1H), 7.95 (s, 1H),
7.20 (d, 1H), 7.13 (d, 1H), 6.92 (d, 1H), 6.52 (dd, 1H), 5.49 (s,
2H), 3.84 (s, 3H); MS (ESI) m/z: 319.1 (M+H.sup.+).
Example A15
Sodium hydride (136 mg, 3.4 mmol, 60% in mineral) was added to a
0.degree. C. solution of 2-chloropyridin-4-ol (2 g, 15.4 mmol) in
DMF (38 mL) under Ar. The mixture was stirred at 0.degree. C. for 1
h. A solution of 1,2,4-trifluoro-5-nitrobenzene (626 mg, 3.1 mmol)
in DMF (7.6 ml) was added and the reaction was stirred under Ar at
90.degree. C. for 3 h. The mixture was cooled to RT and stirred
overnight. The solvent was removed under reduced pressure and the
crude product was partitioned between water (50 ml) and EtOAc (50
ml). The mixture was extracted with EtOAc (3.times.50 ml). The
combined organic extracts were washed with brine, dried
(Na.sub.2SO.sub.4), concentrated under reduced pressure and
purified by silica gel column chromatography (hexanes/EtOAc) to
yield 2-chloro-4-(2,5-difluoro-4-nitrophenoxy)pyridine (3.57 g, 81%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.43-8.33 (m,
2H), 7.85-7.79 (m, 1H), 7.33 (d, 1H), 7.20-7.18 (m, 1H); MS (ESI)
m/z: 287.0 (M+H.sup.+).
A mixture of 2-chloro-4-(2,5-difluoro-4-nitrophenoxy)pyridine (3.57
g, 2.1 mmol), zinc dust (8.14 g, 125 mmol) and ammonium chloride
(6.66 g, 125 mmol) in THF (160 mL) and MeOH (160 ml) was stirred at
RT for 2 h. The reaction mixture was filtered and the filtrate was
concentrated under reduced pressure. The crude product was
partitioned between EtOAc (50 ml) and a mixture of water and
saturated NaHCO.sub.3 (aq) (1:1; 50 ml). The mixture was extracted
with EtOAc (2.times.50 ml). The combined organic extracts were
dried (Na.sub.2SO.sub.4) and evaporated to yield
4-(2-chloropyridin-4-yloxy)-2,5-difluoroaniline (3.18 g, 100%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.26 (d, 1H),
7.24-7.19 (m, 1H), 7.00 (s, 1H), 6.94-6.92 (m, 1H), 6.74-6.69 (m,
1H), 5.54 (brs, 2H); MS (ESI) m/z: 257.0 (M+H.sup.+).
3-Methyl-4-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-1H-pyrazole
(0.3 g, 1.442 mmol) and potassium carbonate (0.996 g, 7.21 mmol)
were suspended in acetonitrile (10 ml) and stirred overnight at RT.
Additional iodomethane (0.5 ml) was added and the mixture was
stirred overnight at RT. The mixture was diluted with EtOAc and the
inorganic salts were removed by filtration. The filtrate was
evaporated to yield an inseparable mixture (2:1) of
1,3-dimethyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole
and
1,5-dimethyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyraz-
ole (0.267 g, 83% yield). MS (ESI) m/z: 223.1 (M+H.sup.+).
In a sealed tube, 4-(2-chloropyridin-4-yloxy)-2,5-difluoroaniline
(0.257 g, 1.00 mmol), a (2:1) mixture of
1,3-dimethyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole
and
1,5-dimethyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyraz-
ole (0.267 g, 1.20 mmol), potassium carbonate (0.415 g, 3.01 mmol)
and tetrakistriphenylphosphine palladium(0) (0.058 g, 0.050 mmol)
were suspended in a mixture of dioxane (10 ml) and water (1.667
ml). The mixture was degassed with Ar and heated at 90.degree. C.
overnight. The reaction was diluted with saturated aq. NaHCO.sub.3
(25 ml) and extracted with EtOAc (3.times.25 ml). The combined
organic extracts were concentrated in vacuo and purified by silica
gel chromatography (hexanes/EtOAc) to elute an inseparable (2:1)
mixture of
4-(2-(1,3-dimethyl-1H-pyrazol-4-yl)pyridin-4-yloxy)-2,5-difluorobenzenami-
ne and
4-(2-(1,5-dimethyl-1H-pyrazol-4-yl)pyridin-4-yloxy)-2,5-difluoroben-
zenamine (0.31 g, 98% yield). MS (ESI) m/z: 317.1 (M+H.sup.+).
Example A16
Methyl chloroformate (77.3 g, 0.82 mol) was added dropwise to a
-10.degree. C. solution of 2-chloro-4-fluorophenol (100 g, 0.68
mol) and sodium hydroxide (32.8 g, 0.82 mol) in water (550 mL).
After complete addition, the precipitated solid was collected by
filtration and washed with water to give 2-chloro-4-fluorophenyl
methyl carbonate (110 g, 79% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 7.62 (dd, J=8.1, 2.7 Hz, 1H), 7.50 (dd,
J=9.0, 5.4 Hz, 1H), 7.30 (td, J=8.1, 3.0 Hz, 1H), 3.86 (s, 3H); MS
(ESI) m/z: 205.2 (M+H.sup.+).
To a suspension of 2-chloro-4-fluorophenyl methyl carbonate (110 g,
0.54 mol) in conc. H.sub.2SO.sub.4 (50 mL) was slowly added a
mixture comprised of conc. H.sub.2SO.sub.4 (40 mL) and fuming
HNO.sub.3 (40.8 mL, 0.89 mol). The resultant mixture was stirred
for 30 min at 0.degree. C. The reaction mixture was poured into ice
water and the precipitated solid was collected by filtration and
washed with water to give 2-chloro-4-fluoro-5-nitrophenyl methyl
carbonate (120 g, 90% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 8.45 (d, J=7.2 Hz, 1H), 8.12 (d, J=10.8 Hz, 1H), 3.89 (s,
3H); MS (ESI) m/z: 250.1 (M+H.sup.+).
2-Chloro-4-fluoro-5-nitrophenyl methyl carbonate (120 g 0.48 mol)
was combined with a solution of sodium hydroxide (22.7 g, 0.57 mol)
in water (300 mL) and the resultant mixture was refluxed for 4 h.
The insoluble solids were removed by filtration and the filtrate
was acidified with dilute HCl. The precipitated solid was collected
by filtration and washed with water to give
2-chloro-4-fluoro-5-nitrophenol (90 g, 98% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 11.18 (s, 1H), 8.10 (d, J=10.4 Hz, 1H),
7.62 (d, J=7.2 Hz, 1H); MS (ESI) m/z: 192.1 (M+H.sup.+).
2-Chloro-4-fluoro-5-nitrophenol (85 g, 0.45 mol) and 10% Pd/C (25
g, 0.023 mol) were combined in EtOH and hydrogenated (50 psi) for
12 h. The reaction mixture was filtered. The filtrate was
concentrated in vacuo and purified by silica gel chromatography to
provide 3-amino-4-fluorophenol (40 g 70% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 8.87 (s, 1H), 6.70 (dd, J=11.2, 8.8 Hz,
1H), 6.14 (dd, J=7.8, 2.4 Hz, 1H), 5.84 (m, 1H), 4.92 (s, 2H); MS
(ESI) m/z: 128.2 (M+H.sup.+).
4-Chloro-2-methylsulfanyl-pyrimidine (1.4 g, 8.8 mmol),
1-methyl-4-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-1H-pyrazole
(2.0 g, 1.1 eq), Na.sub.2CO.sub.3 (2.8 g, 3 eq) and
Pd(PPh.sub.3).sub.4 (500 mg, 0.43 mmol) were combined in a solvent
comprised of toluene/EtOH/H.sub.2O (4/4/1, 20 mL). The reaction
mixture was purged with argon and heated to 100.degree. C.
overnight. The reaction was filtered to remove insolubles and the
filtrate was concentrated in vacuo. The residue was purified by
silica gel chromatography to provide
4-(1-methyl-1H-pyrazol-4-yl)-2-(methylthio)pyrimidine contaminated
with triphenylphosphine oxide (2.0 g, >100% yield). .sup.1H NMR
(300 MHz, DMSO-d.sub.6): .delta. 8.49 (d, J=5.1 Hz, 1H), 8.46 (s,
1H), 8.12 (s, 1H), 7.38 (d, J=5.1 Hz, 1H), 3.89 (s, 3H), 2.52 (s,
3H).
A solution of
4-(1-methyl-1H-pyrazol-4-yl)-2-methylsulfanyl-pyrimidine (2.0 g
crude, 8.8 mmol) in dichloromethane (20 mL) was treated with m-CPBA
(3.0 g, 17.4 mmol) portionwise at RT. The reaction was stirred 2 h
and was quenched with saturated aqueous NaS.sub.2SO.sub.3 (3 mL).
The mixture was partitioned with saturated aq Na.sub.2CO.sub.3 and
the organics were washed with brine, dried (Na.sub.2SO.sub.4), and
concentrated to provide a mixture (2.0 g) of
2-methanesulfonyl-4-(1-methyl-1H-pyrazol-4-yl)-pyrimidine and
2-methanesulfinyl-4-(1-methyl-1H-pyrazol-4-yl)-pyrimidine with a
molar ratio of 1:0.3. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.83 (d, J=5.2 Hz, 1H), 8.82 (d, J=5.2 Hz, 0.24H), 8.57 (s, 1H),
8.57 (s, 0.24H), 8.21 (s, 1H), 8.21 (s, 0.23H), 7.80 (d, J=5.6 Hz,
1H), 7.80 (d, J=5.6 Hz, 0.25H), 3.48 (s, 3H), 2.88 (s, 0.7H).
The above mixture of
2-methanesulfonyl-4-(1-methyl-1H-pyrazol-4-yl)-pyrimidine and
2-methanesulfinyl-4-(1-methyl-1H-pyrazol-4-yl)-pyrimidine (1 g, 4.2
mmol), 4-amino-3-fluoro-phenol (1.1 g, 8.6 mmol) and
K.sub.2CO.sub.3 (1.2 g, 8.6 mmol) in DMF (10 mL) was heated at
100.degree. C. for 12 h. The reaction was partitioned between
H.sub.2O and EtOAc (3.times.50 mL). The combined organics were
dried (Na.sub.2SO.sub.4), concentrated in vacuo and chromatographed
to provide
2-fluoro-5-(4-(1-methyl-1H-pyrazol-4-yl)pyrimidin-2-yloxy)benzenamine
(402 mg). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.44 (d,
J=5.2 Hz, 1H), 8.39 (s, 1H), 8.07 (s, 1H), 7.41 (d, J=5.2 Hz, 1H),
6.98 (t, J=9.6 Hz, 1H), 6.53 (dd, J=5.6, 2.0 Hz, 1H), 6.28 (d,
J=8.4 Hz, 1H), 5.25 (br s, 2H), 3.88 (s, 3H). MS (ESI) m/z: 286.2
(M+H.sup.+).
Example A17
Sulfuric acid (10 mL) was cooled to 0.degree. C. and hydrogen
peroxide (4.92 ml, 48.1 mmol) was added slowly, maintaining an
internal temperature of less than 20.degree. C. A solution of
2-amino-5-bromo-4-methylpyridine (1.5 g, 8.02 mmol) in 10 mL of
sulfuric acid was then added. The mixture was stirred in the ice
bath for 45 minutes, and then warmed to RT. After 1 hour at RT the
color of the reaction mixture gradually changed from grass green to
bright yellow. The reaction mixture was poured over ice (100 mL)
and the solid that formed was collected via suction filtration and
washed with water. The light orange solid was dried overnight to
yield 5-bromo-4-methyl-2-nitropyridine (1.08 g, 62% yield), which
was used without further purification. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.77 (s, 1H), 8.38 (s, 1H), 2.51 (s,
3H).
2-Chloro-4-hydroxypyridine (0.239 g, 1.843 mmol) was dissolved in
DMF (18.43 ml) and potassium t-butoxide (0.290 g, 2.58 mmol) was
added. The solution was degassed for several minutes, and then
5-bromo-4-methyl-2-nitropyridine (0.4 g, 1.843 mmol) was added. The
mixture was heated at 65.degree. C. for 70 hours under argon and
then at 80.degree. C. for 24 hours. The reaction mixture was cooled
to RT, diluted with ethyl acetate (150 mL), washed with water (75
mL), 10% aqueous LiCl (2.times.75 mL), saturated aqueous
bicarbonate (75 mL) and brine (75 mL), dried (MgSO.sub.4),
evaporated and purified via silica gel chromatography (ethyl
acetate/hexanes) to yield
2-chloro-4-(4-methyl-6-nitropyridin-3-yloxy)pyridine as a yellow
solid (0.087 g, 18% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 8.49 (s, 1H), 8.47 (s, 1H), 8.35 (d, 1H), 7.24 (d, 1H),
7.12 (dd, 1H), 2.31 (s, 3H); MS (ESI) m/z: 266.0 (M+H.sup.+).
2-Chloro-4-(4-methyl-6-nitropyridin-3-yloxy)pyridine was dissolved
in THF (11.95 ml)/methanol (11.95 ml) and ammonium chloride (0.256
g, 4.78 mmol) was added, followed by zinc dust (0.313 g, 4.78
mmol). The mixture stirred at RT for 1.5 hours before it was
filtered through Celite.RTM.. The filtrate was evaporated under
reduced pressure to yield a magenta film which was partitioned
between ethyl acetate/THF (4:1) and water. The organic layer was
washed with brine, dried (MgSO.sub.4) and evaporated to yield
5-(2-chloropyridin-4-yloxy)-4-methylpyridin-2-amine as a brown oil
(0.116 g, 103%), which was used in the next step without
purification. MS (ESI) m/z: 236.1 (M+H.sup.+).
5-(2-chloropyridin-4-yloxy)-4-methylpyridin-2-amine (0.116 g, 0.492
mmol) was dissolved in DMF (2 ml) and
1-methyl-1H-pyrazole-4-boronic acid pinacol ester (0.154 g, 0.738
mmol) was added, followed by cesium carbonate (0.481 g, 1.477 mmol)
and water (0.667 ml). Argon was bubbled through the mixture for
several minutes, and then palladium tetrakistriphenylphosphine
(0.028 g, 0.025 mmol) was added. The flask was fitted with a reflux
condenser, flushed with argon, and heated under a balloon of argon
at 90.degree. C. for 16 hours. The mixture was then cooled to RT,
and the solution was diluted with a 4:1 mix of ethyl acetate and
THF (70 mL). It was washed with 10% aqueous LiCl (2.times.50 mL)
and brine (50 mL), dried (MgSO.sub.4), evaporated in vacuo and
purified via silica gel chromatography (DCM/MeOH) to yield
4-methyl-5-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pyridin-2-amine
as a clear oil (0.084 g, 61% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.30 (d, 1H), 8.22 (s, 1H), 7.93 (s, 1H),
7.69 (s, 1H), 7.11 (d, 1H), 6.50 (dd, 1H), 6.38 (s, 1H), 5.89 (s,
2H), 3.84 (s, 3H), 1.95 (s, 3H); MS (ESI) m/z: 282.1
(M+H.sup.+).
Example A18
4-Chloro-2-methylsulfanyl-pyrimidine (1.4 g, 8.8 mmol),
4-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-1H-pyrazole (2.0
g, 10.3 mmol), Na.sub.2CO.sub.3 (2.8 g, 26.4) and
Pd(PPh.sub.3).sub.4 (500 mg, 0.43 mmol) were combined in a solvent
comprised of toluene/EtOH/H.sub.2O (4/4/1, 20 mL). The mixture was
degassed by applying a vacuum and backfilling the headspace with
argon. The reaction mixture was heated overnight at 100.degree. C.
The insoluble portion was filtered and the filtrate was
concentrated and purified by silica gel chromatography to provide
2-(methylthio)-4-(1H-pyrazol-4-yl)pyrimidine (1.2 g, 71% yield).
.sup.1H NMR (400 MHz, CDCl.sub.3) .delta. 8.45 (d, J=6.4 Hz, 1H),
8.24 (s, 1H), 7.23 (s, 1H), 7.05 (d, J=6.4 Hz, 1H), 2.51 (s,
3H).
To a solution of 2-(methylthio)-4-(1H-pyrazol-4-yl)pyrimidine (200
mg, 1 mmol) in dichloromethane (3 mL) and H.sub.2O (1 mL) was added
4-methoxybenzylchloride (200 mg, 1.28 mmol) at 0.degree. C. The
mixture was stirred at RT overnight. The organic layer was
separated, washed with brine and concentrated in vacuo to give
crude
4-(1-(4-methoxybenzyl)-1H-pyrazol-4-yl)-2-(methylthio)pyrimidine.
.sup.1H NMR (300 MHz, DMSO-d.sub.6) .delta. 8.58 (s, 1H), 8.50, (d,
J=5.4 Hz, 1H), 8.16 (s, 1H), 7.40 (d, J=5.4 Hz, 1H), 7.27 (d, J=8.4
Hz, 2H), 7.22 (d, J=8.4 Hz, 2H), 5.30 (s, 2H), 3.72 (s, 3H), 2.51
(s, 3H); MS (ESI) m/z: 313 (M+H.sup.+).
To a solution of
4-(1-(4-methoxybenzyl)-1H-pyrazol-4-yl)-2-(methylthio)pyrimidine
(200 mg, 0.64 mmol) in dichloromethane was added m-CPBA (220 mg,
1.28 mmol). The reaction was stirred for 2 hour at RT. Water was
added, the organic layer was separated and the aqueous layer was
extracted with dichloromethane. The combined organics were washed
with brine and concentrated in vacuo. The residue was combined with
3-amino-4-fluorophenol (165 mg, 1.28 mmol) and K.sub.2CO.sub.3 (176
mg, 1.28 mmol) in DMF (5 mL) and the resultant mixture was heated
at 90.degree. C. overnight. After filtration and concentration, the
residue was purified by silica gel column chromatography to give
5-(4-(1-(4-methoxybenzyl)-1H-pyrazol-4-yl)pyrimidin-2-yloxy)-2-fluorobenz-
enamine (210 mg, 84% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6)
.delta. 8.50 (s, 1H), 8.44, (d, J=5.4 Hz, 1H), 8.10 (s, 1H), 7.42
(d, J=5.4 Hz, 1H), 7.25 (d, J=8.4 Hz, 2H), 6.98 (t, J=9.6 Hz, 1H),
6.91 (d, J=8.4 Hz, 2H), 6.52 (dd, J=2.7, 8.7 Hz, 1H), 6.28 (m, 1H),
5.30 (br s, 2H), 5.26 (s, 2H), 3.72 (s, 3H); MS (ESI) m/z: 392.2
(M+H.sup.+).
To a solution of
5-(4-(1-(4-methoxybenzyl)-1H-pyrazol-4-yl)pyrimidin-2-yloxy)-2-fluorobenz-
enamine (50 mg, 0.13 mmol) in dichloromethane (3 mL) was added TFA
(0.3 mL) at 0.degree. C. and the reaction stirred at RT for 12 h.
The solvent was removed in vacuo, the residue was washed with ether
and treated with saturated ammonia solution. The solid was
collected via filtration and dried under vacuum to give
5-(4-(1H-pyrazol-4-yl)pyrimidin-2-yloxy)-2-fluorobenzenamine (15
mg, 43% yield). .sup.1H NMR (300 MHz, MeOD) .delta. 8.44 (d, J=5.1
Hz, 1H), 8.23 (br s, 2H), 7.40 (d, J=5.4, 1H), 7.02 (dd, J=10.8,
8.7 Hz, 1H), 6.73 (dd, J=2.7, 7.2 Hz, 1H), 6.50 (m, 1H); MS (ESI)
m/z: 272.2 (M+H.sup.+).
