U.S. patent application number 11/318399 was filed with the patent office on 2007-04-05 for enzyme modulators and treatments.
Invention is credited to Daniel L. Flynn, Peter A. Petillo.
Application Number | 20070078121 11/318399 |
Document ID | / |
Family ID | 36615509 |
Filed Date | 2007-04-05 |
United States Patent
Application |
20070078121 |
Kind Code |
A1 |
Flynn; Daniel L. ; et
al. |
April 5, 2007 |
Enzyme modulators and treatments
Abstract
Novel compounds and methods of using those compounds for the
treatment of inflammatory conditions, immunological disorders,
hyperproliferative diseases, cancer, and diseases characterized by
hyper-vascularization are provided. In a preferred embodiment,
modulation of the activation state of kinases, including p38 kinase
protein, abl kinase protein, bcr-abl kinase protein, braf kinase
protein, VEGFR kinase protein, or PDGFR kinase protein, comprises
the step of contacting said kinase protein with the novel
compounds.
Inventors: |
Flynn; Daniel L.; (Lawrence,
KS) ; Petillo; Peter A.; (Lawrence, KS) |
Correspondence
Address: |
HOVEY WILLIAMS LLP
2405 GRAND BLVD., SUITE 400
KANSAS CITY
MO
64108
US
|
Family ID: |
36615509 |
Appl. No.: |
11/318399 |
Filed: |
December 23, 2005 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
60639087 |
Dec 23, 2004 |
|
|
|
60638986 |
Dec 23, 2004 |
|
|
|
60638987 |
Dec 23, 2004 |
|
|
|
60638968 |
Dec 23, 2004 |
|
|
|
Current U.S.
Class: |
514/212.07 ;
514/217.01; 514/227.8; 514/232.8; 514/234.2; 514/249; 514/253.05;
514/253.07; 514/303; 514/309; 514/310; 514/312; 514/322; 514/323;
514/373; 514/375; 514/394; 514/414; 514/418; 540/523; 540/593;
544/120; 544/128; 544/330; 544/363; 544/368; 544/373; 544/60;
546/143; 546/153; 546/198; 546/199 |
Current CPC
Class: |
C07D 231/38 20130101;
C07D 417/12 20130101; C07D 471/04 20130101; C07D 417/04 20130101;
C07D 409/04 20130101; A61P 9/00 20180101; C07D 413/10 20130101;
A61P 19/08 20180101; C07D 403/12 20130101; A61P 19/02 20180101;
A61P 17/06 20180101; C07D 401/14 20130101; C07D 403/10 20130101;
A61P 31/04 20180101; C07D 403/04 20130101; C07D 401/10 20130101;
C07D 405/12 20130101; A61P 15/00 20180101; C07D 401/04 20130101;
C07D 413/12 20130101; A61P 37/00 20180101; A61P 43/00 20180101;
A61P 11/06 20180101; C07D 417/14 20130101; C07D 209/46 20130101;
A61P 29/00 20180101; A61P 35/00 20180101; A61P 37/06 20180101; C07D
401/12 20130101; A61P 1/04 20180101; A61P 7/08 20180101; A61P 9/10
20180101; A61P 11/00 20180101; A61P 35/02 20180101; C07D 409/12
20130101; A61P 17/02 20180101; A61P 35/04 20180101; C07D 231/40
20130101; C07D 409/14 20130101; C07D 403/14 20130101 |
Class at
Publication: |
514/212.07 ;
514/217.01; 514/309; 514/310; 514/312; 514/227.8; 514/232.8;
514/234.2; 514/303; 514/375; 514/394; 514/373; 514/414; 514/418;
514/253.05; 514/253.07; 514/249; 514/322; 514/323; 540/523;
540/593; 544/060; 544/120; 544/128; 544/363; 544/373; 544/330;
546/143; 546/153; 544/368; 546/198; 546/199 |
International
Class: |
A61K 31/55 20060101
A61K031/55; A61K 31/541 20060101 A61K031/541; A61K 31/5377 20060101
A61K031/5377; A61K 31/498 20060101 A61K031/498; A61K 31/496
20060101 A61K031/496; A61K 31/454 20060101 A61K031/454; C07D 413/02
20060101 C07D413/02; C07D 417/02 20060101 C07D417/02; C07D 403/02
20060101 C07D403/02 |
Claims
1. Compounds of the formula ##STR1044## wherein A2 is selected from
the group consisting of bicyclic fused aryl, bicyclic fused
heteroaryl, and bicyclic fused heterocyclyl rings, each A2 moiety
presenting a proximal ring bonded with A1 and a distal ring
attached to the proximal ring, and either the distal ring has a
heteroatom in the ring structure thereof and/or the distal ring has
Z2 or Z3 substituents; A1 is selected from the group consisting of
R2' and R7-substituted phenyl, pyridyl, or pyrimidinyl,
R2-substituted monocyclic 5-membered ring heteroaryl, and
R2'-substituted monocyclic heterocyclyl moieties; W and Y are CHR4,
NR3, or O and wherein W and Y are not simultaneously O; X is O, S,
or NR3; D comprises a member of the group consisting of Z5- or
Z6-substituted mono- and poly-aryl, of Z5- or Z6-substituted mono-
and poly-heteroaryl, of Z5- or Z6-substituted mono- and
poly-heterocyclyl, of Z5- or Z6-substituted mono- and
poly-arylalkyl, of Z5- or Z6-substituted mono- and poly-aryl
branched alkyl, of Z5- or Z6-substituted mono- and
poly-heteroarylalkyl, of Z5- or Z6-substituted mono- and
poly-heteroaryl branched alkyl, of Z5- or Z6-substituted mono- and
poly-heterocyclylalkyl, of Z5- or Z6-substituted mono- and
poly-heterocyclyl branched alkyl, alkyl, and carbocyclyl moieties;
each Z2 is independently and individually selected from the group
consisting of hydroxyl, hydroxyC1-C6alkyl, cyano, (R3).sub.2N--,
(R4).sub.2N--, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl, carboxyl,
carboxyC1-C6alkyl, C1-C6alkoxycarbonyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2,
(R4).sub.2NSO.sub.2, --SO.sub.2R5-, --(CH.sub.2).sub.nN(R4)C(O)R8,
.dbd.O, .dbd.NOH, .dbd.N(OR6), heteroarylC1-C6alkyl,
heterocyclylC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, heterocyclylaminoC1-C6alkyl, or moieties
of the formulae ##STR1045## wherein the symbol (#) indicates the
point of attachment of the Z2 moiety to the A2 ring of formula I;
in the event that Z2 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z2 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z2 may cyclize to
form a C3-C7 heterocyclyl ring; each Z3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyl, hydroxyC1-C6alkyl, cyano, C1-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, halogen, CF.sub.3, (R3).sub.2N--,
(R4).sub.2N--, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, --R8C(.dbd.O)--,
(R4).sub.2N--CO--C1-C6alkyl, carboxyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R3).sub.2NSO.sub.2, --SO.sub.2R3, SOR3, (R4).sub.2NSO.sub.2,
--SO.sub.2R4, --SOR4, --(CH.sub.2).sub.nN(R4)C(O)R8,
--C.dbd.(NOH)R6, --C.dbd.(NOR3)R6, heteroaryl, heterocyclyl,
heteroarylC1-C6alkyl, heterocyclylC1-C6alkyl, heteroaryloxy,
heterocyclyloxy, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylamino, heteroarylamino,
heterocyclylamino, arylaminoC1-C6alkyl, heteroarylaminoC1-C6alkyl,
heterocyclylaminoC1-C6alkyl, or moieties of the formulae
##STR1046## wherein the symbol (#) indicates the point of
attachment of the Z3 moiety to the A2 ring of formula I; in the
event that Z3 contains an alkyl or alkylene moiety, such moieties
may be further substituted with one or more C1-C6alkyls; wherein
two R3 moieties are independently and individually taken from the
group consisting of C1-C6alkyl and branched C3-C6alkyl and are
attached to the same nitrogen heteroatom of Z3 may cyclize to form
a C3-C7 heterocyclyl ring; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z3 may cyclize to form a C3-C7
heterocyclyl ring; each Z5 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, halogen, fluoroalkyl, cyano, hydroxyl, alkoxy, oxo,
aminocarbonyl, carbonylamino, aminosulfonyl, sulfonylamino,
--N(R3).sub.2, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --R5, --O--(CH.sub.2)q-O-Alkyl,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-O-Alkyl,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --O--(CH.sub.2)q-R5, and
--N(R3)-(CH.sub.2)q-R5; wherein two R3 moieties are independently
and individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring;
each Z6 is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, hydroxyl,
C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8, (R4).sub.2N--, --R5,
--N(R4)COR8, --N(R3)SO.sub.2R6-, --CON(R3).sub.2, --CON(R4).sub.2,
--COR5, --SO.sub.2NHR4, heteroaryl, heterocyclyl, heteroaryloxy,
heterocyclyloxy, arylamino, heteroarylamino, and heterocyclylamino;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z6 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z6 may cyclize to
form a C3-C7 heterocyclyl ring; each R2 is selected from the group
consisting of alkyl, branched alkyl, fluoroalkyl, wherein the alkyl
group is partially or fully fluorinated, and R19 substituted
C3-C8carbocyclyl wherein R19 is H and C1-C6alkyl; each R2' is
selected from the group consisting of halogen and R2; each R3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl;
each R4 is selected from the group consisting of H, C1-C6alkyl,
hydroxyC1-C6 alkyl, dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
branched C3-C7alkyl, branched hydroxyC1-C6 alkyl, branched
C1-C6alkoxyC1-C6alkyl, branched dihydroxyC1-C6alkyl, carbocyclyl,
hydroxyl substituted carbocyclyl, alkoxy substituted carbocyclyl,
dihydroxy substituted carbocyclyl, phenyl, heteroaryl,
heterocyclyl, phenylC1-C6alkyl, heteroarylC1-C6alkyl, and
heterocyclylC1-C6alkyl; each R5 is independently and individually
selected from the group consisting of ##STR1047## and wherein the
symbol (##) is the point of attachment to respective R8, R10, Z2,
or Z3, moieties containing a R5 moiety; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of R5 may cyclize to
form a C3-C7 heterocyclyl ring; each R6 is independently and
individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, phenyl, heteroaryl, and
heterocyclyl; each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or C1-C3alkoxy;
each R8 is independently and individually selected from the group
consisting of C1-C6alkyl, branched C3-C7alkyl, fluoroalkyl wherein
the alkyl moiety is partially or fully fluorinated, carbocyclyl,
phenyl, C1-C6phenylalkyl, heteroaryl or heteroarylC1-C6alkyl,
heterocyclyl, heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2,
N(R4).sub.2, or R5; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of R8 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of R8 may cyclize to form a C3-C7 heterocyclyl ring;
each R10 is independently and individually selected from the group
consisting of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH,
C1-C6alkoxy, --N(R4).sub.2; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1;
and tautomers, diastereomers, geometric isomers, enantiomers,
hydrates, prodrugs and salts of any of the foregoing.
2. The compounds of claim 1 wherein D is a moiety of the formula
##STR1048## wherein E1 is selected from the group consisting
cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, pyrrolidinyl
piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl; wherein the
symbol (***) is the point of attachment to the Y group of formula
I; X1 is selected from the group consisting of O, S, NR3,
--C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2).sub.n--N(R4)--C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2).sub.p--, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I; and
wherein the carbon atoms of --(CH.sub.2)n-, --(CH.sub.2)q-,
--(CH.sub.2)p-, C2-C5alkenyl, and C2-C5alkynyl of X2 can be further
substituted by one or more C1-C6alkyl; and E2 is selected from the
group comprising cyclopentyl, cyclohexyl, phenyl, naphthyl,
pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
triazolyl, tetrazolyl, pyridinyl, pyrimidinyl, pyrazinyl,
pyridazinyl, triazinyl, fused bicyclic rings selected from the
group comprising indolyl, isoindolyl, isoindolinyl, isoindolonyl,
indazolyl, benzofuranyl, benzothienyl, benzothiazolyl,
benzothiazolonyl, benzoxazolyl, benzoxazolonyl, benzisoxazolyl,
benzisothiazolyl, benzimidazolyl, benzimidazolonyl, benztriazolyl,
imidazopyridinyl, imidazopyrimidinyl, imidazolonopyrimidinyl,
dihydropurinonyl, pyrrolopyrimidinyl, purinyl, pyrazolopyridinyl,
pyrazolopyrimidinyl, isoxazolopyrimidinyl, isothiazolopyrimidinyl,
furylopyrimidinyl, thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl,
non-fused bicyclic rings comprising pyridylpyridiminyl,
pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl,
imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl; and n is 0-4; p
is 1-4; q is 2-6.
3. The compounds of claim 1 wherein D comprises carbocyclyls and a
moiety of the formula ##STR1049## X2 is selected from the group
consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct bond
wherein E2 is directly linked to the Y group of formula I.
4. The compounds of claim 3 wherein the E2 ring is selected from
the group comprising cyclopentyl, cyclohexyl, phenyl, naphthyl,
pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
triazolyl, tetrazolyl, pyridinyl, pyrimidinyl, pyrazinyl,
pyridazinyl, triazinyl, fused bicyclic rings selected from the
group comprising indolyl, isoindolyl, isoindolinyl, isoindolonyl,
indazolyl, benzofuranyl, benzothienyl, benzothiazolyl,
benzothiazolonyl, benzoxazolyl, benzoxazolonyl, benzisoxazolyl,
benzisothiazolyl, benzimidazolyl, benzimidazolonyl, benztriazolyl,
imidazopyridinyl, imidazopyrimidinyl, imidazolonopyrimidinyl,
dihydropurinonyl, pyrrolopyrimidinyl, purinyl, pyrazolopyridinyl,
pyrazolopyrimidinyl, isoxazolopyrimidinyl, isothiazolopyrimidinyl,
furylopyrimidinyl, thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl,
non-fused bicyclic rings comprising pyridylpyridiminyl,
pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl,
imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl.
5. The compounds of claim 1 wherein A2 is selected from the group
consisting of ##STR1050## ##STR1051## ##STR1052## ##STR1053##
##STR1054## ##STR1055## and wherein the symbol (**) is the point of
attachment to the A1 ring of formula I; and wherein ----- indicates
either a saturated or an unsaturated bond; wherein each Z3 and Z5
may be independently attached to either of the rings making up the
foregoing bicyclic structures; each R9 is independently and
individually selected from the group consisting of H, F,
C1-C6alkyl, branched C4-C7alkyl, carbocyclyl, phenyl, phenyl
C1-C6alkyl, heterocyclyl and heterocyclylC1-C6alkyl; each R13 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, branched C3-C7alkyl, carbocyclyl,
hydroxyC2-C7alkyl, C1-C6alkoxyC2-C7alkyl, (R4).sub.2N--CO,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.q,
R5-C2-C6alkylN(R4)-(CH.sub.2).sub.q,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.q,
R5-C2-C6alkyl-O--(CH.sub.2).sub.q, --(CH2).sub.qN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC2-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, and heterocyclylaminoC2-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R13
may cyclize to form a C3-C7 heterocyclyl ring; each R14 is
independently and respectively selected from the group consisting
of H and C1-C6alkyl; V, V1, and V2 are each independently and
respectively selected from the group consisting of O and H.sub.2;
each Z4 is a substituent attached to a ring nitrogen and is
independently and individually selected from the group consisting
of H, C1-C6alkyl, hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl,
(R4).sub.2N--C2-C6alkyl, (R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1056## wherein the symbol (#)
indicates the point of attachment of the Z4 moiety to the A2 ring
for formula I; in the event that Z4 contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; and
n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v is 1 or 2.
6. The compounds of claim 5, wherein A2 is selected from the group
consisting of ##STR1057## ##STR1058## and wherein the symbol (**)
is the point of attachment to the A1 ring for formula I; wherein
each Z3 and Z5 is independently attached to either aryl or
heteroaryl ring of the A2 bicyclic ring.
7. The compounds of claim 6, wherein A2 is selected from the group
consisting of ##STR1059## and wherein the symbol (**) is the point
of attachment to the A1 ring of formula I; wherein each Z3 and Z5
is independently attached to either aryl or heteroaryl ring of the
A2 bicyclic ring.
8. The compounds of claim 2 wherein said A2 group is defined as set
forth in claim 5.
9. The compounds of claim 8 wherein said A2 group is defined as set
forth in claim 6.
10. The compounds of claim 8 wherein said A2 group is defined as
set forth in claim 7.
11. The compounds of claim 3 wherein said A2 group is defined as
set forth in claim 5.
12. The compounds of claim 11 wherein said A2 group is defined as
set forth in claim 6.
13. The compounds of claim 11 wherein said A2 group is defined as
set forth in claim 7.
14. The compounds of claims 1, 5, 8 or 11, wherein A1 is selected
from the group consisting of ##STR1060## wherein the symbol (*)
denotes the attachment to the W moiety of formula I and the symbol
(**) denotes the attachment to the A2 moiety of formula I.
15. The compounds of claims 1, 5, 8 or 11 wherein A1 is selected
from the group consisting of ##STR1061## wherein the symbol (*)
denotes the attachment to the W moiety of formula I and the symbol
(**) denotes the attachment to the A2 moiety of formula I;
16. The compounds of claims 1, 5, 8 or 11 wherein A1 is selected
from the group consisting of ##STR1062## wherein the symbol (*)
denotes the attachment to the W moiety of formula I and the symbol
(**) denotes the attachment to the A2 moiety of formula I;
17. The compounds of claims 1, 5, 8, 11 wherein: (1) W and Y are
each NH, and X.dbd.O; (2) W.dbd.NH, Y.dbd.CHR4 and X.dbd.O; or (3)
W.dbd.CHR4, Y.dbd.NH, and X.dbd.O.
18. The compounds of claims 1, 5, 8, 11 wherein W and Y are each NH
and X.dbd.O.
19. Compounds of the formula ##STR1063## wherein A2 is selected
from the group consisting of ##STR1064## wherein each Z3 and Z5 is
independently attached to either aryl or heteroaryl ring of the A2
bicyclic ring; wherein the symbol (**) denotes the attachment to
the A1 moiety of formula I; A1 is selected from the group
consisting of ##STR1065## wherein the symbol (*) denotes the
attachment to the W moiety of formula I and the symbol (**) denotes
the attachment to the A2 moiety of formula I; X is O, S, or NR3; D
is selected from the group consisting of 2,3-dichlorophenyl,
2-fluorophenyl, 3-fluorophenyl, 4-fluorophenyl, 3-cyanophenyl,
2,3-difluorophenyl, 2,4-difluorophenyl, 3,4-difluorophenyl,
2,5-difluorophenyl, 3,5-difluorophenyl, 2,3,5-trifluorophenyl,
2,4,5-trifluorophenyl, 2,3,4-trifluorophenyl,
3,4,5-trifluorophenyl, 4-cyanophenyl, 3-fluoro-5-cyanophenyl,
3-(R8SO.sub.2)-phenyl, 3-(hydroxyC1-C3alkyl)-phenyl,
3-(R3O--N.dbd.C(R6))-phenyl, 3-phenoxyphenyl, 4 phenoxyphenyl,
##STR1066## ##STR1067## ##STR1068## ##STR1069## ##STR1070## wherein
E1 is selected from the group consisting cyclopropyl, cyclobutyl,
cyclopentyl, cyclohexyl, pyrrolidinyl piperidinyl, phenyl, thienyl,
oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl,
oxadiazolyl, thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl
and naphthyl; X1 is selected from the group consisting of O, S,
NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I; and
wherein the carbon atoms of --(CH.sub.2)n-, --(CH.sub.2)q-,
--(CH.sub.2)p-, C2-C5alkenyl, and C2-C5alkynyl of X2 can be further
substituted by one or more C1-C6alkyl; each R2 is selected from the
group consisting of alkyl, branched alkyl, fluoroalkyl, wherein the
alkyl group is partially or fully fluorinated, and R19 substituted
C3-C8carbocyclyl wherein R19 is H and C1-C6alkyl; each R2' is
selected from the group consisting of halogen and R2; each R3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl;
wherein two R3 moieties independently and individually taken from
the group consisting of C1-C6alkyl and branched C3-C7alkyl are
attached to the same nitrogen heteroatom, the two R3 moieties may
cyclize to form a C3-C7 heterocyclyl ring; each R4 is selected from
the group consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom may
cyclize to form a C3-C7 heterocyclyl ring; each R5 is independently
and individually selected from the group consisting of ##STR1071##
and wherein the symbol (##) is the point of attachment to
respective R8, R10, R13, Z2, Z3, Z4, Z5, or A2 ring moieties
containing a R5 moiety; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R5 may cyclize to form a C3-C7
heterocyclyl ring; wherein each R6 is independently and
individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, phenyl, heteroaryl, and
heterocyclyl; each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or C1-C3alkoxy;
each R8 is independently and individually selected from the group
consisting of C1-C6alkyl, branched C3-C7alkyl, fluoroalkyl wherein
the alkyl moiety is partially or fully fluorinated, carbocyclyl,
phenyl, C1-C6phenylalkyl, heteroaryl or heteroarylC1-C6alkyl,
heterocyclyl, heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2,
N(R4).sub.2, or R5; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of R8 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of R8 may cyclize to form a C3-C7 heterocyclyl ring;
each R10 is independently and individually selected from the group
consisting of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH,
C1-C6alkoxy, --N(R4).sub.2; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; each R13 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, carbocyclyl, hydroxyC2-C7alkyl, C1-C6alkoxyC2-C7alkyl,
(R4).sub.2N--CO, (R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.q,
R5-C2-C6alkylN(R4)-(CH.sub.2).sub.q,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.q,
R5-C2-C6alkyl-O--(CH.sub.2).sub.q, --(CH.sub.2).sub.qN(R4)C(O)R8,
aryl, arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl,
heterocyclyl, heterocyclylC1-C6alkyl, aryloxyC2-C6alkyl,
heteroaryloxyC2-C6alkyl, heterocyclyloxyC2-C6alkyl,
arylaminoC2-C6alkyl, heteroarylaminoC2-C6alkyl, and
heterocyclylaminoC2-C6alkyl; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R13 may cyclize to form a C3-C7
heterocyclyl ring; each R14 is independently and respectively
selected from the group consisting of H and C1-C6alkyl; V, V1, and
V2 are each independently and respectively selected from the group
consisting of O and H.sub.2; each Z3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyl, hydroxyC1-C6alkyl, cyano, C1-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, halogen, CF.sub.3, (R3).sub.2N--,
(R4).sub.2N--, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, R8CO--,
(R4).sub.2N--CO--C1-C6alkyl, carboxyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R3).sub.2NSO.sub.2, --SO.sub.2R3, SOR3, (R4).sub.2NSO.sub.2,
--SO.sub.2R4, --SOR4, --(CH.sub.2).sub.nN(R4)C(O)R8,
--C.dbd.(NOH)R6, --C.dbd.(NOR3)R6, heteroaryl, heterocyclyl,
heteroarylC1-C6alkyl, heterocyclylC1-C6alkyl, heteroaryloxy,
heterocyclyloxy, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylamino, heteroarylamino,
heterocyclylamino, arylaminoC1-C6alkyl, heteroarylaminoC1-C6alkyl,
heterocyclylaminoC1-C6alkyl, or moieties of the formulae
##STR1072## wherein the symbol (#) indicates the point of
attachment of the Z3 moiety to the A2 ring of formula I; in the
event that Z3 contains an alkyl or alkylene moiety, such moieties
may be further substituted with one or more C1-C6alkyls; wherein
two R3 moieties are independently and individually taken from the
group consisting of C1-C6alkyl and branched C3-C6alkyl and are
attached to the same nitrogen heteroatom of Z3 may cyclize to form
a C3-C7 heterocyclyl ring; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z3 may cyclize to form a C3-C7
heterocyclyl ring; each Z4 is a substituent attached to a ring
nitrogen and is independently and individually selected from the
group consisting of H, C1-C6alkyl, hydroxyC2-C6alkyl,
C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1073## wherein the symbol (#)
indicates the point of attachment of the Z4 moiety to the A2 ring
for formula I; in the event that Z4 contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2; and tautomers, diastereomers, geometric isomers,
enantiomers, hydrates, prodrugs and salts of any of the
foregoing.
20. Most preferred compounds from claim 19 are
1-(3-t-butyl-1-(1-(methanesulfonylureidoamidomethyl)naphthalen-3-yl)-1H-p-
yrazol-5-yl)3-(2,3-dichlorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
1-(1-(4-(2-aminoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3--
dichlorophenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(2-
,3-dichlorophenyl)urea,
(3S)-6-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-1,2,3-
,4-tetrahydroisoquinoline-3-carboxylic acid,
6-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-1,2,3,4-te-
trahydroisoquinoline-3-carboxylic acid,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,3,4-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,4-
,5-trifluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)naphthalen-2-y-
l)-1H-pyrazol-5-yl)-3-(2,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-((1-amino-1-oxo-methylamino)methyl)naphthalen-2-yl)-1H--
pyrazol-5-yl)-3-(2,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(2-
,4,5-trifluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,3,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)naphthalen-2-y-
l)-1H-pyrazol-5-yl)-3-(2,3,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,3-
,5-trifluorophenyl)urea,
1-(1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3,5-
-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-((1-amino-1-oxo-methylamino)methyl)naphthalen-2-yl)-1H--
pyrazol-5-yl)-3-(2,3,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(3,4-
,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)naphthalen-2-y-
l)-1H-pyrazol-5-yl)-3-(3,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(3,5-
-difluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(3,5-difluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,5-difluorophenyl)urea,
1-(3-t-butyl-1-(4-(2-(1,3-dihydroxypropan-2-ylamino)-2-oxoethyl)naphthale-
n-2-yl)-1H-pyrazol-5-yl)-3-(2,5-difluorophenyl)urea,
1-(1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-cya-
nophenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-cyanophenyl)urea,
1-(3-t-butyl-1-(1H-indol-5-yl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phe-
nyl)urea,
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-y-
loxy)phenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(4-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)naphthalen-2-y-
l)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(3-(-
pyridin-3-yloxy)phenyl)urea,
1-(1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(py-
ridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(5-chloropyridin-3-yloxy)phenyl)urea,
6-(3-t-butyl-5-(3-(3-(pyridin-3-yloxy)phenyl)ureido)-1H-pyrazol-1-yl)-1,2-
,3,4-tetrahydroisoquinoline-3-carboxylic acid,
1-(3-t-butyl-1-(3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazo-
l-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(3-(methylcarbamoyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1-
H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1-(methylcarbamoyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1-
H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(py-
ridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(quinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phe-
nyl)urea,
1-(3-cyclopentyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-
-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-(piperazin-1-yl)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2-
-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(1-(2-(2-aminoethylamino)quinolin-6-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-cyclopentyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-(dimethylamino)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-((R)-3-(dimethylamino)pyrrolidin-1-yl)quinolin-6-yl)-1H-
-pyrazol-5-yl)-3-(4-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(1-(2-aminoquinolin-6-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(2-(methylcar-
bamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-(methylamino)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2-(m-
ethylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-(1-oxoisoindolin-4-yl)phenyl)urea,
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(4-(1-oxoisoindolin-4-yl-
)phenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(4-(1--
oxoisoindolin-4-yl)phenyl)urea,
6-(3-t-butyl-5-(3-(4-(1-oxoisoindolin-4-yl)phenyl)ureido)-1H-pyrazol-1-yl-
)-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-
-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(8--
methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazo-
l-5-yl)-3-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl-
)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3--
(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(1H-indol-5-yl)-1H-pyrazol-5-yl)-3-(3-(8-methyl-7-oxo-7,8--
dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(2-(piperazin-1-yl)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(8-
-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea,
1-(3-t-butyl-1-(2-(piperazin-1-yl)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-me-
thyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea
21. A method of modulating a kinase activity of a wild-type kinase,
oncogenic forms thereof, aberrant fusion proteins thereof and
polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 1.