Example A19
2,5-Difluoro-4-nitro-phenol (1.739 g, 9.93 mmol) and
3-bromo-4-chloro-pyridine (0.637 g, 3.31 mmol) were dissolved in
chlorobenzene (6 ml) and heated at 145.degree. C. overnight. The
solvent was removed under reduced pressure and the residue
partitioned between EtOAc and 10% K.sub.2CO.sub.3 (aq). The mixture
was extracted with EtOAc (2.times.). The combined organic extracts
were washed with 10% K.sub.2CO3.sub.(aq) and brine, dried,
evaporated and purified by silica gel chromatography
(hexanes/EtOAc) to yield
3-bromo-4-(2,5-difluoro-4-nitrophenoxy)pyridine (414 mg, 38%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.84 (s, 1H),
8.51-8.45 (m, 2H), 7.82-7.78 (m, 1H), 7.22 (d, 1H); MS (ESI) m/z:
331.0 (M+H.sup.+).
3-Bromo-4-(2,5-difluoro-4-nitrophenoxy)pyridine (0.414 g, 1.25
mmol) was dissolved in EtOH (30 ml). Tin (II) chloride dihydrate
(1.129 g, 5.00 mmol) was added and the mixture was heated at
80.degree. C. for 4 h. The solvent was removed under reduced
pressure and the residue quenched with sat. NaHCO.sub.3 (aq). The
mixture was diluted with EtOAc and filtered through Celite.RTM..
The Celite bed was washed with water (2.times.) and EtOAc
(2.times.). The filtrate was extracted with EtOAc (2.times.). The
combined organic extracts were dried and evaporated to yield
4-(3-bromopyridin-4-yloxy)-2,5-difluorobenzenamine (0.42 g, 112%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.68 (s, 1H),
8.33 (d, 1H), 7.28-7.23 (m, 1H), 6.76-6.71 (m, 2H), 5.56 (br s,
2H); MS (ESI) m/z: 301.0 (M+H.sup.+).
In a sealed tube,
4-(3-bromopyridin-4-yloxy)-2,5-difluorobenzenamine (0.42 g, 1.395
mmol),
1-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole
(0.363 g, 1.744 mmol), potassium carbonate (0.578 g, 4.18 mmol),
and tetrakistriphenylphosphine palladium (0) (0.081 g, 0.070 mmol)
were suspended in dioxane (8 ml) and water (1.333 ml). The mixture
was degassed with Ar and heated at 90.degree. C. overnight. The
reaction mixture was cooled and partitioned between EtOAc and sat.
NaHCO.sub.3 (aq). The mixture was extracted with EtOAc (3.times.).
The combined organic extracts were dried, evaporated and purified
by silica gel chromatography (hexanes/EtOAc) to yield
2,5-difluoro-4-(3-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)benzenamine
(272 mg, 65% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.80 (s, 1H) 8.22-8.20 (m, 2H), 8.00 (s, 1H), 7.24-7.19 (m, 1H),
6.76-6.71 (m, 1H), 6.62 (d, 1H), 5.50 (br s, 2H), 3.78 (s, 3H); MS
(ESI) m/z: 301.0 (M+H.sup.+).
Example A20
To a solution of
4-(1-(4-methoxybenzyl)-1H-pyrazol-4-yl)-2-(methylthio)pyrimidine
from Example A18 (200 mg, 0.64 mmol) in dichloromethane was added
m-CPBA (220 mg, 1.28 mmol). The reaction was stirred for 2 hour at
RT. Water was added, the organic layer was separated and the
aqueous layer was extracted with dichloromethane. The combined
organics were washed with brine and concentrated in vacuo. The
residue was combined with 5-amino-4-fluoro-2-methylphenol (180 mg,
1.28 mmol) and K.sub.2CO.sub.3 (176 mg, 1.28 mmol) in DMF (5 mL)
and the resultant mixture was heated at 90.degree. C. overnight.
After filtration and concentration, the residue was purified by
silica gel column chromatography to give
5-(4-(1-(4-methoxybenzyl)-1H-pyrazol-4-yl)pyrimidin-2-yloxy)-2-fluoro-4-m-
ethylbenzenamine (210 mg, 84% yield). MS (ESI) m/z: 406.2
(M+H.sup.+).
A solution of
5-(4-(1-(4-methoxybenzyl)-1H-pyrazol-4-yl)pyrimidin-2-yloxy)-2-fluoro-4-m-
ethylbenzenamine (0.5 g, 1.2 mmol) in dichloromethane (20 mL) was
treated with TFA (5 mL) at 0.degree. C. The mixture was then
stirred at RT for 12 h. The solvent was removed in vacuo, the
residue was washed with ether and treated with saturated ammonia
solution. The solid was collected via filtration and dried under
vacuum to give
5-(4-(1H-pyrazol-4-yl)pyrimidin-2-yloxy)-2-fluoro-4-methylbenzenamine
(240 mg, 68%, yield). .sup.1H NMR (400 MHz, MeOD): .delta. 8.41 (d,
J=5.2 Hz, 1H), 8.21 (br s, 2H), 7.40 (d, J=5.2, 1H), 6.90 (d,
J=11.6 Hz, 1H), 6.62 (d, J=8.0 Hz, 1H), 1.99 (s, 3H). MS (ESI) m/z:
286.1 (M+H.sup.+).
Example A21
To a degassed solution of
4-(2-chloropyridin-4-yloxy)-2-fluoroaniline from Example A1 (0.801
g, 3.36 mmol) in DMF (2 mL) and TEA (2 mL) was added
ethynyltrimethylsilane (0.929 ml, 6.71 mmol),
trans-dichloro-bis(triphenyl phosphine) palladium(0) (0.236 g,
0.336 mmol) and copper (I) iodide (0.064 g, 0.336 mmol) and the
mixture was stirred at 90.degree. C. for 16 h. Water (60 ml) was
added to the mixture, product was extracted with EtOAc (2.times.45
ml) and the combined organics were washed with brine, dried
(Na.sub.2SO.sub.4) and concentrated to afford crude product. The
product was dissolved in methanol (10 ml), K.sub.2CO.sub.3 (0.5 g)
was added and the mixture was stirred at RT for 2 h. Solvent was
removed, water (60 mL) and EtOAc (40 ml) were added, the layers
were separated and the aqueous layer was extracted with EtOAc
(1.times.30 mL). The combined organic layer was washed with brine,
dried (Na.sub.2SO.sub.4), concentrated and purified by column
chromatography (ethylacetate/hexanes) to afford
4-(2-ethynylpyridin-4-yloxy)-2-fluorobenzenamine as a thick residue
(0.56 g, 73% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.37 (d, J=6.0 Hz, 1H), 6.98 (dd, J=8.0 Hz, 2.4 Hz, 1H), 6.95 (d,
J=6.0 Hz, 1H), 6.87 (dd, J=6.0 Hz, 2.4 Hz, 1H), 6.81-6.73 (m, 2H),
5.20 (brs, 2H), 4.03 (s, 1H); MS (ESI) m/z: 229.1 (M+H.sup.+).
Acetaldoxime (0.078 g, 1.321 mmol) and triethylamine (0.246 ml,
1.761 mmol) were added to a solution of
4-(2-ethynylpyridin-4-yloxy)-2-fluorobenzenamine (0.201 g, 0.881
mmol) in THF (4 mL) in a microwave reaction vial. To this solution
was added 1-chloropyrrolidine-2,5-dione (0.176 g, 1.32 mmol) and
the mixture was stirred at 130.degree. C. for 45 min under
microwave irradiation. An additional 1.5 eq each of acetaldoxime
and 1-chloropyrrolidine-2,5-dione were added and the reaction
heated for an additional 45 min at 130.degree. C. This process was
repeated one more time. The mixture was poured into a biphasic
solution of water (40 mL) and EtOAc (30 mL). The organic layer was
separated and the aqueous layer was extracted with EtOAc
(2.times.20 ml). The combined organics were washed with brine,
dried (Na.sub.2SO.sub.4), concentrated in vacuo and purified by
column chromatography (EtOAc-hexanes) to afford
2-fluoro-4-(2-(3-methylisoxazol-5-yl)pyridin-4-yloxy)benzenamine
(58 mg, 23% yield) as light red colored residue. MS (ESI) m/z:
286.1 (M+H.sup.+).
Example A22
Using a procedure analogous to Example A1,
5-amino-2-hydroxypyridine (10.15 g, 92 mmol) and
2,4-dichloropyridine (13.64 g, 92 mmol) were combined to provide
6-(2-chloropyridin-4-yloxy)pyridin-3-amine (7.09 g, 35% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.12 (m, 1H), 7.61 (m,
1H), 7.26 (m, 1H), 7.0 (s, 1H), 6.97-6.94 (m, 2H), 5.4 (brs, 2H);
MS (ESI) m/z: 222.0 (M+H.sup.+).
Using a procedure analogous to Example A13,
6-(2-chloropyridin-4-yloxy)pyridin-3-amine (6.06 g, 27.3 mmol) and
1-methyl-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole
(8.53 g, 41.0 mmol) were combined to provide
6-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pyridin-3-amine
(4.67 g, 64% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.3 (m, 1H), 8.2 (s, 1H), 7.98 (s, 1H), 7.65 (s, 1H), 7.3 (s, 1H),
7.25-7.2 (m, 1H), 6.85-6.81 (m, 1H), 6.6-6.55 (m, 1H), 5.3 (s, 2H),
3.8 (s, 3H); MS (ESI) m/z: 268.1 (M+H.sup.+).
Example A23
Sodium azide (1.942 g, 29.9 mmol) was added to a suspension of
chloromethyl pivalate (3.00 g, 19.92 mmol) in water (5 mL) and
stirred vigorously at 90.degree. C. for 16 h. The reaction mixture
was diluted with water (20 mL) and EtOAc (20 ml). The organic layer
was washed with brine, dried (Na.sub.2SO.sub.4) and concentrated to
afford azidomethyl pivalate as a liquid (2 g, 64% yield). .sup.1H
NMR (400 MHz, Acetone-d.sub.6): .delta. 5.23 (s, 2H), 1.22 (s,
9H).
To a suspension of azidomethyl pivalate (0.075 g, 0.477 mmol),
4-(2-ethynylpyridin-4-yloxy)-2-fluorobenzenamine from Example A21
(0.109 g, 0.477 mmol) in t-butanol (0.6 mL) and water (0.6 mL) was
added sodium ascorbate (0.021 g, 0.095 mmol). Copper(II)sulfate in
water (0.048 ml, 0.048 mmol) was added to the above suspension and
the dark red mixture was stirred for 3 h at RT. It was diluted with
water (30 mL) and EtOAc (20 mL), the layers were separated and the
aqueous layer was extracted with EtOAc (2.times.15 mL). The
combined organics were washed with brine, dried (Na.sub.2SO.sub.4)
and concentrated to afford
(4-(4-(4-amino-3-fluorophenoxy)pyridin-2-yl)-1H-1,2,3-triazol-1-yl)methyl
pivalate as a red solid. (0.165 g, 90% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 8.54 (s, 1H), 8.46 (brs, 1H), 7.60 (s,
1H), 6.98 (d, J=8.8 Hz, 1H), 6.94 (d, J=3.6 Hz, 1H), 6.83-6.81 (m,
2H), 6.42 (s, 2H), 4.78 (s, 2H), 1.17 (s, 9H); MS (ESI) m/z: 386.1
(M+H.sup.+).
Example B1
A solution of 1,1-cyclopropanedicarboxylic acid (3.07 g, 23.60
mmol) in THF (40 mL) was cooled to 0.degree. C. and treated with
Et.sub.3N (3.30 mL, 23.7 mmol) and thionyl chloride (1.72 mL, 23.6
mmol). The resultant reaction mixture was stirred 30 min at
0.degree. C. 4-Fluoroaniline (2.30 mL, 23.9 mmol) was added and the
reaction mixture was allowed to slowly warm to RT overnight. The
slurry was diluted with EtOAc (200 mL) and was extracted into 1 N
aq NaOH (3.times.60 mL). The aqueous portion was washed with ether
(50 mL) and acidified to pH 1-2 with 6 N aq HCl. The resulting
precipitate was collected by filtration and washed with water. The
remaining solids were dissolved in a mixture of acetonitrile-MeOH
and the solution was concentrated in vacuo until precipitation
began. Complete dissolution was affected by warming to 70.degree.
C. The resultant solution was allowed to cool to RT overnight to
provide large crystals. The crystals were isolated by filtration,
washed with acetonitrile and dried in vacuo to provide
1-((4-fluorophenyl)carbamoyl)cyclopropanecarboxylic acid (1.76 g).
The mother liquors were concentrated to initiate a second
crystallization, which provided an additional crop of
1-((4-fluorophenyl)carbamoyl)cyclopropanecarboxylic acid (1.39 g,
60% yield overall). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
13.06 (s, 1H), 10.55 (s, 1H), 7.60 (m, 2H), 7.12 (m, 2H), 1.39 (s,
4H); MS (ESI) m/z: 224.1 (M+H.sup.+).
Example B2
A solution of 1,1-cyclopropanecarboxylic acid (0.23 g, 1.74 mmol)
in THF (5 mL) was cooled to 0.degree. C. and treated with
triethylamine (0.48 ml, 3.47 mmol) and thionyl chloride (0.13 ml,
1.74 mmol). The reaction mixture was stirred 30 min at 0.degree. C.
A solution of Example A3 (0.5 g, 1.65 mmol) in THF (5 mL) was
added. The reaction mixture was stirred at 0.degree. C. for 1 h and
then stirred overnight at RT. The reaction mixture was treated with
1 M HCl, and then EtOAc was added. The resultant precipitate was
collected by filtration, washed with EtOAc, and dried under vacuum
to obtain
1-((2,3-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)ca-
rbamoyl)cyclopropanecarboxylic acid (60% purity, 0.6 g, 53% yield).
MS (ESI) m/z: 415.1 (M+H.sup.+). This material was used without
further purification.
Example B3
To a stirring solution of 1,1-cyclopropanedicarboxylic acid (0.178
g, 1.367 mmol) in THF (4 ml) at 0.degree. C. was added Et.sub.3N
(0.190 ml, 1.367 mmol) followed by thionyl chloride (0.099 ml,
1.367 mmol). The reaction was stirred at 0.degree. C. for 30 min.
Example A2 (0.370 g, 1.301 mmol), DMF (4.00 ml) and Et.sub.3N
(0.380 ml, 2.73 mmol) were added and the reaction was stirred
overnight with warming to RT. The reaction was quenched with 1M HCl
(4 ml) and stirred for 15 min. The pH was adjusted back to 7 with
50% NaOH and the mixture extracted with EtOAc (3.times.). The
combined organics were washed with H.sub.2O (1.times.) and brine
(2.times.), dried (MgSO.sub.4), and evaporated to afford a solid.
The crude solid was triturated with CH.sub.2Cl.sub.2/hexanes. The
remaining solids were collected by filtration, rinsed with hexanes
and dried in vacuo to afford
1-((3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)carbam-
oyl)cyclopropanecarboxylic acid (0.199 g, 39% yield) as
cream-colored solid which was used without further purification.
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.76 (s, 1H), 8.3 (d,
J=5.7 Hz, 1H), 8.26 (s, 1H), 7.96 (s, 1H), 7.84 (dd, J=2.4, 13 Hz,
1H), 7.44-7.43 (m, 1H), 7.42-7.41 (m, 1H), 7.33 (s, 1H), 6.66-6.64
(m, 1H), 3.84 (s, 3H), 1.39 (s, 4H); MS (ESI) m/z: 397.1
(M+H.sup.+).
Example B4
Thionyl chloride (1.09 mL, 15.0 mmol) was added slowly over 2 min
to a stirring solution of 1,1-cyclopropanedicarboxylic acid (1.95
g, 15.0 mmol) and Et.sub.3N (4.29 g, 42.4 mmol) in THF (15 mL) at
0.degree. C. After complete addition, the reaction was further
diluted with THF (25 mL) and the reaction was stirred vigorously at
0.degree. C. for 30 min. The hydrochloride salt of Example A1 (4.00
g, 12.5 mmol) was added in three portions and the resulting mixture
was allowed to slowly warm to RT over 4 h. The reaction mixture was
concentrated to dryness in vacuo and the residue was digested with
aqueous MeOH. The remaining solids were collected by filtration.
This solid was dissolved in 1 M aq NaOH (30 mL) and methanol. The
methanol was removed in vacuo, the remaining aqueous phase was
diluted with water to a volume of 150 mL and extracted with EtOAc
(3.times.50 mL). The combined EtOAc extracts were washed with sat
aq NaHCO.sub.3. The combined aqueous was acidified to pH 6 with 0.5
M HCl. The resultant fine precipitate was collected by filtration,
washed with acetonitrile (20 mL) and dried in vacuo to provide
1-((2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)carbam-
oyl)cyclopropanecarboxylic acid (1.177 g). The remaining aqueous
was concentrated in vacuo to about 1/3 volume and the pH was
reduced to pH 5 with 1 M aq HCl. The additional precipitate that
formed was collected by filtration, washed with acetonitrile and
dried in vacuo to provide an additional crop (1.34 g) of
1-((2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)carbam-
oyl)cyclopropanecarboxylic acid (2.517 g total, 51% yield). .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .delta. 13.51 (br s, 1H), 11.30 (s,
1H), 8.37 (d, J=5.7 Hz, 1H), 8.25 (s, 1H), 8.19 (t, J=9.0 Hz, 1H),
7.95 (s, 1H), 7.28 (dd, J=11.6, 2.7 Hz, 1H), 7.22 (d, J=1.6 Hz,
1H), 7.01 (m, 1H), 6.69 (dd, J=5.6, 2.3 Hz, 1H), 3.84 (s, 3H),
1.58-1.51 (m, 4H); MS (ESI) m/z: 397.1 (M+H.sup.+).
Example B5
To a solution of Example A12 (9.66 g, 32.0 mmol) in DMF (100 mL)
were added cyclopropane-1,1-dicarboxylic acid monomethyl ester
(6.91 g, 47.9 mmol), TBTU (15.39 g, 47.9 mmol) and DIPEA (27.9 mL,
160 mmol). The sides of the flask were rinsed with DMF (10 mL) and
the resultant reaction mixture was stirred at RT overnight. The
solvent was removed under high vacuum and the residue was dissolved
in EtOAc (600 mL). The organic phase was washed with water (100
mL), sat. aq. NaHCO.sub.3 (200 mL) and brine (50 mL), dried
(MgSO.sub.4), and was concentrated in vacuo and purified by silica
gel chromatography (CH.sub.2Cl.sub.2--MeOH) to provide methyl
1-((2,5-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)ca-
rbamoyl)cyclopropanecarboxylate (10.1 g, 69% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 10.94 (s, 1H), 8.39 (d, J=5.7 Hz,
1H), 8.29 (s, 1H), 8.19 (dd, J=12.2, 7.2 Hz, 1H), 7.99 (s, 1H),
7.59 (dd, J=11.0, 7.4 Hz, 1H), 7.26 (d, J=2.6 Hz, 1H), 6.73 (dd,
J=5.6, 2.5 Hz, 1H), 3.86 (s, 3H), 3.70 (s, 3H), 1.61-1.54 (m, 4H);
MS (ESI): m/z 429.1 [M+1].sup.+.
To a suspension of methyl
1-((2,5-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)ca-
rbamoyl)cyclopropanecarboxylate (5.8 g, 13.54 mmol) in THF (100 mL)
were added water (50.0 mL) and lithium hydroxide monohydrate (2.84
g, 67.7 mmol). The reaction mixture was stirred at RT for 40
minutes. The layers were separated and the organic phase washed
with brine (50 mL), dried (MgSO.sub.4) and concentrated to dryness
to afford lithium
1-((2,5-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)ca-
rbamoyl)cyclopropanecarboxylate (5.11 g, 86% yield) as an off-white
foam. MS (ESI): m/z 415.1 [M+1].sup.+.
Example 1
Example B1 (0.060 g, 0.269 mmol), Example A3 (0.060 g, 0.198 mmol),
TBTU (0.129 g, 0.403 mmol) and i-Pr.sub.2NEt (0.089 ml, 0.538 mmol)
were combined in DMF (2 mL). The resultant mixture was stirred
overnight at RT. An additional portion of Example B1 (60 mg), TBTU
(120 mg) and i-Pr.sub.2NEt (0.080 mL) was added and the mixture was
stirred an additional 24 h. The reaction mixture was partitioned
between water and EtOAc. The organic layer was washed with 5% aq
LiCl, dried (MgSO.sub.4), concentrated in vacuo and purified by
chromatography on silica gel and reverse-phase silica gel to
provide
N-(2,3-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-
-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide (21 mg, 15% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.82 (s, 1H), 9.89
(s, 1H), 8.38 (d, J=5.5 Hz, 1H), 8.27 (s, 1H), 7.97 (s, 1H), 7.76
(m, 1H), 7.61-7.57 (m, 2H), 7.29 (d, J=2.5 Hz, 1H), 7.22-7.13 (m,
3H), 6.71 (m, 1H), 3.84 (s, 3H), 1.61 (m, 2H), 1.55 (m, 2H); MS
(ESI) m/z: 508.1 (M+H.sup.+).
Example 2
Example B1 (51 mg, 0.229 mmol), Example A2 (50 mg, 0.176 mmol),
TBTU (85 mg, 0.264 mmol) and DIEA (35 .mu.l, 0.212 mmol) were
combined in DMF (1 mL) and stirred overnight at RT. The reaction
mixture was diluted with EtOAc (20 mL) and washed with water, satd
aq NaHCO.sub.3, and brine. The organics were dried (MgSO.sub.4),
concentrated in vacuo and was purified via silica gel
chromatography to provide
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(4--
fluorophenyl)cyclopropane-1,1-dicarboxamide (65 mg, 76% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.35 (s, 1H), 9.97
(s, 1H), 8.35 (d, J=5.7 Hz, 1H), 8.25 (s, 1H), 7.95 (s, 1H), 7.85
(dd, J=13.2, 2.2 Hz, 1H), 7.64-7.60 (m, 2H), 7.46 (m, 1H), 7.32 (t,
J=9.0 Hz, 1H), 7.22 (d, J=2.5 Hz, 1H), 7.12 (m, 2H), 6.60 (dd,
J=5.7, 2.4 Hz, 1H), 3.84 (s, 3H), 1.46 (m, 2H), 1.43 (m, 2H); MS
(ESI) m/z: 490.1 (M+H.sup.+).
Example 3
Example B2 (60% purity, 0.15 g, 0.22 mmol), benzylamine (0.036 ml,
0.326 mmol), EDC (0.062 g, 0.326 mmol), HOBT (0.050 g, 0.326 mmol)
and Et.sub.3N (0.091 ml, 0.652 mmol) were combined in DMF (2.5 ml)
and stirred at RT. Additional benzyl amine (10 mg) was added and
then the reaction was stirred overnight at RT. The completed
reaction was poured into water and extracted with EtOAc (3.times.).
The combined organic layers were washed with NaHCO.sub.3, LiCl,
brine, dried (Na.sub.2SO.sub.4) and purified by silica gel column
chromatography (EtOAc/hexane.fwdarw.MeOH/CH.sub.2Cl.sub.2) to
obtain
N-benzyl-N'-(2,3-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)-
phenyl)cyclopropane-1,1-dicarboxamide (22 mg, 20% yield) following
lyophilzation. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 11.9
(s, 1H), 8.45 (t, J=5.6 Hz, 1H), 8.38 (m, 1H), 8.26 (s, 1H), 7.96
(m, 2H), 7.1-7.4 (m, 7H), 6.73 (dd, J=5.2, 2.4 Hz, 1H), 4.32 (d,
J=5.6 Hz, 2H), 3.84 (s, 3H), 1.55 (s, 4H); MS (ESI) m/z: 504.1
(M+H.sup.+).
Example 4
Benzylamine (0.017 ml, 0.151 mmol), Example B3 (0.040 g, 0.101
mmol) and i-Pr.sub.2NEt (0.025 ml, 0.151 mmol) were combined in DMF
(0.4 mL). TBTU (0.049 g, 0.151 mmol) was added and the mixture was
stirred at RT overnight. The completed reaction was diluted with
EtOAc (30 mL), washed with H.sub.2O (15 mL), 5% citric acid (15 mL)
and saturated brine, dried (MgSO.sub.4), concentrated in vacuo and
purified by chromatography to afford
N-benzyl-N'-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-ylo-
xy)phenyl)cyclopropane-1,1-dicarboxamide (0.028 g, 57% yield). It
was converted to the corresponding HCl salt by reacting with HCl
(4.0 M HCl in dioxane, 1.0 eq.). .sup.1H NMR (DMSO-d.sub.6):
.delta. 10.97 (s, 1H), 8.55-8.44 (m, 3H), 8.23 (s, 1H), 7.90 (dd,
J=13.6, 1.6 Hz, 1H), 7.59 (s, 1H), 7.50-7.38 (m, 2H), 7.31-7.19 (m,
5H), 6.98 (s, 1H), 4.31 (d, J=6.0 Hz, 2H), 3.89 (s, 3H), 1.40-1.39
(m, 4H); MS (ESI) m/z: 486.2 (M+H.sup.+).
Example 5
Using a procedure analogous to Example 4, aniline (0.015 ml, 0.159
mmol) and Example B3 (0.042 g, 0.106 mmol) were combined to provide
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-phe-
nylcyclopropane-1,1-dicarboxamide (0.040 g, 79% yield) as a light
yellow oil. It was converted to the corresponding HCl salt by
reacting with HCl (4.0 M HCl in dioxane, 1.0 eq.). .sup.1H NMR
(DMSO-d.sub.6): .delta. 10.43 (s, 1H), 9.96 (s, 1H), 8.52-8.49 (m,
2H), 8.21 (s, 1H), 7.92 (d, J=11.2 Hz, 1H), 7.64-7.52 (m, 4H), 7.42
(t, J=8.8 Hz, 1H), 7.34-7.30 (m, 2H), 7.08 (t, J=6.8 Hz, 1H), 6.95
(s, 1H), 3.91 (s, 3H), 1.50-1.44 (m, 4H); MS (ESI) m/z: 472.1
(M+H.sup.+).
Example 6
Using a procedure analogous to Example 4, Example B3 (0.042 g,
0.106 mmol) and 3-aminobenzotrifluoride (0.020 ml, 0.159 mmol) were
combined to provide
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl-
)-N'-(3-(trifluoromethyl)phenyl)cyclopropane-1,1-dicarboxamide
(0.018 g, 32% yield) as a light yellow oil. It was converted to the
corresponding HCl salt by reacting with HCl (4.0 M HCl in dioxane,
1.0 eq.). .sup.1H NMR (DMSO-d.sub.6): .delta. 10.39 (s, 1H), 10.28
(s, 1H), 8.52-8.46 (m, 2H), 8.18 (s, 1H), 8.15 (s, 1H), 7.58-7.49
(m, 3H), 7.44-7.38 (m, 2H), 6.93 (s, 1H), 3.91 (s, 3H), 1.50-1.42
(m, 4H); MS (ESI) m/z: 540.1 (M+H.sup.+).
Example 7
Example B4 (1.19 g, 3.00 mmol), 4-fluoroaniline (0.367 g, 3.30
mmol), and DIEA (0.54 ml, 3.27 mmol) were combined in DMF (10.5
mL). TBTU (1.25 g, 3.89 mmol) was added and the resultant solution
was stirred at RT. After 36 h, the reaction mixture was diluted
with EtOAc (150 mL) and washed with water (50 mL), brine
(2.times.50 mL), satd sodium bicarbonate solution (2.times.50 mL)
and brine (50 mL). The combined aqueous phases were back extracted
with EtOAc (50 mL). The combined organics were dried
(Na.sub.2SO.sub.4) and concentrated to a viscous oil. The residue
was completely dissolved in acetonitrile (15 mL) and the solution
was sonicated until precipitation occurred. The fine suspension was
allowed to stand overnight, and collected by filtration, washed
with acetonitrile (25 mL), and dried in vacuo to provide
N-(2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(4--
fluorophenyl)cyclopropane-1,1-dicarboxamide (1.258 g). The filtrate
was concentrated to about a 3 mL volume to afford a second crop
(0.106 g, 92% total yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 10.62 (s, 1H), 9.91 (s, 1H), 8.38 (d, J=4.9 Hz, 1H), 8.25
(s, 1H), 7.96-7.90 (m, 2H), 7.60-7.56 (m, 2H), 7.26-7.23 (m, 2H),
7.15 (m, 2H), 7.01 (m, 1H), 6.67 (m, 1H), 3.84 (s, 3H), 1.60 (m,
2H), 1.54 (m, 2H); MS (ESI) m/z: 490.2 (M+H.sup.+).
Example 8
4-Methoxyaniline (0.020 g, 0.159 mmol) and Example B3 (0.042 g,
0.106 mmol) were combined using a procedure analogous to Example 4
to provide
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(4--
methoxyphenyl)cyclopropane-1,1-dicarboxamide (0.019 g, 36% yield).
.sup.1H NMR (DMSO-d.sub.6): .delta. 10.41 (s, 1H), 9.76 (s, 1H),
8.35 (dd, J=6.0, 1.2 Hz, 1H), 8.24 (s, 1H), 7.95 (s, 1H), 7.85 (d,
J=13.2 Hz, 1H), 7.50-7.44 (m, 3H), 7.32 (t, J=8.8 Hz, 1H), 7.22 (s,
1H), 6.86 (dd, J=9.2, 1.6 Hz, 2H), 6.60 (m, 1H), 3.84 (s, 3H), 3.70
(s, 3H), 1.50-1.42 (m, 4H); MS (ESI) m/z: 502.1 (M+H.sup.+).
Example 9
m-Anisidine (0.020 g, 0.159 mmol) and Example B3 (0.042 g, 0.106
mmol) were combined using a procedure analogous to Example 4 to
provide
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(3--
methoxyphenyl)cyclopropane-1,1-dicarboxamide (0.031 g, 58% yield)
as a colorless oil. It was converted to the corresponding HCl salt
by reacting with HCl (4.0 M HCl in dioxane, 1.0 eq.). .sup.1H NMR
(DMSO-d.sub.6): .delta. 10.42 (s, 1H), 9.92 (s, 1H), 8.68 (d, J=2.4
Hz, 1H), 8.60 (d, J=6.8 Hz, 1H), 8.34 (d, J=3.6 Hz, 1H), 7.93 (dd,
J=12.8, 1.6 Hz, 1H), 7.80 (d, J=2.8 Hz, 1H), 7.55-7.52 (m, 1H),
7.44 (t, J=8.8 Hz, 1H), 7.31 (s, 1H), 7.20-7.16 (m, 3H), 6.63 (m,
1H), 3.92 (s, 3H), 3.70 (s, 3H), 1.50-1.41 (m, 4H); MS (ESI) m/z:
502.2 (M+H.sup.+).
Example 10
3-Fluoroaniline (0.018 g, 0.159 mmol) and Example B3 (0.042 g,
0.106 mmol) were combined using a procedure analogous to Example 4
to provide
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(3--
fluorophenyl)cyclopropane-1,1-dicarboxamide (0.022 g, 42% yield).
.sup.1H NMR (DMSO-d.sub.6): .delta. 10.27 (s, 1H), 10.17 (s, 1H),
8.35 (d, J=5.6 Hz, 1H), 8.25 (s, 1H), 7.95 (s, 1H), 7.84 (dd,
J=13.2, 2.4 Hz, 1H), 7.62 (d, J=12.0 Hz, 1H), 7.46 (d, J=8.8, 1.6
Hz, 1H), 7.38-7.29 (m, 3H), 7.22 (d, J=2.0 Hz, 1H), 6.89 (t, J=8.0
Hz, 1H), 6.60 (dd, J=5.6, 2.0 Hz, 1H), 3.84 (s, 3H), 1.47-1.42 (m,
4H); MS (ESI) m/z: 490.1 (M+H.sup.+).
Example 11
Example B1 (53 mg, 0.237 mmol), Example A4 (51 mg, 0.182 mmol),
TBTU (88 mg, 0.273 mmol) and i-Pr.sub.2NEt (0.045 mL, 0.272 mmol)
were combined in DMF (1 mL) using a procedure analogous to Example
2 to afford
N-(4-fluorophenyl)-N'-(3-methyl-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4--
yloxy)phenyl)cyclopropane-1,1-dicarboxamide (70 mg, 80% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.12 (s, 1H), 10.00
(s, 1H), 8.31 (d, J=6.0 Hz, 1H), 8.22 (s, 1H), 7.92 (s, 1H),
7.64-7.60 (m, 3H), 7.54 (m, 1H), 7.16-7.11 (m, 3H), 7.04 (d, J=8.8
Hz, 1H), 6.46 (dd, J=5.6, 2.4 Hz, 1H), 3.84 (s, 3H), 2.08 (s, 3H),
1.45 (m, 4H); MS (ESI) m/z: 486.2 (M+H.sup.+).
Example 12
A solution of 2-(4-fluorophenyl)acetyl chloride (0.173 g, 1.0 mmol)
in dry ether (1.0 mL) was slowly added to a suspension of silver
cyanate (0.180 g, 1.2 mmol) in ether (1.5 mL). The mixture was
subsequently refluxed for 2 h under N.sub.2. After filtration of
the silver salts, solvent was removed under reduced pressure and
the residue was dissolved in CH.sub.2Cl.sub.2 (4.0 mL).
A portion of the above solution (0.179 g, 1.0 mmol) and Example A2
(0.071 g, 0.25 mmol) were combined in CH.sub.2Cl.sub.2 (2.0 mL).
After stirring at RT overnight, the reaction was concentrated in
vacuo and purified by chromatography to afford
1-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-3-(2-(-
4-fluorophenyl)acetyl)urea (0.020 g, 17% yield) as a white solid.
.sup.1H NMR (DMSO-d.sub.6): .delta. 11.03 (s, 1H), 10.57 (s, 1H),
8.35 (d, J=5.6 Hz, 1H), 8.24 (s, 1H), 7.95 (s, 1H), 7.76 (dd,
J=12.8, 2.4 Hz, 1H), 7.37-7.32 (m, 4H), 7.20-7.13 (m, 3H), 6.61
(dd, J=5.6, 2.4 Hz, 1H), 3.84 (s, 3H), 3.73 (s, 2H); MS (ESI) m/z:
464.1 (M+H.sup.+).
Example 13
To a solution of 4-aminopyridine (0.019 g, 0.202 mmol) in
CH.sub.2Cl.sub.2 (5 ml) was added Example B3 (0.040 g, 0.101 mmol),
TBTU (0.039 g, 0.151 mmol) and triethylamine (0.020 g, 0.202 mmol).
The reaction mixture was stirred at RT for 13 hours, washed with
water, the organic layer was concentrated and purified by
chromatography (THF/acetonitrile) to provide
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(py-
ridin-4-yl)cyclopropane-1,1-dicarboxamide (0.032 g, 67% yield) as a
white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.45 (s,
1H), 10.25 (s, 1H), 8.42 (d, J=6 Hz, 2H), 8.35 (d, J=6 Hz, 1H),
8.25 (s, 1H), 7.95 (s, 1H), 7.82 (m, 1H), 7.65 (d, J=6 Hz, 2H),
7.44 (m, 1H), 7.32 (m, 1H), 7.20 (d, J=2.4 Hz, 1H), 6.60 (m, 1H),
3.85 (s, 3H), 1.47 (s, 4H); MS (ESI) m/z: 473.1 (M+H.sup.+).
Example 14
Using a procedure analogous to Example 13, 3-aminopyridine (0.019
g, 0.202 mmol), Example B3 (0.040 g, 0.101 mmol), TBTU (0.039 g,
0.151 mmol) and triethylamine (0.020 g, 0.202 mmol) were combined
in CH.sub.2Cl.sub.2 (5 ml) to provide
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(py-
ridin-3-yl)cyclopropane-1,1-dicarboxamide (0.032 g, 67% yield) as a
white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.36 (s,
1H), 10.16 (s, 1H), 8.78 (d, J=2.5 Hz, 1H), 8.35 (d, J=6 Hz, 1H),
8.25 (m, 2H), 8.00 (m, 1H), 7.94 (s, 1H), 7.84 (m, 1H), 7.44 (m,
1H), 7.33 (m, 2H), 7.22 (d, J=2.5 Hz, 1H), 6.60 (m, 1H), 3.85 (s,
3H), 1.47 (s, 4H); MS (ESI) m/z: 473.1 (M+H.sup.+).
Example 15
To a solution of 3-chlorobenzylamine (0.029 g, 0.202 mmol) in
CH.sub.2Cl.sub.2 (3 ml) was added Example B3 (0.040 g, 0.101 mmol),
TBTU (0.039 g, 0.151 mmol) and triethylamine (0.020 g, 0.202 mmol).
The reaction mixture was stirred at RT for 13 hours. The reaction
mixture was washed with saturated NaHCO.sub.3 and brine, dried and
the solvent evaporated to provide
N-(3-chlorobenzyl)-N'-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4--
yloxy)phenyl)cyclopropane-1,1-dicarboxamide (0.036 g, 69% yield) as
a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.80
(s, 1H), 8.49 (m, 2H), 8.35 (d, J=6 Hz, 1H), 8.25 (s, 1H), 7.95 (s,
1H), 7.82 (m, 2H), 7.55-7.18 (m, 5H), 6.60 (m, 1H), 4.31 (d, J=6
Hz, 2H), 3.85 (s, 3H), 1.38 (s, 4H); MS (ESI) m/z: 520.2
(M+H.sup.+).
Example 16
To a solution of (S)-(-)-alpha-methylbenzylamine (0.024 g, 0.202
mmol) in CH.sub.2Cl.sub.2 (3 ml) was added Example B3 (0.040 g,
0.101 mmol), TBTU (0.039 g, 0.151 mmol) and triethylamine (10.21
mg, 0.101 mmol). The reaction mixture was stirred at RT for 13
hours. The reaction mixture was washed with saturated NaHCO.sub.3
and brine, dried, concentrated in vacuo and recrystalled
(acetonitrile) to provide
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-((S-
)-1-phenylethyl)cyclopropane-1,1-dicarboxamide (0.04 g, 79% yield)
as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
10.72 (s, 1H), 8.34 (d, J=5.5 Hz, 1H), 8.31 (d, J=8 Hz, 1H), 8.25
(s, 1H), 7.95 (s, 1H), 7.82 (m, 1H), 7.42 (m, 1H), 7.29 (m, 5H),
7.19 (m, 2H), 6.60 (m, 1H), 4.99 (m, 1H), 3.85 (s, 3H), 1.40 (m,
7H); MS (ESI) m/z: 500.2 (M+H.sup.+).
Example 17
Using a procedure analogous to Example 16,
(R)-(+)-alpha-methylbenzylamine (0.024 g, 0.202 mmol), Example B3
(0.040 g, 0.101 mmol), TBTU (0.039 g, 0.151 mmol) and triethylamine
(0.020 g, 0.202 mmol) were combined in CH.sub.2Cl.sub.2 (3 ml) and
the crude material was recrystallized (methanol) to provide
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-((R-
)-1-phenylethyl)cyclopropane-1,1-dicarboxamide (0.040 g, 79% yield)
as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
10.72 (s, 1H), 8.34 (d, J=5.5 Hz, 1H), 8.31 (d, J=8 Hz, 1H), 8.25
(s, 1H), 7.95 (s, 1H), 7.82 (m, 1H), 7.42 (m, 1H), 7.29 (m, 5H),
7.19 (m, 2H), 6.60 (m, 1H), 4.99 (m, 1H), 3.85 (s, 3H), 1.40 (m,
7H); MS (ESI) m/z: 500.1 (M+H.sup.+).