22. The method of claim 21, said kinase species being activated or
unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
23. The method of claim 21, said kinase activity selected from the
group consisting of catalysis of phospho transfer reactions, kinase
cellular localization, and recruitment of other proteins into
signaling complexes through modulation of kinase conformation.
24. A method of modulating a kinase activity of a wild-type kinase,
oncogenic forms thereof, aberrant fusion proteins thereof and
polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 19.
25. The method of claim 24, said species being activated or
unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
26. The method of claim 24, said kinase activity selected from the
group consisting of catalysis of phospho transfer reactions, kinase
cellular localization, and recruitment of other proteins into
signaling complexes through modulation of kinase conformation.
27. A pharmaceutical composition comprising a compound of claim 1
together with a pharmaceutically acceptable carrier.
28. The composition of claim 27 including an additive selected from
the group including adjuvants, excipients, diluents, and
stablilizers.
29. A pharmaceutical composition comprising a compound of claim 19
together with a pharmaceutically acceptable carrier.
30. The composition of claim 29 including an additive selected from
the group including adjuvants, excipients, diluents, and
stablilizers.
31. A method of treating an individual suffering from a condition
selected from the group consisting of cancer and hyperproliferative
diseases, comprising the step of administering to such individual a
compound of claim 1.
32. The method of claim 31, said condition being chronic
myelogenous leukemia, acute lymphocytic leukemia, gastrointestinal
stromal tumors, and hypereosinophillic syndrome.
33. The method of claim 31, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
34. A method of treating an individual suffering from a condition
selected from the group consisting of cancer and hyperproliferative
diseases, comprising the step of administering to such individual a
compound of claim 19.
35. The method of claim 34 said condition being chronic myelogenous
leukemia, acute lymphocytic leukemia, gastrointestinal stromal
tumors, and hypereosinophillic syndrome.
36. The method of claim 34, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
37. An adduct comprising a compound of claim 1 bound with a species
of a wild-type kinase, oncogenic forms thereof, aberrant fusion
proteins thereof and polymorphs of any of the foregoing.
38. An adduct comprising a compound of claim 19 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
39. A method of claim 21, further comprising the step of inducing,
synergizing, or promoting the binding of a second modulator
compound of said kinase to form a ternary adduct, such co-incident
binding resulting in enhanced biological modulation of the kinase
when compared to the biological modulation of the protein affected
by either of said compounds alone.
40. A method of claim 39, wherein the second compound interacts at
a substrate, cofactor, or regulatory site on the kinase, said
second site being distinct from the site of interaction of the
first compound.
41. A method of claim 40, wherein the second site is an ATP
cofactor site.
42. A method of claim 39, wherein the kinase is c-Abl kinase,
Bcr-Abl kinase or disease polymorphs thereof.
43. A method of claim 40, wherein the kinase is c-Abl kinase,
Bcr-Abl kinase or disease polymorphs thereof.
44. A method of claim 41, wherein the kinase is c-Abl kinase,
Bcr-Abl kinase or disease polymorphs thereof.
45. A method of claim 44, wherein the second compound is taken from
the group consisting of
N-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)-4-((4-methylpi-
perazin-1-yl)methyl)benzamide (Gleevec);
N-(2-chloro-6-methylphenyl)-2-(6-(4-(2-hydroxyethyl)piperazin-1-yl)-2-met-
hylpyrimidin-4-ylamino)thiazole-5-carboxamide (BMS-354825);
6-(2,6-dichlorophenyl)-2-(3-(hydroxymethyl)phenylamino)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one (PD 166326);
6-(2,6-dichlorophenyl)-8-methyl-2-(3-(methylthio)phenylamino)pyrido[2,3-d-
]pyrimidin-7(8H)-one (PD 173955);
6-(2,6-dichlorophenyl)-2-(4-fluoro-3-methylphenylamino)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one (PD 180970);
6-(2,6-dichlorophenyl)-2-(4-ethoxyphenylamino)-8-methylpyrido[2,3-d]pyrim-
idin-7(8H)-one (PD 173958);
6-(2,6-dichlorophenyl)-2-(4-fluorophenylamino)-8-methylpyrido[2,3-d]pyrim-
idin-7(8H)-one (PD 173956);
6-(2,6-dichlorophenyl)-2-(4-(2-(diethylamino)ethoxy)phenylamino)-8-methyl-
pyrido[2,3-d]pyrimidin-7(8H)-one (PD 166285);
2-(4-(2-aminoethoxy)phenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one;
N-(3-(6-(2,6-dichlorophenyl)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrim-
idin-2-ylamino)phenyl)acetamide (SKI DV-MO16);
2-(4-aminophenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 1-10);
6-(2,6-dichlorophenyl)-2-(3-hydroxyphenylamino)-8-methylpyrido[2,3-d]pyri-
midin-7(8H)-one (SKI DV2-89);
2-(3-aminophenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 2-43);
N-(4-(6-(2,6-dichlorophenyl)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrim-
idin-2-ylamino)phenyl)acetamide (SKI DV-M017);
6-(2,6-dichlorophenyl)-2-(4-hydroxyphenylamino)-8-methylpyrido[2,3-d]pyri-
midin-7(8H)-one (SKI DV-M017);
6-(2,6-dichlorophenyl)-2-(3-ethylphenylamino)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 2 87).
46. A method of claim 24, further comprising the step of inducing,
synergizing, or promoting the binding of a second modulator
compound of said kinase to form a ternary adduct, such co-incident
binding resulting in enhanced biological modulation of the kinase
when compared to the biological modulation of the protein affected
by either of said compounds alone.
47. A method of claim 46, wherein the second compound interacts at
a substrate, cofactor, or regulatory site on the kinase, said
second site being distinct from the site of interaction of the
first compound.
48. A method of claim 47, wherein the second site is an ATP
cofactor site.
49. A method of claim 46, wherein the kinase is c-Abl kinase,
Bcr-Abl kinase or disease polymorphs thereof.
50. A method of claim 47, wherein the kinase is c-Abl kinase,
Bcr-Abl kinase or disease polymorphs thereof.
51. A method of claim 48, wherein the kinase is c-Abl kinase,
Bcr-Abl kinase or disease polymorphs thereof.
52. A method of claim 51, wherein the second compound is taken from
the group consisting of
N-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)-4-((4-methylpi-
perazin-1-yl)methyl)benzamide (Gleevec);
N-(2-chloro-6-methylphenyl)-2-(6-(4-(2-hydroxyethyl)piperazin-1-yl)-2-met-
hylpyrimidin-4-ylamino)thiazole-5-carboxamide (BMS-354825);
6-(2,6-dichlorophenyl)-2-(3-(hydroxymethyl)phenylamino)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one (PD 166326);
6-(2,6-dichlorophenyl)-8-methyl-2-(3-(methylthio)phenylamino)pyrido[2,3-d-
]pyrimidin-7(8H)-one (PD 173955);
6-(2,6-dichlorophenyl)-2-(4-fluoro-3-methylphenylamino)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one (PD180970);
6-(2,6-dichlorophenyl)-2-(4-ethoxyphenylamino)-8-methylpyrido[2,3-d]pyrim-
idin-7(8H)-one (PD 173958);
6-(2,6-dichlorophenyl)-2-(4-fluorophenylamino)-8-methylpyrido[2,3-d]pyrim-
idin-7(8H)-one (PD 173956);
6-(2,6-dichlorophenyl)-2-(4-(2-(diethylamino)ethoxy)phenylamino)-8-methyl-
pyrido[2,3-d]pyrimidin-7(8H)-one (PD 166285);
2-(4-(2-aminoethoxy)phenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one;
N-(3-(6-(2,6-dichlorophenyl)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrim-
idin-2-ylamino)phenyl)acetamide (SKI DV-MO16);
2-(4-aminophenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 1-10);
6-(2,6-dichlorophenyl)-2-(3-hydroxyphenylamino)-8-methylpyrido[2,3-d]pyri-
midin-7(8H)-one (SKI DV2-89);
2-(3-aminophenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 2-43);
N-(4-(6-(2,6-dichlorophenyl)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrim-
idin-2-ylamino)phenyl)acetamide (SKI DV-M017);
6-(2,6-dichlorophenyl)-2-(4-hydroxyphenylamino)-8-methylpyrido[2,3-d]pyri-
midin-7(8H)-one (SKI DV-MO17);
6-(2,6-dichlorophenyl)-2-(3-ethylphenylamino)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 2 87).
53. A synthesis method comprising the steps of: providing a ring
compound of the formula ##STR1074## wherein s is 3 or 4, the ring
compound has two double bonds and one reactable ring NH moiety, Q
is independently and individually selected from the group
consisting of N and CR2, and R15 is selected from the group
consisting of lower alkyl, branched lower alkyl, benzyl,
substituted benzyl, or other suitable carboxylic acid protecting
group; each R2 is selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, C1-C6fluoroalkyl wherein the
alkyl group is partially or fully fluorinated; reacting said ring
compound with a compound of the formula A3P-M In the presence of a
transition metal catalyst; wherein A3P is a protected form of A3;
wherein A3 comprises a member of the group consisting of mono- and
poly-aryl, mono- and poly-heteroaryl, mono- and poly-heterocyclyl
moieties, P is a protective group wherein A3 is chemically
protected so as not to interfere with the reaction of A3P-M with
##STR1075## wherein A3P-M is taken from the group consisting of
A3P--B(OH).sub.2, -A3P--B(OR16).sub.2, -A3P--B(R17).sub.3M2,
-A3P--Si(R18).sub.3, or A3P--Sn(R16).sub.3, wherein R16 is taken
from lower alkyl or branched lower alkyl, R17 is halogen, R18 is
lower alkoxy, and M2 is Li, K, or Na, and from the formulae
##STR1076## wherein v is 1 or 2; said reaction generating an
intermediate compound of the formula ##STR1077## converting said
intermediate compound to the carboxylic acid form thereof
##STR1078## subjecting said carboxylic acid to a Curtiuss
rearrangement in the presence of a compound of formula D1-NH.sub.2,
to yield a compound of the formula ##STR1079## where D1 is selected
from the group consisting of mono- and poly-aryl, mono- and
poly-heteroaryl, mono- and poly-heterocyclyl.
54. The synthesis method of claim 53 wherein ##STR1080## is
preferably taken from ##STR1081## A3P-M is taken from
A3P--B(OH).sub.2, A3P--B(OR16).sub.2, or boroxines (A3PBO).sub.3;
said reaction generating an intermediate compound of the formula
##STR1082## and being catalyzed by a copper(II) catalyst, in an
inert solvent taken from the group consisting of dichloromethane,
dichloroethane, and N-methylpyrrolidinone, in the presence of a
base taken from the group consisting of triethylamine and pyridine,
at temperatures ranging from ambient to about 130.degree. C.,
wherein the reaction is exposed to an atmosphere containing oxygen;
Converting said intermediate compound to the carboxylic acid form
thereof ##STR1083## and subjecting said acid form compound to a
Curtiuss rearrangement in the presence of a compound of formula
D1-NH.sub.2, such rearrangement mediated by the use of
diphenylphosphoryl azidate in an inert solvent taken from the group
consisting of toluene, tetrahydrofuran, and dimethoxyethane, and in
the presence of a base taken from the group consisting of
triethylamine, pyridine, and di-iso-propylethylamine, at
temperatures ranging from 80.degree. C. to 110.degree. C. to yield
a desired compound of the formula ##STR1084##
55. The synthesis method of claim 53 wherein ##STR1085## is taken
from ##STR1086## A3P-M is taken from A3P--B(OH).sub.2,
A3P--B(OR15).sub.2, or boroxines (A3PBO).sub.3; said reaction
generating an intermediate compound of the formula ##STR1087## said
catalyst comprising copper(II) acetate, said reaction being carried
in an inert solvent, selected from the group consisting of
dichloromethane, dichloroethane, and N-methylpyrrolidinone, in the
presence of a base from the group consisting of triethylamine and
pyridine, and in the presence of 4 angstrom sieves at ambient
temperature, wherein the reaction is exposed to air, to generate an
intermediate compound of the formula ##STR1088## converting said
intermediate compound to the carboxylic acid form thereof
##STR1089## subjecting said carboxylic acid form intermediate to a
Curtiuss rearrangement in the presence of a compound of formula
D1-NH.sub.2, such rearrangement mediated by the use of
diphenylphosphoryl azidate in an inert solvent taken from the group
consisting of toluene, and in the presence of triethylamine at
temperatures ranging from 80.degree. C. to 110.degree. C. to yield
a desired compound of the formula. ##STR1090##
56. Compounds of the formula ##STR1091## wherein A2 is selected
from the group consisting of a Z1-substituted phenyl,
Z1-substituted pyridyl, Z1-substituted pyrimidinyl, Z1-substituted
thienyl, Z1 or Z4'-substituted monocyclic heterocyclyl rings, and
other monocyclic heteroaryls, excluding tetrazolyl,
1,2,4-oxadiazolonyl, 1,2,4-triazolonyl, and alkyl-substituted
pyrrolyl wherein the pyrrolyl nitrogen is the site of attachment to
the A1 ring; A1 is selected from the group consisting of R2' and
R7-substituted phenyl, pyridyl, or pyrimidinyl, R2-substituted
monocyclic 5-membered ring heteroaryl, and R2'-substituted
monocyclic heterocyclyl moieties; W and Y are CHR4, NR3, or O and
wherein W and Y are not simultaneously O; X is O, S, or NR3; each
Z1 is a substituent attached to a ring carbon and is independently
and individually selected from the group consisting of
hydroxyC1-C6alkyl, C2-C6alkoxy, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1092## cyano wherein the site of
attachment to the A2 ring is meta to the point of attachment to the
A1 ring and wherein A2 is phenyl, and cyano wherein the site of
attachment is to a substitutable position when A2 is pyridyl,
pyrimidinyl or a five-membered ring; wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z1 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; each Z4' is a substituent attached
to a ring nitrogen and is independently and individually selected
from the group consisting of hydroxyC2-C6alkyl,
C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1093## wherein the symbol (#)
indicates the point of attachment of the Z4' moiety to the A1 ring
of formula I; in the event that Z4' contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4' may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4' may cyclize to form a C3-C7 heterocyclyl ring;
each R2 is selected from the group consisting of alkyl, branched
alkyl, fluoroalkyl, wherein the alkyl group is partially or fully
fluorinated, and R19 substituted C3-C8carbocyclyl wherein R19 is H
and C1-C6alkyl; each R2' is selected from the group consisting of
halogen and R2; each R3 is independently and individually selected
from the group consisting of H, C1-C6alkyl, branched C3-C7alkyl,
C3-C7cycloalkyl, or phenyl; each R3' is independently and
individually selected from the group consisting of C2-C6alkyl,
branched C3-C7alkyl, C3-C7cycloalkyl, aryl, arylalkyl, heteroaryl,
and heteroarylalkyl; each R4 is selected from the group consisting
of H, C1-C6alkyl, hydroxyC1-C6 alkyl, dihydroxyC1-C6alkyl,
C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl, branched hydroxyC1-C6
alkyl, branched C1-C6alkoxyC1-C6alkyl, branched
dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted carbocyclyl,
alkoxy substituted carbocyclyl, dihydroxy substituted carbocyclyl,
phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; each R5 is
independently and individually selected from the group consisting
of ##STR1094## and wherein the symbol (##) is the point of
attachment to respective R8, R10, Z1, Z4', Z5, Z6 or A2 ring
moieties containing a R5 moiety; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of R5 may cyclize to
form a C3-C7 heterocyclyl ring; wherein each R6 is independently
and individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, phenyl, heteroaryl, and
heterocyclyl; each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or C1-C3alkoxy;
each R8 is independently and individually selected from the group
consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, branchedC4-C7alkyl,
carbocyclyl, phenyl, C1-C6phenylalkyl, heteroaryl or
heteroarylC1-C6alkyl, heterocyclyl, heterocyclylC1-C6alkyl, OH,
C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2, or R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; each R10 is independently and individually
selected from the group consisting of CO.sub.2H,
CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; D comprises a moiety taken from group consisting
of moieties of the formula ##STR1095## wherein the symbol (***) is
the point of attachment to the Y group of formula I; wherein E2 is
taken from the group consisting of poly-aryl, poly-heteroaryl,
mono- and poly heterocyclyl, and carbocyclyl; wherein E1 is taken
from the group consisting of mono- and poly-aryl, mono- and
poly-heteroaryl, mono- and poly heterocyclyl and carbocyclyl; X1 is
selected from the group consisting of O, S, NR3, --C(.dbd.O)--,
--O--(CH.sub.2)n-, --S--(CH.sub.2)n-, --NR3-(CH.sub.2)n-,
--O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2).sub.n--N(R4)--C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2).sub.p--, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein either E1 or E2 is directly linked to the Y group of
formula I; and n is 0-4; p is 1-4; q is 2-6, r is 0 or 1; and
tautomers, diastereomers, geometric isomers, enantiomers, hydrates,
prodrugs, and salts of any of the foregoing.
57. The compounds of claim 56 wherein E1 is selected from the group
consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl;
wherein E2 comprises the group consisting of cyclopentyl,
cyclohexyl, non-fused bicyclic rings comprising pyridylpyridiminyl
pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl,
imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl.
58. The compounds of claim 56 wherein D comprises a moiety of the
formula ##STR1096## X2 is selected from the group consisting of
C1-C6 alkyl, C3-C6 branched alkyl, or a direct bond wherein E2 is
directly linked to the Y group of formula I.
59. The compounds of claim 58 wherein the E2 ring is cyclopentyl,
cyclohexyl, non-fused bicyclic rings comprising pyridylpyridiminyl
pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl,
imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl.
60. The compounds of claim 56 wherein A2 is selected from the group
consisting of ##STR1097## ##STR1098## and wherein the symbol (**)
is the point of attachment to the A1 ring of formula I; each Z4 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl,
(R4).sub.2N--C2-C6alkyl, (R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1099## wherein the symbol (#)
indicates the point of attachment of the Z4 moiety to the A2 ring
for formula I; in the event that Z4 contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2).sub.q--N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2.
61. The compounds of claim 60, wherein A2 is selected from the
group consisting of ##STR1100## and wherein the symbol (**) is the
point of attachment to the A1 ring for formula I.
62. The compounds of claim 61, wherein A2 is selected from the
group consisting of ##STR1101## and wherein the symbol (**) is the
point of attachment to the A1 ring of formula I.
63. The compounds of claim 57 wherein said A2 group is defined as
set forth in claim 60.
64. The compounds of claim 63 wherein said A2 group is defined as
set forth in claim 61.
65. The compounds of claim 63 wherein said A2 group is defined as
set forth in claim 62.
66. The compounds of claim 58 wherein said A2 group is defined as
set forth in claim 60.
67. The compounds of claim 66 wherein said A2 group is defined as
set forth in claim 61.
68. The compounds of claim 66 wherein said A2 group is defined as
set forth in claim 62.
69. The compounds of claims 56, 60. 63 or 66, wherein A1 is
selected from the group consisting of ##STR1102## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I.
70. The compounds of claims 56, 60, 63 or 66, wherein A1 is
selected from the group consisting of ##STR1103## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
71. The compounds of claims 56, 60, 63 or 66, wherein A1 is
selected from the group consisting of ##STR1104## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
72. The compounds of claims 56, 60, 63 or 66, wherein: (1) W and Y
are each NH, and X.dbd.O; (2) W.dbd.NH, Y.dbd.CHR4 and X.dbd.O; or
(3) W.dbd.CHR4, Y.dbd.NH, and X.dbd.O.
73. The compounds of claims 56, 60, 63 or 66, wherein W and Y are
each NH and X.dbd.O.
74. Compounds of the formula ##STR1105## wherein A2 is selected
from the group consisting of ##STR1106## and wherein the symbol
(**) is the point of attachment to the A1 ring of formula I. A1 is
selected from the group consisting of ##STR1107## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I; X is O, S, or NR3; D comprises a member of ##STR1108##
##STR1109## wherein E1 is selected from the group consisting
cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, pyrrolidinyl
piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl; wherein the
symbol (***) denotes the attachment to the Y moiety of formula I;
X1 is selected from the group consisting of O, S, NR3,
--C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I;
each Z1 is a substituent attached to a ring carbon and is
independently and individually selected from the group consisting
of hydroxyC1-C6alkyl, C2-C6alkoxy, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1110## cyano wherein the site of
attachment to the A2 ring is meta to the point of attachment to the
A1 ring and wherein A2 is phenyl, and cyano wherein the site of
attachment is to a substitutable position when A2 is pyridyl,
pyrimidinyl or a five-membered ring; In the foregoing definition of
Z1, alkyl moieties may optionally be substituted by one or more
C1-C6alkyl; Wherein the asterisk (*) indicates the point of
attachment of the Z1 moiety to the A2 ring; in the event that Z1
contains an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; wherein two R3 moieties
are independently and individually taken from the group consisting
of C1-C6alkyl and branched C3-C6alkyl and are attached to the same
nitrogen heteroatom of Z1 may cyclize to form a C3-C7 heterocyclyl
ring; wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z1 may cyclize to form a C3-C7 heterocyclyl ring;
each Z4 is a substituent attached to a ring nitrogen and is
independently and individually selected from the group consisting
of H, C1-C6alkyl, hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl,
(R4).sub.2N--C2-C6alkyl, (R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1111## wherein the symbol (#)
indicates the point of attachment of the Z4 moiety to the A2 ring
for formula I; in the event that Z4 contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
each Z4' is a substituent attached to a ring nitrogen and is
independently and individually selected from the group consisting
of hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl,
(R4).sub.2N--C2-C6alkyl, (R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1112## wherein the symbol (#)
indicates the point of attachment of the Z4' moiety to the A1 ring
of formula I; in the event that Z4' contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4' may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4' may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; each R2 is selected from the group consisting of
alkyl, branched alkyl, fluoroalkyl, wherein the alkyl group is
partially or fully fluorinated, and R19 substituted
C3-C8carbocyclyl wherein R19 is H and C1-C6alkyl; each R2' is
selected from the group consisting of halogen and R2; each R3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, branched C3-C7alkyl, C3-C7cycloalkyl, or phenyl;
each R3' is independently and individually selected from the group
consisting of C2-C6alkyl, branched C3-C7alkyl, C3-C7cycloalkyl,
aryl, arylalkyl, heteroaryl, and heteroarylalkyl; each R4 is
selected from the group consisting of H, C1-C6alkyl, hydroxyC1-C6
alkyl, dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched
C3-C7alkyl, branched hydroxyC1-C6 alkyl, branched
C1-C6alkoxyC1-C6alkyl, branched dihydroxyC1-C6alkyl, carbocyclyl,
hydroxyl substituted carbocyclyl, alkoxy substituted carbocyclyl,
dihydroxy substituted carbocyclyl, phenyl, heteroaryl,
heterocyclyl, phenylC1-C6alkyl, heteroarylC1-C6alkyl, and
heterocyclylC1-C6alkyl; each R5 is independently and individually
selected from the group consisting of ##STR1113## and wherein the
symbol (##) is the point of attachment to respective R8, R10, Z1,
Z4', Z5, Z6 or A2 ring moieties containing a R5 moiety; wherein two
R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R5
may cyclize to form a C3-C7 heterocyclyl ring; wherein each R6 is
independently and individually selected from the group consisting
of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl, phenyl,
heteroaryl, and heterocyclyl; each R7 is selected from the group
consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl moiety
is partially or fully fluorinated, C1-C3alkyl, cyclopropyl, cyano,
or C1-C3alkoxy; each R8 is independently and individually selected
from the group consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein
the alkyl moiety is partially or fully fluorinated,
branchedC4-C7alkyl, carbocyclyl, phenyl, C1-C6phenylalkyl,
heteroaryl or heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2,
or R5; wherein two R3 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2; and tautomers, diastereomers, geometric isomers,
enantiomers, hydrates, prodrugs and salts of any of the
foregoing.
75. Most preferred compounds from claim 74 are
1-(3-t-butyl-1-(3-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)phenyl)-1H-pyr-
azol-5-yl)-3-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-methy-
l-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea,
1-(2-(3-(2-amino-2-oxoethylophenyl)-5-t-butylthiophen-3-yl)-3-(4-methyl-3-
-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea,
1-(1-(3-(1H-pyrazol-4-yl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(4-(6-(-
thiazol-4-yl)pyrimidin-4-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(3-(-
4-(pyridin-3-yl)pyrimidin-2-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(3-(-
4-(isoxazol-4-yl)pyrimidin-2-ylamino)phenyl)urea,
1-(1-(3-(1H-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-methyl-3-
-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea
76. A method of modulating a kinase activity of a wild-type kinase,
oncogenic forms thereof, aberrant fusion proteins thereof and
polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 56.
77. The method of claim 76, said kinase species being activated or
unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
78. The method of claim 76, said kinase activity selected from the
group consisting of catalysis of phospho transfer reactions, kinase
cellular localization, and recruitment of other proteins into
signaling complexes through modulation of kinase conformation.
79. A method of modulating a kinase activity of a wild-type kinase,
oncogenic forms thereof, aberrant fusion proteins thereof and
polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 74.
80. The method of claim 79, said species being activated or
unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
81. The method of claim 79, said kinase activity selected from the
group consisting of catalysis of phospho transfer reactions, kinase
cellular localization, and recruitment of other proteins into
signaling complexes through modulation of kinase conformation.
82. A pharmaceutical composition comprising a compound of claim 56
together with a pharmaceutically acceptable carrier.
83. The composition of claim 82 including an additive selected from
the group including adjuvants, excipients, diluents, and
stablilizers.
84. A pharmaceutical composition comprising a compound of claim 74
together with a pharmaceutically acceptable carrier.
85. The composition of claim 84 including an additive selected from
the group including adjuvants, excipients, diluents, and
stablilizers.
86. A method of treating an individual suffering from a condition
selected from the group consisting of cancer and hyperproliferative
diseases, comprising the step of administering to such individual a
compound of claim 56.
87. The method of claim 86, said condition being chronic
myelogenous leukemia, acute lymphocytic leukemia, gastrointestinal
stromal tumors, and hypereosinophillic syndrome.
88. The method of claim 86, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
89. A method of treating an individual suffering from a condition
selected from the group consisting of cancer and hyperproliferative
diseases, comprising the step of administering to such individual a
compound of claim 74.
90. The method of claim 89 said condition being chronic myelogenous
leukemia, acute lymphocytic leukemia, gastrointestinal stromal
tumors, and hypereosinophillic syndrome.
91. The method of claim 89, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
92. An adduct comprising a compound of claim 56 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
93. An adduct comprising a compound of claim 74 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
94. A method of claim 76, further comprising the step of inducing,
synergizing, or promoting the binding of a second modulator
compound of said kinase to form a ternary adduct, such co-incident
binding resulting in enhanced biological modulation of the kinase
when compared to the biological modulation of the protein affected
by either of said compounds alone.
95. A method of claim 94, wherein the second compound interacts at
a substrate, cofactor, or regulatory site on the kinase, said
second site being distinct from the site of interaction of the
first compound.
96. A method of claim 95, wherein the second site is an ATP
cofactor site.
97. A method of claim 94, wherein the kinase is c-Abl kinase,
Bcr-Abl kinase or disease polymorphs thereof.
98. A method of claim 95, wherein the kinase is c-Abl kinase,
Bcr-Abl kinase or disease polymorphs thereof.
99. A method of claim 96, wherein the kinase is c-Abl kinase,
Bcr-Abl kinase or disease polymorphs thereof.
100. A method of claim 99, wherein the second compound is taken
from the group consisting of
N-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)-4-((4-methylpi-
perazin-1-yl)methyl)benzamide (Gleevec);
N-(2-chloro-6-methylphenyl)-2-(6-(4-(2-hydroxyethyl)piperazin-1-yl)-2-met-
hylpyrimidin-4-ylamino)thiazole-5-carboxamide (BMS-354825);
6-(2,6-dichlorophenyl)-2-(3-(hydroxymethyl)phenylamino)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one (PD 166326);
6-(2,6-dichlorophenyl)-8-methyl-2-(3-(methylthio)phenylamino)pyrido[2,3-d-
]pyrimidin-7(8H)-one (PD 173955);
6-(2,6-dichlorophenyl)-2-(4-fluoro-3-methylphenylamino)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one (PD180970);
6-(2,6-dichlorophenyl)-2-(4-ethoxyphenylamino)-8-methylpyrido[2,3-d]pyrim-
idin-7(8H)-one (PD 173958);
6-(2,6-dichlorophenyl)-2-(4-fluorophenylamino)-8-methylpyrido[2,3-d]pyrim-
idin-7(8H)-one (PD 173956);
6-(2,6-dichlorophenyl)-2-(4-(2-(diethylamino)ethoxy)phenylamino)-8-methyl-
pyrido[2,3-d]pyrimidin-7(8H)-one (PD 166285);
2-(4-(2-aminoethoxy)phenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one;
N-(3-(6-(2,6-dichlorophenyl)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrim-
idin-2-ylamino)phenyl)acetamide (SKI DV-MO16);
2-(4-aminophenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 1-10);
6-(2,6-dichlorophenyl)-2-(3-hydroxyphenylamino)-8-methylpyrido[2,3-d]pyri-
midin-7(8H)-one (SKI DV2-89);
2-(3-aminophenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 2-43);
N-(4-(6-(2,6-dichlorophenyl)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrim-
idin-2-ylamino)phenyl)acetamide (SKI DV-M017);
6-(2,6-dichlorophenyl)-2-(4-hydroxyphenylamino)-8-methylpyrido[2,3-d]pyri-
midin-7(8H)-one (SKI DV-M017);
6-(2,6-dichlorophenyl)-2-(3-ethylphenylamino)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 2 87).
101. A method of claim 79, further comprising the step of inducing,
synergizing, or promoting the binding of a second modulator
compound of said kinase to form a ternary adduct, such co-incident
binding resulting in enhanced biological modulation of the kinase
when compared to the biological modulation of the protein affected
by either of said compounds alone.
102. A method of claim 101, wherein the second compound interacts
at a substrate, cofactor, or regulatory site on the kinase, said
second site being distinct from the site of interaction of the
first compound.
103. A method of claim 102, wherein the second site is an ATP
cofactor site.
104. A method of claim 101, wherein the kinase is c-Abl kinase,
Bcr-Abl kinase or disease polymorphs thereof.
105. A method of claim 102, wherein the kinase is c-Abl kinase,
Bcr-Abl kinase or disease polymorphs thereof.
106. A method of claim 103, wherein the kinase is c-Abl kinase,
Bcr-Abl kinase or disease polymorphs thereof.
107. A method of claim 106, wherein the second compound is taken
from the group consisting of
N-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)-4-((4-methylpi-
perazin-1-yl)methyl)benzamide (Gleevec);
N-(2-chloro-6-methylphenyl)-2-(6-(4-(2-hydroxyethyl)piperazin-1-yl)-2-met-
hylpyrimidin-4-ylamino)thiazole-5-carboxamide (BMS-354825);
6-(2,6-dichlorophenyl)-2-(3-(hydroxymethyl)phenylamino)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one (PD 166326);
6-(2,6-dichlorophenyl)-8-methyl-2-(3-(methylthio)phenylamino)pyrido[2,3-d-
]pyrimidin-7(8H)-one (PD 173955);
6-(2,6-dichlorophenyl)-2-(4-fluoro-3-methylphenylamino)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one (PD180970);
6-(2,6-dichlorophenyl)-2-(4-ethoxyphenylamino)-8-methylpyrido[2,3-d]pyrim-
idin-7(8H)-one (PD 173958);
6-(2,6-dichlorophenyl)-2-(4-fluorophenylamino)-8-methylpyrido[2,3-d]pyrim-
idin-7(8H)-one (PD 173956);
6-(2,6-dichlorophenyl)-2-(4-(2-(diethylamino)ethoxy)phenylamino)-8-methyl-
pyrido[2,3-d]pyrimidin-7(8H)-one (PD 166285);
2-(4-(2-aminoethoxy)phenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one;
N-(3-(6-(2,6-dichlorophenyl)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrim-
idin-2-ylamino)phenyl)acetamide (SKI DV-MO16);
2-(4-aminophenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 1-10);
6-(2,6-dichlorophenyl)-2-(3-hydroxyphenylamino)-8-methylpyrido[2,3-d]pyri-
midin-7(8H)-one (SKI DV2-89);
2-(3-aminophenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 2-43);
N-(4-(6-(2,6-dichlorophenyl)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrim-
idin-2-ylamino)phenyl)acetamide (SKI DV-M017);
6-(2,6-dichlorophenyl)-2-(4-hydroxyphenylamino)-8-methylpyrido[2,3-d]pyri-
midin-7(8H)-one (SKI DV-M017);
6-(2,6-dichlorophenyl)-2-(3-ethylphenylamino)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 2 87).
108. Compounds of the formula ##STR1114## wherein A2 is selected
from the group consisting of bicyclic fused aryl, bicyclic fused
heteroaryl, and bicyclic fused heterocyclyl rings, each A2 moiety
presenting a proximal ring bonded with A1 and a distal ring
attached to the proximal ring, and either the distal ring has a
heteroatom in the ring structure thereof and/or the distal ring has
Z2 or Z3 substituents; A1 is selected from the group consisting of
R2' and R7-substituted phenyl, pyridyl, or pyrimidinyl,
R2-substituted monocyclic 5-membered ring heteroaryl, and
R2'-substituted monocyclic heterocyclyl moieties; W and Y are CHR4,
NR3, or O and wherein W and Y are not simultaneously O; X is O, S,
or NR3; D comprises a member of the group consisting of Z5- or
Z6-substituted mono- and poly-aryl, of Z5- or Z6-substituted mono-
and poly-heteroaryl, of Z5- or Z6-substituted mono- and
poly-heterocyclyl, of Z5- or Z6-substituted mono- and
poly-arylalkyl, of Z5- or Z6-substituted mono- and poly-aryl
branched alkyl, of Z5- or Z6-substituted mono- and
poly-heteroarylalkyl, of Z5- or Z6-substituted mono- and
poly-heteroaryl branched alkyl, of Z5- or Z6-substituted mono- and
poly-heterocyclylalkyl, of Z5- or Z6-substituted mono- and
poly-heterocyclyl branched alkyl, alkyl, and carbocyclyl moieties;
each Z2 is independently and individually selected from the group
consisting of hydroxyl, hydroxyC1-C6alkyl, cyano, (R3).sub.2N--,
(R4).sub.2N--, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)--(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl, carboxyl,
carboxyC1-C6alkyl, C1-C6alkoxycarbonyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2,
(R4).sub.2NSO.sub.2, --SO.sub.2R5-, --(CH.sub.2).sub.nN(R4)C(O)R8,
.dbd.O, .dbd.NOH, .dbd.N(OR6), heteroarylC1-C6alkyl,
heterocyclylC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, heterocyclylaminoC1-C6alkyl, or moieties
of the formulae ##STR1115## ##STR1116## wherein the symbol (#)
indicates the point of attachment of the Z2 moiety to the A2 ring
of formula I; in the event that Z2 contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z2 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z2 may cyclize to form a C3-C7 heterocyclyl ring;
wherein Z1' is independently and individually selected from the
group consisting of H, C1-C6alkyl, C3-C7cycloalkyl,
hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, (R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, hydroxyl, hydroxyC1-C6alkyl, cyano, C1-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, halogen, CF.sub.3, (R3).sub.2N--,
(R4).sub.2N--, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, R8CO--,
(R4).sub.2N--CO--C1-C6alkyl, carboxyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R3).sub.2NSO.sub.2, --SO.sub.2R3, SOR3, (R4).sub.2NSO.sub.2,
--SO.sub.2R4, --SOR4, --(CH.sub.2).sub.nN(R4)C(O)R8,
--C.dbd.(NOH)R6, --C.dbd.(NOR3)R6, heteroaryl, heterocyclyl,
heteroarylC1-C6alkyl, heterocyclylC1-C6alkyl, heteroaryloxy,
heterocyclyloxy, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylamino, heteroarylamino,
heterocyclylamino, arylaminoC1-C6alkyl, heteroarylaminoC1-C6alkyl,
heterocyclylaminoC1-C6alkyl, or moieties of the formulae
##STR1117## ##STR1118## wherein the symbol (#) indicates the point
of attachment of the Z3 moiety to the A2 ring of formula I; in the
event that Z3 contains an alkyl or alkylene moiety, such moieties
may be further substituted with one or more C1-C6alkyls; wherein
two R3 moieties are independently and individually taken from the
group consisting of C1-C6alkyl and branched C3-C6alkyl and are
attached to the same nitrogen heteroatom of Z3 may cyclize to form
a C3-C7 heterocyclyl ring; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z3 may cyclize to form a C3-C7
heterocyclyl ring; each Z5 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, halogen, fluoroalkyl, cyano, hydroxyl, alkoxy, oxo,
aminocarbonyl, carbonylamino, aminosulfonyl, sulfonylamino,
--N(R3).sub.2, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --R5, --O--(CH.sub.2)q-O-Alkyl,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-O-Alkyl,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --O--(CH.sub.2)q-R5, and
--N(R3)-(CH.sub.2)q-R5; wherein two R3 moieties are independently
and individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring;
each Z6 is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, hydroxyl,
C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8, (R4).sub.2N--, --R5,
--N(R4)COR8, --N(R3)SO.sub.2R6-, --CON(R3).sub.2, --CON(R4).sub.2,
--COR5, --SO.sub.2NHR4, heteroaryl, heterocyclyl, heteroaryloxy,
heterocyclyloxy, arylamino, heteroarylamino, and heterocyclylamino;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z6 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z6 may cyclize to
form a C3-C7 heterocyclyl ring; each R2 is selected from the group
consisting of C1-C6alkyl, branched C3-C7alkyl, and R19 substituted
C3-C8carbocyclyl wherein R19 is H or C1-C6alkyl, C1-C6fluoroalkyl
wherein the alkyl group is partially or fully fluorinated, phenyl
wherein the phenyl group is optionally substituted by one or more
fluorine substituents, or monocyclic heteroaryl; each R2' is
selected from the group consisting of halogen and R2; each R3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl;
each R4 is selected from the group consisting of H, C1-C6alkyl,
hydroxyC1-C6 alkyl, dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
branched C3-C7alkyl, branched hydroxyC1-C6 alkyl, branched
C1-C6alkoxyC1-C6alkyl, branched dihydroxyC1-C6alkyl, carbocyclyl,
hydroxyl substituted carbocyclyl, alkoxy substituted carbocyclyl,
dihydroxy substituted carbocyclyl, phenyl, heteroaryl,
heterocyclyl, phenylC1-C6alkyl, heteroarylC1-C6alkyl, and
heterocyclylC1-C6alkyl; each R5 is independently and individually
selected from the group consisting of ##STR1119## and wherein the
symbol (##) is the point of attachment to respective R8, R10, Z2,
or Z3, moieties containing a R5 moiety; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of R5 may cyclize to
form a C3-C7 heterocyclyl ring; each R6 is independently and
individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, phenyl, heteroaryl, and
heterocyclyl; each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or C1-C3alkoxy;
each R8 is independently and individually selected from the group
consisting of C1-C6alkyl, branched C3-C7alkyl, fluoroalkyl wherein
the alkyl moiety is partially or fully fluorinated, carbocyclyl,
phenyl, C1-C6phenylalkyl, heteroaryl or heteroarylC1-C6alkyl,
heterocyclyl, heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2,
N(R4).sub.2, or R5; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of R8 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of R8 may cyclize to form a C3-C7 heterocyclyl ring;
each R10 is independently and individually selected from the group
consisting of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH,
C1-C6alkoxy, --N(R4).sub.2; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1;
and tautomers, diastereomers, geometric isomers, enantiomers,
hydrates, prodrugs and salts of any of the foregoing.
109. The compounds of claim 108 wherein D is a moiety of the
formula ##STR1120## wherein E1 is selected from the group
consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl;
wherein the symbol (***) is the point of attachment to the Y group
of formula I; X1 is selected from the group consisting of O, S,
NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2).sub.n--N(R4)--C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I; and
E2 is selected from the group comprising cyclopentyl, cyclohexyl,
phenyl, naphthyl, pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, triazolyl, tetrazolyl, pyridinyl, pyrimidinyl,
pyrazinyl, pyridazinyl, triazinyl, fused bicyclic rings selected
from the group comprising indolyl, isoindolyl, isoindolinyl,
isoindolonyl, indazolyl, benzofuranyl, benzothienyl,
benzothiazolyl, benzothiazolonyl, benzoxazolyl, benzoxazolonyl,
benzisoxazolyl, benzisothiazolyl, benzimidazolyl, benzimidazolonyl,
benztriazolyl, imidazopyridinyl, imidazopyrimidinyl,
imidazolonopyrimidinyl, dihydropurinonyl, pyrrolopyrimidinyl,
purinyl, pyrazolopyridinyl, pyrazolopyrimidinyl,
isoxazolopyrimidinyl, isothiazolopyrimidinyl, furylopyrimidinyl,
thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl,
non-fused bicyclic rings comprising pyridylpyridiminyl,
pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl,
imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl; and n is 0-4; p
is 1-4; q is 2-6.
110. The compounds of claim 108 wherein D comprises carbocyclyl and
a moiety of the formula X2 is selected from the group consisting of
C1-C6 alkyl, C3-C6 branched alkyl, or a direct bond wherein E2 is
directly linked to the Y group of formula I.
111. The compounds of claim 110 wherein the E2 ring is selected
from the group comprising cyclopentyl, cyclohexyl, phenyl,
naphthyl, pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, triazolyl, tetrazolyl, pyridinyl, pyrimidinyl,
pyrazinyl, pyridazinyl, triazinyl, fused bicyclic rings comprising
indolyl, isoindolyl, isoindolinyl, isoindolonyl, indazolyl,
benzofuranyl, benzothienyl, benzothiazolyl, benzothiazolonyl,
benzoxazolyl, benzoxazolonyl, benzisoxazolyl, benzisothiazolyl,
benzimidazolyl, benzimidazolonyl, benztriazolyl, imidazopyridinyl,
imidazopyrimidinyl, dihydropurinonyl, pyrrolopyrimidinyl, purinyl,
pyrazolopyridinyl, pyrazolopyrimidinyl, phthalimidyl,
phthalimidinyl, pyrazinylpyridinyl, pyridinopyrimidinyl,
pyrimidinopyrimidinyl, cinnolinyl, quinoxalinyl, quinazolinyl,
quinolinyl, isoquinolinyl, phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl,
non-fused bicyclic rings comprising pyridylpyridiminyl,
pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl,
imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl.
112. The compounds of claim 108 wherein A2 is selected from the
group consisting of ##STR1121## ##STR1122## ##STR1123## ##STR1124##
##STR1125## ##STR1126## and wherein the symbol (**) is the point of
attachment to the A1 ring of formula I; and wherein indicates
either a saturated or an unsaturated bond; wherein each Z3 and Z5
is independently attached to either aryl or heteroaryl ring of the
A2 bicyclic ring; each R9 is independently and individually
selected from the group consisting of H, F, C1-C6alkyl, branched
C4-C7alkyl, carbocyclyl, phenyl, phenyl C1-C6alkyl, heterocyclyl
and heterocyclylC1-C6alkyl; each R13 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, hydroxyC2-C7alkyl,
C1-C6alkoxyC2-C7alkyl, (R4).sub.2N--CO,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.q,
R5-C2-C6alkylN(R4)-(CH.sub.2).sub.q,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.q,
R5-C2-C6alkyl-O--(CH.sub.2).sub.q, --(CH.sub.2).sub.qN(R4)C(O)R8,
aryl, arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl,
heterocyclyl, heterocyclylC1-C6alkyl, aryloxyC2-C6alkyl,
heteroaryloxyC2-C6alkyl, heterocyclyloxyC2-C6alkyl,
arylaminoC2-C6alkyl, heteroarylaminoC2-C6alkyl, and
heterocyclylaminoC2-C6alkyl; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R13 may cyclize to form a C3-C7
heterocyclyl ring; each R14 is independently and respectively
selected from the group consisting of H and C1-C6alkyl; V, V1, and
V2 are each independently and respectively selected from the group
consisting of O and H.sub.2; each Z4 is a substituent attached to a
ring nitrogen and is independently and individually selected from
the group consisting of H, C1-C6alkyl, hydroxyC2-C6alkyl,
C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1127## ##STR1128## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; and
n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v is 1 or 2.
113. The compounds of claim 112, wherein A2 is selected from the
group consisting of ##STR1129## ##STR1130## ##STR1131## ##STR1132##
and wherein the symbol (*) is the point of attachment to the A1
ring for formula I; wherein each Z3 and Z5 is independently
attached to either aryl or heteroaryl ring of the A2 bicyclic
ring.
114. The compounds of claim 113, wherein A2 is selected from the
group consisting of ##STR1133## ##STR1134## and wherein the symbol
(**) is the point of attachment to the A1 ring of formula I;
wherein each Z3 and Z5 is independently attached to either aryl or
heteroaryl ring of the A2 bicyclic ring.
115. The compounds of claim 109 wherein said A2 group is defined as
set forth in claim 112.
116. The compounds of claim 115 wherein said A2 group is defined as
set forth in claim 113.
117. The compounds of claim 115 wherein said A2 group is defined as
set forth in claim 114.
118. The compounds of claim 110 wherein said A2 group is defined as
set forth in claim 112.
119. The compounds of claim 118 wherein said A2 group is defined as
set forth in claim 113.
120. The compounds of claim 118 wherein said A2 group is defined as
set forth in claim 114.
121. The compounds of claims 108, 112, 115 or 118, wherein A1 is
selected from the group consisting of ##STR1135## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I.
122. The compounds of claims 108, 112, 115 or 118, wherein A1 is
selected from the group consisting of ##STR1136## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I; ##STR1137##
123. The compounds of claims 108, 112, 115 or 118, wherein A1 is
selected from the group consisting of ##STR1138## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
124. The compounds of claims 108, 112, 115 or 118, wherein: (1) W
and Y are each NH, and X.dbd.O; (2) W.dbd.NH, Y.dbd.CHR4 and
X.dbd.O; or (3) W.dbd.CHR4, Y.dbd.NH, and X.dbd.O.
125. The compounds of claims 108, 112, 115 or 118, wherein W and Y
are each NH and X.dbd.O.
126. Compounds of the formula ##STR1139## wherein A2 is selected
from the group consisting of ##STR1140## ##STR1141## wherein each
Z3 and Z5 is independently attached to either aryl or heteroaryl
ring of the A2 bicyclic ring; wherein the symbol (*) denotes the
attachment to the A1 moiety of formula I; A1 is selected from the
group consisting of ##STR1142## wherein the symbol (*) denotes the
attachment to the W moiety of formula I and the symbol (**) denotes
the attachment to the A2 moiety of formula I; X is O, S, or NR3; D
comprises a member of 2,3-dichlorophenyl, 3,4-dichlorophenyl,
3,5-dichlorophenyl, 4-chlorophenyl, 3-chlorophenyl, 3-bromophenyl,
2,3-difluorophenyl, 2,4-difluorophenyl, 3,4-difluorophenyl,
2,5-difluorophenyl, 3,5-difluorophenyl, 2,3,5-trifluorophenyl,
2,4,5-trifluorophenyl, 2,3,4-trifluorophenyl,
3,4,5-trifluorophenyl, 4-cyanophenyl, 3-(R8SO.sub.2)-- phenyl,
3-phenoxyphenyl, 4 phenoxyphenyl, ##STR1143## ##STR1144##
##STR1145## ##STR1146## wherein E1 is selected from the group
consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl;
wherein the symbol (***) denotes the attachment to the Y moiety of
formula I; X1 is selected from the group consisting of O, S. NR3,
--C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --N--(CH.sub.2).sub.q--O--,
--O--(CH.sub.2)q-NR3-, N(R3)-(CH.sub.2)q-N(R3)-,
--(CH.sub.2)n-N(R4)--C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I;
each R2 is selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, and R19 substituted C3-C8carbocyclyl wherein
R19 is H or C1-C6alkyl, C1-C6fluoroalkyl wherein the alkyl group is
partially or fully fluorinated, phenyl wherein the phenyl group is
optionally substituted by one or more fluorine substituents, or
monocyclic heteroaryl; each R2' is selected from the group
consisting of halogen and R2; each R3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl; wherein two R3
moieties independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C7alkyl are attached to
the same nitrogen heteroatom, the two R3 moieties may cyclize to
form a C3-C7 heterocyclyl ring; each R4 is selected from the group
consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom may
cyclize to form a C3-C7 heterocyclyl ring; each R5 is independently
and individually selected from the group consisting of ##STR1147##
and wherein the symbol (##) is the point of attachment to
respective R8, R10, R13, Z2, Z3, Z4, Z5, or A2 ring moieties
containing a R5 moiety; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R5 may cyclize to form a C3-C7
heterocyclyl ring; wherein each R6 is independently and
individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, phenyl, heteroaryl, and
heterocyclyl; each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or C1-C3alkoxy;
each R8 is independently and individually selected from the group
consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, branchedC4-C7alkyl,
carbocyclyl, phenyl, C1-C6phenylalkyl, heteroaryl or
heteroarylC1-C6alkyl, heterocyclyl, heterocyclylC1-C6alkyl, OH,
C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2, or R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; each R10 is independently and individually
selected from the group consisting of CO.sub.2H,
CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; each R13 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, carbocyclyl, hydroxyC2-C7alkyl, C1-C6alkoxyC2-C7alkyl,
(R4).sub.2N--CO, (R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.q,
R5-C2-C6alkylN(R4)-(CH.sub.2).sub.q,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.q,
R5-C2-C6alkyl-O--(CH.sub.2).sub.q, --(CH.sub.2).sub.qN(R4)C(O)R8,
aryl, arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl,
heterocyclyl, heterocyclylC1-C6alkyl, aryloxyC2-C6alkyl,
heteroaryloxyC2-C6alkyl, heterocyclyloxyC2-C6alkyl,
arylaminoC2-C6alkyl, heteroarylaminoC2-C6alkyl, and
heterocyclylaminoC2-C6alkyl; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R13 may cyclize to form a C3-C7
heterocyclyl ring; each R14 is independently and respectively
selected from the group consisting of H and C1-C6alkyl; wherein Z1'
is independently and individually selected from the group
consisting of H, C1-C6alkyl, C3-C7cycloalkyl, hydroxyC1-C6alkyl,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8 aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, hydroxyl, hydroxyC1-C6alkyl, cyano, C1-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, halogen, CF.sub.3, (R3).sub.2N--,
(R4).sub.2N--, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, R8CO--,
(R4).sub.2N--CO--C1-C6alkyl, carboxyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R3).sub.2NSO.sub.2, --SO.sub.2R3, SOR3, (R4).sub.2NSO.sub.2,
--SO.sub.2R4, --SOR4, --(CH.sub.2).sub.nN(R4)C(O)R8,
--C.dbd.(NOH)R6, --C.dbd.(NOR3)R6, heteroaryl, heterocyclyl,
heteroarylC1-C6alkyl, heterocyclylC1-C6alkyl, heteroaryloxy,
heterocyclyloxy, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylamino, heteroarylamino,
heterocyclylamino, arylaminoC1-C6alkyl, heteroarylaminoC1-C6alkyl,
heterocyclylaminoC1-C6alkyl, or moieties of the formulae
##STR1148## ##STR1149## wherein the symbol (#) indicates the point
of attachment of the Z3 moiety to the A2 ring of formula I; in the
event that Z3 contains an alkyl or alkylene moiety, such moieties
may be further substituted with one or more C1-C6alkyls; wherein
two R3 moieties are independently and individually taken from the
group consisting of C1-C6alkyl and branched C3-C6alkyl and are
attached to the same nitrogen heteroatom of Z3 may cyclize to form
a C3-C7 heterocyclyl ring; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z3 may cyclize to form a C3-C7
heterocyclyl ring; each Z4 is independently and individually
selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1150## ##STR1151## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2; V, V1, and V2 are each independently and respectively
selected from the group consisting of O and H.sub.2; and tautomers,
diastereomers, geometric isomers, enantiomers, hydrates, prodrugs,
and salts of any of the foregoing.