Example 18
To a solution of 4-fluorobenzylamine (0.019 g, 0.151 mmol) in
CH.sub.2Cl.sub.2 was added Example B3 (0.030 g, 0.076 mmol), TBTU
(0.039 g, 0.151 mmol) and triethylamine (0.015 g, 0.151 mmol). The
reaction mixture was stirred at RT for 3 hours. The reaction
mixture was washed with saturated sodium bicarbonate and brine,
dried, concentrated in vacuo and the residue was recrystallized
(methanol) to provide
N-(4-fluorobenzyl)-N'-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4--
yloxy)phenyl)cyclopropane-1,1-dicarboxamide (0.025 g, 66% yield) as
a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.83
(s, 1H), 8.40 (t, J=5.5 Hz, 1H), 8.34 (d, J=5.5 Hz, 1H), 8.25 (s,
1H), 7.95 (s, 1H), 7.82 (m, 1H), 7.43 (m, 1H), 7.30 (m, 3H), 7.20
(d, J=2.5 Hz, 1H), 7.12 (m, 2H), 6.59 (m, 1H), 4.32 (d, J=6 Hz,
2H), 3.85 (s, 3H), 1.40 (s, 4H); MS (ESI) m/z: 504.1
(M+H.sup.+).
Example 19
Example 31 (0.061 g, 0.128 mmol), K.sub.2CO.sub.3 (0.053 g, 0.385
mmol) and iodoethane (0.060 g, 0.385 mmol) were combined in DMSO (1
mL) and the mixture was stirred at RT for 24 h. The reaction
mixture was poured into EtOAc (20 mL) and water (30 mL). The layers
were separated and the aqueous layer was extracted with EtOAc (15
mL). The combined organics were washed with brine, dried
(Na.sub.2SO.sub.4), concentrated and purified by silica gel
chromatography (EtOAc-hexanes) to afford
N-(4-(2-(1-ethyl-1H-pyrazol-4-yl)pyridin-4-yloxy)-3-fluorophenyl)-N'-(4-f-
luorophenyl)cyclopropane-1,1-dicarboxamide (37 mg; 57% yield) as a
white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.35 (s,
1H), 9.97 (s, 1H), 8.35 (d, J=6.0 Hz, 1H), 8.23 (s, 1H), 7.96 (s,
1H), 7.85 (dd, J=13.2 Hz, 2.0 Hz, 1H), 7.63-7.60 (m, 2H), 7.45 (dd,
J=8.8 Hz, 1.6 Hz, 1H), 7.31 (t, J=8.8 Hz, 1H), 7.23 (d, J=2.0 Hz,
1H), 7.15-7.11 (m, 2H), 6.59 (dd, J=5.6 Hz, 2.4 Hz, 1H), 4.13 (q,
J=7.2 Hz, 2H), 1.45-1.42 (m, 4H), 1.37 (t, J=7.2 Hz, 3H); MS (ESI)
m/z: 504.1 (M+H.sup.+).
Example 20
Using a procedure analogous to Example 19, Example 31 (0.061 g,
0.128 mmol), K.sub.2CO.sub.3 (0.053 g, 0.385 mmol) and
1-iodopropane (0.11 g, 0.64 mmol) were combined to afford
N-(3-fluoro-4-(2-(1-propyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(4--
fluorophenyl)cyclopropane-1,1-dicarboxamide as a white solid. (51
mg, 77% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.35
(s, 1H), 9.97 (s, 1H), 8.35 (d, J=5.6 Hz, 1H), 8.28 (s, 1H), 7.96
(s, 1H), 7.84 (dd, J=13.2 Hz, 2.0 Hz, 1H), 7.63-7.60 (m, 2H), 7.46
(dd, J=8.8 Hz, 1.2 Hz, 1H), 7.31 (t, J=8.8 Hz, 1H), 7.23 (d, J=2.0
Hz, 1H), 7.15-7.11 (m, 2H), 6.59 (dd, J=5.6 Hz, 2.4 Hz, 1H), 4.06
(t, J=6.8 Hz, 2H), 1.82-1.73 (m, 2H), 1.47-1.41 (m, 4H), 0.80 (t,
J=7.2 Hz, 3H); MS (ESI) m/z: 518.2 (M+H.sup.+).
Example 21
Using a procedure analogous to Example 19, Example 31 (0.091 g,
0.19 mmol), K.sub.2CO.sub.3 (0.08 g, 0.57 mmol) and ethyl
2-bromoacetate (0.16 g, 0.96 mmol) were combined to afford
N-(3-fluoro-4-(2-(1-(1-ethoxy2-acetyl)-1H-pyrazol-4-yl)pyridin-4-yloxy)ph-
enyl)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide (97 mg, 90%
yield) as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 10.35 (s, 1H), 9.97 (s, 1H), 8.37 (d, J=5.6 Hz, 1H), 8.29
(s, 1H), 8.02 (s, 1H), 7.85 (dd, J=13.2 Hz, 2.0 Hz, 1H), 7.63-7.60
(m, 2H), 7.47-7.45 (m, 1H), 7.32 (t, J=8.8 Hz, 1H), 7.23 (d, J=2.8
Hz, 1H), 7.15-7.11 (m, 2H), 6.64 (dd, J=6.0 Hz, 2.4 Hz, 1H), 5.07
(s, 2H), 4.14 (q, J=7.2 Hz, 2H), 1.45-1.42 (m, 4H), 1.19 (t, J=7.2
Hz, 3H); MS (ESI) m/z: 562.1 (M+H.sup.+).
To a solution of
N-(3-fluoro-4-(2-(1-(1-ethoxy2-acetyl)-1H-pyrazol-4-yl)pyridin-4-yloxy)ph-
enyl)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide (0.097 g,
0.173 mmol) in THF (4 mL) was added LiAlH.sub.4 (2 M in THF, 0.173
ml, 0.345 mmol) at -78.degree. C. The mixture was warmed to RT and
stirred for 1 h. It was cooled to 0.degree. C., methanol (0.2 ml)
and sat. aq Na.sub.2SO.sub.4 solution (0.2 ml) were added and the
mixture stirred for 4 h at RT. The mixture was filtered through a
Celite.RTM. pad, and the pad was washed with THF (2.times.2 mL).
The combined filtrate was concentrated to afford crude product
which was purified by silica gel chromatography
(CH.sub.2Cl.sub.2-MeOH) to afford
N-(3-fluoro-4-(2-(1-(2-hydroxyethyl)-1H-pyrazol-4-yl)pyridin-4-yloxy)phen-
yl)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide. (41 mg, 46%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.35 (s, 1H),
9.97 (s, 1H), 8.35 (d, J=4.8 Hz, 1H), 8.26 (s, 1H), 7.98 (s, 1H),
7.85 (dd, J=13.2 Hz, 2.4 Hz, 1H), 7.63-7.60 (m, 2H), 7.47-7.44 (m,
1H), 7.32 (t, J=9.2 Hz, 1H), 7.24 (d, J=1.6 Hz, 1H), 7.15-7.11 (m,
2H), 6.62-6.60 (m, 1H), 4.85 (brs, 1H), 4.14 (t, J=5.2 Hz, 2H),
3.72 (t, J=5.2 Hz, 2H), 1.47-1.41 (m, 4H); MS (ESI) m/z: 520.1
(M+H.sup.+).
Example 22
Using a procedure analogous to Example 15, 4-chloroaniline (0.064
g, 0.505 mmol) in CH.sub.2Cl.sub.2 (5 mL), Example B4, (0.100 g,
0.252 mmol), TBTU (0.096 g, 0.378 mmol) and triethylamine (0.051 g,
0.505 mmol) were combined and purified by silica gel chromatography
(EtOAc/CH.sub.2Cl.sub.2) to provide
N-(4-chlorophenyl)-N'-(2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4--
yloxy)phenyl)cyclopropane-1,1-dicarboxamide (0.138 mmol, 55% yield)
as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
10.48 (s, 1H), 10.00 (s, 1H), 8.40 (d, J=5.5 Hz, 1H), 8.25 (s, 1H),
7.95 (s, 1H), 7.90 (m, 1H), 7.62 (d, J=9 Hz, 2H), 7.37 (d, J=9 Hz,
2H), 7.25 (m, 2H), 7.0 (m, 1H), 6.66 (m, 1H), 3.85 (s, 3H), 1.54
(m, 4H); MS (ESI) m/z: 506.2 (M+H.sup.+).
Example 23
Using a procedure analogous to Example 15, Example B4 (0.100 g,
0.252 mmol), TBTU (0.071 g, 0.278 mmol), triethylamine (0.051 g,
0.505 mmol) and p-toluidine (0.054 g, 0.505 mmol) were combined and
purified by silica gel chromatography to provide
N-(2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-p-t-
olylcyclopropane-1,1-dicarboxamide (0.070 g, 57% yield) as a white
solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.68 (s, 1H),
9.79 (s, 1H), 8.40 (d, J=5.5 Hz, 1H), 8.25 (s, 1H), 7.95 (m, 2H),
7.43 (d, J=8 Hz, 2H), 7.22 (m, 2H), 7.11 (d, J=8 Hz, 2H), 7.02 (m,
1H), 6.67 (m, 1H), 3.85 (s, 3H), 2.24 (s, 3H), 1.57 (m, 4H); MS
(ESI) m/z: 486.2 (M+H.sup.+).
Example 24
Using a procedure analogous to Example 15, 3,4-difluoroaniline
(0.065 g, 0.505 mmol), Example B4 (0.100 g, 0.252 mmol), TBTU
(0.071 g, 0.278 mmol) and triethylamine (0.051 g, 0.505 mmol) were
combined and purified by silica gel chromatography to provide
N-(3,4-difluorophenyl)-N'-(2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridi-
n-4-yloxy)phenyl)cyclopropane-1,1-dicarboxamide (0.06 g, 47%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.48 (s, 1H),
10.22 (s, 1H), 8.46 (d, J=5.5 Hz, 1H), 8.33 (s, 1H), 7.99 (s, 1H),
7.95 (m, 1H), 7.84 (m, 1H), 7.40 (m, 2H), 7.35 (m, 2H), 7.10 (m,
1H), 6.74 (m, 1H), 3.95 (s, 3H), 1.61 (m, 4H); MS (ESI) m/z: 508.2
(M+H.sup.+).
Example 25
4-Trifluoroaniline (0.081 g, 0.505 mmol), Example B4 (0.100 g,
0.252 mmol), TBTU (0.071 g, 0.278 mmol) and triethylamine (0.051 g,
0.505 mmol) were combined using a procedure analogous to Example 15
to provide
N-(2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(4--
(trifluoromethyl)phenyl)cyclopropane-1,1-dicarboxamide (0.028 g,
21% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.33 (s,
1H), 10.31 (s, 1H), 8.40 (d, J=5.5 Hz, 1H), 8.25 (s, 1H), 7.95 (s,
1H), 7.82 (m, 3H), 7.67 (m, 2H), 7.25 (m, 2H), 7.02 (m, 1H), 6.66
(m, 1H), 3.85 (s, 3H), 1.53 (m, 4H); MS (ESI) m/z: 540.2
(M+H.sup.+).
Example 26
Example B4 (0.050 g, 0.126 mmol), N,N-diisopropylethylamine (0.016
g, 0.126 mmol), 5-amino-2-fluorobenzonitrile (0.017 g, 0.126 mmol),
and BOP-chloride (0.032 g, 0.126 mmol) were combined in
CH.sub.2Cl.sub.2 (5 mL) using a procedure analogous to Example 28
to provide
N-(3-cyano-4-fluorophenyl)-N'-(2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)py-
ridin-4-yloxy)phenyl)cyclopropane-1,1-dicarboxamide (0.030 g, 47%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.38 (s, 1H),
10.27 (s, 1H), 8.40 (d, J=5.5 Hz, 1H), 8.25 (s, 1H), 8.11 (m, 1H),
7.95 (s, 1H), 7.88 (m, 2H), 7.50 (m, 1H), 7.25 (m, 2H), 7.02 (d,
J=10 Hz, 1H), 6.89 (m, 1H), 3.85 (s, 3H), 1.55 (m, 4H); MS (ESI)
m/z: 515.2 (M+H.sup.+).
Example 27
Example B4 (0.100 g, 0.252 mmol), N,N-diisopropylethylamine (0.033
g, 0.252 mmol), 2,4-difluoroaniline (0.065 g, 0.505 mmol), and
BOP-chloride (0.064 g, 0.252 mmol) were combined in
CH.sub.2Cl.sub.2 (5 mL) using a procedure analogous to Example 28
to provide
N-(2,4-difluorophenyl)-N'-(2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridi-
n-4-yloxy)phenyl)cyclopropane-1,1-dicarboxamide (0.034 g, 27%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.59 (s, 1H),
10.23 (s, 1H), 8.40 (d, J=5.5 Hz, 1H), 8.25 (s, 1H), 7.95 (s, 1H),
7.89 (m, 1H), 7.71 (m, 1H), 7.35 (m, 1H), 7.26 (m, 2H), 7.02 (m,
2H), 6.68 (m, 1H), 3.85 (s, 3H), 1.66 (m, 4H); MS (ESI) m/z: 508.2
(M+H.sup.+).
Example 28
To a solution of 4-aminobenzonitrile (0.089 g, 0.757 mmol) in
CH.sub.2Cl.sub.2 (5 mL) was added Example B4 (0.150 g, 0.378 mmol),
BOP-chloride (0.096 g, 0.378 mmol) and diisopropylethyl amine
(0.098 g, 0.757 mmol). The reaction mixture was stirred at RT for
13 hours. The solvent from the reaction mixture was completely
removed and the residue was purified by flash chromatography to
provide
N-(4-cyanophenyl)-N'-(2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-y-
loxy)phenyl)cyclopropane-1,1-dicarboxamide (0.075 g, 40% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.38 (s, 1H), 10.15
(s, 1H), 8.33 (d, J=5.5 Hz, 1H), 8.20 (s, 1H), 7.90 (s, 1H), 7.75
(m, 4H), 7.20 (m, 3H), 6.96 (m, 1H), 6.62 (m, 1H), 3.85 (m 3H),
1.50 (m, 4H); MS (ESI) m/z: 497.2 (M+H.sup.+).
Example 29
2-Chloro-4-fluoroaniline (0.073 g, 0.505 mmol), Example B4 (0.100
g, 0.252 mmol), BOP-chloride (0.064 g, 0.252 mmol) and
diisopropylethylamine (0.065 g, 0.505 mmol) were combined in
CH.sub.2Cl.sub.2 (5 mL) using a procedure analogous to Example 28
to provide
N-(2-chloro-4-fluorophenyl)-N'-(2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)p-
yridin-4-yloxy)phenyl)cyclopropane-1,1-dicarboxamide (0.055 g, 42%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.53 (s, 1H),
10.48 (s, 1H), 8.40 (d, J=5.5 Hz, 1H), 8.25 (s, 1H), 7.95 (s, 1H),
7.82 (m, 2H), 7.50 (m, 1H), 7.25 (m, 3H), 7.02 (d, J=10 Hz, 1H),
6.89 (m, 1H), 3.85 (s, 3H), 1.70 (m, 4H); MS (ESI) m/z: 524.2
(M+H.sup.+).
Example 30
Example B1 (80 mg, 0.36 mmol), Example A5 (108 mg, 0.36 mmol),
i-Pr.sub.2NEt (0.1 mL, 0.54 mmol) and TBTU (180 mg, 0.54 mmol) were
combined in DMF (3 mL) and the mixture was stirred overnight at RT.
Water was added and resultant precipitate was collected by
filtration. The solid was dissolved in EtOAc and the organic layer
was dried (Na.sub.2SO.sub.4), concentrated in vacuo and purified by
silica gel chromatography (EtOAc-hexanes). The pure fractions were
combined and concentrated in vacuo and the residue was precipitated
from EtOAc-hexanes. The resultant solid was collected by filtration
and dried under vacuum to obtain
N-(3-chloro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(4--
fluorophenyl)cyclopropane-1,1-dicarboxamide (95 mg, 52% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.3 (s, 1H), 9.99 (s,
1H), 8.34 (d, J=5.6 Hz, 1H), 8.25 (s, 1H), 8.04 (d, J=2.4 Hz, 1H),
7.95 (s, 1H), 7.62 (m, 3H), 7.32 (d, J=8.8 Hz, 1H), 7.20 (d, J=2.8
Hz, 1H), 7.11 (m, 2H), 6.52 (dd, J=5.6, 2.4, Hz, 1H), 3.89 (s, 3H),
1.44 (m, 4H); MS (ESI) m/z: 506.1 (M+H.sup.+).
Example 31
To a solution of Example A6 (0.242 g, 0.896 mmol) in DMF (3 ml) was
added Example B1 (0.20 g, 0.896 mmol), EDC (0.258 g, 1.344 mmol),
and HOBt (0.206 g, 1.344 mmol). The mixture was stirred at RT for 3
hours. Water was added and the solution was extracted with EtOAc
(3.times.). The organic extracts were washed with brine, dried
(Na.sub.2SO.sub.4), concentrated in vacuo and purified by silica
gel column chromatography (EtOAc/hexane). Pure fractions containing
product were combined and concentrated. The residue was treated
with EtOAc/hexane and the resultant precipitate was collected by
filtration and dried under vacuum to obtain
N-(4-(2-(1H-pyrazol-4-yl)pyridin-4-yloxy)-3-fluorophenyl)-N'-(4-fluorophe-
nyl)cyclopropane-1,1-dicarboxamide (0.205 g, 48% yield). .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .delta. 13.1 (br s, 1H), 10.4 (s, 1H),
9.98 (s, 1H), 8.35 (d, J=5.2 Hz, 1H), 8.32 (brs, 1H), 8.02 (br s,
1H), 7.85 (dd, J=13.2, 2.4 Hz, 1H), 7.61 (m, 2H), 7.46 (m, 1H),
7.32 (m, 2H), 7.13 (m, 2H), 6.58 (dd, J=6.6, 2.4 Hz, 1H), 1.44 (m,
4H); MS (ESI) m/z: 476.2 (M+H.sup.+).
Example 32
To a solution of Example B1 (0.100 g, 0.448 mmol) in
CH.sub.2Cl.sub.2 (5 mL) was added Example A7 (0.134 g, 0.448 mmol),
BOP-chloride (0.228 g, 0.896 mmol) and diisopropylethylamine (0.116
g, 0.896 mmol). The reaction mixture was stirred at RT for 15
hours. The solvent from the reaction mixture was completely removed
and the residue was recrystallized (acetonitrile) to provide
N-(2-fluoro-3-methyl-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pheny-
l)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide (0.060 g, 27%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.74 (s, 1H),
9.80 (s, 1H), 8.40 (d, J=5.5 Hz, 1H), 8.25 (s, 1H), 7.95 (s, 1H),
7.82 (m, 1H), 7.60 (m, 2H), 7.20 (m, 3H), 6.95 (d, J=10 Hz, 1H),
6.56 (m, 1H), 3.83 (s, 3H), 2.00 (s, 3H), 1.65 (m, 4H); MS (ESI)
m/z: 504.2 (M+H.sup.+).