127. Most preferred compounds from claim 126 are
1-(3-t-butyl-1-(1-methyl-1H-indol-5-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorop-
henyl)urea,
1-(3-t-butyl-1-(1H-indazol-5-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)u-
rea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2-
,3-dichlorophenyl)urea,
2-(3-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)naphthal-
en-1-yl)acetic acid,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
1-(3-t-butyl-1-(1-(methylcarbamoyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1-
H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-
-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3-d-
ichlorophenyl)urea,
1-(3-t-butyl-1-(1-carbamimidoyl-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyraz-
ol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,4,5-
-trifluorophenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3,5-
-trifluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,3,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)naphthalen-2-y-
l)-1H-pyrazol-5-yl)-3-(2,3,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3-d-
ifluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,5-difluorophenyl)urea,
1-(3-t-butyl-1-(1H-indol-5-yl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phe-
nyl)urea,
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-y-
loxy)phenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(4-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)naphthalen-2-y-
l)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(3-(-
pyridin-3-yloxy)phenyl)urea,
1-(1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(py-
ridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(5-chloropyridin-3-yloxy)phenyl)urea,
6-(3-t-butyl-5-(3-(3-(pyridin-3-yloxy)phenyl)ureido)-1H-pyrazol-1-yl)-1,2-
,3,4-tetrahydroisoquinoline-3-carboxylic acid,
1-(3-t-butyl-1-(3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazo-
l-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(3-(methylcarbamoyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1-
H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1-(methylcarbamoyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1-
H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(py-
ridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(quinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phe-
nyl)urea,
1-(1-(1-((2,3-dihydroxypropyl)carbamoyl)-1,2,3,4-tetrahydroisoqu-
inolin-6-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-cyclopentyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-(piperazin-1-yl)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2-
-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(1-(2-(2-aminoethylamino)quinolin-6-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-cyclopentyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-13-(4-(2-(methylcarba-
moyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-(dimethylamino)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-((R)-3-(dimethylamino)pyrrolidin-1-yl)quinolin-6-yl)-1H-
-pyrazol-5-yl)-3-(4-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(1-(2-aminoquinolin-6-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(2-(methylcar-
bamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-(methylamino)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2-(m-
ethylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-(1-oxoisoindolin-4-yl)phenyl)urea,
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(4-(1-oxoisoindolin-4-yl-
)phenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(4-(1--
oxoisoindolin-4-yl)phenyl)urea,
6-(3-t-butyl-5-(3-(4-(1-oxoisoindolin-4-yl)phenyl)ureido)-1H-pyrazol-1-yl-
)-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid,
6-(3-t-butyl-5-(3-(4-(1-oxoisoindolin-4-yl)phenyl)ureido)-1H-pyrazol-1-yl-
)-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid,
128. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 108.
129. The method of claim 128, said kinase species being activated
or unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
130. The method of claim 128, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
131. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 126.
132. The method of claim 131, said species being activated or
unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
133. The method of claim 131, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
134. A pharmaceutical composition comprising a compound of claim
108 together with a pharmaceutically acceptable carrier
135. The composition of claim 134 including an additive selected
from the group including adjuvants, excipients, diluents, and
stablilizers.
136. A pharmaceutical composition comprising a compound of claim
126 together with a pharmaceutically acceptable carrier
137. The composition of claim 136 including an additive selected
from the group including adjuvants, excipients, diluents, and
stabilizers.
138. A method of treating an individual suffering from a condition
selected from the group consisting of cancer, secondary cancer
growth arising from metastasis, hyperproliferative diseases, and
diseases characterized by hyper-vascularization, comprising the
step of administering to such individual a compound of claim
108.
139. The method of claim 138, said condition being glioblastomas,
ovarian cancer, pancreatic cancer, prostate cancer, lung cancers,
breast cancers, kidney cancers, cervical carcinomas, metastasis of
primary solid tumor secondary sites, ocular diseases characterized
by hyperproliferation leading to blindness including various
retinopathies including diabetic retinopathy and age-related
macular degeneration, or rheumatoid arthritis characterized by the
in-growth of a vascularized pannus.
140. The method of claim 138, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
141. A method of treating an individual suffering from a condition
selected from the group consisting of cancer, secondary cancer
growth arising from metastasis, hyperproliferative diseases, and
diseases characterized by hyper-vascularization, comprising the
step of administering to such individual a compound of claim
126.
142. The method of claim 141, said condition being glioblastomas,
ovarian cancer, pancreatic cancer, prostate cancer, lung cancers,
breast cancers, kidney cancers, cervical carcinomas, metastasis of
primary solid tumor secondary sites, ocular diseases characterized
by hyperproliferation leading to blindness including various
retinopathies including diabetic retinopathy and age-related
macular degeneration, or rheumatoid arthritis characterized by the
in-growth of a vascularized pannus.
143. The method of claim 141, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
144. An adduct comprising a compound of claim 108 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
145. An adduct comprising a compound of claim 126 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
146. Compounds of the formula ##STR1152## wherein A2 is selected
from the group consisting of a Z1-substituted phenyl,
Z1-substituted pyridyl, Z1-substituted pyrimidinyl, Z1-substituted
thienyl, Z1 or Z4'-substituted monocyclic heterocyclyl rings, and
other monocyclic heteroaryls, excluding tetrazolyl,
1,2,4-oxadiazolonyl, 1,2,4-triazolonyl, and alkyl-substituted
pyrrolyl wherein the pyrrolyl nitrogen is the site of attachment to
the A1 ring; A1 is selected from the group consisting of R2' and
R7-substituted phenyl, pyridyl, or pyrimidinyl, R2-substituted
monocyclic 5-membered ring heteroaryl, and R2'-substituted
monocyclic heterocyclyl moieties; W and Y are CHR4, NR3, or O and
wherein W and Y are not simultaneously O; X is O, S, or NR3; each
Z1 is a substituent attached to a ring carbon and is independently
and individually selected from the group consisting of
hydroxyC1-C6alkyl, C2-C6alkoxy, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1153## ##STR1154## cyano wherein
the site of attachment to the A2 ring is meta to the point of
attachment to the A1 ring and wherein A2 is phenyl, and cyano
wherein the site of attachment is to a substitutable position when
A2 is pyridyl, pyrimidinyl or a five-membered ring; wherein the
asterisk (*) indicates the point of attachment of the Z1 moiety to
the A2 ring; in the event that Z1 contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z1 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z1 may cyclize to form a C3-C7 heterocyclyl ring;
wherein Z1' is independently and individually selected from the
group consisting of H, C1-C6alkyl, C3-C7cycloalkyl,
hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, (R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4' is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1155## ##STR1156## wherein the symbol
(#) indicates the point of attachment of the Z4' moiety to the A1
ring of formula I; in the event that Z4' contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4' may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4' may cyclize to form a C3-C7 heterocyclyl ring;
each R2 is selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, and R19 substituted C3-C8carbocyclyl wherein
R19 is H or C1-C6alkyl, C1-C6fluoroalkyl wherein the alkyl group is
partially or fully fluorinated, phenyl wherein the phenyl group is
optionally substituted by one or more fluorine substituents, or
monocyclic heteroaryl; each R2' is selected from the group
consisting of halogen and R2; each R3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, C3-C7cycloalkyl, or phenyl; each R3' is
independently and individually selected from the group consisting
of C2-C6alkyl, branched C3-C7alkyl, C3-C7cycloalkyl, aryl,
arylalkyl, heteroaryl, and heteroarylalkyl; each R4 is selected
from the group consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; each R5 is
independently and individually selected from the group consisting
of ##STR1157## and wherein the symbol (##) is the point of
attachment to respective R8, R10, Z1, Z4', Z5, Z6 or A2 ring
moieties containing a R5 moiety; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of R5 may cyclize to
form a C3-C7 heterocyclyl ring; wherein each R6 is independently
and individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, phenyl, heteroaryl, and
heterocyclyl; each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or C1-C3alkoxy;
each R8 is independently and individually selected from the group
consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, branchedC4-C7alkyl,
carbocyclyl, phenyl, C1-C6phenylalkyl, heteroaryl or
heteroarylC1-C6alkyl, heterocyclyl, heterocyclylC1-C6alkyl, OH,
C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2, or R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; each R10 is independently and individually
selected from the group consisting of CO.sub.2H,
CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; D comprises a moiety taken from group consisting
of the formula ##STR1158## wherein the symbol (***) is the point of
attachment to the Y group of formula I; wherein E2 is taken from
the group consisting of poly-aryl, poly-heteroaryl, mono- and poly
heterocyclyl, and carbocyclyl; wherein E1 is taken from the group
consisting of mono- and poly-aryl, mono- and poly-heteroaryl, mono-
and poly heterocyclyl and carbocyclyl; X1 is selected from the
group consisting of O, S, NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-,
--S--(CH.sub.2)n-, --NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--,
--O--(CH.sub.2)q-NR3-, --N(R3)-(CH.sub.2)q-N(R3)-,
--(CH.sub.2).sub.n--N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2).sub.p--, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein either E1 or E2 is directly linked to the Y group of
formula I; and n is 0-4; p is 1-4; q is 2-6, r is 0 or 1; and
tautomers, diastereomers, geometric isomers, enantiomers, hydrates,
prodrugs, and salts of any of the foregoing.
147. The compounds of claim 146 wherein E1 is selected from the
group consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl;
wherein E2 is comprises the group consisting of cyclopentyl,
cyclohexyl, non-fused bicyclic rings comprising pyridylpyridiminyl
pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl,
imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl.
148. The compounds of claim 146 wherein D comprises a moiety of the
formula ##STR1159## X2 is selected from the group consisting of
C1-C6 alkyl, C3-C6 branched alkyl, or a direct bond wherein E2 is
directly linked to the Y group of formula I.
149. The compounds of claim 148 wherein the E2 ring is non-fused
bicyclic rings comprising pyridylpyridiminyl
pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl,
imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl.
150. The compounds of claim 146 wherein A2 is selected from the
group consisting of ##STR1160## ##STR1161## each Z4 is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1162## ##STR1163## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)--(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2.
151. The compounds of claim 150, wherein A2 is selected from the
group consisting of ##STR1164## and wherein the symbol (**) is the
point of attachment to the A1 ring for formula I.
152. The compounds of claim 151, wherein A2 is selected from the
group consisting of ##STR1165## and wherein the symbol (**) is the
point of attachment to the A1 ring of formula I.
153. The compounds of claim 147 wherein said A2 group is defined as
set forth in claim 150.
154. The compounds of claim 153 wherein said A2 group is defined as
set forth in claim 151.
155. The compounds of claim 153 wherein said A2 group is defined as
set forth in claim 152.
156. The compounds of claim 148 wherein said A2 group is defined as
set forth in claim 150.
157. The compounds of claim 156 wherein said A2 group is defined as
set forth in claim 151.
158. The compounds of claim 156 wherein said A2 group is defined as
set forth in claim 152.
159. The compounds of claims 146, 150, 153, 156, wherein A1 is
selected from the group consisting of ##STR1166## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I.
160. The compounds of claims 146, 150, 153, 156, wherein A1 is
selected from the group consisting of ##STR1167## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
161. The compounds of claims 146, 150, 153, 156, wherein A1 is
selected from the group consisting of ##STR1168## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
162. The compounds of claims 146, 150, 153, 156, wherein: (1) W and
Y are each NH, and X.dbd.O; (2) W.dbd.NH, Y.dbd.CHR4 and X.dbd.O;
or (3) W.dbd.CHR4, Y.dbd.NH, and X.dbd.O.
163. The compounds of claims 146, 150, 153, 156, wherein W and Y
are each NH and X.dbd.O.
164. Compounds of the formula ##STR1169## wherein A2 is selected
from the group consisting of ##STR1170## wherein the symbol (**)
denotes the attachment to the A1 moiety of formula I; A1 is
selected from the group consisting of ##STR1171## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I; X is O, S, or NR3; D comprises a member of ##STR1172## wherein
E1 is selected from the group consisting cyclopropyl, cyclobutyl,
cyclopentyl, cyclohexyl, pyrrolidinyl piperidinyl, phenyl, thienyl,
oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl,
oxadiazolyl, thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl
and naphthyl; wherein the symbol (***) denotes the attachment to
the Y moiety of formula I; X1 is selected from the group consisting
of O, S, NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2).sub.n--N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2).sub.p--, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I;
each R2 is selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, and R19 substituted C3-C8carbocyclyl wherein
R19 is H or C1-C6alkyl, C1-C6fluoroalkyl wherein the alkyl group is
partially or fully fluorinated, phenyl wherein the phenyl group is
optionally substituted by one or more fluorine substituents, or
monocyclic heteroaryl; each R2' is selected from the group
consisting of halogen and R2; each R3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl; wherein two R3
moieties independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C7alkyl are attached to
the same nitrogen heteroatom, the two R3 moieties may cyclize to
form a C3-C7 heterocyclyl ring; each R4 is selected from the group
consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom may
cyclize to form a C3-C7 heterocyclyl ring; each R5 is independently
and individually selected from the group consisting of ##STR1173##
and wherein the symbol (##) is the point of attachment to
respective R8, R10, Z1, Z4, Z5, Z6 or A2 ring moieties containing a
R5 moiety; wherein two R4 moieties independently and individually
taken from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of R5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein each R6 is independently and individually selected from the
group consisting of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl,
phenyl, heteroaryl, and heterocyclyl; each R7 is selected from the
group consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, C1-C3alkyl, cyclopropyl,
cyano, or C1-C3alkoxy; each R8 is independently and individually
selected from the group consisting of C1-C6alkyl, C1-C6 fluoroalkyl
wherein the alkyl moiety is partially or fully fluorinated,
branchedC4-C7alkyl, carbocyclyl, phenyl, C1-C6phenylalkyl,
heteroaryl or heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2,
or R5; wherein two R3 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; each Z1 is a substituent attached to a ring
carbon and is independently and individually selected from the
group consisting of hydroxyC1-C6alkyl, C2-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1174## ##STR1175## cyano wherein
the site of attachment to the A2 ring is meta to the point of
attachment to the A1 ring and wherein A2 is phenyl, and cyano
wherein the site of attachment is to a substitutable position when
A2 is pyridyl, pyrimidinyl or a five-membered ring; In the
foregoing definition of Z1, alkyl moieties may optionally be
substituted by one or more C1-C6alkyl; Wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z1 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
In the foregoing definition of Z1, alkyl moieties may optionally be
substituted by one or more C1-C6alkyl; Wherein the asterisk (*)
indicates the point of attachment of the Z I moiety to the A2 ring;
in the event that Z1 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; wherein Z1' is independently and
individually selected from the group consisting of H, C1-C6alkyl,
C3-C7cycloalkyl, hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4 is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1176## ##STR1177## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2; and tautomers, diastereomers, geometric isomers,
enantiomers, hydrates, prodrugs and salts of any of the
foregoing.
165. Most preferred compounds from claim 164 are:
1-(1-(3-(1-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(6-(thiaz-
ol-4-yl)pyrimidin-4-yloxy)phenyl)urea,
1-(2-(3-(2-amino-2-oxoethyl)phenyl)-5-t-butylthiophen-3-yl)-3-(4-(4-(pyri-
din-3-yl)pyrimidin-2-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(4-(i-
soxazol-4-yl)pyrimidin-2-yl)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(4-(p-
yridin-3-yl)pyrimidin-2-yloxy)phenyl)urea,
1-(1-(3-(1H-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(4-(pyri-
din-3-yl)pyrimidin-2-yloxy)phenyl)urea
166. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 146.
167. The method of claim 166, said kinase species being activated
or unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
168. The method of claim 166, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
169. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 164.
170. The method of claim 169, said species being activated or
unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
171. The method of claim 169, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
172. A pharmaceutical composition comprising a compound of claim
146 together with a pharmaceutically acceptable carrier
173. The composition of claim 172 including an additive selected
from the group including adjuvants, excipients, diluents, and
stablilizers.
174. A pharmaceutical composition comprising a compound of claim
164 together with a pharmaceutically acceptable carrier
175. The composition of claim 174 including an additive selected
from the group including adjuvants, excipients, diluents, and
stabilizers.
176. A method of treating an individual suffering from a condition
selected from the group consisting of cancer, secondary cancer
growth arising from metastasis, hyperproliferative diseases, and
diseases characterized by hyper-vascularization, comprising the
step of administering to such individual a compound of claim
146.
177. The method of claim 176, said condition being glioblastomas,
ovarian cancer, pancreatic cancer, prostate cancer, lung cancers,
breast cancers, kidney cancers, cervical carcinomas, metastasis of
primary solid tumor secondary sites, ocular diseases characterized
by hyperproliferation leading to blindness including various
retinopathies including diabetic retinopathy and age-related
macular degeneration, or rheumatoid arthritis characterized by the
in-growth of a vascularized pannus.
178. The method of claim 176, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
179. A method of treating an individual suffering from a condition
selected from the group consisting of cancer, secondary cancer
growth arising from metastasis, hyperproliferative diseases, and
diseases characterized by hyper-vascularization, comprising the
step of administering to such individual a compound of claim
164.
180. The method of claim 179, said condition being glioblastomas,
ovarian cancer, pancreatic cancer, prostate cancer, lung cancers,
breast cancers, kidney cancers, cervical carcinomas, metastasis of
primary solid tumor secondary sites, ocular diseases characterized
by hyperproliferation leading to blindness including various
retinopathies including diabetic retinopathy and age-related
macular degeneration, or rheumatoid arthritis characterized by the
in-growth of a vascularized pannus.
181. The method of claim 179, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
182. An adduct comprising a compound of claim 146 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
183. An adduct comprising a compound of claim 164 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
184. Compounds of the formula ##STR1178## wherein A2 is selected
from the group consisting of bicyclic fused aryl, bicyclic fused
heteroaryl, and bicyclic fused heterocyclyl rings, each A2 moiety
presenting a proximal ring bonded with A1 and a distal ring
attached to the proximal ring, and either the distal ring has a
heteroatom in the ring structure thereof and/or the distal ring has
Z2 or Z3 substituents; A1 is selected from the group consisting of
R2' and R7-substituted phenyl, pyridyl, or pyrimidinyl,
R2-substituted monocyclic 5-membered ring heteroaryl, and
R2'-substituted monocyclic heterocyclyl moieties; W and Y are CHR4,
NR3, or O and wherein W and Y are not simultaneously O; X is O, S,
or NR3; D comprises a member of the group consisting of Z5- or
Z6-substituted mono- and poly-aryl, of Z5- or Z6-substituted mono-
and poly-heteroaryl, of Z5- or Z6-substituted mono- and
poly-heterocyclyl, of Z5- or Z6-substituted mono- and
poly-arylalkyl, of Z5- or Z6-substituted mono- and poly-aryl
branched alkyl, of Z5- or Z6-substituted mono- and
poly-heteroarylalkyl, of Z5- or Z6-substituted mono- and
poly-heteroaryl branched alkyl, of Z5- or Z6-substituted mono- and
poly-heterocyclylalkyl, of Z5- or Z6-substituted mono- and
poly-heterocyclyl branched alkyl, alkyl, and carbocyclyl moieties;
each Z2 is independently and individually selected from the group
consisting of hydroxyl, hydroxyC1-C6alkyl, cyano, (R3).sub.2N--,
(R4).sub.2N--, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--CO,
(R4).sub.2N--CO, (R4).sub.2N--CO--C1-C6alkyl, carboxyl,
carboxyC1-C6alkyl, C1-C6alkoxycarbonyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2,
(R4).sub.2NSO.sub.2, --SO.sub.2R5, --(CH.sub.2).sub.nN(R4)C(O)R8,
.dbd.O, .dbd.NOH, .dbd.N(OR6), heteroarylC1-C6alkyl,
heterocyclylC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, heterocyclylaminoC1-C6alkyl, or moieties
of the formulae ##STR1179## ##STR1180## wherein the symbol (#)
indicates the point of attachment of the Z2 moiety to the A2 ring
of formula I; in the event that Z2 contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z2 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z2 may cyclize to form a C3-C7 heterocyclyl ring;
wherein Z1' is independently and individually selected from the
group consisting of H, C1-C6alkyl, C3-C7cycloalkyl,
hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, (R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, hydroxyl, hydroxyC1-C6alkyl, cyano, C1-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, halogen, CF.sub.3, (R3).sub.2N--,
(R4).sub.2N--, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, R8CO--,
(R4).sub.2N--CO--C1-C6alkyl, carboxyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R3).sub.2NSO.sub.2, --SO.sub.2R3, SOR3, (R4).sub.2NSO.sub.2,
--SO.sub.2R4, --SOR4, --(CH.sub.2).sub.nN(R4)C(O)R8,
--C.dbd.(NOH)R6, --C.dbd.(NOR3)R6, heteroaryl, heterocyclyl,
heteroarylC1-C6alkyl, heterocyclylC1-C6alkyl, heteroaryloxy,
heterocyclyloxy, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylamino, heteroarylamino,
heterocyclylamino, arylaminoC1-C6alkyl, heteroarylaminoC1-C6alkyl,
heterocyclylaminoC1-C6alkyl, or moieties of the formulae
##STR1181## ##STR1182## wherein the symbol (#) indicates the point
of attachment of the Z3 moiety to the A2 ring of formula I; in the
event that Z3 contains an alkyl or alkylene moiety, such moieties
may be further substituted with one or more C1-C6alkyls; wherein
two R3 moieties are independently and individually taken from the
group consisting of C1-C6alkyl and branched C3-C6alkyl and are
attached to the same nitrogen heteroatom of Z3 may cyclize to form
a C3-C7 heterocyclyl ring; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z3 may cyclize to form a C3-C7
heterocyclyl ring; each Z5 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, halogen, fluoroalkyl, cyano, hydroxyl, alkoxy, oxo,
aminocarbonyl, carbonylamino, aminosulfonyl, sulfonylamino,
--N(R3).sub.2, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --R5, --O--(CH.sub.2)q-O-Alkyl,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-O-Alkyl,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --O--(CH.sub.2)q-R5, and
--N(R3)-(CH.sub.2)q-R5; wherein two R3 moieties are independently
and individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring;
each Z6 is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, hydroxyl,
C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8, (R4).sub.2N--, --R5,
--N(R4)COR8, --N(R3)SO.sub.2R6-, --CON(R3).sub.2, --CON(R4).sub.2,
--COR5, --SO.sub.2NHR4, heteroaryl, heterocyclyl, heteroaryloxy,
heterocyclyloxy, arylamino, heteroarylamino, and heterocyclylamino;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z6 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z6 may cyclize to
form a C3-C7 heterocyclyl ring; Each R2 is independently and
individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, C1-C6fluoroalkyl, wherein the alkyl group is
partially or fully fluorinated, monocyclic heteroaryl, and R19
substituted C3-C8carbocyclyl wherein R19 is H and C1-C6alkyl; each
R2' is selected from the group consisting of halogen and R2; each
R3 is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, C3-C7carbocyclyl,
or phenyl; each R4 is selected from the group consisting of H,
C1-C6alkyl, hydroxyC1-C6 alkyl, dihydroxyC1-C6alkyl,
C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl, branched hydroxyC1-C6
alkyl, branched C1-C6alkoxyC1-C6alkyl, branched
dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted carbocyclyl,
alkoxy substituted carbocyclyl, dihydroxy substituted carbocyclyl,
phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; each R5 is
independently and individually selected from the group consisting
of ##STR1183## and wherein the symbol (##) is the point of
attachment to respective R8, R10, Z2, or Z3, moieties containing a
R5 moiety; wherein two R4 moieties independently and individually
taken from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of R5 may cyclize to form a C3-C7 heterocyclyl ring;
each R6 is independently and individually selected from the group
consisting of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl, phenyl,
heteroaryl, and heterocyclyl; each R7 is selected from the group
consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl moiety
is partially or fully fluorinated, C1-C3alkyl, cyclopropyl, cyano,
or C1-C3alkoxy; each R8 is independently and individually selected
from the group consisting of C1-C6alkyl, branched C3-C7alkyl,
fluoroalkyl wherein the alkyl moiety is partially or fully
fluorinated, carbocyclyl, phenyl, C1-C6phenylalkyl, heteroaryl or
heteroarylC1-C6alkyl, heterocyclyl, heterocyclylC1-C6alkyl, OH,
C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2, or R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; each R10 is independently and individually
selected from the group consisting of CO.sub.2H,
CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1;
and tautomers, diastereomers, geometric isomers, enantiomers,
hydrates, prodrugs and salts of any of the foregoing.
185. The compounds of claim 184 wherein D is a moiety of the
formula ##STR1184## wherein E1 is selected from the group
consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl;
wherein the symbol (***) is the point of attachment to the Y group
of formula I; X1 is selected from the group consisting of O, S,
NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2).sub.n--N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I; and
E2 is selected from the group comprising cyclopentyl, cyclohexyl,
phenyl, naphthyl, pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, triazolyl, tetrazolyl, pyridinyl, pyrimidinyl,
pyrazinyl, pyridazinyl, triazinyl, fused bicyclic rings selected
from the group comprising indolyl, isoindolyl, isoindolinyl,
isoindolonyl, indazolyl, benzofuranyl, benzothienyl,
benzothiazolyl, benzothiazolonyl, benzoxazolyl, benzoxazolonyl,
benzisoxazolyl, benzisothiazolyl, benzimidazolyl, benzimidazolonyl,
benztriazolyl, imidazopyridinyl, imidazopyrimidinyl,
imidazolonopyrimidinyl, dihydropurinonyl, pyrrolopyrimidinyl,
purinyl, pyrazolopyridinyl, pyrazolopyrimidinyl,
isoxazolopyrimidinyl, isothiazolopyrimidinyl, furylopyrimidinyl,
thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl,
non-fused bicyclic rings comprising pyridylpyridiminyl,
pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl,
imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl; and n is 0-4; p
is 1-4; q is 2-6.
186. The compounds of claim 184 wherein D comprises carbocyclyl and
a moiety of the formula ##STR1185## X2 is selected from the group
consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct bond
wherein E2 is directly linked to the Y group of formula I.
187. The compounds of claim 186 wherein the E2 ring is selected
from the group comprising cyclopentyl, cyclohexyl, phenyl,
naphthyl, pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, triazolyl, tetrazolyl, pyridinyl, pyrimidinyl,
pyrazinyl, pyridazinyl, triazinyl, fused bicyclic rings selected
from the group comprising indolyl, isoindolyl, isoindolinyl,
isoindolonyl, indazolyl, benzofuranyl, benzothienyl,
benzothiazolyl, benzothiazolonyl, benzoxazolyl, benzoxazolonyl,
benzisoxazolyl, benzisothiazolyl, benzimidazolyl, benzimidazolonyl,
benztriazolyl, imidazopyridinyl, imidazopyrimidinyl,
imidazolonopyrimidinyl, dihydropurinonyl, pyrrolopyrimidinyl,
purinyl, pyrazolopyridinyl, pyrazolopyrimidinyl,
isoxazolopyrimidinyl, isothiazolopyrimidinyl, furylopyrimidinyl,
thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl,
non-fused bicyclic rings comprising pyridylpyridiminyl,
pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl,
imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl;
188. The compounds of claim 184 wherein A2 is selected from the
group consisting of ##STR1186## ##STR1187## ##STR1188## ##STR1189##
##STR1190## ##STR1191## and wherein the symbol (**) is the point of
attachment to the A1 ring of formula I; and wherein indicates
either a saturated or an unsaturated bond; wherein each Z3 and Z5
is independently attached to either aryl or heteroaryl ring of the
A2 bicyclic ring; each R9 is independently and individually
selected from the group consisting of H, F, C1-C6alkyl, branched
C4-C7alkyl, carbocyclyl, phenyl, phenyl C1-C6alkyl, heterocyclyl
and heterocyclylC1-C6alkyl; each R13 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, hydroxyC2-C7alkyl,
C1-C6alkoxyC2-C7alkyl, (R4).sub.2N--CO,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.q,
R5-C2-C6alkylN(R4)-(CH.sub.2).sub.q,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.q,
R5-C2-C6alkyl-O--(CH.sub.2).sub.q, --(CH.sub.2).sub.qN(R4)C(O)R8,
aryl, arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl,
heterocyclyl, heterocyclylC1-C6alkyl, aryloxyC2-C6alkyl,
heteroaryloxyC2-C6alkyl, heterocyclyloxyC2-C6alkyl,
arylaminoC2-C6alkyl, heteroarylaminoC2-C6alkyl, and
heterocyclylaminoC2-C6alkyl; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R13 may cyclize to form a C3-C7
heterocyclyl ring; each R14 is independently and respectively
selected from the group consisting of H and C1-C6alkyl; V, V1, and
V2 are each independently and respectively selected from the group
consisting of O and H.sub.2; each Z4 is a substituent attached to a
ring nitrogen and is independently and individually selected from
the group consisting of H, C1-C6alkyl, hydroxyC2-C6alkyl,
C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1192## ##STR1193## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; and
n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v is 1 or 2.
189. The compounds of claim 188, wherein A2 is selected from the
group consisting of ##STR1194## ##STR1195## and wherein the symbol
(**) is the point of attachment to the A1 ring for formula I;
wherein each Z3 and Z5 is independently attached to either aryl or
heteroaryl ring of the A2 bicyclic ring.
190. The compounds of claim 189, wherein A2 is selected from the
group consisting of ##STR1196## and wherein the symbol (**) is the
point of attachment to the A1 ring of formula I; wherein each Z3
and Z5 is independently attached to either aryl or heteroaryl ring
of the A2 bicyclic ring.
191. The compounds of claim 185 wherein said A2 group is defined as
set forth in claim 188.
192. The compounds of claim 191 wherein said A2 group is defined as
set forth in claim 189.
193. The compounds of claim 191 wherein said A2 group is defined as
set forth in claim 190.
194. The compounds of claim 186 wherein said A2 group is defined as
set forth in claim 188.
195. The compounds of claim 194 wherein said A2 group is defined as
set forth in claim 189.
196. The compounds of claim 194 wherein said A2 group is defined as
set forth in claim 190.
197. The compounds of claims 184, 188, 191 or 194, wherein A1 is
selected from the group consisting of ##STR1197## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I.
198. The compounds of claims 184, 188, 191 or 194, wherein A1 is
selected from the group consisting of ##STR1198## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
199. The compounds of claims 184, 188, 191 or 194, wherein A1 is
selected from the group consisting of ##STR1199## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
200. The compounds of claims 184, 188, 191 or 194, wherein: (1) W
and Y are each NH, and X.dbd.O; (2) W.dbd.NH, Y.dbd.CHR4 and
X.dbd.O; or (3) W.dbd.CHR4, Y.dbd.NH, and X.dbd.O.
201. The compounds of claims 184, 188, 191 or 194, wherein W and Y
are each NH and X.dbd.O.
202. Compounds of the formula ##STR1200## wherein A2 is selected
from the group consisting of ##STR1201## ##STR1202## ##STR1203##
wherein each Z3 and Z5 is independently attached to either aryl or
heteroaryl ring of the A2 bicyclic ring; wherein the symbol (**)
denotes the attachment to the A1 moiety of formula I; A1 is
selected from the group consisting of ##STR1204## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I; X is O, S, or NR3; D comprises a member of 2,3-dichlorophenyl,
2,3-difluorophenyl, 2,4-difluorophenyl, 3,4-difluorophenyl,
2,5-difluorophenyl, 3,5-difluorophenyl, 2,3,5-trifluorophenyl,
2,4,5-trifluorophenyl, 2,3,4-trifluorophenyl,
3,4,5-trifluorophenyl, 3-phenoxyphenyl, 4-phenoxyphenyl,
cyclohexyl, ##STR1205## ##STR1206## ##STR1207## ##STR1208##
##STR1209## wherein E1 is selected from the group consisting
cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, pyrrolidinyl
piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl; wherein the
symbol (***) denotes the attachment to the Y moiety of formula I;
X1 is selected from the group consisting of O, S, NR3,
--C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5 alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I;
Each R2 is independently and individually selected from the group
consisting of C1-C6alkyl, branched C3-C7alkyl, C1-C6fluoroalkyl,
wherein the alkyl group is partially or fully fluorinated,
monocyclic heteroaryl, and R19 substituted C3-C8carbocyclyl wherein
R19 is H, and C1-C6alkyl; each R2' is selected from the group
consisting of halogen and R2; each R3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl; wherein two R3
moieties independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C7alkyl are attached to
the same nitrogen heteroatom, the two R3 moieties may cyclize to
form a C3-C7 heterocyclyl ring; each R4 is selected from the group
consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom may
cyclize to form a C3-C7 heterocyclyl ring; each R5 is independently
and individually selected from the group consisting of ##STR1210##
and wherein the symbol (##) is the point of attachment to
respective R8, R10, R13, Z2, Z3, Z4, Z5, or A2 ring moieties
containing a R5 moiety; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R5 may cyclize to form a C3-C7
heterocyclyl ring; wherein each R6 is independently and
individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, phenyl, heteroaryl, and
heterocyclyl; each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or C1-C3alkoxy;
each R8 is independently and individually selected from the group
consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, branchedC4-C7alkyl,
carbocyclyl, phenyl, C1-C6phenylalkyl, heteroaryl or
heteroarylC1-C6alkyl, heterocyclyl, heterocyclylC1-C6alkyl, OH,
C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2, or R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; each R10 is independently and individually
selected from the group consisting of CO.sub.2H,
CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; each R13 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, carbocyclyl, hydroxyC2-C7alkyl, C1-C6alkoxyC2-C7alkyl,
(R4).sub.2N--CO, (R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.q,
R5-C2-C6alkylN(R4)-(CH.sub.2).sub.q,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.q,
R5-C2-C6alkyl-O--(CH.sub.2).sub.q, --(CH.sub.2).sub.qN(R4)C(O)R8,
aryl, arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl,
heterocyclyl, heterocyclylC1-C6alkyl, aryloxyC2-C6alkyl,
heteroaryloxyC2-C6alkyl, heterocyclyloxyC2-C6alkyl,
arylaminoC2-C6alkyl, heteroarylaminoC2-C6alkyl, and
heterocyclylaminoC2-C6alkyl; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R13 may cyclize to form a C3-C7
heterocyclyl ring; each R14 is independently and respectively
selected from the group consisting of H and C1-C6alkyl; wherein Z1'
is independently and individually selected from the group
consisting of H, C1-C6alkyl, C3-C7cycloalkyl, hydroxyC1-C6alkyl,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, hydroxyl, hydroxyC1-C6alkyl, cyano, C1-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, halogen, CF.sub.3, (R3).sub.2N--,
(R4).sub.2N--, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, R8CO--,
(R4).sub.2N--CO--C1-C6alkyl, carboxyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R3).sub.2NSO.sub.2, --SO.sub.2R3, SOR3, (R4).sub.2NSO.sub.2,
--SO.sub.2R4, --SOR4, --(CH.sub.2).sub.nN(R4)C(O)R8,
--C.dbd.(NOH)R6, --C.dbd.(NOR3)R6, heteroaryl, heterocyclyl,
heteroarylC1-C6alkyl, heterocyclylC1-C6alkyl, heteroaryloxy,
heterocyclyloxy, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylamino, heteroarylamino,
heterocyclylamino, arylaminoC1-C6alkyl, heteroarylaminoC1-C6alkyl,
heterocyclylaminoC1-C6alkyl, or moieties of the formulae
##STR1211## ##STR1212## wherein the symbol (#) indicates the point
of attachment of the Z3 moiety to the A2 ring of formula I; in the
event that Z3 contains an alkyl or alkylene moiety, such moieties
may be further substituted with one or more C1-C6alkyls; wherein
two R3 moieties are independently and individually taken from the
group consisting of C1-C6alkyl and branched C3-C6alkyl and are
attached to the same nitrogen heteroatom of Z3 may cyclize to form
a C3-C7 heterocyclyl ring; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z3 may cyclize to form a C3-C7
heterocyclyl ring; each Z4 is independently and individually
selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1213## ##STR1214## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2; V, V1, and V2 are each independently and respectively
selected from the group consisting of O and H.sub.2; and tautomers,
diastereomers, geometric isomers, enantiomers, hydrates, prodrugs,
and salts of any of the foregoing.
203. Most preferred compounds from claim 202 are
1-(3-t-butyl-1-(3-hydroxy-2,3-dihydro-1H-inden-5-yl)-1H-pyrazol-5-yl)-3-(-
2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(hydroxyimino)-2,3-dihydro-1H-inden-5-yl)-1H-pyrazol-5--
yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(1-methyl-1H-indol-5-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorop-
henyl)urea,
1-(3-t-butyl-1-(1H-indazol-5-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)u-
rea,
1-(3-t-butyl-1-(indolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)-
urea,
1-(1-(1-acetylindolin-6-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3-dichlo-
rophenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3-d-
ichlorophenyl)urea,
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea-
,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3--
dichlorophenyl)urea,
1-(1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3-d-
ichlorophenyl)urea,
1-(3-t-butyl-1-(4-((1-methylsulfonylamino-1-oxo-methylamino)methyl)naphth-
alen-2-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
2-(3-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)naphthal-
en-1-yl)acetic acid,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
1-(3-t-butyl-1-(quinolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)ure-
a,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3--
(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(1-oxo-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl-
)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(2-(methylsulfonyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-
-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
(3S)-6-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-1,2,3-
,4-tetrahydroisoquinoline-3-carboxylic acid,
1-(3-t-butyl-1-(3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazo-
l-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-
-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3-d-
ichlorophenyl)urea,
1-(3-t-butyl-1-(1-carbamimidoyl-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyraz-
ol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-2,3,4,5-tetrahydro-1H-benzo[d]azepin-7-yl)-1H-pyraz-
ol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(methylsulfonyl)-2,3,4,5-tetrahydro-1H-benzo[d]azepin-7-
-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(4-oxo-3,4-dihydroquinazolin-7-yl)-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,3,4-trifluorophenyl)urea,
1-(3-t-butyl-1-(quinolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3,4-trifluorophenyl)-
urea,
1-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5--
yl)-3-(2,3,4-trifluorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3,4-
-trifluorophenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,4,5-
-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,4-
,5-trifluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)naphthalen-2-y-
l)-1H-pyrazol-5-yl)-3-(2,4,5-trifluorophenyl)urea,
1-(1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,4,5-
-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-((1-amino-1-oxo-methylamino)methyl)naphthalen-2-yl)-1H--
pyrazol-5-yl)-3-(2,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(quinolin-6-yl)-1H-pyrazol-5-yl)-3-(2,4,5-trifluorophenyl)-
urea,
1-(3-t-butyl-1-((3S)-3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-7-yl)-
-1H-pyrazol-5-yl)-3-(2,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(2-
,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-
-(2,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3,5-
-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)naphthalen-2-y-
l)-1H-pyrazol-5-yl)-3-(2,3,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,3-
,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(quinolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3,5-trifluorophenyl)-
urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(-
2,3,5-trifluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(3,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(3,5-
-difluorophenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3-d-
ifluorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,3-
-difluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,3-difluorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-
-(2,3-difluorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,4-
-difluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,4-difluorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(2,4-d-
ifluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(4-fluorophenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-phenoxyphenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-
-(3-phenoxyphenyl)urea,
1-(3-t-butyl-1-(1H-indol-5-yl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phe-
nyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazo-
l-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(3-(-
pyridin-3-yloxy)phenyl)urea,
1-(1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(py-
ridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(5-chloropyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(py-
ridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(1-(2-(2-aminoethylamino)quinolin-6-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-cyclopentyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-(dimethylamino)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(1-(2-aminoquinolin-6-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(2-(methylcar-
bamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-(methylamino)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2-(m-
ethylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-
-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-cyclopentyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(8--
methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazo-
l-5-yl)-3-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl-
)urea,
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(3-(8-methyl-7-oxo-
-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(3-(8--
methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(1H-indol-5-yl)-1H-pyrazol-5-yl)-3-(3-(8-methyl-7-oxo-7,8--
dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-cyclopentyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-y-
l)-3-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea-
,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(-
4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea.
204. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 184.
205. The method of claim 204, said kinase species being activated
or unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
206. The method of claim 204, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
207. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 202.
208. The method of claim 207, said species being activated or
unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
209. The method of claim 207, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
210. A pharmaceutical composition comprising a compound of claim
184 together with a pharmaceutically acceptable carrier
211. The composition of claim 210 including an additive selected
from the group including adjuvants, excipients, diluents, and
stablilizers.
212. A pharmaceutical composition comprising a compound of claim
202 together with a pharmaceutically acceptable carrier
213. The composition of claim 212 including an additive selected
from the group including adjuvants, excipients, diluents, and
stablilizers.
214. A method of treating an individual suffering from a condition
selected from the group consisting of cancer, hyperproliferative
diseases, or diseases characterized angiogenesis, comprising the
step of administering to such individual a compound of claim
184.
215. The method of claim 214, said condition being melanomas,
glioblastomas, ovarian cancer, pancreatic cancer, prostate cancer,
lung cancers, breast cancers, kidney cancers, cervical carcinomas,
metastisis of primary solid tumor secondary sites, ocular diseases
characterized by hyperproliferation leading to blindness including
various retinopathies including diabetic retinopathy and
age-related macular degeneration, rheumatoid arthritis
characterized by the in-growth of a vascularized pannus, or a
disease caused by a mutation in the RAS-RAF-MEK-ERK-MAP kinase
pathway.
216. The method of claim 214, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
217. A method of treating an individual suffering from a condition
selected from the group consisting of cancer and hyperproliferative
diseases, comprising the step of administering to such individual a
compound of claim 202.
218. The method of claim 217 said condition being melanomas,
glioblastomas, ovarian cancer, pancreatic cancer, prostate cancer,
lung cancers, breast cancers, kidney cancers, cervical carcinomas,
metastisis of primary solid tumor secondary sites, ocular diseases
characterized by hyperproliferation leading to blindness including
various retinopathies including diabetic retinopathy and
age-related macular degeneration, rheumatoid arthritis
characterized by the in-growth of a vascularized pannus, or a
disease caused by a mutation in the RAS-RAF-MEK-ERK-MAP kinase
pathway.
219. The method of claim 217, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
220. An adduct comprising a compound of claim 184 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
221. An adduct comprising a compound of claim 202 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
222. Compounds of the formula ##STR1215## wherein A2 is selected
from the group consisting of a Z1-substituted phenyl,
Z1-substituted pyridyl, Z1-substituted pyrimidinyl, Z1-substituted
thienyl, Z1 or Z4'-substituted monocyclic heterocyclyl rings, and
other monocyclic heteroaryls, excluding tetrazolyl,
1,2,4-oxadiazolonyl, 1,2,4-triazolonyl, and alkyl-substituted
pyrrolyl wherein the pyrrolyl nitrogen is the site of attachment to
the A1 ring; A1 is selected from the group consisting of R2' and
R7-substituted phenyl, pyridyl, or pyrimidinyl, R2-substituted
monocyclic 5-membered ring heteroaryl, and R2'-substituted
monocyclic heterocyclyl moieties; W and Y are CHR4, NR3, or O and
wherein W and Y are not simultaneously O; X is O, S, or NR3; Each
R2 is independently and individually selected from the group
consisting of C1-C6alkyl, branched C3-C7alkyl, C1-C6fluoroalkyl,
wherein the alkyl group is partially or fully fluorinated,
monocyclic heteroaryl, and R19 substituted C3-C8carbocyclyl wherein
R19 is H and C1-C6alkyl; each R2' is selected from the group
consisting of halogen and R2; each R3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, C3-C7cycloalkyl, or phenyl; each R3' is
independently and individually selected from the group consisting
of C2-C6alkyl, branched C3-C7alkyl, C3-C7cycloalkyl, aryl,
arylalkyl, heteroaryl, and heteroarylalkyl; each R4 is selected
from the group consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; each R5 is
independently and individually selected from the group consisting
of ##STR1216## and wherein the symbol (##) is the point of
attachment to respective R8, R10, Z1, Z4', Z5, Z6 or A2 ring
moieties containing a R5 moiety; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of R5 may cyclize to
form a C3-C7 heterocyclyl ring; wherein each R6 is independently
and individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, phenyl, heteroaryl, and
heterocyclyl; each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or C1-C3alkoxy;
each R8 is independently and individually selected from the group
consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, branchedC4-C7alkyl,
carbocyclyl, phenyl, C1-C6phenylalkyl, heteroaryl or
heteroarylC1-C6alkyl, heterocyclyl, heterocyclylC1-C6alkyl, OH,
C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2, or R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; each R10 is independently and individually
selected from the group consisting of CO.sub.2H,
CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; D comprises a moiety taken from the formula
##STR1217## wherein the symbol (***) is the point of attachment to
the Y group of formula I; wherein E2 is taken from the group
consisting of poly-aryl, poly-heteroaryl, mono- and poly
heterocyclyl, and carbocyclyl; wherein E1 is taken from the group
consisting of mono- and poly-aryl, mono- and poly-heteroaryl, mono-
and poly heterocyclyl and carbocyclyl; X1 is selected from the
group consisting of O, S, NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-,
--S--(CH.sub.2)n-, --NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--,
--O--(CH.sub.2)q-NR3-, --N(R3)-(CH.sub.2)q-N(R3)-,
--(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5 alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein either E1 or E2 is directly linked to the Y group of
formula I; each Z1 is a substituent attached to a ring carbon and
is independently and individually selected from the group
consisting of hydroxyC1-C6alkyl, C2-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1218## ##STR1219## cyano wherein
the site of attachment to the A2 ring is meta to the point of
attachment to the A1 ring and wherein A2 is phenyl, and cyano
wherein the site of attachment is to a substitutable position when
A2 is pyridyl, pyrimidinyl or a five-membered ring; wherein the
asterisk (*) indicates the point of attachment of the Z1 moiety to
the A2 ring; in the event that Z1 contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z1 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z1 may cyclize to form a C3-C7 heterocyclyl ring;
wherein Z1' is independently and individually selected from the
group consisting of H, C1-C6alkyl, C3-C7cycloalkyl,
hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, (R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8 aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4' is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1220## ##STR1221## wherein the symbol
(#) indicates the point of attachment of the Z4' moiety to the A1
ring of formula I; in the event that Z4' contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4' may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4' may cyclize to form a C3-C7 heterocyclyl ring;
and n is 0-4; p is 1-4; q is 2-6, r is 0 or 1; and tautomers,
diastereomers, geometric isomers, enantiomers, hydrates, prodrugs,
and salts of any of the foregoing.
223. The compounds of claim 222 wherein E1 is selected from the
group consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl;
wherein E2 comprises the group consisting of cyclopentyl,
cyclohexyl, non-fused bicyclic rings comprising pyridylpyridiminyl,
pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl,
imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl.
224. The compounds of claim 222 wherein D comprises a moiety of the
formula ##STR1222## X2 is selected from the group consisting of
C1-C6 alkyl, C3-C6 branched alkyl, or a direct bond wherein E2 is
directly linked to the Y group of formula I.
225. The compounds of claim 224 wherein the E2 ring is non-fused
bicyclic rings comprising pyridylpyridiminyl,
pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl,
imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl.
226. The compounds of claim 222 wherein A2 is selected from the
group consisting of ##STR1223## ##STR1224## each Z4 is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1225## ##STR1226## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2).sub.q--N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2.
227. The compounds of claim 226, wherein A2 is selected from the
group consisting of ##STR1227## and wherein the symbol (**) is the
point of attachment to the A1 ring for formula I.
228. The compounds of claim 227, wherein A2 is selected from the
group consisting of ##STR1228## and wherein the symbol (**) is the
point of attachment to the A1 ring of formula I.
229. The compounds of claim 223 wherein said A2 group is defined as
set forth in claim 226.
230. The compounds of claim 229 wherein said A2 group is defined as
set forth in claim 227.
231. The compounds of claim 229 wherein said A2 group is defined as
set forth in claim 228.
232. The compounds of claim 224 wherein said A2 group is defined as
set forth in claim 226.
233. The compounds of claim 232 wherein said A2 group is defined as
set forth in claim 227.
234. The compounds of claim 232 wherein said A2 group is defined as
set forth in claim 228.
235. The compounds of claims 222, 226, 229, 232, wherein A1 is
selected from the group consisting of ##STR1229## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I.
236. The compounds of claims 222, 226, 229, 232, wherein A1 is
selected from the group consisting of ##STR1230## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
237. The compounds of claims 222, 226, 229, 232, wherein A1 is
selected from the group consisting of ##STR1231## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
238. The compounds of claims 222, 226, 229, 232, wherein: (1) W and
Y are each NH, and X.dbd.O; (2) W.dbd.NH, Y.dbd.CHR4 and X.dbd.O;
or (3) W.dbd.CHR4, Y.dbd.NH, and X.dbd.O.
239. The compounds of claims 222, 226, 229, 232, wherein W and Y
are each NH and X.dbd.O.
240. Compounds of the formula ##STR1232## wherein A2 is selected
from the group consisting of ##STR1233## wherein the symbol (**)
denotes the attachment to the A1 moiety of formula I; A1 is
selected from the group consisting of ##STR1234## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I; X is O, S, or NR3; D comprises a member of ##STR1235##
##STR1236## wherein E1 is selected from the group consisting
cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, pyrrolidinyl
piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl; wherein the
symbol (***) denotes the attachment to the Y moiety of formula I;
X1 is selected from the group consisting of O, S, NR3,
--C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2).sub.n--N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2) p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I;
Each R2 is independently and individually selected from the group
consisting of C1-C6alkyl, branched C3-C7alkyl, C1-C6fluoroalkyl,
wherein the alkyl group is partially or fully fluorinated,
monocyclic heteroaryl, and R19 substituted C3-C8carbocyclyl wherein
R19 is H, and C1-C6alkyl; each R2' is selected from the group
consisting of halogen and R2; each R3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl; wherein two R3
moieties independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C7alkyl are attached to
the same nitrogen heteroatom, the two R3 moieties may cyclize to
form a C3-C7 heterocyclyl ring; each R4 is selected from the group
consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom may
cyclize to form a C3-C7 heterocyclyl ring; each R5 is independently
and individually selected from the group consisting of ##STR1237##
and wherein the symbol (##) is the point of attachment to
respective R8, R10, Z1, Z4, Z5, Z6 or A2 ring moieties containing a
R5 moiety; wherein two R4 moieties independently and individually
taken from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of R5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein each R6 is independently and individually selected from the
group consisting of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl,
phenyl, heteroaryl, and heterocyclyl; each R7 is selected from the
group consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, C1-C3alkyl, cyclopropyl,
cyano, or C1-C3alkoxy; each R8 is independently and individually
selected from the group consisting of C1-C6alkyl, C1-C6 fluoroalkyl
wherein the alkyl moiety is partially or fully fluorinated,
branchedC4-C7alkyl, carbocyclyl, phenyl, C1-C6phenylalkyl,
heteroaryl or heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2,
or R5; wherein two R3 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; each Z1 is a substituent attached to a ring
carbon and is independently and individually selected from the
group consisting of hydroxyC1-C6alkyl, C2-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1238## ##STR1239## cyano wherein
the site of attachment to the A2 ring is meta to the point of
attachment to the A1 ring and wherein A2 is phenyl, and cyano
wherein the site of attachment is to a substitutable position when
A2 is pyridyl, pyrimidinyl or a five-membered ring; In the
foregoing definition of Z1, alkyl moieties may optionally be
substituted by one or more C1-C6alkyl; Wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z1 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
In the foregoing definition of Z1, alkyl moieties may optionally be
substituted by one or more C1-C6alkyl; Wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z1 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; wherein Z1' is independently and
individually selected from the group consisting of H, C1-C6alkyl,
C3-C7cycloalkyl, hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4 is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1240## ##STR1241## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2; and tautomers, diastereomers, geometric isomers,
enantiomers, hydrates, prodrugs and salts of any of the
foregoing.
241. Most preferred compounds from claim 240 are
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-methy-
l-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea,
1-(3-t-butyl-1-(3-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)phenyl)-1H-pyr-
azol-5-yl)-3-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea,
1-(2-(3-(2-amino-2-oxoethyl)phenyl)-5-t-butylthiophen-3-yl)-3-(4-(4-(pyri-
din-3-yl)pyrimidin-2-yloxy)phenyl)urea,
1-(3-t-butyl-1-(3-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)phenyl)-1H-pyr-
azol-5-yl)-3-(4-(6-(thiazol-4-yl)pyrimidin-4-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(4-(p-
yridin-3-yl)pyrimidin-2-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(4-(i-
soxazol-4-yl)pyrimidin-2-ylamino)phenyl)urea
242. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 222.
243. The method of claim 242, said kinase species being activated
or unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
244. The method of claim 242, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
245. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 240.
246. The method of claim 245, said species being activated or
unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
247. The method of claim 245, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
248. A pharmaceutical composition comprising a compound of claim
222 together with a pharmaceutically acceptable carrier
249. The composition of claim 248 including an additive selected
from the group including adjuvants, excipients, diluents, and
stablilizers.
250. A pharmaceutical composition comprising a compound of claim
250 together with a pharmaceutically acceptable carrier
251. The composition of claim 250 including an additive selected
from the group including adjuvants, excipients, diluents, and
stabilizers.