Example 33
Example B3 (65 mg, 0.164 mmol), TBTU (79 mg, 0.246 mmol), DIEA
(0.114 ml, 0.656 mmol) and (S)-1-(4-fluorophenyl)ethylamine (27.4
mg, 0.197 mmol) were combined in DMF (2 ml) and stirred at RT
overnight. The reaction was diluted with satd. NaHCO.sub.3 and
extracted with EtOAc (2.times.). The combined organics were washed
with satd. LiCl (2.times.), dried (MgSO.sub.4), concentrated in
vacuo and purified by reverse phase C18 chromatography (MeCN
(w/0.1% TFA)/H.sub.2O (w/0.1% TFA)). Pure fractions were combined,
treated with satd. NaHCO.sub.3 (pH 8) and extracted with EtOAc
(3.times.). The combined organics were washed with brine
(1.times.), dried (MgSO.sub.4), filtered and evaporated. The
material was dissolved in MeCN/H.sub.2O, treated with 0.1 N HCl
(1.14 ml, 0.114 mmol), frozen and lyophilized to afford
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-((S-
)-1-(4-fluorophenyl)ethyl)cyclopropane-1,1-dicarboxamide
hydrochloride (55 mg) as a white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.78 (s, 1H), 8.48-8.47 (m, 2H), 8.29 (d,
J=7.95 Hz, 1H), 8.16 (br s, 1H), 7.90 (dd, J=2.0, 14 Hz, 1H),
7.54-7.32 (m, 5H), 7.14-7.1 (m, 2H), 6.92 (br s, 1H), 5.04-4.97 (m,
1H), 3.89 (s, 3H), 1.41-1.36 (m, 7H); MS (ESI) m/z: 518.2
(M+H.sup.+).
Example 34
Using a procedure analogous to Example 33, Example B3 (65 mg, 0.164
mmol), TBTU (79 mg, 0.246 mmol), DIEA (0.114 ml, 0.656 mmol) and
(1S)-1-(4-fluorophenyl)propylamine hydrochloride (37.3 mg, 0.197
mmol) were combined in DMF (2 ml) to provide
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-((S-
)-1-(4-fluorophenyl)propyl)cyclopropane-1,1-dicarboxamide. It was
further reacted with 0.1 N HCl (0.94 ml, 1.0 eq) to provide
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-((S-
)-1-(4-fluorophenyl)propyl)cyclopropane-1,1-dicarboxamide
hydrochloride (49 mg) as an off-white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.8 (s, 1H), 8.49-8.47 (m, 2H), 8.26 (d,
J=8.4 Hz, 1H), 8.2 (br s, 1H), 7.88 (dd, J=2.1, 13.2 Hz, 1H),
7.54-7.31 (m, 5H), 7.14-7.1 (m, 2H), 6.9 (brs, 1H), 4.73 (q, J=8.3
Hz. 1H), 3.89 (s, 3H), 1.78-1.63 (m, 2H), 1.44-1.32 (m, 4H), 0.83
(t, J=7.1 Hz, 3H); MS (ESI) m/z: 532.2 (M+H.sup.+).
Example 35
To a solution of thiophenecarboxylic acid (0.5 g, 3.90 mmol) in
tBuOH (10 ml) was added Et.sub.3N (0.571 ml, 4.10 mmol) and DPPA
(0.883 ml, 4.10 mmol). The solution was heated at 90.degree. C. for
4 hours. The reaction mixture was cooled to RT and the solvent was
removed in vacuo. The residue was treated with benzene and then the
solution was washed with 5% citric acid, and sat'd NaHCO.sub.3.
Solid was filtered off and the filtrate was washed with brine. The
organic layer was dried (MgSO.sub.4), concentrated in vacuo and the
residue was purified by silica gel column chromatography
(EtOAc/hexanes) to obtain tert-butyl thiophen-2-ylcarbamate (0.39
g, 50% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.4
(brs, 1H), 6.84 (dd, J=1.6, and 5.2 Hz, 1H), 6.75 (dd, J=4.0, and
5.6 Hz, 1H), 6.48 (dd, J=1.6, and 4.0 Hz, 2H), 1.45 (s, 9H); MS
(ESI) m/z: 222.0 (M+22+H.sup.+).
Acetyl chloride (0.36 mL) was added dropwise to a solution of EtOAc
(4 mL) and MeOH (0.203 mL) at 0.degree. C. A solution of tert-butyl
thiophen-2-ylcarbamate (0.10 g, 0.502 mmol) in EtOAc (1 mL) was
added dropwise to the reaction mixture while maintaining the
temperature under 0.degree. C. The solution was stirred for 1 hour
(the ice bath was allowed to melt during this time) and then
concentrated to obtain thiophen-2-amine which was used for the next
reaction without purification.
Example B4 (0.10 g, 0.252 mmol), thiophen-2-amine (0.050 g, 0.505
mmol), and DIEA (0.125 ml, 0.757 mmol) were combined in DMF (2 ml).
TBTU (0.105 g, 0.328 mmol) was added and the resultant solution was
stirred overnight at RT. The reaction was diluted with water and
extracted with EtOAc (3.times.). The combined organic phases were
washed with brine, dried (Na.sub.2SO.sub.4), concentrated in vacuo
and purified by silica gel column chromatography (EtOAc/hexanes) to
give a residue. The residue was treated with CH.sub.3CN: H.sub.2O
(1:1, 4 mL) and lyophilized to obtain
N-(2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(th-
iophen-2-yl)cyclopropane-1,1-dicarboxamide (0.025 g, 21% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 11.0 (s, 1H), 10.6 (s,
1H), 8.38 (d, J=5.6 Hz, 1H), 8.25 (s, 1H), 7.95 (m, 2H), 7.25 (m,
2H), 7.02 (m, 1H), 6.98 (dd, J=1.2, and 5.6 Hz, 1H), 6.83 (m, 2H),
6.68 (m, 1H), 3.84 (s, 3H), 1.57 (m, 4H); MS (ESI) m/z: 478.0
(M+H.sup.+).
Example 36
To a stirring suspension of Example B3 (65 mg, 0.164 mmol), TBTU
(79 mg, 0.246 mmol) and (R)-1-(4-fluorophenyl)-2-methoxyethanamine
(40.5 mg, 0.197 mmol; prepared according to the published method:
J. Med. Chem. (1999), 42(24), 4981) in DMF (2 ml) was added DIEA
(0.171 ml, 0.984 mmol). The resulting clear solution was stirred at
RT overnight. After stirring overnight, the reaction was diluted
with satd. NaHCO.sub.3 and extracted with EtOAc (2.times.). The
combined organics were washed with satd. NaHCO.sub.3 (1.times.),
satd. LiCl (2.times.), and brine (1.times.), dried (MgSO.sub.4),
evaporated in vacuo and purified by reverse phase chromatography.
Pure fractions were pooled, treated with satd. NaHCO.sub.3 (pH 8)
and extracted with EtOAc (3.times.). The combined organics were
washed with satd. NaHCO.sub.3 (1.times.), brine (1.times.), dried
(MgSO.sub.4), and evaporated to afford
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-((R-
)-1-(4-fluorophenyl)-2-methoxyethyl)cyclopropane-1,1-dicarboxamide
as an oil. This was dissolved in 4:1 MeCN/H.sub.2O, treated with
certified 0.1N HCl (1.37 ml, 1.0 eq), frozen and lyophilized to
afford 63 mg (66% yield) of the HCl salt as a solid. .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 10.64 (s, 1H), 8.49-8.48 (m, 2H),
8.44-8.42 (m, 1H), 8.18 (brs, 1H), 7.89-7.85 (m, 1H), 7.54 (brs,
1H), 7.48-7.35 (m, 4H), 7.16-7.11 (m, 2H), 6.92 (brs, 1H),
5.13-5.06 (m, 1H), 3.89 (s, 3H), 3.61-3.56 (m, 1H), 3.49-3.46 (m,
1H), 3.25 (s, 3H), 1.45-1.33 (m, 4H); MS (ESI) m/z: 516.1
(M+H.sup.+).
Example 37
To a solution of Example B1 (0.070 g, 0.314 mmol) in DMF (1 ml) was
added Example A8 (0.100 g, 0.314 mmol), Hunigs base (0.078 ml,
0.470 mmol) and TBTU (0.151 g, 0.470 mmol). The mixture was stirred
overnight at RT and then diluted with EtOAc. The resultant solution
was washed with water and NaHCO.sub.3, dried (Na.sub.2SO.sub.4),
concentrated in vacuo and purified by silica gel column
chromatography (EtOAc/hexanes) to give a residue. The residue was
treated with CH.sub.3CN and kept overnight at RT. The solid was
filtered and dried under vacuum to obtain
N-(4-fluorophenyl)-N'-(4-(2-(4-(trifluoromethyl)-1H-imidazol-2-yl)pyridin-
-4-yloxy)phenyl)cyclopropane-1,1-dicarboxamide (0.105 g, 64%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6, major isomer): .delta.
13.5 (s, 1H), 10.2 (s, 1H), 10.1 (s, 1H), 8.52 (d, J=5.6 Hz, 1H),
7.84 (m, 1H), 7.75 (m, 2H), 7.62 (m, 2H), 7.35 (d, J=2.8 Hz, 1H),
7.14 (m, 2H), 7.12 (m, 3H), 7.06 (dd, J=2.4, and 5.6 Hz, 1H), 1.44
(m, 4H); MS (ESI) m/z: 526.1 (M+H.sup.+).
Example 38
To a solution of Example B1 (0.100 g, 0.448 mmol) in
dichloromethane (5 ml) was added Example A22 (0.120 g, 0.448 mmol)
followed by Bop-chloride (0.228 g, 0.896 mmol) and
diisopropylethylamine (0.116 g, 0.896 mmol). The reaction mixture
was stirred at RT for 15 hours, concentrated in vacuo, stirred with
water, filtered, washed and dried. The solid was purified by
chromatography (ethyl acetate/hexanes) to provide
N-(4-fluorophenyl)-N'-(6-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pyr-
idin-3-yl)cyclopropane-1,1-dicarboxamide (0.055 g, 26% yield) as an
off-white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6 .delta.10.25
(s, 1H), 10.03 (s, 1H), 8.45 (s, 1H), 8.40 (m, 1H), 8.25 (s, 1H),
8.18 (m, 1H), 8.00 (s, 1H), 7.60 (m, 2H), 7.40 (s, 1H), 7.16 (m
3H), 6.85 (m, 1H), 3.80 (s, 3H), 1.40 (s, 4H); MS (ESI) m/z: 473.1
(M+H.sup.+).
Example 39
To a solution of 4-fluorophenylacetyl chloride (0.500 g, 2.90 mmol)
in toluene (8.0 ml) was added silver cyanate (0.456 g, 3.05 mmol)
at RT. The reaction mixture was shielded from light and heated to
reflux. After 2 hours, the mixture was cooled to RT and the
solution was filtered using 0.45 .mu.M Teflon syringe filter. The
filtrate, 2-(4-fluorophenyl)acetyl isocyanate solution (0.4M: 0.52
g/7 mL) was used as is in the next reaction.
To a solution of 2-(4-fluorophenyl)acetyl isocyanate (4.68 ml,
1.873 mmol) in toluene (4.68 ml) was added Example A8 (0.10 g,
0.312 mmol) to form a heterogeneous mixture. THF (5 mL) was added
and the reaction mixture was stirred overnight at RT. The solid was
filtered and purified by silica gel column chromatography
(EtOAc/hexanes) to obtain
1-(2-(4-fluorophenyl)acetyl)-3-(4-(2-(4-(trifluoromethyl)-1H-imidazol-2-y-
l)pyridin-4-yloxy)phenyl)urea (0.097 g, 62% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6, major isomer): .delta. 13.5 (s, 1H), 11.0
(s, 1H), 10.5 (s, 1H), 8.52 (d, J=5.6 Hz, 1H), 7.83 (m, 1H), 7.64
(m, 2H), 7.1-7.4 (m, 7H), 7.04 (dd, J=2.8, and 5.6 Hz, 1H), 3.71
(s, 2H); MS (ESI) m/z: 500.1 (M+H.sup.+).
Example 40
To a solution of Example B5 (9.91 g, 23.58 mmol) in DMF (80 mL),
under an atmosphere of argon, were added TBTU (11.36 g, 35.4 mmol),
DIPEA (20.59 ml, 118 mmol) and 4-fluoroaniline (3.93 g, 35.4 mmol).
The reaction mixture was stirred at RT overnight. An additional
portion of TBTU (7.5 g, 17.8 mmol) was added and stirring was
continued. After 2 h, an additional portion of TBTU (3.5 g, 8.33
mmol) was added and stirring was continued for 2 h. The solvent was
removed under high vacuum and the residue was dissolved in EtOAc
(700 mL) and washed with sat. aq. NaHCO.sub.3 (2.times.200 mL) and
brine (50 mL), dried (MgSO.sub.4), concentrated to dryness and
purified by silica gel chromatography (MeOH-DCM) to provide
N-(2,5-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-
-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide (7.2 g, 59% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 11.14 (s, 1H), 9.76
(s, 1H), 8.39 (d, J=5.6 Hz, 1H), 8.28 (s, 1H), 8.13 (dd, J=12.1,
7.1 Hz, 1H), 7.99 (s, 1H), 7.62-7.53 (m, 3H), 7.27 (d, J=2.6 Hz,
1H), 7.22-7.15 (m, 2H), 6.71 (dd, J=5.6, 2.4 Hz, 1H), 3.86 (s, 3H),
1.69-1.56 (m, 4H); MS (ESI): m/z 508.1 [M+1].sup.+.
Example 41
To a solution of Example B1 (0.100 g, 0.448 mmol) in
dichloromethane (5 ml) was added Example A13 (0.120 g, 0.448 mmol),
followed by Bop-chloride (0.228 g, 0.896 mmol) and
diisopropylethylamine (0.116 g, 0.896 mmol). The reaction mixture
was stirred at RT for 15 hours, concentrated in vacuo, stirred with
water, filtered, washed, dried and crystallized (acetonitrile) to
provide
N-(4-fluorophenyl)-N'-(5-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pyr-
idin-2-yl)cyclopropane-1,1-dicarboxamide (0.005 g, 2.3% yield) as a
solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6 .delta. 9.70 (s, 1H),
8.40 (d, J=5 Hz, 1H), 8.26 (s, 1H), 8.15 (d, J=11 Hz, 1H), 7.98 (s,
1H), 7.65 (dd, J=9, 5 Hz, 1H), 7.60 (m, 2H), 7.20 (brs, 1H), 7.15
(m, 2H), 6.70 (m, 1H), 3.80 (s, 3H), 1.60 (m, 2H), 1.50 (m, 2H); MS
(ESI) m/z: 473.2 (M+H.sup.+).
Example 42
4-Fluorophenylacetic acid (1 g, 6.49 mmol) was dissolved in
acetonitrile (40 ml) and cooled to 0.degree. C. in an ice bath.
1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride (1.492
g, 7.79 mmol) was added, followed by 1-hydroxybenzotriazole (1.19
g, 7.79 mmol). The mixture was stirred at 0.degree. C. for 2.5
hours, and then concentrated ammonium hydroxide (0.865 ml, 13.0
mmol) was added slowly. The mixture then stirred at RT for an
additional 2 hours. After this time the solids were filtered off,
and the filtrate was diluted with ethyl acetate (50 mL). The
solution was washed with saturated aqueous NaHCO.sub.3 (2.times.50
mL) and brine (50 mL), dried (MgSO.sub.4) and concentrated in vacuo
to yield 2-(4-fluorophenyl)acetamide (0.87 g, 88% yield) as a white
solid which was used as is in the next reaction. .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 7.45 (broad s, 1H), 7.26 (m, 2H), 7.09
(m, 2H), 6.87 (broad s, 1H), 3.34 (s, H).
2-(4-Fluorophenyl)acetamide (0.046 g, 0.298 mmol) was dissolved in
dichloroethane (3 ml) and oxalyl chloride (0.026 ml, 0.298 mmol)
was added. The mixture was heated in an 85.degree. C. oil bath
under a balloon of argon for 14 hours. The reaction mixture was
then cooled to RT and concentrated to dryness under reduced
pressure. It was dissolved in NMP (1.5 ml) and Example A12 (0.045
g, 0.149 mmol) was added. The mixture stirred for 1.5 hours at RT
and was then diluted with ethyl acetate (50 mL), washed with water
(3.times.50 mL) and brine (50 mL), dried (MgSO.sub.4), concentrated
in vacuo and purified via silica gel chromatography (THF-hexanes)
to yield
1-(2,5-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-3--
(2-(4-fluorophenyl)acetyl)urea as an off-white solid (0.059 g, 82%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 11.26 (s, 1H),
10.89 (s, 1H), 8.36 (d, 1H), 8.26 (s, 1H), 8.18 (dd, 1H), 7.97 (s,
1H), 7.59 (dd, 1H), 7.34 (m, 2H), 7.22 (d, 1H), 7.16 (m, 2H), 6.70
(dd, 1H), 3.84 (s, 3H), 3.74 (s, 2H); MS (ESI) m/z: 482.1
(M+H.sup.+).
Example 43
4-Fluorophenylacetyl chloride (0.5 g, 2.90 mmol) was added to a
suspension of silver cyanate (1.30 g, 8.70 mmol) in toluene (8 ml)
at RT. The reaction mixture was shielded from light and heated to
reflux. After 2 h, the mixture was cooled to RT and filtered. The
filtrate containing 2-(4-fluorophenyl)acetyl isocyanate (0.363 M)
was used without further purification. An aliquot of the
2-(4-fluorophenyl)acetyl isocyanate solution (0.363 M in toluene,
3.5 mL, 1.271 mmol) was treated with Example A3 (0.192 g, 0.635
mmol) and the mixture was stirred at RT overnight. The resultant
precipitate was collected by filtration and further purified by
reverse-phase silica gel chromatography (acetonitrile/water (0.1%
TFA)). Pure fractions were combined, concentrated, basified with
NaHCO.sub.3 and extracted with EtOAc (2.times.). The combined
extracts were washed with brine, dried (MgSO.sub.4) and
concentrated in vacuo to provide
1-(2,3-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-3--
(2-(4-fluorophenyl)acetyl)urea (0.066 g, 22% yield) as a white
solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 11.25 (s, 1H),
10.84 (s, 1H), 8.39 (d, J=5.6 Hz, 1H), 8.28 (s, 1H), 8.01-7.97 (m,
2H), 7.39-7.35 (m, 2H), 7.27 (d, J=2.5 Hz, 1H), 7.26-7.21 (m, 1H),
7.21-7.15 (m, 2H), 6.75 (dd, J=5.6, 2.6 Hz, 1H), 3.86 (s, 3H), 3.76
(s, 2H); MS (ESI) m/z: 482.1 (M+H.sup.+).
Example 44
2-(4-Fluorophenyl)acetamide from Example 42 (0.115 g, 0.748 mmol)
was dissolved in dichloroethane (8 ml) and oxalyl chloride (0.082
ml, 0.935 mmol) was added. The mixture was stirred at 85.degree. C.
under a balloon of argon for 18 hours. The mixture was cooled to
RT, evaporated to dryness, and added to a solution of Example A13
(0.357 g, 0.935 mmol) in NMP (5 ml). The mixture was stirred at RT
for 45 minutes, diluted with ethyl acetate (50 mL), washed with
water (2.times.50 mL) and brine (50 mL) dried (MgSO.sub.4),
concentrated under reduced pressure and purified via silica gel
chromatography (THF-hexanes) to yield
1-(2-(4-fluorophenyl)acetyl)-3-(5-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4--
yloxy)pyridin-2-yl)urea (0.185 g, 54% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 11.12 (s, 1H), 10.93 (s, 1H), 8.36 (d, 1H),
8.24 (m, 2H), 8.07 (d, 1H), 7.96 (s, 1H), 7.72 (dd, 1H), 7.35 (m,
2H), 7.18 (m, 3H), 6.69 (dd, 1H), 3.83 (s, 3H), 3.74 (s, 2H); MS
(ESI) m/z: 447.2 (M+H.sup.+).