252. A method of treating an individual suffering from a condition
selected from the group consisting of cancer, hyperproliferative
diseases, or diseases characterized angiogenesis, comprising the
step of administering to such individual a compound of claim
222.
253. The method of claim 252, said condition being melanomas,
glioblastomas, ovarian cancer, pancreatic cancer, prostate cancer,
lung cancers, breast cancers, kidney cancers, cervical carcinomas,
metastisis of primary solid tumor secondary sites, ocular diseases
characterized by hyperproliferation leading to blindness including
various retinopathies including diabetic retinopathy and
age-related macular degeneration, rheumatoid arthritis
characterized by the in-growth of a vascularized pannus, or a
disease caused by a mutation in the RAS-RAF-MEK-ERK-MAP kinase
pathway.
254. The method of claim 252, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
255. A method of treating an individual suffering from a condition
selected from the group consisting of cancer, hyperproliferative
diseases, or diseases characterized angiogenesis, comprising the
step of administering to such individual a compound of claim
240.
256. The method of claim 255, said condition being melanomas,
glioblastomas, ovarian cancer, pancreatic cancer, prostate cancer,
lung cancers, breast cancers, kidney cancers, cervical carcinomas,
metastisis of primary solid tumor secondary sites, ocular diseases
characterized by hyperproliferation leading to blindness including
various retinopathies including diabetic retinopathy and
age-related macular degeneration, rheumatoid arthritis
characterized by the in-growth of a vascularized pannus, or a
disease caused by a mutation in the RAS-RAF-MEK-ERK-MAP kinase
pathway.
257. The method of claim 255, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
258. An adduct comprising a compound of claim 222 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
259. An adduct comprising a compound of claim 240 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
260. Compounds of the formula ##STR1242## wherein A2 is selected
from the group consisting of bicyclic fused aryl, bicyclic fused
heteroaryl, and bicyclic fused heterocyclyl rings, each A2 moiety
presenting a proximal ring bonded with A1 and a distal ring
attached to the proximal ring, and either the distal ring has a
heteroatom in the ring structure thereof and/or the distal ring has
Z2 or Z3 substituents; A1 is selected from the group consisting of
R2' and R7-substituted phenyl, pyridyl, or pyrimidinyl,
R2-substituted monocyclic 5-membered ring heteroaryl, and
R2'-substituted monocyclic heterocyclyl moieties; W and Y are CHR4,
NR3, or O and wherein W and Y are not simultaneously O; X is O, S,
or NR3; D comprises a member of the group consisting of Z5- or
Z6-substituted mono- and poly-aryl, of Z5- or Z6-substituted mono-
and poly-heteroaryl, of Z5- or Z6-substituted mono- and
poly-heterocyclyl, of Z5- or Z6-substituted mono- and
poly-arylalkyl, of Z5- or Z6-substituted mono- and poly-aryl
branched alkyl, of Z5- or Z6-substituted mono- and
poly-heteroarylalkyl, of Z5- or Z6-substituted mono- and
poly-heteroaryl branched alkyl, of Z5- or Z6-substituted mono- and
poly-heterocyclylalkyl, of Z5- or Z6-substituted mono- and
poly-heterocyclyl branched alkyl, alkyl, and carbocyclyl moieties;
each Z2 is independently and individually selected from the group
consisting of hydroxyl, hydroxyC1-C6alkyl, cyano, (R3).sub.2N--,
(R4).sub.2N--, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl, carboxyl,
carboxyC1-C6alkyl, C1-C6alkoxycarbonyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2,
(R4).sub.2NSO.sub.2, --SO.sub.2R5-, --(CH.sub.2).sub.nN(R4)C(O)R8,
.dbd.O, .dbd.NOH, .dbd.N(OR6), heteroarylC1-C6alkyl,
heterocyclylC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, heterocyclylaminoC1-C6alkyl, or moieties
of the formulae ##STR1243## ##STR1244## wherein the symbol (#)
indicates the point of attachment of the Z2 moiety to the A2 ring
of formula I; in the event that Z2 contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z2 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z2 may cyclize to form a C3-C7 heterocyclyl ring;
wherein Z1' is independently and individually selected from the
group consisting of H, C1-C6alkyl, C3-C7cycloalkyl,
hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, (R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, hydroxyl, hydroxyC1-C6alkyl, cyano, C1-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, halogen, CF.sub.3, (R3).sub.2N--,
(R4).sub.2N--, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, R8CO--,
(R4).sub.2N--CO--C1-C6alkyl, carboxyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R3).sub.2NSO.sub.2, --SO.sub.2R3, SOR3, (R4).sub.2NSO.sub.2,
--SO.sub.2R4, --SOR4, --(CH.sub.2).sub.nN(R4)C(O)R8,
--C.dbd.(NOH)R6, --C.dbd.(NOR3)R6, heteroaryl, heterocyclyl,
heteroarylC1-C6alkyl, heterocyclylC1-C6alkyl, heteroaryloxy,
heterocyclyloxy, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylamino, heteroarylamino,
heterocyclylamino, arylaminoC1-C6alkyl, heteroarylaminoC1-C6alkyl,
heterocyclylaminoC1-C6alkyl, or moieties of the formulae
##STR1245## ##STR1246## wherein the symbol (#) indicates the point
of attachment of the Z3 moiety to the A2 ring of formula I; in the
event that Z3 contains an alkyl or alkylene moiety, such moieties
may be further substituted with one or more C1-C6alkyls; wherein
two R3 moieties are independently and individually taken from the
group consisting of C1-C6alkyl and branched C3-C6alkyl and are
attached to the same nitrogen heteroatom of Z3 may cyclize to form
a C3-C7 heterocyclyl ring; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z3 may cyclize to form a C3-C7
heterocyclyl ring; each Z5 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, halogen, fluoroalkyl, cyano, hydroxyl, alkoxy, oxo,
aminocarbonyl, carbonylamino, aminosulfonyl, sulfonylamino,
--N(R3).sub.2, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --R5, --O--(CH.sub.2)q-O-Alkyl,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-O-Alkyl,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --O--(CH.sub.2)q-R5, and
--N(R3)-(CH.sub.2)q-R5; wherein two R3 moieties are independently
and individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring;
each Z6 is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, hydroxyl,
C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8, (R4).sub.2N--, --R5,
--N(R4)COR8, --N(R3)SO.sub.2R6-, --CON(R3).sub.2, --CON(R4).sub.2,
--COR5, --SO.sub.2NHR4, heteroaryl, heterocyclyl, heteroaryloxy,
heterocyclyloxy, arylamino, heteroarylamino, and heterocyclylamino;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z6 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z6 may cyclize to
form a C3-C7 heterocyclyl ring; each R2 is selected from the group
consisting of monocyclic heteroaryl, C1-C6alkyl, branched
C3-C7alkyl, a R19-substituted C3-C8carbocyclyl wherein R19 is H or
C1-C6alkyl, C1-C6fluoroalkyl wherein the alkyl group is partially
or fully fluorinated, and phenyl wherein the phenyl group is
optionally substituted by one or more fluorine substituents or
chlorine; each R2' is selected from the group consisting of halogen
and R2; each R3 is independently and individually selected from the
group consisting of H, C1-C6alkyl, branched C3-C7alkyl,
C3-C7carbocyclyl, or phenyl; each R4 is selected from the group
consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; each R5 is
independently and individually selected from the group consisting
of ##STR1247## and wherein the symbol (##) is the point of
attachment to respective R8, R10, Z2, or Z3, moieties containing a
R5 moiety; wherein two R4 moieties independently and individually
taken from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of R5 may cyclize to form a C3-C7 heterocyclyl ring;
each R6 is independently and individually selected from the group
consisting of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl, phenyl,
heteroaryl, and heterocyclyl; each R7 is selected from the group
consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl moiety
is partially or fully fluorinated, C1-C3alkyl, cyclopropyl, cyano,
or C1-C3alkoxy; each R8 is independently and individually selected
from the group consisting of C1-C6alkyl, branched C3-C7alkyl,
fluoroalkyl wherein the alkyl moiety is partially or fully
fluorinated, carbocyclyl, phenyl, C1-C6phenylalkyl, heteroaryl or
heteroarylC1-C6alkyl, heterocyclyl, heterocyclylC1-C6alkyl, OH,
C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2, or R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; each R10 is independently and individually
selected from the group consisting of CO.sub.2H,
CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1;
and tautomers, diastereomers, geometric isomers, enantiomers,
hydrates, prodrugs and salts of any of the foregoing.
261. The compounds of claim 260 wherein D is a moiety of the
formula ##STR1248## wherein E1 is selected from the group
consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl;
wherein the symbol (***) is the point of attachment to the Y group
of formula I; X1 is selected from the group consisting of O, S,
NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I; and
E2 is selected from the group comprising cyclopentyl, cyclohexyl,
phenyl, naphthyl, pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, triazolyl, tetrazolyl, pyridinyl, pyrimidinyl,
pyrazinyl, pyridazinyl, triazinyl, fused bicyclic rings selected
from the group comprising indolyl, isoindolyl, isoindolinyl,
isoindolonyl, indazolyl, benzofuranyl, benzothienyl,
benzothiazolyl, benzothiazolonyl, benzoxazolyl, benzoxazolonyl,
benzisoxazolyl, benzisothiazolyl, benzimidazolyl, benzimidazolonyl,
benztriazolyl, imidazopyridinyl, imidazopyrimidinyl,
imidazolonopyrimidinyl, dihydropurinonyl, pyrrolopyrimidinyl,
purinyl, pyrazolopyridinyl, pyrazolopyrimidinyl,
isoxazolopyrimidinyl, isothiazolopyrimidinyl, furylopyrimidinyl,
thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl,
non-fused bicyclic rings comprising pyridylpyridiminyl,
pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl,
imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl; and n is 0-4; p
is 1-4; q is 2-6.
262. The compounds of claim 260 wherein D is a moiety of the
formula ##STR1249## X2 is selected from the group consisting of
C1-C6 alkyl, C3-C6 branched alkyl, or a direct bond wherein E2 is
directly linked to the Y group of formula I.
263. The compounds of claim 262 wherein the E2 ring is selected
from the group comprising cyclopentyl, cyclohexyl, phenyl,
naphthyl, pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, triazolyl, tetrazolyl, pyridinyl, pyrimidinyl,
pyrazinyl, pyridazinyl, triazinyl, fused bicyclic rings comprising
indolyl, isoindolyl, isoindolinyl, isoindolonyl, indazolyl,
benzofuranyl, benzothienyl, benzothiazolyl, benzothiazolonyl,
benzoxazolyl, benzoxazolonyl, benzisoxazolyl, benzisothiazolyl,
benzimidazolyl, benzimidazolonyl, benztriazolyl, imidazopyridinyl,
imidazopyrimidinyl, dihydropurinonyl, pyrrolopyrimidinyl, purinyl,
pyrazolopyridinyl, pyrazolopyrimidinyl, phthalimidyl,
phthalimidinyl, pyrazinylpyridinyl, pyridinopyrimidinyl,
pyrimidinopyrimidinyl, cinnolinyl, quinoxalinyl, quinazolinyl,
quinolinyl, isoquinolinyl, phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl,
non-fused bicyclic rings comprising pyridylpyridiminyl,
pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl,
imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl.
264. The compounds of claim 260 wherein A2 is selected from the
group consisting of ##STR1250## ##STR1251## ##STR1252## ##STR1253##
##STR1254## ##STR1255## and wherein the symbol (**) is the point of
attachment to the A1 ring of formula I; and wherein ----- indicates
either a saturated or an unsaturated bond; wherein each Z3 and Z5
is independently attached to either aryl or heteroaryl ring of the
A2 bicyclic ring; each R9 is independently and individually
selected from the group consisting of H, F, C1-C6alkyl, branched
C4-C7alkyl, carbocyclyl, phenyl, phenyl C1-C6alkyl, heterocyclyl
and heterocyclylC1-C6alkyl; each R13 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, hydroxyC2-C7alkyl,
C1-C6alkoxyC2-C7alkyl, (R4).sub.2N--CO,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.q,
R5-C2-C6alkylN(R4)-(CH.sub.2).sub.q,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.q,
R5-C2-C6alkyl-O--(CH.sub.2).sub.q, --(CH.sub.2).sub.qN(R4)C(O)R8,
aryl, arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl,
heterocyclyl, heterocyclylC1-C6alkyl, aryloxyC2-C6alkyl,
heteroaryloxyC2-C6alkyl, heterocyclyloxyC2-C6alkyl,
arylaminoC2-C6alkyl, heteroarylaminoC2-C6alkyl, and
heterocyclylaminoC2-C6alkyl; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R13 may cyclize to form a C3-C7
heterocyclyl ring; each R14 is independently and respectively
selected from the group consisting of H and C1-C6alkyl; V, V1, and
V2 are each independently and respectively selected from the group
consisting of O and H.sub.2; each Z4 is a substituent attached to a
ring nitrogen and is independently and individually selected from
the group consisting of H, C1-C6alkyl, hydroxyC2-C6alkyl,
C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1256## ##STR1257## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; and
n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v is 1 or 2.
265. The compounds of claim 264, wherein A2 is selected from the
group consisting of ##STR1258## ##STR1259## ##STR1260## ##STR1261##
and wherein the symbol (**) is the point of attachment to the A1
ring for formula I; wherein each Z3 and Z5 is independently
attached to either aryl or heteroaryl ring of the A2 bicyclic
ring.
266. The compounds of claim 265, wherein A2 is selected from the
group consisting of ##STR1262## ##STR1263## and wherein the symbol
(**) is the point of attachment to the A1 ring of formula I;
wherein each Z3 and Z5 is independently attached to either aryl or
heteroaryl ring of the A2 bicyclic ring.
267. The compounds of claim 261 wherein said A2 group is defined as
set forth in claim 264.
268. The compounds of claim 267 wherein said A2 group is defined as
set forth in claim 265.
269. The compounds of claim 267 wherein said A2 group is defined as
set forth in claim 266.
270. The compounds of claim 262 wherein said A2 group is defined as
set forth in claim 264.
271. The compounds of claim 270 wherein said A2 group is defined as
set forth in claim 265.
272. The compounds of claim 270 wherein said A2 group is defined as
set forth in claim 266.
273. The compounds of claims 260, 264, 267 or 270, wherein A1 is
selected from the group consisting of ##STR1264## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I.
274. The compounds of claims 260, 264, 267 or 270, wherein A1 is
selected from the group consisting of ##STR1265## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
275. The compounds of claims 260, 264, 267 or 270, wherein A1 is
selected from the group consisting of ##STR1266## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
276. The compounds of claims 260, 264, 267 or 270, wherein: (1) W
and Y are each NH, and X.dbd.O; (2) W.dbd.NH, Y.dbd.CHR4 and
X.dbd.O; or (3) W.dbd.CHR4, Y.dbd.NH, and X.dbd.O.
277. The compounds of claims 260, 264, 267 or 270, wherein W and Y
are each NH and X.dbd.O.
278. Compounds of the formula ##STR1267## wherein A2 is selected
from the group consisting of ##STR1268## ##STR1269## wherein each
Z3 and Z5 is independently attached to either aryl or heteroaryl
ring of the A2 bicyclic ring; wherein the symbol (**) denotes the
attachment to the A1 moiety of formula I; A1 is selected from the
group consisting of ##STR1270## wherein the symbol (*) denotes the
attachment to the W moiety of formula I and the symbol (**) denotes
the attachment to the A2 moiety of formula I; X is O, S, or NR3; D
comprises a member of 2,3-dichlorophenyl, 2,4-dichlorophenyl,
3,4-dichlorophenyl, 3,5-dichlorophenyl, 3-chlorophenyl,
4-chlorophenyl, 3-bromophenyl, 4-bromophenyl,
3-trifluoromethylphenyl, 3-trifluoromethyl-4-chlorophenyl,
2,3,4-trifluorophenyl, 2,3,4-trifluorophenyl,
2,4,5-trifluorophenyl, 2,3,5-trifluorophenyl,
3,4,5-trifluorophenyl, 2,3-difluorophenyl, 2,4-difluorophenyl,
2,5-difluorophenyl, 3,4-difluorophenyl, 2-fluorophenyl,
3-fluorophenyl, 4-fluorophenyl, 3-cyanophenyl, 3-phenoxyphenyl, 4
phenoxyphenyl, 1-naphthyl-2,3-dihydro-1H-inden-1-yl,
1,2,3,4-tetrahydronaphthalen 1-yl, benzo[d][1,3]dioxol-5-yl or
benzo[d][1,3]dioxol-4-yl, ##STR1271## ##STR1272## ##STR1273##
##STR1274## ##STR1275## wherein E1 is selected from the group
consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl;
wherein the symbol (***) denotes the attachment to the Y moiety of
formula I; X1 is selected from the group consisting of O, S, NR3,
--C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I;
each R2 is selected from the group consisting of monocyclic
heteroaryl, C1-C6alkyl, branched C3-C7alkyl, a R19-substituted
C3-C8carbocyclyl wherein R19 is H, or C1-C6alkyl, C1-C6fluoroalkyl
wherein the alkyl group is partially or fully fluorinated, and
phenyl wherein the phenyl group is optionally substituted by one or
more fluorine substituents or chlorine; each R2' is selected from
the group consisting of halogen and R2; each R3 is independently
and individually selected from the group consisting of H,
C1-C6alkyl, branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl;
wherein two R3 moieties independently and individually taken from
the group consisting of C1-C6alkyl and branched C3-C7alkyl are
attached to the same nitrogen heteroatom, the two R3 moieties may
cyclize to form a C3-C7 heterocyclyl ring; each R4 is selected from
the group consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom may
cyclize to form a C3-C7 heterocyclyl ring; each R5 is independently
and individually selected from the group consisting of ##STR1276##
and wherein the symbol (##) is the point of attachment to
respective R8, R10, R13, Z2, Z3, Z4, Z5, or A2 ring moieties
containing a R5 moiety; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R5 may cyclize to form a C3-C7
heterocyclyl ring; wherein each R6 is independently and
individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, phenyl, heteroaryl, and
heterocyclyl; each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or C1-C3alkoxy;
each R8 is independently and individually selected from the group
consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, branchedC4-C7alkyl,
carbocyclyl, phenyl, C1-C6phenylalkyl, heteroaryl or
heteroarylC1-C6alkyl, heterocyclyl, heterocyclylC1-C6alkyl, OH,
C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2, or R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; each R10 is independently and individually
selected from the group consisting of CO.sub.2H,
CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; each R13 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, carbocyclyl, hydroxyC2-C7alkyl, C1-C6alkoxyC2-C7alkyl,
(R4).sub.2N--CO, (R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.q,
R5-C2-C6alkylN(R4)-(CH.sub.2).sub.q,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.q,
R5-C2-C6alkyl-O--(CH2).sub.q, --(CH.sub.2).sub.qN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC2-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, and heterocyclylaminoC2-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R13
may cyclize to form a C3-C7 heterocyclyl ring; each R14 is
independently and respectively selected from the group consisting
of H and C1-C6alkyl; wherein Z1' is independently and individually
selected from the group consisting of H, C1-C6alkyl,
C3-C7cycloalkyl, hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8 aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, hydroxyl, hydroxyC1-C6alkyl, cyano, C1-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, halogen, CF.sub.3, (R3).sub.2N--,
(R4).sub.2N--, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, R8CO--,
(R4).sub.2N--CO--C1-C6alkyl, carboxyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R3).sub.2NSO.sub.2, --SO.sub.2R3, SOR3, (R4).sub.2NSO.sub.2,
--SO.sub.2R4, --SOR4, --(CH.sub.2).sub.nN(R4)C(O)R8,
--C.dbd.(NOH)R6, --C.dbd.(NOR3)R6, heteroaryl, heterocyclyl,
heteroarylC1-C6alkyl, heterocyclylC1-C6alkyl, heteroaryloxy,
heterocyclyloxy, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylamino, heteroarylamino,
heterocyclylamino, arylaminoC1-C6alkyl, heteroarylaminoC1-C6alkyl,
heterocyclylaminoC1-C6alkyl, or moieties of the formulae
##STR1277## ##STR1278## wherein the symbol (#) indicates the point
of attachment of the Z3 moiety to the A2 ring of formula I; in the
event that Z3 contains an alkyl or alkylene moiety, such moieties
may be further substituted with one or more C1-C6alkyls; wherein
two R3 moieties are independently and individually taken from the
group consisting of C1-C6alkyl and branched C3-C6alkyl and are
attached to the same nitrogen heteroatom of Z3 may cyclize to form
a C3-C7 heterocyclyl ring; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z3 may cyclize to form a C3-C7
heterocyclyl ring; each Z4 is independently and individually
selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1279## ##STR1280## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2; V, V1, and V2 are each independently and respectively
selected from the group consisting of O and H.sub.2; and tautomers,
diastereomers, geometric isomers, enantiomers, hydrates, prodrugs,
and salts of any of the foregoing.
279. Most preferred compounds from claim 278 are
1-(3-t-butyl-1-(3-hydroxy-2,3-dihydro-1H-inden-5-yl)-1H-pyrazol-5-yl)-3-(-
2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-oxo-2,3-dihydro-1H-inden-5-yl)-1H-pyrazol-5-yl)-3-(2,3--
dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(hydroxyimino)-2,3-dihydro-1H-inden-5-yl)-1H-pyrazol-5--
yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(indolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea-
,
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)ure-
a,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
2-(3-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)naphthal-
en-1-yl)acetic acid,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
1-(3-t-butyl-1-(2-(methylsulfonyl)-1,2,3,4-tetrahydroisoquinolin-7-yl)-1H-
-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(2-(methylsulfonyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-
-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(1-(methylcarbamoyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1-
H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-2,3,4,5-tetrahydro-1H-benzo[d]azepin-7-yl)-1H-pyraz-
ol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(methylsulfonyl)-2,3,4,5-tetrahydro-1H-benzo[d]azepin-7-
-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(1-(3-carbamoyl-2,3-dihydro-1H-inden-5-yl)-3-cyclopentyl-1H-pyrazol-5-y-
l)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(indolin-6-yl)-1H-pyrazol-5-yl)-3-(naphthalen-1-yl)urea,
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(naphthalen-1-yl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazo-
l-5-yl)-3-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl-
)urea,
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(3-(8-methyl-7-oxo-
-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
280. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 260.
281. The method of claim 280, said kinase species being activated
or unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
282. The method of claim 280, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
283. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 278.
284. The method of claim 283, said species being activated or
unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
285. The method of claim 283, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
286. A pharmaceutical composition comprising a compound of claim
260 together with a pharmaceutically acceptable carrier
287. The composition of claim 286 including an additive selected
from the group including adjuvants, excipients, diluents, and
stablilizers.
288. A pharmaceutical composition comprising a compound of claim
278 together with a pharmaceutically acceptable carrier
289. The composition of claim 288 including an additive selected
from the group including adjuvants, excipients, diluents, and
stabilizers.
290. A method of treating an individual suffering from a condition
selected from the group consisting of inflammation, osteoarthritis,
respiratory diseases, stroke, systemic shock, immunological
diseases, and cardiovascular disease comprising the step of
administering to such individual a compound of claim 260.
291. The method of claim 290, said method including the step of
administering said molecule to an individual undergoing treatment
for a condition selected from the group consisting of human
inflammation, rheumatoid arthritis, rheumatoid spondylitis,
ostero-arthritis, asthma, gouty arthritis, sepsis, septic shock,
endotoxic shock, Gram-negative sepsis, toxic shock syndrome, adult
respiratory distress syndrome, stroke, reperfusion injury, neural
trauma, neural ischemia, psoriasis, restenosis, chronic pulmonary
inflammatory disease, bone resorptive diseases, graft-versus-host
reaction, Chron's disease, ulcerative colitis, inflammatory bowel
disease, pyresis, and combinations thereof.
292. The method of claim 290, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
293. A method of treating an individual suffering from a condition
selected from the group consisting of inflammation, osteoarthritis,
respiratory diseases, stroke, systemic shock, immunological
diseases, and cardiovascular disease comprising the step of
administering to such individual a compound of claim 278.
294. The method of claim 293, said method including the step of
administering said molecule to an individual undergoing treatment
for a condition selected from the group consisting of human
inflammation, rheumatoid arthritis, rheumatoid spondylitis,
ostero-arthritis, asthma, gouty arthritis, sepsis, septic shock,
endotoxic shock, Gram-negative sepsis, toxic shock syndrome, adult
respiratory distress syndrome, stroke, reperfusion injury, neural
trauma, neural ischemia, psoriasis, restenosis, chronic pulmonary
inflammatory disease, bone resorptive diseases, graft-versus-host
reaction, Chron's disease, ulcerative colitis, inflammatory bowel
disease, pyresis, and combinations thereof.