Example 45
Using a procedure analogous to Example 2, Example B5 (0.11 g, 0.265
mmol), diisopropylethylamine (0.051 ml, 0.292 mmol), aniline (1.004
ml, 0.345 mmol) and TBTU (0.111 g, 0.345 mmol) were combined and
purified via silica gel chromatography (methanol-methylene
chloride) to yield
N-(2,5-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-
-phenylcyclopropane-1,1-dicarboxamide as a clear film (0.030 g, 23%
yield). MS (ESI) m/z: 490.2 (M+H.sup.+).
N-(2,5-Difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-
-phenylcyclopropane-1,1-dicarboxamide was dissolved in acetonitrile
(5 ml) and 4M HCl in dioxane (0.068 ml, 0.274 mmol) was added
slowly with stirring. The mixture was stirred for 1.5 hours at RT
as a white solid slowly precipitated from the solution. The salt
was collected via suction filtration and washed with diethyl ether.
A suspension of the product in a 4:1 mix of acetonitrile and water
was lyophilized overnight to obtain
N-(2,5-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-
-phenylcyclopropane-1,1-dicarboxamide hydrochloride as a white
powder (0.047 g, 65% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 11.18 (s, 1H), 9.64 (s, 1H), 8.43 (m, 2H), 8.13 (m, 2H),
7.60 (m, 1H), 7.51 (m, 3H), 7.28 (m, 2H), 7.05 (m, 1H), 6.97 (broad
s, 1H), 3.84 (s, 3H), 1.63 (m, 2H), 1.53 (m, 2H); MS (ESI) m/z:
490.2 (M+H.sup.+).
Example 46
4-Fluorophenylacetic acid (0.144 g, 0.941 mmol) was dissolved in
dichloroethane (9.51 ml) and oxalyl chloride (0.082 ml, 0.941 mmol)
was added. The mixture was heated in an 85.degree. C. oil bath
under argon for 14 hours, cooled to RT and concentrated under
reduced pressure. The crude yellow oil was then re-dissolved in NMP
(4.75 ml) and Example A14 (0.15 g, 0.471 mmol) was added. The
mixture was stirred for 2.5 hours at RT, diluted with ethyl acetate
(70 mL), washed with water (2.times.40 mL) and brine (40 mL), dried
(MgSO.sub.4), concentrated in vacuo and purified via silica gel
chromatography (ethyl acetate/hexanes) to yield
1-(5-chloro-2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pheny-
l)-3-(2-(4-fluorophenyl)acetyl)urea as a white solid. It was
triturated in DCM (4 mL) and ethyl acetate (0.2 mL) and collected
by suction filtration to give
1-(5-chloro-2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-ylo-
xy)phenyl)-3-(2-(4-fluorophenyl)acetyl)urea (0.1456 g, 62% yield).
MS (ESI) m/z: 498.1 (M+H.sup.+).
1-(5-Chloro-2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pheny-
l)-3-(2-(4-fluorophenyl)acetyl)urea (0.146 g, 0.293 mmol) was fully
dissolved in a mixture of THF (4 ml), acetonitrile (4 mL), and
methanol (0.5 mL). Methanesulfonic acid (19 .mu.l, 0.293 mmol) was
added, and after stirring for several minutes a precipitate started
to form. The mixture was stirred at RT for 5 hours.
1-(5-Chloro-2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pheny-
l)-3-(2-(4-fluorophenyl)acetyl)urea mesylate salt was obtained by
suction filtration and was washed with acetonitrile (0.148 g, 82%
yield). .sup.1H NMR (500 MHz, DMSO-d.sub.6): .delta. 11.33 (s, 1H),
10.97 (s, 1H), 8.59 (m, 2H), 8.46 (d, 1H), 8.26 (s, 1H), 7.74 (d,
1H), 7.65 (s, 1H), 7.36 (m, 2H), 7.17 (m, 3H), 3.92 (s, 3H), 3.77
(s, 2H), 2.33 (s, 3H); MS (ESI) m/z: 498.1 (M+H.sup.+).
Example 47
Example B1 (1.484 g, 6.65 mmol) was dissolved in thionyl chloride
(14 ml, 192 mmol) at 60.degree. C. The reaction mixture stirred for
30 minutes under argon, then the solution was cooled to RT and the
mixture was azeotroped with toluene (4.times.10 mL) to give
1-((4-fluorophenyl)carbamoyl)cyclopropanecarbonyl chloride as an
off-white solid, which was used in the next step without
purification, assuming a 100% yield. MS (ESI) m/z (methanol
quench): 238.1 (M+H.sup.+).
Example A14 (1.696 g, 5.32 mmol) was dissolved in THF (15 ml) and
added to 1-((4-fluorophenyl)carbamoyl)cyclopropanecarbonyl chloride
(1.545 g, 6.39 mmol), followed by triethylamine (0.964 ml, 6.92
mmol). The mixture was stirred at RT for 5 minutes and then the
mixture was filtered to remove triethylamine HCl. The filtrate was
concentrated under reduced pressure and purified via silica gel
chromatography (DCM/MeOH) to yield
N-(5-chloro-2-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pheny-
l)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide as a white
foam (2.55 g, 91% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 11.03 (s, 1H), 9.77 (s, 1H), 8.37 (d, 1H), 8.27 (m, 2H),
7.97 (s, 1H), 7.57 (m, 3H), 7.22 (d, 1H), 7.16 (m, 2H), 6.61 (dd,
1H), 3.84 (s, 3H), 1.64 (m, 2H), 1.56 (m, 2H); MS (ESI) m/z: 524.2
(M+H.sup.+).
Example 48
A suspension of silver cyanate (0.434 g, 2.90 mmol) in toluene (8.0
ml) was treated with 4-fluorophenylacetyl chloride (0.397 ml, 2.90
mmol), the mixture shielded from light and heated to reflux for 2
hours. The mixture was cooled to RT, filtered through a syringe
filter, treated with Example A10 (0.438 g, 1.449 mmol) and stirred
overnight at RT. The solid was filtered, rinsed with a small amount
of toluene and dried in a vacuum oven at 70.degree. C. for 2 days
to afford
1-(3,5-difluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-3--
(2-(4-fluorophenyl)acetyl)urea (620 mg, 89% yield) as a white
solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): 3.74 (s, 2H), 3.84 (s,
3H), 6.71 (dd, 1H), 7.15 (t, 2H), 7.27 (d, 1H), 7.34 (m, 2H), 7.62
(d, 2H), 7.98 (s, 1H), 8.27 (s, 1H), 8.37 (d, 1H), 10.65 (s, 1H),
11.10 (s, 1H); MS (ESI) m/z: 482.2 (M+H.sup.+).
Example 49
Example B1 (0.241 g, 1.078 mmol) was dissolved in thionyl chloride
(4 ml, 54.8 mmol) and heated at 60.degree. C. for 3 h. The reaction
was azeotroped with toluene (3.times.). The crude acid chloride was
dissolved in THF (5 ml) and added dropwise to a 0.degree. C.
solution of Example A15 (0.31 g, 0.980 mmol) and
N,N-diisopropylethylamine (0.171 ml, 0.980 mmol) in THF (5 ml). The
mixture was stirred overnight at RT, saturated aq. NaHCO.sub.3 (25
ml) was added and the mixture extracted with EtOAc (3.times.25 ml).
The combined organic extracts were dried (Na.sub.2SO.sub.4),
evaporated and purified by silica gel chromatography
(hexanes/EtOAc) to elute two products.
N-(4-(2-(1,3-Dimethyl-1H-pyrazol-4-yl)pyridin-4-yloxy)-2,5-difluorophenyl-
)-N-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide (278 mg; 54.4%)
(eluted first) and
N-(4-(2-(1,5-dimethyl-1H-pyrazol-4-yl)pyridin-4-yloxy)-2,5-difluorophenyl-
)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide (81 mg; 16%)
(eluted second).
N-(4-(2-(1,3-Dimethyl-1H-pyrazol-4-yl)pyridin-4-yloxy)-2,5-diflu-
orophenyl)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide:
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 11.07 (s, 1H), 9.75
(s, 1H), 8.42 (d, 1H), 8.12-8.07 (m, 1H), 7.85 (s, 1H), 7.83-7.15
(m, 4H), 7.20-7.12 (m, 2H), 6.68-6.6.66 (m, 1H), 3.75 (s, 3H), 2.54
(s, 3H), 1.67-1.64 (m, 2H), 1.58-1.55 (m, 2H); MS (ESI) m/z: 522.2
(M+H.sup.+).
N-(4-(2-(1,5-Dimethyl-1H-pyrazol-4-yl)pyridin-4-yloxy)-2,5-difluorophenyl-
)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide: .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 11.10 (s, 1H), 9.74 (s, 1H), 8.41
(d, 1H), 8.14-8.08 (m, 2H), 7.59-7.53 (m, 4H), 7.19-7.14 (m, 1H),
7.07 (d, 1H), 6.72-6.70 (m, 1H), 3.75 (s, 3H), 2.36 (s, 3H),
1.67-1.64 (m, 2H), 1.58-1.55 (m, 2H); MS (ESI) m/z: 522.2
(M+H.sup.+).
N-(4-(2-(1,3-Dimethyl-1H-pyrazol-4-yl)pyridin-4-yloxy)-2,5-difluorophenyl-
)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide (0.278 g, 0.533
mmol) was dissolved in THF (5 ml) and warmed until reflux.
Methanesulfonic acid (0.035 ml, 0.533 mmol) was added. A
precipitate immediately formed. The mixture was sonicated for 10
min and allowed to cool to RT. The precipitate was filtered off and
dried overnight in the drying pistol (80.degree. C.) to yield
N-(4-(2-(1,3-Dimethyl-1H-pyrazol-4-yl)pyridin-4-yloxy)-2,5-difluorophenyl-
)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide mesylate (234
mg, 71.1% yie3ld). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
11.20 (s, 1H), 9.71 (s, 1H), 8.57 (d, 1H), 8.19-8.14 (m, 1H), 7.90
(s, 1H), 7.66-7.62 (m, 1H), 7.58-7.55 (m, 2H), 7.38 (s, 1H),
7.19-7.14 (m, 2H), 7.05-7.02 (m, 1H), 3.79 (s, 3H), 2.34 (s, 3H),
2.29 (s, 3H), 1.68-1.65 (m, 2H), 1.58-1.56 (m, 2H); MS (ESI) m/z:
522.2 (M+H.sup.+).
Example 50
N-(4-(2-(1,5-Dimethyl-1H-pyrazol-4-yl)pyridin-4-yloxy)-2,5-difluorophenyl-
)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide from Example 49
(0.081 g, 0.155 mmol) was dissolved in THF (2.5 ml) and warmed
until reflux. Methanesulfonic acid (10.09 .mu.l, 0.155 mmol) was
added and the mixture cooled to RT. The mixture was slowly diluted
with Et.sub.2O (5 ml). A precipitate immediately began to form upon
addition. After the addition was complete, the mixture was
sonicated for 20 min. The precipitate was filtered off to yield
N-(4-(2-(1,5-dimethyl-1H-pyrazol-4-yl)pyridin-4-yloxy)-2,5-difluorophenyl-
)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide mesylate (79
mg, 82% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 11.18
(s, 1H), 9.72 (s, 1H), 8.52 (d, 1H), 8.20-8.14 (m, 2H), 7.63-7.56
(m, 3H), 7.25 (s, 1H), 7.18-7.14 (m, 2H), 6.99-6.94 (m, 1H), 3.74
(s, 3H), 2.35 (s, 3H), 2.28 (s, 3H), 1.67-1.64 (m, 2H), 1.58-1.55
(m, 2H); MS (ESI) m/z: 522.2 (M+H.sup.+).
Example 51
1-((4-fluorophenyl)carbamoyl)cyclopropanecarbonyl chloride prepared
via the procedure in Example 47 (0.13 g, 0.538 mmol), Example A9
(0.123 g, 0.414 mmol), and triethylamine (0.065 ml, 0.621 mmol)
were dissolved in THF (3 ml). The mixture was stirred at RT for 30
min, filtered to remove triethylamine HCl, concentrated under
reduced pressure and purified by silica gel column chromatography
(MeOH/DCM) to obtain
N-(2-fluoro-5-methyl-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pheny-
l)-N'-4-fluorophenyl)cyclopropane-1,1-dicarboxamide (0.067 g, 32%
yield). MS (ESI) m/z: 504.2 (M+H.sup.+).
N-(2-fluoro-5-methyl-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pheny-
l)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide (0.067 g,
0.133 mmol) was dissolved in CH.sub.2Cl.sub.2 (1 ml), 1.0 M
methanesulfonic acid (0.133 ml, 0.133 mmol) was added and the
reaction mixture was stirred at RT for 1 hour. The solid was
filtered to obtain
N-(2-fluoro-5-methyl-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)pheny-
l)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide
methanesulfonate salt (55 mg, 67% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.8 (brs, 1H), 9.81 (s, 1H), 8.53 (m, 2H),
8.18 (m, 1H), 8.01 (m, 1H), 7.57 (m, 3H), 7.32 (m, 1H), 7.16 (m,
2H), 6.94 (m, 1H), 3.90 (s, 3H), 2.29 (s, 3H), 2.09 (s, 3H),
1.5-1.7 (m, 4H).
Example 52
A solution of Example A11 (0.107 g, 0.359 mmol) and triethylamine
(0.075 ml, 0.538 mmol) in THF (3.0 ml) was sparged with argon for
several minutes, treated with
1-((4-fluorophenyl)carbamoyl)cyclopropanecarbonyl chloride from
Example 51 (0.130 g, 0.538 mmol) and the mixture stirred at RT
under an argon atmosphere for 30 minutes. The mixture was filtered,
rinsed with THF and the filtrate concentrated to dryness. The
resulting residue was triturated with diethyl ether, sonicated for
several minutes and the resulting solid filtered, rinsed with
Et.sub.2O and dried in vacuo to afford
N-(2-fluoro-4-methyl-5-(4-(1-methyl-1H-pyrazol-4-yl)pyrimidin-2-yloxy)phe-
nyl)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide (154 mg, 85%
yield) as an off-white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
1.52 (m, 2H), 1.57 (m, 2H), 2.04 (s, 3H), 3.87 (s, 3H), 7.15 (t,
2H), 7.25 (d, 1H), 7.44 (d, 1H), 7.56 (m, 2H), 7.71 (d, 1H), 8.08
(s, 1H), 8.43 (m, 2H), 9.83 (brs, 1H), 10.71 (brs, 1H); MS (ESI)
m/z: 505.2 (M+H.sup.+).
Example 53
To a suspension of Example B1 (0.293 g, 1.315 mmol) and cyanuric
chloride (0.097 g, 0.526 mmol) in acetonitrile (5 ml) was added
N-methylpyrrolidine (0.112 g, 1.32 mmol) and the reaction was
stirred at RT for 20 minutes. To this reaction mixture was added
Example A16 (0.250 g, 0.876 mmol), and stirring continued at RT for
13 hours. The reaction mixture was concentrated in vacuo, the
residue stirred in dichloromethane, filtered, washed and dried. The
resultant solid was stirred in hot methanol, cooled to RT,
filtered, washed and dried to provide
N-(2-fluoro-5-(4-(1-methyl-1H-pyrazol-4-yl)pyrimidin-2-yloxy)phen-
yl)-N'-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide (0.096 g, 22%
yield) as white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6) .delta.
11.15 (s, 1H), 10.89 (s, 1H)), 9.79 (s, 1H), 8.47 (d, J=5 Hz, 1H),
8.42 (s, 1H), 8.08 (s, 1H), 7.86 (s, 1H), 7.57 (m, 1H), 7.45 (d,
J=5.7 Hz, 1H), 7.32 (dd, J=9, 11.5 Hz, 1H), 7.15 (t, J=9 Hz, 2H),
7.00 (m, 1H), 3.87 (s, 3H), 1.60 (m, 2H), 1.53 (m, 2H); MS (ESI)
m/z: 491.2 (M+H.sup.+).
Example 54
1-((4-Fluorophenyl)carbamoyl)cyclopropanecarbonyl chloride from
Example 51 (0.13 g, 0.538 mmol), Example A20 (0.102 g, 0.359 mmol),
and triethylamine (0.075 ml, 0.717 mmol) were dissolved in THF (3
ml). The mixture was stirred at RT. After 1 hour, the reaction was
filtered to remove triethylamine HCl, concentrated in vacuo, and
purified by silica gel column chromatography (EtOAc/hexanes) to
obtain a residue. The residue was treated with Et.sub.2O. The solid
formed was filtered and dried to obtain
N-(5-(4-(1H-pyrazol-4-yl)pyrimidin-2-yloxy)-2-fluoro-4-methylphenyl)-N'-(-
4-fluorophenyl)cyclopropane-1,1-dicarboxamide (80 mg, 45% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 13.3 (s, 1H), 10.7 (s,
1H), 9.84 (s, 1H), 8.49 (s, 1H), 8.43 (d, J=5.2 Hz, 1H), 8.11 (d,
J=1.6 Hz, 1H), 7.70 (d, J=7.2 Hz, 1H), 7.56 (m, 2H), 7.49 (d, J=5.2
Hz, 1H), 7.25 (d, J=11.6 Hz, 1H), 7.13 (m, 2H), 2.05 (s, 3H), 1.58
(m, 2H), 1.51 (m, 2H); MS (ESI) m/z: 491.2 (M+H.sup.+).
Example 55
A solution of Example B1 (196 mg, 0.811 mmol) in THF (2 mL) was
added to a stirred mixture of triethylamine (200 mg, 2.212 mmol)
and Example A18 (200 mg, 0.737 mmol) in THF (4 mL). The mixture was
then stirred at RT. The mixture was further treated with Example B1
(.about.75 mg) in THF (1 mL). The mixture was stirred at RT for 3
hrs, then diluted with ethyl acetate (30 mL) and washed with 10%
potassium carbonate (30 mL), brine (30 mL), dried
(Na.sub.2SO.sub.4), evaporated at reduced pressure and purified by
reverse phase chromatography (CH.sub.3CN/H.sub.2O with 0.1% TFA) to
give an aqueous residue was then treated with saturated sodium
bicarbonate (4 mL) and allowed to precipitate. The solid was
collected by filtration, washed with water (1 mL) and dried on a
high vacuum line at 80.degree. C. to give
N-(5-(4-(1H-pyrazol-4-yl)pyrimidin-2-yloxy)-2-fluorophenyl)-N'-(4-fluorop-
henyl)cyclopropane-1,1-dicarboxamide (26 mg, 7% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 1.50-1.60 (m, 4H), 6.90-7.01 (m,
1H), 7.15 (t, 2H), 7.31 (t, 1H), 7.49-7.50 (m, 1H), 7.55-7.58 (m,
2H), 7.84-7.85 (m, 1H), 8.15 (br. s, 1H), 8.46 (d, 1H), 8.50 (br.
s, 1H), 9.80 (s, 1H), 10.87 (s, 1H), 13.3 (s, 1H); MS (ES-API) m/z:
477.2 (M+H.sup.+).
Example 56
2-(4-Fluorophenyl)acetamide from Example 42 (0.091 g, 0.597 mmol)
was dissolved in dichloroethane (6 ml) and oxalyl chloride (0.052
ml, 0.597 mmol) was added. The mixture was heated at 85.degree. C.
under a balloon of argon for 15 hours. The reaction mixture was
cooled to RT and the solvent was removed under reduced pressure.
The residue that remained was dissolved in NMP (3.00 ml) and added
to Example A17 (0.084 g, 0.299 mmol). The solution stirred at RT
for 30 minutes under argon. The reaction mixture was diluted with a
4:1 mixture of ethyl acetate and THF (60 mL) and washed with 10%
aqueous LiCl (2.times.50 mL) and brine (50 mL), dried (MgSO.sub.4),
evaporated in vacuo and purified via silica gel chromatography
(ethyl acetate/hexanes) to yield
1-(2-(4-fluorophenyl)acetyl)-3-(4-methyl-5-(2-(1-methyl-1H-pyrazol-4-yl)p-
yridin-4-yloxy)pyridin-2-yl)urea as an off-white solid (0.097 g,
71% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 11.11 (s,
1H), 10.89 (s, 1H), 8.33 (d, 1H), 8.24 (s, 1H), 8.12 (s, 1H), 8.00
(s, 1H), 7.95 (s, 1H), 7.35 (m, 2H), 7.25 (m, 1H), 7.14 (m, 2H),
6.59 (dd, 1H), 3.83 (s, 3H), 3.74 (s, 2H), 2.15 (s, 3H); MS (ESI)
m/z: 461.1 (M+H.sup.+).
Example 57
Example B1 (0.092 g, 0.412 mmol) was dissolved in thionyl chloride
(6 ml, 82 mmol) and heated at 80.degree. C. for 1 h. The mixture
was cooled and azeotroped with toluene (3.times.10 ml). The crude
acid chloride was dissolved in THF (5 ml) and added dropwise to a
0.degree. C. solution of Example A19 (0.113 g, 0.375 mmol) and
N,N-diethylisopropylamine (0.131 ml, 0.749 mmol) in THF (5 ml). The
mixture was stirred overnight at RT. The reaction was not complete.
Additional acid chloride was generated from Example B1 (65 mg, 0.29
mmol) using the above method. The crude acid chloride was dissolved
in THF (5 ml) and added to the reaction mixture. The solution was
stirred at RT for 4 h, diluted with EtOAc and washed with sat.
NaHCO.sub.3 (aq). The organic extract was dried, evaporated and
purified by silica gel chromatography (hexanes/EtOAc) and reverse
phase chromatography (water (0.1% TFA)/acetonitrile (0.1% TFA)),
treated with sat. NaHCO.sub.3 (aq) until basic and the resulting
solid removed by filtration. The solid was dried under vacuum at
80.degree. C. to yield
N-(2,5-difluoro-4-(3-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-
-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide (57 mg, 30% yield).
The mesylate salt was formed by taking
N-(2,5-difluoro-4-(3-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-
-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide (0.057 g, 0.112
mmol) and dissolving it in refluxing acetonitrile (5 ml).
Methanesulfonic acid (7.29 .mu.l, 0.112 mmol) was added and the
mixture was cooled to RT, concentrated (.about.2 ml) and ether (5
ml) was added dropwise. A solid precipitated. The resulting mixture
was sonicated for 30 min. The solid was filtered off and dried
overnight in the drying pistol to yield
N-(2,5-difluoro-4-(3-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-
-(4-fluorophenyl)cyclopropane-1,1-dicarboxamide mesylate (50 mg,
74% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 11.27 (s,
1H), 9.74 (s, 1H), 9.11 (s, 1H), 8.49 (d, 1H), 8.43 (s, 1H),
8.22-8.19 (m, 1H), 8.16 (d, 1H), 7.74-7.70 (m, 1H), 7.60-7.57 (m,
2H), 7.21-7.15 (m, 3H), 3.92 (s, 3H), 2.34 (s, 3H), 1.71-1.68 (m,
2H), 1.61-1.59 (m, 2H); MS (ESI) m/z: 508.2 (M+H.sup.+).
Example 58
Using a procedure analogous to Example B1,
1,1-cyclopropanedicarboxylic acid (2 g, 15.37 mmol), Et.sub.3N
(2.14 mL, 15.4 mmol), thionyl chloride (1.12 mL, 15.4 mmol), and
4-fluoro-N-methylaniline (1.83 g, 14.6 mmol) were combined to
provide 1-((4-fluorophenyl)(methyl)carbamoyl)cyclopropanecarboxylic
acid (2.79 g, 72% yield). MS (ESI) m/z: 260.0 (M+Na.sup.+).
Example A2 (136 mg, 0.479 mmol),
1-((4-fluorophenyl)(methyl)carbamoyl)cyclopropanecarboxylic acid
(125 mg, 0.525 mmol), TBTU (0.169 g, 0.525 mmol) and i-Pr.sub.2NEt
(0.18 mL, 1.050 mmol) were combined in DMF (3 mL). The resultant
mixture was stirred overnight at RT. Additional portions of TBTU
(0.169 g, 0.525 mmol) and i-Pr.sub.2NEt (0.18 mL, 1.05 mmol) were
added and the mixture was stirred an additional 24 h. The reaction
mixture was poured into water (30 mL) and extracted with EtOAc
(3.times.30 mL). The organic extracts were washed with satd aq
NaHCO.sub.3 and brine, were dried (MgSO.sub.4), and were
concentrated in vacuo. The residue was dissolved in
CH.sub.2Cl.sub.2 (20 mL) and the solution was shaken overnight with
polymer-bound isocyanate resin (1.7 mmol/g; 0.5 g). The mixture was
filtered and the filtrate was concentrated to dryness and purified
by reverse phase chromatography (acetonitrile (with 0.1% TFA
added)/water (with 0.1% TFA added)). The pure fractions were
combined and concentrated to dryness. THF (10 mL) and polymer-bound
carbonate resin (200 mg) were added to the residue and the mixture
was shaken for 2 h. The mixture was filtered and the filtrate was
treated with aq HCl (2 N, 2 mL, 4 mmol). The solution was
concentrated in vacuo, dissolved in acetonitrile-water (1:1, 6 mL),
frozen and lyophilized to provide
N-(3-fluoro-4-(2-(1-methyl-1H-pyrazol-4-yl)pyridin-4-yloxy)phenyl)-N'-(4--
fluorophenyl)-N'-methylcyclopropane-1,1-dicarboxamide HCl salt as a
yellow powder (50 mg, 18% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.00 (br s, 1H), 8.70 (s, 1H), 8.54 (d,
1H), 8.38 (s, 1H), 7.73 (s, 1H), 7.51 (br s, 1H), 7.44-7.20 (m,
4H), 7.15-6.97 (m, 3H), 3.93 (s, 3H), 3.23 (s, 3H), 1.43 (s, 2H),
1.22 (s, 2H); MS (ESI) m/z: 504.1 (M+H.sup.+).
Example 59
Thionyl chloride (1 ml, 13.70 mmol) was added to Example B1 (0.131
g, 0.589 mmol; DP-4180) and mixture was stirred at 60.degree. C.
under Ar atmosphere for 30 min. The mixture was concentrated in
vacuo and azeotroped with toluene (2.times.8 mL) to furnish acid
chloride as a white solid. To this solid added a solution of
Example A21 (0.12 g, 0.421 mmol) and triethylamine (0.292 ml, 2.10
mmol) in THF (3 mL) and the reaction was stirred for 1 h at RT. The
mixture was partitioned between EtOAc (30 mL) and NaHCO.sub.3
solution (30 mL). The aqueous layer was extracted with EtOAc
(1.times.20 mL) and combined organics were washed with brine, dried
(Na.sub.2SO.sub.4), concentrated in vacuo and purified by
chromatography (ethylacetate/hexanes) to afford
N-(2-fluoro-4-(2-(3-methylisoxazol-5-yl)pyridin-4-yloxy)phenyl)-N'-(4-flu-
orophenyl)cyclopropane-1,1-dicarboxamide (87 mg, 42% yield) as a
white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.06 (s,
1H), 9.92 (s, 1H), 8.57 (d, J=5.6 Hz, 1H), 7.97 (t, J=8.8 Hz, 1H),
7.61-7.57 (m, 2H), 7.37 (d, J=2.4 Hz 1H), 7.34 (dd, J=11.6 Hz, 2.4
Hz, 1H), 7.15 (t, J=9.2 Hz, 2H), 7.09 (dd, J=8.8 Hz, 1.6 Hz, 1H),
7.03 (dd, J=5.6 Hz, 2.4 Hz, 1H), 6.96 (s, 1H), 2.28 (s, 3H),
1.58-1.54 (m, 4H); MS (ESI) m/z: 491.2 (M+H.sup.+).
Example 60
Using a procedure analogous to Example 59, Example B1 (0.113 g,
0.506 mmol) was converted to
1-(4-fluorophenylcarbamoyl)cyclopropanecarbonyl chloride. To the
solid acid chloride was added a solution of Example A23 (0.13 g,
0.337 mmol) and triethylamine (0.187 ml, 1.349 mmol) in THF (4 mL).
The mixture was stirred for 5 h at RT, concentrated in vacuo,
dissolved in methanol (4 mL) and 2N aq. NaOH (0.093 mL, 0.186 mmol)
was added. The mixture was stirred for 30 min at RT, concentrated
in vacuo, diluted with 5% citric acid (25 mL) and extracted with
EtOAc (2.times.35 mL). The combined organics were washed with
brine, dried (Na.sub.2SO.sub.4), concentrated in vacuo and purified
by reverse phase chromatography (acetonitrile/water (0.1% TFA)) to
afford
N-(4-(2-(1H-1,2,3-triazol-4-yl)pyridin-4-yloxy)-2-fluorophenyl)-N'-(4-flu-
orophenyl)cyclopropane-1,1-dicarboxamide (37 mg, 42% yield) as a
white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.49 (s,
1H), 9.91 (s, 1H), 8.45 (brs, 1H), 8.17 (s, 1H), 7.90 (t, J=8.8 Hz,
1H), 7.55 (dd, J=8.8 Hz, 5.2 Hz, 2H) 7.31 (brs, 1H), 7.29-7.26 (m,
1H), 7.10 (t, J=8.8 Hz, 2H), 7.03 (d, J=8.0 Hz, 1H), 6.91 (s, 1H),
1.55-1.50 (m, 4H); MS (ESI) m/z: 477.2 (M+H.sup.+).
SECTION 4. BIOLOGICAL DATA
c-KIT Kinase Assay
Activity of c-KIT kinase (Seq. ID no. 1) was determined by
following the production of ADP from the kinase reaction through
coupling with the pyruvate kinase/lactate dehydrogenase system
(e.g., Schindler et al. Science (2000) 289: 1938-1942). In this
assay, the oxidation of NADH (thus the decrease at A340 nm) was
continuously monitored spectrophometrically. The reaction mixture
(100 .mu.l) contained c-KIT (cKIT residues T544-V976, from
ProQinase, 5.4 nM), polyE4Y (SEQ ID NO: 4) (1 mg/ml), MgCl.sub.2
(10 mM), pyruvate kinase (4 units), lactate dehydrogenase (0.7
units), phosphoenol pyruvate (1 mM), and NADH (0.28 mM) in 90 mM
Tris buffer containing 0.2% octyl-glucoside and 1% DMSO, pH 7.5.
Test compounds were incubated with c-KIT (Seq. ID no. 1) and other
reaction reagents at 22.degree. C. for <2 min before ATP (200
.mu.M) was added to start the reaction. The absorption at 340 nm
was monitored continuously for 0.5 hours at 30.degree. C. on
Polarstar Optima plate reader (BMG). The reaction rate was
calculated using the 0 to 0.5 h time frame. Percent inhibition was
obtained by comparison of reaction rate with that of a control
(i.e. with no test compound). IC.sub.50 values were calculated from
a series of percent inhibition values determined at a range of
inhibitor concentrations using software routines as implemented in
the GraphPad Prism software package.
TABLE-US-00001 c-KIT with N-terminal GST fusion (Seq ID No. 1)
LGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPN
LPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVDIRYG
VSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFML
YDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIWPLQGW
QATFGGGDHPPKSDLVPRHNQTSLYKKAGSAAAVLEENLYFQGTYKYLQK
PMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF
GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNH
MNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEA
ALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIER
DVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILL
THGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPESIFNCVYTFES
DVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY
DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPV
VDHSVRINSVGSTASSSQPLLVHDDV
c-MET Kinase Assay
Activity of c-MET kinase (Seq. ID no. 2) was determined by
following the production of ADP from the kinase reaction through
coupling with the pyruvate kinase/lactate dehydrogenase system
(e.g., Schindler et al. Science (2000) 289: 1938-1942). In this
assay, the oxidation of NADH (thus the decrease at A340 nm) was
continuously monitored spectrophometrically. The reaction mixture
(100 .mu.l) contained c-MET (c-MET residues: 956-1390, from
Invitrogen, catalogue #PV3143, 6 nM), polyE4Y (SEQ ID NO: 4) (1
mg/ml), MgCl.sub.2 (10 mM), pyruvate kinase (4 units), lactate
dehydrogenase (0.7 units), phosphoenol pyruvate (1 mM), and NADH
(0.28 mM) in 90 mM Tris buffer containing 0.25 mM DTT, 0.2%
octyl-glucoside and 1% DMSO, pH 7.5. Test compounds were incubated
with C-Met (Seq. ID no. 2) and other reaction reagents at
22.degree. C. for 0.5 h before ATP(100 .mu.M) was added to start
the reaction. The absorption at 340 nm was monitored continuously
for 2 hours at 30.degree. C. on Polarstar Optima plate reader
(BMG). The reaction rate was calculated using the 1.0 to 2.0 h time
frame. Percent inhibition was obtained by comparison of reaction
rate with that of a control (i.e. with no test compound). IC.sub.50
values were calculated from a series of percent inhibition values
determined at a range of inhibitor concentrations using software
routines as implemented in the GraphPad Prism software package.
TABLE-US-00002 cMET Kinase (Seq ID No. 2)
MSYYHHHHHHDYDIPTTENLYFQGAMLVPRGSPWIPFTMKKRKQIKDLGS
ELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSS
QNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAV
QHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRIT
DIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLR
NFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKF
TVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDV
WSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVM
LKCWHPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYP
SLLSSEDNADDEVDTRPASFWETS
KDR Kinase Assay Assay K1
The activity of KDR kinase was determined by following the
production of ADP from the kinase reaction through coupling with
the pyruvate kinase/lactate dehydrogenase system (e.g., Schindler
et al. Science (2000) 289: 1938-1942). In this assay, the oxidation
of NADH (thus the decrease at A.sub.340 nm) was continuously
monitored spectrophotometrically. The reaction mixture (100 .mu.l)
contained KDR (Seq ID No. 3, 1.5 nM to 7.1 nM, nominal
concentration), polyE.sub.4Y (SEQ ID NO: 4) (1 mg/ml), pyruvate
kinase (3.5 units), lactate dehydrogenase (5.5 units),
phosphoenolpyruvate (1 mM), and NADH (0.28 mM) in 60 mM Tris buffer
containing 0.13% octyl-glucoside, 13 mM MgCl.sub.2, 6.8 mM DTT, and
3.5% DMSO at pH 7.5. The reaction was initiated by adding ATP (0.2
mM, final concentration). The absorption at 340 nm was continuously
monitored for 3 h at 30.degree. C. on a Polarstar Optima plate
reader (BMG) or instrument of similar capacity. The reaction rate
was calculated using the 1 h to 2 h time frame. Percent inhibition
was obtained by comparison of reaction rate with that of a control
(i.e. with no test compound). IC.sub.50 values were calculated from
a series of percent inhibition values determined at a range of
inhibitor concentrations using software routines as implemented in
the GraphPad Prism software package.
Assay K2
KDR kinase assay K2 is the same as for assay K1 except that (1) a
nominal concentration of 2.1 nM of enzyme was employed (2) the
reaction was pre-incubated at 30.degree. C. for 2 h prior to
initiation with ATP and (3) 1.0 mM ATP (final concentration) was
used to initiate the reaction.
Assay K3
KDR kinase assay K3 is the same as for assay K1 except that (1) a
nominal concentration of 1.1 nM of enzyme was employed, (2) the
buffer components per 100 .mu.l reaction mixture were as follows:
75 mM Tris buffer containing 0.066% octyl-glucoside, 17 mM
MgCl.sub.2, and 1% DMSO at pH 7.5, (3) the final concentration of
DTT was 0.66 mM, (4) the reaction was pre-incubated at 30.degree.
C. for 1 h prior to initiation with ATP, and (5) 1.0 mM ATP (final
concentration) was used to initiate the reaction.
TABLE-US-00003 KDR protein sequence used for screening (Seq. ID No.
3) DPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGI
DKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACT
KPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLI
CYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKD
PDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPY
PGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSEL
VEHLGNLLQANAQQD
HUVEC Cell Culture
HUVEC (Human umbilical vein endothelial cell) cells were obtained
from Lonza (Lonza, Walkersville, Md.). Briefly, cells were grown in
EGM-2 (Lonza, Walkersville, Md.) at 37 degrees Celsius, 5%
CO.sub.2, 95% humidity. Cells were allowed to expand until reaching
90-95% saturation at which point they were subcultured or harvested
for assay use. For assay use, cells were harvested and grown in
EGM-2 medium supplemented with 2% FBS (Lonza, Walkersville,
Md.).
HUVEC VEGF/KDR ELISA
Twenty-five thousand cells were added per well in a 96-well black
clear bottom plate (Corning, Corning, N.Y.). Cells were then
incubated overnight at 37 degrees Celsius, 5% CO.sub.2, 95%
humidity. A serial dilution of test compound was dispensed into
another 96-well black clear bottom plate (Corning, Corning, N.Y.)
containing EBM-2 supplemented with 2% FBS. Compound was added to
plates containing cells and incubated for 4 hours at 37 degrees
Celsius, 5% CO.sub.2, 95% humidity. Cells were stimulated with 100
ng/mL VEGF (R&D Systems, Minneapolis, Minn.) for 5 minutes,
then lysed. Cell lysates were used to detect phospho-VEGF R2 using
DuoSet IC HUVEC VEGF/KDR ELISA (R&D Systems, Minneapolis,
Minn.). Data was analyzed using Prism software (Graphpad, San
Diego, Calif.) to calculate IC.sub.50's.
EBC-1 Cell Culture
EBC-1 cells (catalog #JCRB0820) were obtained from the Japan Health
Science Research Resources Bank, Osaka, Japan. Briefly, cells were
grown in DMEM supplemented with 10% characterized fetal bovine
serum (Invitrogen, Carlsbad, Calif.) at 37 degrees Celsius, 5%
CO.sub.2, 95% humidity. Cells were allowed to expand until reaching
70-95% confluency at which point they were subcultured or harvested
for assay use.
EBC-1 Cell Proliferation Assay
A serial dilution of test compound was dispensed into a 96-well
black clear bottom plate (Corning, Corning, N.Y.). For each cell
line, five thousand cells were added per well in 200 .mu.L complete
growth medium. Plates were incubated for 67 hours at 37 degrees
Celsius, 5% CO.sub.2, 95% humidity. At the end of the incubation
period 40 .mu.L of a 440 .mu.M solution of resazurin (Sigma, St.
Louis, Mo.) in PBS was added to each well and incubated for an
additional 5 hours at 37 degrees Celsius, 5% CO.sub.2, 95%
humidity. Plates were read on a Synergy2 reader (Biotek, Winooski,
Vt.) using an excitation of 540 nM and an emission of 600 nM. Data
was analyzed using Prism software (Graphpad, San Diego, Calif.) to
calculate IC.sub.50 values.
M-NFS-60 Cell Culture
M-NFS-60 cells (catalog #CRL-1838) were obtained from the American
Type Culture Collection (ATCC, Manassas, Va.). Briefly, cells were
grown in suspension in RPMI 1640 medium supplemented with 10%
characterized fetal bovine serum (Invitrogen, Carlsbad, Calif.),
0.05 mM 2-mercaptoethanol, and 20 ng/mL mouse recombinant
macrophage colony stimulating factor (M-CSF) at 37 degrees Celsius,
5% CO.sub.2, and 95% humidity. Cells were allowed to expand until
reaching saturation at which point they were subcultured or
harvested for assay use.