295. The method of claim 293, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
296. An adduct comprising a compound of claim 260 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
297. An adduct comprising a compound of claim 278 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
298. Compounds of the formula ##STR1281## wherein A2 is selected
from the group consisting of a Z1-substituted phenyl,
Z1-substituted pyridyl, Z1-substituted pyrimidinyl, Z1-substituted
thienyl, Z1 or Z4'-substituted monocyclic heterocyclyl rings, and
other monocyclic heteroaryls, excluding tetrazolyl,
1,2,4-oxadiazolonyl, 1,2,4-triazolonyl, and alkyl-substituted
pyrrolyl wherein the pyrrolyl nitrogen is the site of attachment to
the A1 ring; A1 is selected from the group consisting of R2' and
R7-substituted phenyl, pyridyl, or pyrimidinyl, R2-substituted
monocyclic 5-membered ring heteroaryl, and R2'-substituted
monocyclic heterocyclyl moieties; W and Y are CHR4, NR3, or O and
wherein W and Y are not simultaneously O; X is O, S, or NR3; each
Z1 is a substituent attached to a ring carbon and is independently
and individually selected from the group consisting of
hydroxyC1-C6alkyl, C2-C6alkoxy, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1282## ##STR1283## cyano wherein
the site of attachment to the A2 ring is meta to the point of
attachment to the A1 ring and wherein A2 is phenyl, and cyano
wherein the site of attachment is to a substitutable position when
A2 is pyridyl, pyrimidinyl or a five-membered ring; wherein the
asterisk (*) indicates the point of attachment of the Z1 moiety to
the A2 ring; in the event that Z1 contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z1 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z1 may cyclize to form a C3-C7 heterocyclyl ring;
wherein Z1' is independently and individually selected from the
group consisting of H, C1-C6alkyl, C3-C7cycloalkyl,
hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, (R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4' is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1284## ##STR1285## wherein the symbol
(#) indicates the point of attachment of the Z4' moiety to the A1
ring of formula I; in the event that Z4' contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4' may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4' may cyclize to form a C3-C7 heterocyclyl ring;
each R2 is selected from the group consisting of monocyclic
heteroaryl, C1-C6alkyl, branched C3-C7alkyl, a R19-substituted
C3-C8carbocyclyl wherein R19 is H or C1-C6alkyl, C1-C6fluoroalkyl
wherein the alkyl group is partially or fully fluorinated, and
phenyl wherein the phenyl group is optionally substituted by one or
more fluorine substituents or chlorine; each R2' is selected from
the group consisting of halogen and R2; each R3 is independently
and individually selected from the group consisting of H,
C1-C6alkyl, branched C3-C7alkyl, C3-C7cycloalkyl, or phenyl; each
R3' is independently and individually selected from the group
consisting of C2-C6alkyl, branched C3-C7alkyl, C3-C7cycloalkyl,
aryl, arylalkyl, heteroaryl, and heteroarylalkyl; each R4 is
selected from the group consisting of H, C1-C6alkyl, hydroxyC1-C6
alkyl, dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched
C3-C7alkyl, branched hydroxyC1-C6 alkyl, branched
C1-C6alkoxyC1-C6alkyl, branched dihydroxyC1-C6alkyl, carbocyclyl,
hydroxyl substituted carbocyclyl, alkoxy substituted carbocyclyl,
dihydroxy substituted carbocyclyl, phenyl, heteroaryl,
heterocyclyl, phenylC1-C6alkyl, heteroarylC1-C6alkyl, and
heterocyclylC1-C6alkyl; each R5 is independently and individually
selected from the group consisting of ##STR1286## and wherein the
symbol (##) is the point of attachment to respective R8, R10, Z1,
Z4', Z5, Z6 or A2 ring moieties containing a R5 moiety; wherein two
R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R5
may cyclize to form a C3-C7 heterocyclyl ring; wherein each R6 is
independently and individually selected from the group consisting
of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl, phenyl,
heteroaryl, and heterocyclyl; each R7 is selected from the group
consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl moiety
is partially or fully fluorinated, C1-C3alkyl, cyclopropyl, cyano,
or C1-C3alkoxy; each R8 is independently and individually selected
from the group consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein
the alkyl moiety is partially or fully fluorinated,
branchedC4-C7alkyl, carbocyclyl, phenyl, C1-C6phenylalkyl,
heteroaryl or heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2,
or R5; wherein two R3 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; D comprises a moiety taken from group consisting
of the formula ##STR1287## wherein the symbol (***) is the point of
attachment to the Y group of formula I; wherein E2 is taken from
the group consisting of poly-aryl, poly-heteroaryl, mono- and poly
heterocyclyl, and carbocyclyl; wherein E1 is taken from the group
consisting of mono- and poly-aryl, mono- and poly-heteroaryl, mono-
and poly heterocyclyl and carbocyclyl; X1 is selected from the
group consisting of O, S, NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-,
--S--(CH.sub.2)n-, --NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--,
--O--(CH.sub.2)q-NR3-, --N(R3)-(CH.sub.2)q-N(R3)-,
--(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein either E1 or E2 is directly linked to the Y group of
formula I; and n is 0-4; p is 1-4; q is 2-6, r is 0 or 1; and
tautomers, diastereomers, geometric isomers, enantiomers, hydrates,
prodrugs, and salts of any of the foregoing.
299. The compounds of claim 298 wherein E1 is selected from the
group consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl;
wherein E2 comprises the group consisting of cyclopentyl,
cyclohexyl, non-fused bicyclic rings comprising pyridylpyridiminyl,
pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl,
imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl.
300. The compounds of claim 298 wherein D comprises a moiety of the
formula ##STR1288## X2 is selected from the group consisting of
C1-C6 alkyl, C3-C6 branched alkyl, or a direct bond wherein E2 is
directly linked to the Y group of formula I.
301. The compounds of claim 300 wherein the E2 ring is cyclopentyl,
cyclohexyl, non-fused bicyclic rings comprising pyridylpyridiminyl,
pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl,
imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl.
302. The compounds of claim 298 wherein A2 is selected from the
group consisting of ##STR1289## ##STR1290## each Z4 is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1291## ##STR1292## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2.
303. The compounds of claim 302, wherein A2 is selected from the
group consisting of ##STR1293## and wherein the symbol (**) is the
point of attachment to the A1 ring for formula I.
304. The compounds of claim 303, wherein A2 is selected from the
group consisting of ##STR1294## and wherein the symbol (**) is the
point of attachment to the A1 ring of formula I.
305. The compounds of claim 299 wherein said A2 group is defined as
set forth in claim 302.
306. The compounds of claim 305 wherein said A2 group is defined as
set forth in claim 303.
307. The compounds of claim 305 wherein said A2 group is defined as
set forth in claim 304.
308. The compounds of claim 300 wherein said A2 group is defined as
set forth in claim 302.
309. The compounds of claim 308 wherein said A2 group is defined as
set forth in claim 303.
310. The compounds of claim 308 wherein said A2 group is defined as
set forth in claim 304.
311. The compounds of claims 298, 302, 305, 308, wherein A1 is
selected from the group consisting of ##STR1295## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I.
312. The compounds of claims 298, 302, 305, 308, wherein A1 is
selected from the group consisting of ##STR1296## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
313. The compounds of claims 298, 302, 305, 308, wherein A1 is
selected from the group consisting of ##STR1297## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
314. The compounds of claims 298, 302, 305, 308, wherein: (1) W and
Y are each NH, and X.dbd.O; (2) W.dbd.NH, Y.dbd.CHR4 and X.dbd.O;
or (3) W.dbd.CHR4, Y.dbd.NH, and X.dbd.O.
315. The compounds of claims 298, 302, 305, 308, wherein W and Y
are each NH and X.dbd.O.
316. Compounds of the formula ##STR1298## wherein A2 is selected
from the group consisting of ##STR1299## wherein the symbol (**)
denotes the attachment to the A1 moiety of formula I; A1 is
selected from the group consisting of ##STR1300## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I; X is O, S, or NR3; D comprises a member of ##STR1301##
##STR1302## wherein E1 is selected from the group consisting
cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, pyrrolidinyl
piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl; wherein the
symbol (***) denotes the attachment to the Y moiety of formula I;
X1 is selected from the group consisting of O, S, NR3,
--C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I;
each R2 is selected from the group consisting of monocyclic
heteroaryl, C1-C6alkyl, branched C3-C7alkyl, a R19-substituted
C3-C8carbocyclyl wherein R19 is H or C1-C6alkyl, C1-C6fluoroalkyl
wherein the alkyl group is partially or fully fluorinated, and
phenyl wherein the phenyl group is optionally substituted by one or
more fluorine substituents or chlorine; each R2' is selected from
the group consisting of halogen and R2; each R3 is independently
and individually selected from the group consisting of H,
C1-C6alkyl, branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl;
wherein two R3 moieties independently and individually taken from
the group consisting of C1-C6alkyl and branched C3-C7alkyl are
attached to the same nitrogen heteroatom, the two R3 moieties may
cyclize to form a C3-C7 heterocyclyl ring; each R4 is selected from
the group consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom may
cyclize to form a C3-C7 heterocyclyl ring; each R5 is independently
and individually selected from the group consisting of ##STR1303##
and wherein the symbol (##) is the point of attachment to
respective R8, R10, Z1, Z4, Z5, Z6 or A2 ring moieties containing a
R5 moiety; wherein two R4 moieties independently and individually
taken from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of R5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein each R6 is independently and individually selected from the
group consisting of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl,
phenyl, heteroaryl, and heterocyclyl; each R7 is selected from the
group consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, C1-C3alkyl, cyclopropyl,
cyano, or C1-C3alkoxy; each R8 is independently and individually
selected from the group consisting of C1-C6alkyl, C1-C6 fluoroalkyl
wherein the alkyl moiety is partially or fully fluorinated,
branchedC4-C7alkyl, carbocyclyl, phenyl, C1-C6phenylalkyl,
heteroaryl or heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2,
or R5; wherein two R3 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; each Z1 is a substituent attached to a ring
carbon and is independently and individually selected from the
group consisting of hydroxyC1-C6alkyl, C2-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1304## ##STR1305## cyano wherein
the site of attachment to the A2 ring is meta to the point of
attachment to the A1 ring and wherein A2 is phenyl, and cyano
wherein the site of attachment is to a substitutable position when
A2 is pyridyl, pyrimidinyl or a five-membered ring; In the
foregoing definition of Z1, alkyl moieties may optionally be
substituted by one or more C1-C6alkyl; Wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z1 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
In the foregoing definition of Z1, alkyl moieties may optionally be
substituted by one or more C1-C6alkyl; Wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z1 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; wherein Z1' is independently and
individually selected from the group consisting of H, C1-C6alkyl,
C3-C7cycloalkyl, hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8 aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4 is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1306## ##STR1307## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2; and tautomers, diastereomers, geometric isomers,
enantiomers, hydrates, prodrugs and salts of any of the
foregoing.
317. Most preferred compounds from claim 316:
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-methy-
l-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea,
1-(3-t-butyl-1-(3-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)phenyl)-1H-pyr-
azol-5-yl)-3-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea
318. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 298.
319. The method of claim 318, said kinase species being activated
or unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
320. The method of claim 318, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
321. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 316.
322. The method of claim 321, said species being activated or
unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
323. The method of claim 321, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
324. A pharmaceutical composition comprising a compound of claim
298 together with a pharmaceutically acceptable carrier
325. The composition of claim 324 including an additive selected
from the group including adjuvants, excipients, diluents, and
stablilizers.
326. A pharmaceutical composition comprising a compound of claim
316 together with a pharmaceutically acceptable carrier
327. The composition of claim 326 including an additive selected
from the group including adjuvants, excipients, diluents, and
stabilizers.
328. A method of treating an individual suffering from a condition
selected from the group consisting of inflammation, osteoarthritis,
respiratory diseases, stroke, systemic shock, immunological
diseases, and cardiovascular disease comprising the step of
administering to such individual a compound of claim 298.
329. The method of claim 328, said method including the step of
administering said molecule to an individual undergoing treatment
for a condition selected from the group consisting of human
inflammation, rheumatoid arthritis, rheumatoid spondylitis,
ostero-arthritis, asthma, gouty arthritis, sepsis, septic shock,
endotoxic shock, Gram-negative sepsis, toxic shock syndrome, adult
respiratory distress syndrome, stroke, reperfusion injury, neural
trauma, neural ischemia, psoriasis, restenosis, chronic pulmonary
inflammatory disease, bone resorptive diseases, graft-versus-host
reaction, Chron's disease, ulcerative colitis, inflammatory bowel
disease, pyresis, and combinations thereof.
330. The method of claim 328, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
331. A method of treating an individual suffering from a condition
selected from the group consisting of inflammation, osteoarthritis,
respiratory diseases, stroke, systemic shock, immunological
diseases, and cardiovascular disease comprising the step of
administering to such individual a compound of claim 316.
332. The method of claim 331, said method including the step of
administering said molecule to an individual undergoing treatment
for a condition selected from the group consisting of human
inflammation, rheumatoid arthritis, rheumatoid spondylitis,
ostero-arthritis, asthma, gouty arthritis, sepsis, septic shock,
endotoxic shock, Gram-negative sepsis, toxic shock syndrome, adult
respiratory distress syndrome, stroke, reperfusion injury, neural
trauma, neural ischemia, psoriasis, restenosis, chronic pulmonary
inflammatory disease, bone resorptive diseases, graft-versus-host
reaction, Chron's disease, ulcerative colitis, inflammatory bowel
disease, pyresis, and combinations thereof.
333. The method of claim 331, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
334. An adduct comprising a compound of claim 298 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
335. An adduct comprising a compound of claim 316 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
336. Compounds of the formula ##STR1308## wherein A2 is selected
from the group consisting of a Z7-substituted phenyl,
Z7-substituted pyridyl, Z7-substituted pyrimidinyl, Z1-substituted
thienyl, Z1 or Z4'-substituted monocyclic heterocyclyl rings and
other monocyclic heteroaryls, excluding tetrazolyl,
1,2,4-oxadiazolonyl, 1,2,4-triazolonyl, and alkyl-substituted
pyrrolyl wherein the pyrrolyl nitrogen is the site of attachment to
the A1 ring; A1 is selected from the group consisting of R2' and
R7-substituted phenyl, pyridyl, or pyrimidinyl, R2-substituted
monocyclic 5-membered ring heteroaryl, and R2'-substituted
monocyclic heterocyclyl moieties; W and Y are CHR4, NR3, or O and
wherein W and Y are not simultaneously O; X is O, S, or NR3; each
R2 is selected from the group consisting of alkyl, branched alkyl,
fluoroalkyl, wherein the alkyl group is partially or fully
fluorinated, and R19 substituted C3-C8carbocyclyl wherein R19 is H
and C1-C6alkyl; each R2' is selected from the group consisting of
halogen and R2; each R3 is independently and individually selected
from the group consisting of H, C1-C6alkyl, branched C3-C7alkyl,
C3-C7cycloalkyl, or phenyl; each R3' is independently and
individually selected from the group consisting of C2-C6alkyl,
branched C3-C7alkyl, C3-C7cycloalkyl, aryl, arylalkyl, heteroaryl,
and heteroarylalkyl; each R4 is selected from the group consisting
of H, C1-C6alkyl, hydroxyC1-C6 alkyl, dihydroxyC1-C6alkyl,
C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl, branched hydroxyC1-C6
alkyl, branched C1-C6alkoxyC1-C6alkyl, branched
dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted carbocyclyl,
alkoxy substituted carbocyclyl, dihydroxy substituted carbocyclyl,
phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; each R5 is
independently and individually selected from the group consisting
of ##STR1309## and wherein the symbol (##) is the point of
attachment to respective R8, R10, Z1, Z4', Z5, Z6 and Z7 moieties
containing a R5 moiety; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R5 may cyclize to form a C3-C7
heterocyclyl ring; wherein each R6 is independently and
individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, phenyl, heteroaryl, and
heterocyclyl; each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or C1-C3alkoxy;
each R8 is independently and individually selected from the group
consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, branchedC4-C7alkyl,
carbocyclyl, phenyl, C1-C6phenylalkyl, heteroaryl or
heteroarylC1-C6alkyl, heterocyclyl, heterocyclylC1-C6alkyl, OH,
C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2, or R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; each R10 is independently and individually
selected from the group consisting of CO.sub.2H,
CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; D comprises a moiety taken from group consisting
of ##STR1310## wherein the symbol (***) is the point of attachment
to the Y group of formula I; wherein E1A is taken from the groups
consisting of carbocyclyl, mono- and poly-heterocyclyl and mono-
and poly-heteroaryl; wherein E1B is taken from the groups
consisting of phenyl and naphthyl; wherein E2A is taken from the
group consisting of naphthyl, a 5-membered ring heteroaryl, or a
fused bicyclic heteroaryl; wherein E2B is taken from the group
consisting of phenyl, pyridyl, and pyrimidyl; X1 is selected from
the group consisting of O, S, NR3, --C(.dbd.O)--,
--O--(CH.sub.2)n-, --S--(CH.sub.2)n-, --NR3-(CH.sub.2)n-,
--O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1A or
E1B ring and the E2A or E2B ring are directly linked by a covalent
bond; and wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1A or E1B or E2A or E2B are directly linked to the Y
group of formula I; X3 is selected from the group consisting of
NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)q-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the either
the E1B ring or E2B ring are directly linked by a covalent bond;
and wherein the carbon atoms of --(CH2)q-, C2-C5alkenyl, and
C2-C5alkynyl moieties of X3 may be further substituted by one or
more C1-C6alkyl; X4 is selected from the group consisting of C1-C6
alkyl, C3-C6 branched alkyl; each Z1 is a substituent attached to a
ring carbon and is independently and individually selected from the
group consisting of hydroxyC1-C6alkyl, C2-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1311## and cyano wherein the site
of attachment to the A2 ring is meta to the point of attachment to
the A1 ring and wherein A2 is phenyl, cyano wherein the site of
attachment is to a substitutable position when A2 is pyridyl,
pyrimidinyl or a five-membered ring; Wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z1 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; each Z4' is a substituent attached
to a ring nitrogen and is independently and individually selected
from the group consisting of hydroxyC2-C6alkyl,
C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1312## wherein the symbol (#)
indicates the point of attachment of the Z4' moiety to the A1 ring
of formula I; in the event that Z4' contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; each Z7 is a substituent attached to a ring carbon and
is independently and individually selected from the group
consisting of hydroxyC2-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R6).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--CO,
(R4).sub.2N--CO, --SO.sub.2R3', SOR3, --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6,
(CH.sub.2).sub.nN(R4)C(O)N(R4).sub.2, (CH.sub.2).sub.nN(R4)C(O)R5,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1313## cyano wherein the site of
attachment to the A2 ring is meta to the point of attachment to the
A1 ring and wherein A2 is phenyl, and cyano wherein the site of
attachment is to a substitutable position when A2 is pyridyl,
pyrimidinyl or a five-membered ring; In the foregoing definition of
Z7, alkyl moieties may optionally be substituted by one or more
C1-C6alkyl; Wherein the asterisk (*) indicates the point of
attachment of the Z1 moiety to the A2 ring; in the event that Z7
contains an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; wherein two R3 moieties
are independently and individually taken from the group consisting
of C1-C6alkyl and branched C3-C6alkyl and are attached to the same
nitrogen heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl
ring; wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl ring; and
n is 0-4; p is 1-4; q is 2-6, r is 0 or 1; and tautomers,
diastereomers, geometric isomers, enantiomers, hydrates, prodrugs,
and salts of any of the foregoing.
337. The compounds of claim 336 wherein E1A is selected from the
group comprising cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
furyl, imidazolyl, pyridyl, and pyrimidinyl; E2A is selected from
the group comprising naphthyl, pyrrolyl, furyl, thienyl, oxazolyl,
thiazolyl, isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl,
oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl, pyrazinyl,
pyridazinyl, triazinyl and fused bicyclic rings selected from the
group comprising indolyl, isoindolyl, isoindolinyl, isoindolonyl,
indazolyl, benzofuranyl, benzothienyl, benzothiazolyl,
benzothiazolonyl, benzoxazolyl, benzoxazolonyl, benzisoxazolyl,
benzisothiazolyl, benzimidazolyl, benzimidazolonyl, benztriazolyl,
imidazopyridinyl, imidazopyrimidinyl, imidazolonopyrimidinyl,
dihydropurinonyl, pyrrolopyrimidinyl, purinyl, pyrazolopyridinyl,
pyrazolopyrimidinyl, isoxazolopyrimidinyl, isothiazolopyrimidinyl,
furylopyrimidinyl, thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl.
338. The compounds of claim 336 wherein D comprises a moiety taken
from the group consisting of carbocyclyl and a moiety of the
formula ##STR1314## X2 is selected from the group consisting of
C1-C6 alkyl, C3-C6 branched alkyl, or a direct bond wherein E2A or
E2B is directly linked to the Y group of formula I.
339. The compounds of claim 338 wherein the E2A ring is selected
from the group comprising naphthyl, pyrrolyl, furyl, thienyl,
oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl,
pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl,
pyrazinyl, pyridazinyl, triazinyl and fused bicyclic rings selected
from the group comprising indolyl, isoindolyl, isoindolinyl,
isoindolonyl, indazolyl, benzofuranyl, benzothienyl,
benzothiazolyl, benzothiazolonyl, benzoxazolyl, benzoxazolonyl,
benzisoxazolyl, benzisothiazolyl, benzimidazolyl, benzimidazolonyl,
benztriazolyl, imidazopyridinyl, imidazopyrimidinyl,
imidazolonopyrimidinyl, dihydropurinonyl, pyrrolopyrimidinyl,
purinyl, pyrazolopyridinyl, pyrazolopyrimidinyl,
isoxazolopyrimidinyl, isothiazolopyrimidinyl, furylopyrimidinyl,
thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl;
wherein E2B is selected from the group consisting of phenyl,
pyridyl and pyrimidyl.
340. The compounds of claim 336 wherein A2 is selected from the
group consisting of ##STR1315## ##STR1316## Z5 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, halogen, fluoroalkyl, cyano, hydroxyl, alkoxy,
oxo, aminocarbonyl, carbonylamino, aminosulfonyl, sulfonylamino,
--N(R3).sub.2, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --R5, --O--(CH.sub.2)q-O-Alkyl,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-O-Alkyl,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --O--(CH.sub.2)q-R5, and
--N(R3)-(CH.sub.2)q-R5; wherein two R3 moieties are independently
and individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring; and
n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v is 1 or 2.
341. The compounds of claim 340, wherein A2 is selected from the
group consisting of ##STR1317## wherein the symbol (**) is the
point of attachment to the A1 ring for formula I.
342. The compounds of claim 341, wherein A2 is selected from the
group consisting of ##STR1318## and wherein the symbol (**) is the
point of attachment to the A1 ring of formula I.
343. The compounds of claim 337 wherein said A2 group is defined as
set forth in claim 340.
344. The compounds of claim 343 wherein said A2 group is defined as
set forth in claim 341.
345. The compounds of claim 343 wherein said A2 group is defined as
set forth in claim 342.
346. The compounds of claim 338 wherein said A2 group is defined as
set forth in claim 340.
347. The compounds of claim 346 wherein said A2 group is defined as
set forth in claim 341.
348. The compounds of claim 346 wherein said A2 group is defined as
set forth in claim 342.
349. The compounds of claims 336, 340, 343, 346, wherein A1 is
selected from the group consisting of ##STR1319## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I.
350. The compounds of claims 336, 340, 343, 346, wherein A1 is
selected from the group consisting of ##STR1320## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
351. The compounds of claims 336, 340, 343, 346, wherein A1 is
selected from the group consisting of ##STR1321## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
352. The compounds of claims 336, 340, 343, 346, wherein: (1) W and
Y are each NH, and X.dbd.O; (2) W.dbd.NH, Y.dbd.CHR4 and X.dbd.O;
or (3) W.dbd.CHR4, Y.dbd.NH, and X.dbd.O.
353. The compounds of claims 336, 340, 343, 346, wherein W and Y
are each NH and X.dbd.O.
354. Compounds of the formula ##STR1322## wherein A2 is selected
from the group consisting of ##STR1323## wherein the symbol (**)
denotes the attachment to the A1 moiety of formula I; A1 is
selected from the group consisting of ##STR1324## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I; X is O, S, or NR3; D comprises a member of 2,3-dichlorophenyl,
2-fluorophenyl, 3-fluorophenyl, 4-fluorophenyl, 3-cyanophenyl,
2,3-difluorophenyl, 2,4-difluorophenyl, 3,4-difluorophenyl,
2,5-difluorophenyl, 3,5-difluorophenyl, 2,3,5-trifluorophenyl,
2,4,5-trifluorophenyl, 2,3,4-trifluorophenyl,
3,4,5-trifluorophenyl, 4-cyanophenyl, 3-fluoro-5-cyanophenyl,
3-(R8SO.sub.2)-phenyl, 3-(hydroxyC1-C3alkyl)-phenyl,
3-(R3O--N.dbd.C(R6))-phenyl, 3-phenoxyphenyl, 4 phenoxyphenyl,
##STR1325## ##STR1326## ##STR1327## ##STR1328## ##STR1329## wherein
E1A is taken from the groups consisting of cyclopropyl, cyclobutyl,
cyclopentyl, cyclohexyl, pyrrolidinyl piperidinyl, thienyl,
oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl,
oxadiazolyl, thiadiazolyl, furyl, imidazolyl, pyridyl, and
pyrimidinyl; wherein E1B is taken from the groups consisting of
phenyl and naphthyl; wherein E2A is taken from the group comprising
naphthyl, pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, triazolyl, tetrazolyl, pyrazinyl, pyridazinyl,
triazinyl and fused bicyclic rings selected from the group
consisting of indolyl, isoindolyl, isoindolinyl, isoindolonyl,
indazolyl, benzofuranyl, benzothienyl, benzothiazolyl,
benzothiazolonyl, benzoxazolyl, benzoxazolonyl, benzisoxazolyl,
benzisothiazolyl, benzimidazolyl, benzimidazolonyl, benztriazolyl,
imidazopyridinyl, imidazopyrimidinyl, imidazolonopyrimidinyl,
dihydropurinonyl, pyrrolopyrimidinyl, purinyl, pyrazolopyridinyl,
pyrazolopyrimidinyl, isoxazolopyrimidinyl, isothiazolopyrimidinyl,
furylopyrimidinyl, thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl;
wherein E2B is taken from the group consisting of phenyl, pyridyl,
and pyrimidyl; wherein the symbol (***) denotes the attachment to
the Y moiety of formula I; X1 is selected from the group consisting
of O, S, NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I;
each R2 is selected from the group consisting of alkyl, branched
alkyl, fluoroalkyl, wherein the alkyl group is partially or fully
fluorinated, and R19 substituted C3-C8carbocyclyl wherein R19 is H
and C1-C6alkyl; X3 is selected from the group consisting of NR3,
--C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--,
--O--(C1H.sub.2).sub.q--NR3-, --N(R3)-(CH.sub.2)q-N(R3)-,
--(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)q-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the either
the E1B ring or E2B ring are directly linked by a covalent bond;
and wherein the carbon atoms of --(CH2)q-, C2-C5alkenyl, and
C2-C5alkynyl moieties of X3 may be further substituted by one or
more C1-C6alkyl; X4 is selected from the group consisting of C1-C6
alkyl, C3-C6 branched alkyl; each R2' is selected from the group
consisting of halogen and R2; each R3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl; wherein two R3
moieties independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C7alkyl are attached to
the same nitrogen heteroatom, the two R3 moieties may cyclize to
form a C3-C7 heterocyclyl ring; each R4 is selected from the group
consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom may
cyclize to form a C3-C7 heterocyclyl ring; each R5 is independently
and individually selected from the group consisting of ##STR1330##
and wherein the symbol (##) is the point of attachment to
respective R8, R10, Z4, Z5, Z6 or A2 ring moieties containing a R5
moiety; wherein two R4 moieties independently and individually
taken from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of R5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein each R6 is independently and individually selected from the
group consisting of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl,
phenyl, heteroaryl, and heterocyclyl; each R7 is selected from the
group consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, C1-C3alkyl, cyclopropyl,
cyano, or C1-C3alkoxy; each R8 is independently and individually
selected from the group consisting of C1-C6alkyl, C1-C6 fluoroalkyl
wherein the alkyl moiety is partially or fully fluorinated,
branchedC4-C7alkyl, carbocyclyl, phenyl, C1-C6phenylalkyl,
heteroaryl or heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2,
or R5; wherein two R3 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; each Z1 is a substituent attached to a ring
carbon and is independently and individually selected from the
group consisting of hydroxyC1-C6alkyl, C2-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1331## In the foregoing definition
of Z1, alkyl moieties may optionally be substituted by one or more
C1-C6alkyl; Wherein the asterisk (*) indicates the point of
attachment of the Z1 moiety to the A2 ring; in the event that Z1
contains an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; wherein two R3 moieties
are independently and individually taken from the group consisting
of C1-C6alkyl and branched C3-C6alkyl and are attached to the same
nitrogen heteroatom of Z1 may cyclize to form a C3-C7 heterocyclyl
ring; wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z1 may cyclize to form a C3-C7 heterocyclyl ring;
each Z4 is a substituent attached to a ring nitrogen and is
independently and individually selected from the group consisting
of H, C1-C6alkyl, hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl,
(R4).sub.2N--C2-C6alkyl, (R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1332## wherein the symbol (#)
indicates the point of attachment of the Z4 moiety to the A2 ring
for formula I; in the event that Z4 contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; each Z7 is a substituent attached to a ring
carbon and is independently and individually selected from the
group consisting of hydroxyC2-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R6).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--CO,
(R4).sub.2N--CO, --SO.sub.2R3', SOR3, --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6,
(CH.sub.2).sub.nN(R4)C(O)N(R4).sub.2, (CH.sub.2).sub.nN(R4)C(O)R5,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1333## cyano wherein the site of
attachment to the A2 ring is meta to the point of attachment to the
A1 ring and wherein A2 is phenyl, and cyano wherein the site of
attachment is to a substitutable position when A2 is pyridyl,
pyrimidinyl or a five-membered ring; In the foregoing definition of
Z7, alkyl moieties may optionally be substituted by one or more
C1-C6alkyl; Wherein the asterisk (*) indicates the point of
attachment of the Z1 moiety to the A2 ring; in the event that Z7
contains an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; wherein two R3 moieties
are independently and individually taken from the group consisting
of C1-C6alkyl and branched C3-C6alkyl and are attached to the same
nitrogen heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl
ring; wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl ring; and
n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v is 1 or 2; and
tautomers, diastereomers, geometric isomers, enantiomers, hydrates,
prodrugs and salts of any of the foregoing.