M-NFS-60 Cell Proliferation Assay
A serial dilution of test compound was dispensed into a 384-well
black clear bottom plate (Corning, Corning, N.Y.). Two thousand
five hundred cells were added per well in 50 .mu.L complete growth
medium. Plates were incubated for 67 hours at 37 degrees Celsius,
5% CO.sub.2, and 95% humidity. At the end of the incubation period
10 .mu.L of a 440 .mu.M solution of resazurin (Sigma, St. Louis,
Mo.) in PBS was added to each well and incubated for an additional
5 hours at 37 degrees Celsius, 5% CO.sub.2, and 95% humidity.
Plates were read on a Synergy2 reader (Biotek, Winooski, Vt.) using
an excitation of 540 nM and an emission of 600 nM. Data was
analyzed using Prism software (Graphpad, San Diego, Calif.) to
calculate IC.sub.50 values.
FMS Kinase Assay
Activity of FMS kinase was determined by following the production
of ADP from the kinase reaction through coupling with the pyruvate
kinase/lactate dehydrogenase system (e.g., Schindler et al. Science
(2000) 289: 1938-1942). In this assay, the oxidation of NADH (thus
the decrease at A340 nm) was continuously monitored
spectrophometrically. The reaction mixture (100 .mu.l) contained
FMS (purchased from Invitrogen or Millipore, 6 nM), polyE4Y (SEQ ID
NO: 4) (1 mg/ml), MgCl.sub.2 (10 mM), pyruvate kinase (4 units),
lactate dehydrogenase (0.7 units), phosphoenol pyruvate (1 mM) and
NADH (0.28 mM) and ATP (500 .mu.M) in a 90 mM Tris buffer
containing 0.2% octyl-glucoside and 1% DMSO, pH 7.5. The inhibition
reaction was started by mixing serial diluted test compound with
the above reaction mixture. The absorption at 340 nm was monitored
continuously for 4 hours at 30.degree. C. on a Polarstar Optima or
Synergy 2 plate reader. The reaction rate was calculated using the
2 to 3 h time frame. Percent inhibition was obtained by comparison
of reaction rate with that of a control (i.e. with no test
compound). IC.sub.50 values were calculated from a series of
percent inhibition values determined at a range of inhibitor
concentrations using software routines as implemented in the
GraphPad Prism software package.
PDGFR.alpha. Kinase Assay
Activity of PDGFR.alpha. kinase was determined by following the
production of ADP from the kinase reaction through coupling with
the pyruvate kinase/lactate dehydrogenase system. In this assay,
the oxidation of NADH (thus the decrease at A340 nm) was
continuously monitored spectrophometrically. The reaction mixture
(100 .mu.l) contained PDGFR.alpha. (Invitrogen, 10 nM), polyE4Y
(SEQ ID NO: 4) (1 mg/ml), MgCl.sub.2 (10 mM), pyruvate kinase (4
units), lactate dehydrogenase (0.7 units), phosphoenol pyruvate (1
mM) and NADH (0.28 mM) and ATP (500 .mu.M) in a 90 mM Tris buffer
containing 0.2% octyl-glucoside and 1% DMSO, pH 7.5. The inhibition
reaction was started by mixing serial diluted test compound with
the above reaction mixture. The absorption at 340 nm was monitored
continuously for 4 hours at 30.degree. C. on a Polarstar Optima or
Synergy 2 plate reader. The reaction rate was calculated using the
2 to 3 h time frame. Percent inhibition was obtained by comparison
of reaction rate with that of a control (i.e. with no test
compound). IC.sub.50 values were calculated from a series of
percent inhibition values determined at a range of inhibitor
concentrations using software routines as implemented in the
GraphPad Prism software package.
PDGFR.beta. Kinase Assay
This was done as described for PDGFGR.alpha. except that
PDGFR.beta. (Invitrogen, 11 nM) was used.
As shown in Tables 1 and 2, compounds of formula Ia exhibit
inhibitory activity in one or more of the aforementioned assays
when evaluated at concentrations.ltoreq.10 .mu.M.
TABLE-US-00004 TABLE 1 Enzymatic Activity cMET cKIT KDR FMS PDGFRa
PDGFRb Example Enzyme Enzyme Enzyme Enzyme Enzyme Enzyme # Assay
Assay Assay Assay Assay Assay 1 +++ ++ ++ NT +++ ++ 3 + NT ++ NT ++
+ 4 + ++ ++ +++ + + 5 +++ NT NT NT NT NT 6 ++ + +++ ++ ++ + 7 +++ +
++ +++ ++ + 8 + NT NT NT NT NT 10 ++ NT NT NT NT NT 11 ++ NT NT NT
NT NT 12 +++ +++ + +++ +++ +++ 13 + NT NT NT NT NT 14 ++ NT NT NT
NT NT 15 ++ NT NT NT NT NT 16 ++ +++ + +++ ++ + 17 + ++ + +++ + +
18 ++ NT NT NT NT NT 19 +++ NT NT NT NT NT 20 ++ NT NT NT NT NT 21
++ ++ ++ NT ++ + 22 ++ ++ ++ +++ ++ ++ 23 ++ + + ++ + + 24 ++ NT NT
NT NT NT 25 ++ NT NT NT NT NT 26 + NT NT NT NT NT 27 ++ NT NT NT NT
NT 28 + NT NT NT NT NT 29 ++ NT NT NT NT NT 30 +++ +++ NT NT ++ +
31 +++ NT NT NT NT NT 32 ++ NT + ++ NT NT 33 ++ NT NT NT NT NT 34
++ NT NT NT NT NT 35 ++ NT NT NT NT NT 36 ++ NT NT NT NT NT 38 ++
NT + + NT NT 39 NT NT NT NT +++ ++ 40 +++ +++ +++ NT ++ + 41 ++ ++
++ +++ ++ + 42 +++ +++ + NT +++ + 43 ++ ++ + +++ +++ ++ 44 ++ ++ +
+++ +++ +++ 45 +++ +++ ++ NT + + 46 +++ +++ ++ NT +++ +++ 47 +++
+++ ++ NT +++ + 48 + ++ ++ + + + 49 +++ +++ ++ ++ + + 50 +++ +++
+++ NT ++ + 51 +++ +++ ++ +++ ++ ++ 52 + NT + + NT NT 53 + NT + +
NT NT 54 + NT + + NT NT 55 + + + + + + 58 + + + NT + NT 59 +++ NT +
+++ NT NT 60 ++ NT NT NT NT NT + less than 10 .mu.M activity ++
less than 2 .mu.M activity +++ less than 200 nM activity NT not
tested
TABLE-US-00005 TABLE 2 Cellular Acitivity EBC1 Cell M-NFS-60 Cell
HUVEC Mo-7e Example # Proliferation Proliferation pKDR pKIT 6 + NT
NT NT 7 +++ NT ++ NT 12 +++ +++ +++ ++ 16 + NT NT NT 19 ++ NT NT NT
20 ++ NT NT NT 21 ++ NT NT NT 22 ++ NT NT NT 23 ++ NT NT NT 30 ++
NT NT NT 31 ++ NT NT NT 40 +++ NT ++ NT 41 NT + NT NT 42 +++ NT NT
++ 44 NT +++ ++ +++ 45 +++ NT NT +++ 46 +++ NT NT NT 47 +++ NT NT
NT 49 ++ NT NT NT 50 +++ NT NT NT 51 ++ NT NT NT + less than 10
.mu.M activity ++ less than 2 .mu.M activity +++ less than 200 nM
activity NT not tested
EQUIVALENTS
Those skilled in the art will recognize, or be able to ascertain,
using no more than routine experimentation, numerous equivalents to
the specific embodiments described specifically in this disclosure.
Such equivalents are intended to be encompassed in the scope of the
following claims.
SEQUENCE LISTINGS
1
41676PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 1Leu Gly Tyr Trp Lys Ile Lys Gly Leu Val Gln
Pro Thr Arg Leu Leu1 5 10 15Leu Glu Tyr Leu Glu Glu Lys Tyr Glu Glu
His Leu Tyr Glu Arg Asp 20 25 30Glu Gly Asp Lys Trp Arg Asn Lys Lys
Phe Glu Leu Gly Leu Glu Phe 35 40 45Pro Asn Leu Pro Tyr Tyr Ile Asp
Gly Asp Val Lys Leu Thr Gln Ser 50 55 60Met Ala Ile Ile Arg Tyr Ile
Ala Asp Lys His Asn Met Leu Gly Gly65 70 75 80Cys Pro Lys Glu Arg
Ala Glu Ile Ser Met Leu Glu Gly Ala Val Asp 85 90 95Ile Arg Tyr Gly
Val Ser Arg Ile Ala Tyr Ser Lys Asp Phe Glu Thr 100 105 110Leu Lys
Val Asp Phe Leu Ser Lys Leu Pro Glu Met Leu Lys Met Phe 115 120
125Glu Asp Arg Leu Cys His Lys Thr Tyr Leu Asn Gly Asp His Val Thr
130 135 140His Pro Asp Phe Met Leu Tyr Asp Ala Leu Asp Val Val Leu
Tyr Met145 150 155 160Asp Pro Met Cys Leu Asp Ala Phe Pro Lys Leu
Val Cys Phe Lys Lys 165 170 175Arg Ile Glu Ala Ile Pro Gln Ile Asp
Lys Tyr Leu Lys Ser Ser Lys 180 185 190Tyr Ile Trp Pro Leu Gln Gly
Trp Gln Ala Thr Phe Gly Gly Gly Asp 195 200 205His Pro Pro Lys Ser
Asp Leu Val Pro Arg His Asn Gln Thr Ser Leu 210 215 220Tyr Lys Lys
Ala Gly Ser Ala Ala Ala Val Leu Glu Glu Asn Leu Tyr225 230 235
240Phe Gln Gly Thr Tyr Lys Tyr Leu Gln Lys Pro Met Tyr Glu Val Gln
245 250 255Trp Lys Val Val Glu Glu Ile Asn Gly Asn Asn Tyr Val Tyr
Ile Asp 260 265 270Pro Thr Gln Leu Pro Tyr Asp His Lys Trp Glu Phe
Pro Arg Asn Arg 275 280 285Leu Ser Phe Gly Lys Thr Leu Gly Ala Gly
Ala Phe Gly Lys Val Val 290 295 300Glu Ala Thr Ala Tyr Gly Leu Ile
Lys Ser Asp Ala Ala Met Thr Val305 310 315 320Ala Val Lys Met Leu
Lys Pro Ser Ala His Leu Thr Glu Arg Glu Ala 325 330 335Leu Met Ser
Glu Leu Lys Val Leu Ser Tyr Leu Gly Asn His Met Asn 340 345 350Ile
Val Asn Leu Leu Gly Ala Cys Thr Ile Gly Gly Pro Thr Leu Val 355 360
365Ile Thr Glu Tyr Cys Cys Tyr Gly Asp Leu Leu Asn Phe Leu Arg Arg
370 375 380Lys Arg Asp Ser Phe Ile Cys Ser Lys Gln Glu Asp His Ala
Glu Ala385 390 395 400Ala Leu Tyr Lys Asn Leu Leu His Ser Lys Glu
Ser Ser Cys Ser Asp 405 410 415Ser Thr Asn Glu Tyr Met Asp Met Lys
Pro Gly Val Ser Tyr Val Val 420 425 430Pro Thr Lys Ala Asp Lys Arg
Arg Ser Val Arg Ile Gly Ser Tyr Ile 435 440 445Glu Arg Asp Val Thr
Pro Ala Ile Met Glu Asp Asp Glu Leu Ala Leu 450 455 460Asp Leu Glu
Asp Leu Leu Ser Phe Ser Tyr Gln Val Ala Lys Gly Met465 470 475
480Ala Phe Leu Ala Ser Lys Asn Cys Ile His Arg Asp Leu Ala Ala Arg
485 490 495Asn Ile Leu Leu Thr His Gly Arg Ile Thr Lys Ile Cys Asp
Phe Gly 500 505 510Leu Ala Arg Asp Ile Lys Asn Asp Ser Asn Tyr Val
Val Lys Gly Asn 515 520 525Ala Arg Leu Pro Val Lys Trp Met Ala Pro
Glu Ser Ile Phe Asn Cys 530 535 540Val Tyr Thr Phe Glu Ser Asp Val
Trp Ser Tyr Gly Ile Phe Leu Trp545 550 555 560Glu Leu Phe Ser Leu
Gly Ser Ser Pro Tyr Pro Gly Met Pro Val Asp 565 570 575Ser Lys Phe
Tyr Lys Met Ile Lys Glu Gly Phe Arg Met Leu Ser Pro 580 585 590Glu
His Ala Pro Ala Glu Met Tyr Asp Ile Met Lys Thr Cys Trp Asp 595 600
605Ala Asp Pro Leu Lys Arg Pro Thr Phe Lys Gln Ile Val Gln Leu Ile
610 615 620Glu Lys Gln Ile Ser Glu Ser Thr Asn His Ile Tyr Ser Asn
Leu Ala625 630 635 640Asn Cys Ser Pro Asn Arg Gln Lys Pro Val Val
Asp His Ser Val Arg 645 650 655Ile Asn Ser Val Gly Ser Thr Ala Ser
Ser Ser Gln Pro Leu Leu Val 660 665 670His Asp Asp Val
6752474PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 2Met Ser Tyr Tyr His His His His His His Asp
Tyr Asp Ile Pro Thr1 5 10 15Thr Glu Asn Leu Tyr Phe Gln Gly Ala Met
Leu Val Pro Arg Gly Ser 20 25 30Pro Trp Ile Pro Phe Thr Met Lys Lys
Arg Lys Gln Ile Lys Asp Leu 35 40 45Gly Ser Glu Leu Val Arg Tyr Asp
Ala Arg Val His Thr Pro His Leu 50 55 60Asp Arg Leu Val Ser Ala Arg
Ser Val Ser Pro Thr Thr Glu Met Val65 70 75 80Ser Asn Glu Ser Val
Asp Tyr Arg Ala Thr Phe Pro Glu Asp Gln Phe 85 90 95Pro Asn Ser Ser
Gln Asn Gly Ser Cys Arg Gln Val Gln Tyr Pro Leu 100 105 110Thr Asp
Met Ser Pro Ile Leu Thr Ser Gly Asp Ser Asp Ile Ser Ser 115 120
125Pro Leu Leu Gln Asn Thr Val His Ile Asp Leu Ser Ala Leu Asn Pro
130 135 140Glu Leu Val Gln Ala Val Gln His Val Val Ile Gly Pro Ser
Ser Leu145 150 155 160Ile Val His Phe Asn Glu Val Ile Gly Arg Gly
His Phe Gly Cys Val 165 170 175Tyr His Gly Thr Leu Leu Asp Asn Asp
Gly Lys Lys Ile His Cys Ala 180 185 190Val Lys Ser Leu Asn Arg Ile
Thr Asp Ile Gly Glu Val Ser Gln Phe 195 200 205Leu Thr Glu Gly Ile
Ile Met Lys Asp Phe Ser His Pro Asn Val Leu 210 215 220Ser Leu Leu
Gly Ile Cys Leu Arg Ser Glu Gly Ser Pro Leu Val Val225 230 235
240Leu Pro Tyr Met Lys His Gly Asp Leu Arg Asn Phe Ile Arg Asn Glu
245 250 255Thr His Asn Pro Thr Val Lys Asp Leu Ile Gly Phe Gly Leu
Gln Val 260 265 270Ala Lys Gly Met Lys Tyr Leu Ala Ser Lys Lys Phe
Val His Arg Asp 275 280 285Leu Ala Ala Arg Asn Cys Met Leu Asp Glu
Lys Phe Thr Val Lys Val 290 295 300Ala Asp Phe Gly Leu Ala Arg Asp
Met Tyr Asp Lys Glu Tyr Tyr Ser305 310 315 320Val His Asn Lys Thr
Gly Ala Lys Leu Pro Val Lys Trp Met Ala Leu 325 330 335Glu Ser Leu
Gln Thr Gln Lys Phe Thr Thr Lys Ser Asp Val Trp Ser 340 345 350Phe
Gly Val Leu Leu Trp Glu Leu Met Thr Arg Gly Ala Pro Pro Tyr 355 360
365Pro Asp Val Asn Thr Phe Asp Ile Thr Val Tyr Leu Leu Gln Gly Arg
370 375 380Arg Leu Leu Gln Pro Glu Tyr Cys Pro Asp Pro Leu Tyr Glu
Val Met385 390 395 400Leu Lys Cys Trp His Pro Lys Ala Glu Met Arg
Pro Ser Phe Ser Glu 405 410 415Leu Val Ser Arg Ile Ser Ala Ile Phe
Ser Thr Phe Ile Gly Glu His 420 425 430Tyr Val His Val Asn Ala Thr
Tyr Val Asn Val Lys Cys Val Ala Pro 435 440 445Tyr Pro Ser Leu Leu
Ser Ser Glu Asp Asn Ala Asp Asp Glu Val Asp 450 455 460Thr Arg Pro
Ala Ser Phe Trp Glu Thr Ser465 4703315PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
3Asp Pro Asp Glu Leu Pro Leu Asp Glu His Cys Glu Arg Leu Pro Tyr1 5
10 15Asp Ala Ser Lys Trp Glu Phe Pro Arg Asp Arg Leu Lys Leu Gly
Lys 20 25 30Pro Leu Gly Arg Gly Ala Phe Gly Gln Val Ile Glu Ala Asp
Ala Phe 35 40 45Gly Ile Asp Lys Thr Ala Thr Cys Arg Thr Val Ala Val
Lys Met Leu 50 55 60Lys Glu Gly Ala Thr His Ser Glu His Arg Ala Leu
Met Ser Glu Leu65 70 75 80Lys Ile Leu Ile His Ile Gly His His Leu
Asn Val Val Asn Leu Leu 85 90 95Gly Ala Cys Thr Lys Pro Gly Gly Pro
Leu Met Val Ile Val Glu Phe 100 105 110Cys Lys Phe Gly Asn Leu Ser
Thr Tyr Leu Arg Ser Lys Arg Asn Glu 115 120 125Phe Val Pro Tyr Lys
Val Ala Pro Glu Asp Leu Tyr Lys Asp Phe Leu 130 135 140Thr Leu Glu
His Leu Ile Cys Tyr Ser Phe Gln Val Ala Lys Gly Met145 150 155
160Glu Phe Leu Ala Ser Arg Lys Cys Ile His Arg Asp Leu Ala Ala Arg
165 170 175Asn Ile Leu Leu Ser Glu Lys Asn Val Val Lys Ile Cys Asp
Phe Gly 180 185 190Leu Ala Arg Asp Ile Tyr Lys Asp Pro Asp Tyr Val
Arg Lys Gly Asp 195 200 205Ala Arg Leu Pro Leu Lys Trp Met Ala Pro
Glu Thr Ile Phe Asp Arg 210 215 220Val Tyr Thr Ile Gln Ser Asp Val
Trp Ser Phe Gly Val Leu Leu Trp225 230 235 240Glu Ile Phe Ser Leu
Gly Ala Ser Pro Tyr Pro Gly Val Lys Ile Asp 245 250 255Glu Glu Phe
Cys Arg Arg Leu Lys Glu Gly Thr Arg Met Arg Ala Pro 260 265 270Asp
Tyr Thr Thr Pro Glu Met Tyr Gln Thr Met Leu Asp Cys Trp His 275 280
285Gly Glu Pro Ser Gln Arg Pro Thr Phe Ser Glu Leu Val Glu His Leu
290 295 300Gly Asn Leu Leu Gln Ala Asn Ala Gln Gln Asp305 310
31545PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 4Glu Glu Glu Glu Tyr1 5
* * * * *
References