355. Most preferred compounds from claim 354 are
1-(3-t-butyl-1-(3-(pyridin-3-yl)phenyl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3--
yloxy)phenyl)urea,
1-(1-(3-(1H-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(1-oxois-
oindolin-4-yl)phenyl)urea
356. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 336.
357. The method of claim 356, said kinase species being activated
or unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
358. The method of claim 356, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
359. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 354.
360. The method of claim 359, said species being activated or
unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
361. The method of claim 359, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
362. A pharmaceutical composition comprising a compound of claim
336 together with a pharmaceutically acceptable carrier.
363. The composition of claim 362 including an additive selected
from the group including adjuvants, excipients, diluents, and
stablilizers.
364. A pharmaceutical composition comprising a compound of claim
354 together with a pharmaceutically acceptable carrier.
365. The composition of claim 364 including an additive selected
from the group including adjuvants, excipients, diluents, and
stablilizers.
366. A method of treating an individual suffering from a condition
selected from the group consisting of cancer and hyperproliferative
diseases, comprising the step of administering to such individual a
compound of claim 336.
367. The method of claim 366, said condition being chronic
myelogenous leukemia, acute lymphocytic leukemia, gastrointestinal
stromal tumors, and hypereosinophillic syndrome.
368. The method of claim 366, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
369. A method of treating an individual suffering from a condition
selected from the group consisting of cancer and hyperproliferative
diseases, comprising the step of administering to such individual a
compound of claim 354.
370. The method of claim 369 said condition being chronic
myelogenous leukemia, acute lymphocytic leukemia, gastrointestinal
stromal tumors, and hypereosinophillic syndrome.
371. The method of claim 369, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
372. An adduct comprising a compound of claim 336 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
373. An adduct comprising a compound of claim 354 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
374. A method of claim 356, further comprising the step of
inducing, synergizing, or promoting the binding of a second
modulator compound of said kinase to form a ternary adduct, such
co-incident binding resulting in enhanced biological modulation of
the kinase when compared to the biological modulation of the
protein affected by either of said compounds alone.
375. A method of claim 374, wherein the second compound interacts
at a substrate, cofactor, or regulatory site on the kinase, said
second site being distinct from the site of interaction of the
first compound.
376. A method of claim 375, wherein the second site is an ATP
cofactor site.
377. A method of claim 374, wherein the kinase is c-Abl kinase,
Bcr-Abl kinase or disease polymorphs thereof.
378. A method of claim 375, wherein the kinase is c-Abl kinase,
Bcr-Abl kinase or disease polymorphs thereof.
379. A method of claim 376, wherein the kinase is c-Abl kinase,
Bcr-Abl kinase or disease polymorphs thereof.
380. A method of claim 379, wherein the second compound is taken
from the group consisting of
N-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)-4-((4-methylpi-
perazin-1-yl)methyl)benzamide (Gleevec);
N-(2-chloro-6-methylphenyl)-2-(6-(4-(2-hydroxyethyl)piperazin-1-yl)-2-met-
hylpyrimidin-4-ylamino)thiazole-5-carboxamide (BMS-354825);
6-(2,6-dichlorophenyl)-2-(3-(hydroxymethyl)phenylamino)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one (PD 166326);
6-(2,6-dichlorophenyl)-8-methyl-2-(3-(methylthio)phenylamino)pyrido[2,3-d-
]pyrimidin-7(8H)-one (PD 173955);
6-(2,6-dichlorophenyl)-2-(4-fluoro-3-methylphenylamino)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one (PD180970);
6-(2,6-dichlorophenyl)-2-(4-ethoxyphenylamino)-8-methylpyrido[2,3-d]pyrim-
idin-7(8H)-one (PD 173958);
6-(2,6-dichlorophenyl)-2-(4-fluorophenylamino)-8-methylpyrido[2,3-d]pyrim-
idin-7(8H)-one (PD 173956);
6-(2,6-dichlorophenyl)-2-(4-(2-(diethylamino)ethoxy)phenylamino)-8-methyl-
pyrido[2,3-d]pyrimidin-7(8H)-one (PD 166285);
2-(4-(2-aminoethoxy)phenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one;
N-(3-(6-(2,6-dichlorophenyl)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrim-
idin-2-ylamino)phenyl)acetamide (SKI DV-MO16);
2-(4-aminophenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 1-10);
6-(2,6-dichlorophenyl)-2-(3-hydroxyphenylamino)-8-methylpyrido[2,3-d]pyri-
midin-7(8H)-one (SKI DV2-89);
2-(3-aminophenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 2-43);
N-(4-(6-(2,6-dichlorophenyl)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrim-
idin-2-ylamino)phenyl)acetamide (SKI DV-M017);
6-(2,6-dichlorophenyl)-2-(4-hydroxyphenylamino)-8-methylpyrido[2,3-d]pyri-
midin-7(8H)-one (SKI DV-M017);
6-(2,6-dichlorophenyl)-2-(3-ethylphenylamino)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 2 87).
381. A method of claim 359, further comprising the step of
inducing, synergizing, or promoting the binding of a second
modulator compound of said kinase to form a ternary adduct, such
co-incident binding resulting in enhanced biological modulation of
the kinase when compared to the biological modulation of the
protein affected by either of said compounds alone.
382. A method of claim 381, wherein the second compound interacts
at a substrate, cofactor, or regulatory site on the kinase, said
second site being distinct from the site of interaction of the
first compound.
383. A method of claim 382, wherein the second site is an ATP
cofactor site.
384. A method of claim 381, wherein the kinase is c-Abl kinase,
Bcr-Abl kinase or disease polymorphs thereof.
385. A method of claim 382, wherein the kinase is c-Abl kinase,
Bcr-Abl kinase or disease polymorphs thereof.
386. A method of claim 383, wherein the kinase is c-Abl kinase,
Bcr-Abl kinase or disease polymorphs thereof.
387. A method of claim 386, wherein the second compound is taken
from the group consisting of
N-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)-4-((4-methylpi-
perazin-1-yl)methyl)benzamide (Gleevec);
N-(2-chloro-6-methylphenyl)-2-(6-(4-(2-hydroxyethyl)piperazin-1-yl)-2-met-
hylpyrimidin-4-ylamino)thiazole-5-carboxamide (BMS-354825);
6-(2,6-dichlorophenyl)-2-(3-(hydroxymethyl)phenylamino)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one (PD 166326);
6-(2,6-dichlorophenyl)-8-methyl-2-(3-(methylthio)phenylamino)pyrido[2,3-d-
]pyrimidin-7(8H)-one (PD 173955);
6-(2,6-dichlorophenyl)-2-(4-fluoro-3-methylphenylamino)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one (PD180970);
6-(2,6-dichlorophenyl)-2-(4-ethoxyphenylamino)-8-methylpyrido[2,3-d]pyrim-
idin-7(8H)-one (PD 173958);
6-(2,6-dichlorophenyl)-2-(4-fluorophenylamino)-8-methylpyrido[2,3-d]pyrim-
idin-7(8H)-one (PD 173956);
6-(2,6-dichlorophenyl)-2-(4-(2-(diethylamino)ethoxy)phenylamino)-8-methyl-
pyrido[2,3-d]pyrimidin-7(8H)-one (PD 166285);
2-(4-(2-aminoethoxy)phenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one;
N-(3-(6-(2,6-dichlorophenyl)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrim-
idin-2-ylamino)phenyl)acetamide (SKI DV-MO16);
2-(4-aminophenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 1-10);
6-(2,6-dichlorophenyl)-2-(3-hydroxyphenylamino)-8-methylpyrido[2,3-d]pyri-
midin-7(8H)-one (SKI DV2-89);
2-(3-aminophenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 2-43);
N-(4-(6-(2,6-dichlorophenyl)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrim-
idin-2-ylamino)phenyl)acetamide (SKI DV-M017);
6-(2,6-dichlorophenyl)-2-(4-hydroxyphenylamino)-8-methylpyrido[2,3-d]pyri-
midin-7(8H)-one (SKI DV-M017);
6-(2,6-dichlorophenyl)-2-(3-ethylphenylamino)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 2 87).
388. Compounds of the formula ##STR1334## wherein A2 is selected
from the group consisting of a Z7-substituted phenyl,
Z7-substituted pyridyl, Z7-substituted pyrimidinyl, Z1-substituted
thienyl, Z1 or Z4'-substituted monocyclic heterocyclyl rings and
other monocyclic heteroaryls, excluding tetrazolyl,
1,2,4-oxadiazolonyl, 1,2,4-triazolonyl, and alkyl-substituted
pyrrolyl wherein the pyrrolyl nitrogen is the site of attachment to
the A1 ring; A1 is selected from the group consisting of R2' and
R7-substituted phenyl, pyridyl, or pyrimidinyl, R2-substituted
monocyclic 5-membered ring heteroaryl, and R2'-substituted
monocyclic heterocyclyl moieties; W and Y are CHR4, NR3, or O and
wherein W and Y are not simultaneously O; X is O, S, or NR3; each
R2 is selected from the group consisting of C1-C6alkyl, branched
C3-C7alkyl, and R19 substituted C3-C8carbocyclyl wherein R19 is H
or C1-C6alkyl, C1-C6fluoroalkyl wherein the alkyl group is
partially or fully fluorinated, phenyl wherein the phenyl group is
optionally substituted by one or more fluorine substituents, or
monocyclic heteroaryl; each R2' is selected from the group
consisting of halogen and R2; each R3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, C3-C7cycloalkyl, or phenyl; each R3' is
independently and individually selected from the group consisting
of C2-C6alkyl, branched C3-C7alkyl, C3-C7cycloalkyl, aryl,
arylalkyl, heteroaryl, and heteroarylalkyl; each R4 is selected
from the group consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; each R5 is
independently and individually selected from the group consisting
of ##STR1335## and wherein the symbol (##) is the point of
attachment to respective R8, R10, Z1, Z4', Z5, Z6 and Z7 moieties
containing a R5 moiety; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R5 may cyclize to form a C3-C7
heterocyclyl ring; wherein each R6 is independently and
individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, phenyl, heteroaryl, and
heterocyclyl; each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or C1-C3alkoxy;
each R8 is independently and individually selected from the group
consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, branchedC4-C7alkyl,
carbocyclyl, phenyl, C1-C6phenylalkyl, heteroaryl or
heteroarylC1-C6alkyl, heterocyclyl, heterocyclylC1-C6alkyl, OH,
C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2, or R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; each R10 is independently and individually
selected from the group consisting of CO.sub.2H,
CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; D comprises a moiety taken from group consisting
of ##STR1336## wherein the symbol (***) is the point of attachment
to the Y group of formula I; wherein E1A is taken from the groups
consisting of carbocyclyl, mono- and poly-heterocyclyl and mono-
and poly-heteroaryl; wherein E1B is taken from the groups
consisting of phenyl and naphthyl; wherein E2A is taken from the
group consisting of naphthyl, a 5-membered ring heteroaryl, or a
fused bicyclic heteroaryl; wherein E2B is taken from the group
consisting of phenyl, pyridyl, and pyrimidyl; X1 is selected from
the group consisting of O, S, NR3, --C(.dbd.O)--,
--O--(CH.sub.2)n-, --S--(CH.sub.2)n-, --NR3-(CH.sub.2)n-,
--O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1A or
E1B ring and the E2A or E2B ring are directly linked by a covalent
bond; and wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1A or E1B or E2A or E2B are directly linked to the Y
group of formula I; X3 is selected from the group consisting of
NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2).sub.n--,
--(CH.sub.2)n-CO--N(R4)-, --(CH2).sub.q--, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the either
the E1B ring or E2B ring are directly linked by a covalent bond;
and wherein the carbon atoms of --(CH2)q-, C2-C5alkenyl, and
C2-C5alkynyl moieties of X3 may be further substituted by one or
more C1-C6alkyl; X4 is selected from the group consisting of C1-C6
alkyl, C3-C6 branched alkyl; each Z1 is a substituent attached to a
ring carbon and is independently and individually selected from the
group consisting of hydroxyC1-C6alkyl, C2-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1337## ##STR1338## wherein the
site of attachment to the A2 ring is meta to the point of
attachment to the A1 ring and wherein A2 is phenyl, and cyano
wherein the site of attachment is to a substitutable position when
A2 is pyridyl, pyrimidinyl or a five-membered ring; Wherein the
asterisk (*) indicates the point of attachment of the Z1 moiety to
the A2 ring; in the event that Z1 contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z1 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z I may cyclize to form a C3-C7 heterocyclyl ring;
wherein Z1' is independently and individually selected from the
group consisting of H, C1-C6alkyl, C3-C7cycloalkyl,
hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, (R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4' is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1339## ##STR1340## wherein the symbol
(#) indicates the point of attachment of the Z4' moiety to the A1
ring of formula I; in the event that Z4' contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; each Z7 is a substituent attached to ring
carbon and is independently and individually selected from the
group consisting of hydroxyC2-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R6).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--CO,
(R4).sub.2N--CO, --SO.sub.2R3', SOR3, --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6,
(CH.sub.2).sub.nN(R4)C(O)N(R4).sub.2, (CH.sub.2).sub.nN(R4)C(O)R5,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1341## cyano wherein the site of
attachment to the A2 ring is meta to the point of attachment to the
A1 ring and wherein A2 is phenyl, and cyano wherein the site of
attachment is to a substitutable position when A2 is pyridyl,
pyrimidinyl or a five-membered ring; In the foregoing definition of
Z7, alkyl moieties may optionally be substituted by one or more
C1-C6alkyl; Wherein the asterisk (*) indicates the point of
attachment of the Z1 moiety to the A2 ring; in the event that Z7
contains an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; wherein two R3 moieties
are independently and individually taken from the group consisting
of C1-C6alkyl and branched C3-C6alkyl and are attached to the same
nitrogen heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl
ring; wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl ring; and
n is 0-4; p is 1-4; q is 2-6, r is 0 or 1; and tautomers,
diastereomers, geometric isomers, enantiomers, hydrates, prodrugs,
and salts of any of the foregoing.
389. The compounds of claim 388 wherein E1A is selected from the
group consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
furyl, imidazolyl, pyridyl, and pyrimidinyl; E2A is selected from
the group comprising naphthyl, pyrrolyl, furyl, thienyl, oxazolyl,
thiazolyl, isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl,
oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl, pyrazinyl,
pyridazinyl, triazinyl and fused bicyclic rings selected from the
group comprising indolyl, isoindolyl, isoindolinyl, isoindolonyl,
indazolyl, benzofuranyl, benzothienyl, benzothiazolyl,
benzothiazolonyl, benzoxazolyl, benzoxazolonyl, benzisoxazolyl,
benzisothiazolyl, benzimidazolyl, benzimidazolonyl, benztriazolyl,
imidazopyridinyl, imidazopyrimidinyl, imidazolonopyrimidinyl,
dihydropurinonyl, pyrrolopyrimidinyl, purinyl, pyrazolopyridinyl,
pyrazolopyrimidinyl, isoxazolopyrimidinyl, isothiazolopyrimidinyl,
furylopyrimidinyl, thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl.
390. The compounds of claim 388 wherein D comprises a moiety taken
from the group consisting of carbocyclyl and a moiety of the
formula ##STR1342## X2 is selected from the group consisting of
C1-C6 alkyl, C3-C6 branched alkyl, or a direct bond wherein E2A or
E2B is directly linked to the Y group of formula I.
391. The compounds of claim 390 wherein the E2A ring is selected
from the group comprising naphthyl, pyrrolyl, furyl, thienyl,
oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl,
pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl,
pyrazinyl, pyridazinyl, triazinyl and fused bicyclic rings selected
from the group comprising indolyl, isoindolyl, isoindolinyl,
isoindolonyl, indazolyl, benzofuranyl, benzothienyl,
benzothiazolyl, benzothiazolonyl, benzoxazolyl, benzoxazolonyl,
benzisoxazolyl, benzisothiazolyl, benzimidazolyl, benzimidazolonyl,
benztriazolyl, imidazopyridinyl, imidazopyrimidinyl,
imidazolonopyrimidinyl, dihydropurinonyl, pyrrolopyrimidinyl,
purinyl, pyrazolopyridinyl, pyrazolopyrimidinyl,
isoxazolopyrimidinyl, isothiazolopyrimidinyl, furylopyrimidinyl,
thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl;
wherein E2B is selected from the group consisting of phenyl,
pyridyl and pyrimidyl.
392. The compounds of claim 388 wherein A2 is selected from the
group consisting of ##STR1343## ##STR1344## Z5 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, halogen, fluoroalkyl, cyano, hydroxyl, alkoxy,
oxo, aminocarbonyl, carbonylamino, aminosulfonyl, sulfonylamino,
--N(R3).sub.2, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --R5, --O--(CH.sub.2)q-O-Alkyl,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-O-Alkyl,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --O--(CH.sub.2)q-R5, and
--N(R3)-(CH.sub.2)q-R5; wherein two R3 moieties are independently
and individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring; and
n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v is 1 or 2.
393. The compounds of claim 392, wherein A2 is selected from the
group consisting of ##STR1345## and wherein the symbol (**) is the
point of attachment to the A1 ring for formula I.
394. The compounds of claim 393, wherein A2 is selected from the
group consisting of ##STR1346## and wherein the symbol (**) is the
point of attachment to the A1 ring of formula I.
395. The compounds of claim 389 wherein said A2 group is defined as
set forth in claim 392.
396. The compounds of claim 395 wherein said A2 group is defined as
set forth in claim 393.
397. The compounds of claim 395 wherein said A2 group is defined as
set forth in claim 394.
398. The compounds of claim 390 wherein said A2 group is defined as
set forth in claim 392.
399. The compounds of claim 398 wherein said A2 group is defined as
set forth in claim 393.
400. The compounds of claim 398 wherein said A2 group is defined as
set forth in claim 394.
401. The compounds of claims 388, 392, 395, 398, wherein A1 is
selected from the group consisting of ##STR1347## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
402. The compounds of claims 388, 392, 395, 398, wherein A1 is
selected from the group consisting of ##STR1348## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I.
403. The compounds of claims 388, 392, 395, 398, wherein A1 is
selected from the group consisting of ##STR1349## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
404. The compounds of claims 388, 392, 395, 398, wherein: (1) W and
Y are each NH, and X.dbd.O; (2) W.dbd.NH, Y.dbd.CHR4 and X.dbd.O;
or (3) W.dbd.CHR4, Y.dbd.NH, and X.dbd.O.
405. The compounds of claims 388, 392, 395, 398, wherein W and Y
are each NH and X.dbd.O.
406. Compounds of the formula ##STR1350## wherein A2 is selected
from the group consisting of ##STR1351## wherein the symbol (**)
denotes the attachment to the A1 moiety of formula I; A1 is
selected from the group consisting of ##STR1352## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I; X is O, S, or NR3; D comprises a member of 2,3-dichlorophenyl,
3,4-dichlorophenyl, 3,5-dichlorophenyl, 4-chlorophenyl,
3-chlorophenyl, 3-bromophenyl, 2,3-difluorophenyl,
2,4-difluorophenyl, 3,4-difluorophenyl, 2,5-difluorophenyl,
3,5-difluorophenyl, 2,3,5-trifluorophenyl, 2,4,5-trifluorophenyl,
2,3,4-trifluorophenyl, 3,4,5-trifluorophenyl, 4-cyanophenyl,
3-(R8SO.sub.2)-- phenyl, 3-phenoxyphenyl, 4 phenoxyphenyl,
##STR1353## ##STR1354## ##STR1355## ##STR1356## ##STR1357## wherein
E2A is taken from the groups consisting of cyclopropyl, cyclobutyl,
cyclopentyl, cyclohexyl, pyrrolidinyl piperidinyl, thienyl,
oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl,
oxadiazolyl, thiadiazolyl, furyl, imidazolyl, pyridyl, and
pyrimidinyl; wherein E1B is taken from the groups consisting of
phenyl and naphthyl; wherein E2A is taken from the group comprising
naphthyl, pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, triazolyl, tetrazolyl, pyrazinyl, pyridazinyl,
triazinyl and fused bicyclic rings selected from the group
comprising indolyl, isoindolyl, isoindolinyl, isoindolonyl,
indazolyl, benzofuranyl, benzothienyl, benzothiazolyl,
benzothiazolonyl, benzoxazolyl, benzoxazolonyl, benzisoxazolyl,
benzisothiazolyl, benzimidazolyl, benzimidazolonyl, benztriazolyl,
imidazopyridinyl, imidazopyrimidinyl, imidazolonopyrimidinyl,
dihydropurinonyl, pyrrolopyrimidinyl, purinyl, pyrazolopyridinyl,
pyrazolopyrimidinyl, isoxazolopyrimidinyl, isothiazolopyrimidinyl,
furylopyrimidinyl, thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl;
wherein E2B is taken from the group consisting of phenyl, pyridyl,
and pyrimidyl; wherein the symbol (***) denotes the attachment to
the Y moiety of formula I; X1 is selected from the group consisting
of O, S, NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I;
each R2 is selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, and R19 substituted C3-C8carbocyclyl wherein
R19 is H, or C1-C6alkyl, C1-C6fluoroalkyl wherein the alkyl group
is partially or fully fluorinated, phenyl wherein the phenyl group
is optionally substituted by one or more fluorine substituents, or
monocyclic heteroaryl; X3 is selected from the group consisting of
NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2).sub.n--, --O--(CH.sub.2)q-O--,
--O--(CH.sub.2)q-NR3-, --N(R3)-(CH.sub.2)q-N(R3)-,
--(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2).sub.n--,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)q-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the either
the E1B ring or E2B ring are directly linked by a covalent bond;
and wherein the carbon atoms of --(CH2)q-, C2-C5alkenyl, and
C2-C5alkynyl moieties of X3 may be further substituted by one or
more C1-C6alkyl; X4 is selected from the group consisting of C1-C6
alkyl, C3-C6 branched alkyl; each R2' is selected from the group
consisting of halogen and R2; each R3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl; wherein two R3
moieties independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C7alkyl are attached to
the same nitrogen heteroatom, the two R3 moieties may cyclize to
form a C3-C7 heterocyclyl ring; each R4 is selected from the group
consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom may
cyclize to form a C3-C7 heterocyclyl ring; each R5 is independently
and individually selected from the group consisting of ##STR1358##
and wherein the symbol (##) is the point of attachment to
respective R8, R10, Z4, Z5, Z6 or A2 ring moieties containing a R5
moiety; wherein two R4 moieties independently and individually
taken from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of R5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein each R6 is independently and individually selected from the
group consisting of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl,
phenyl, heteroaryl, and heterocyclyl; each R7 is selected from the
group consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, C1-C3alkyl, cyclopropyl,
cyano, or C1-C3alkoxy; each R8 is independently and individually
selected from the group consisting of C1-C6alkyl, C1-C6 fluoroalkyl
wherein the alkyl moiety is partially or fully fluorinated,
branchedC4-C7alkyl, carbocyclyl, phenyl, C1-C6phenylalkyl,
heteroaryl or heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2,
or R5; wherein two R3 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; wherein Z1' is independently and individually
selected from the group consisting of H, C1-C6alkyl,
C3-C7cycloalkyl, hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4 is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1359## ##STR1360## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2).sub.q--N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; each Z7 is a substituent attached to a ring
carbon and is independently and individually selected from the
group consisting of hydroxyC2-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R6).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--CO,
(R4).sub.2N--CO, --SO.sub.2R3', SOR3, --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6,
(CH.sub.2).sub.nN(R4)C(O)N(R4).sub.2, (CH.sub.2).sub.nN(R4)C(O)R5,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1361## cyano wherein the site of
attachment to the A2 ring is meta to the point of attachment to the
A1 ring and wherein A2 is phenyl, and cyano wherein the site of
attachment is to a substitutable position when A2 is pyridyl,
pyrimidinyl or a five-membered ring; In the foregoing definition of
Z7, alkyl moieties may optionally be substituted by one or more
C1-C6alkyl; Wherein the asterisk (*) indicates the point of
attachment of the Z1 moiety to the A2 ring; in the event that Z7
contains an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; wherein two R3 moieties
are independently and individually taken from the group consisting
of C1-C6alkyl and branched C3-C6alkyl and are attached to the same
nitrogen heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl
ring; wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl ring; and
n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v is 1 or 2; and
tautomers, diastereomers, geometric isomers, enantiomers, hydrates,
prodrugs and salts of any of the foregoing.
407. Most preferred compounds from claim 406 are:
1-(1-(3-(1H-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3-dichlo-
rophenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(pyri-
din-3-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-(trifluoromethyl)-1H-pyrazol-5-yl)--
3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(3-(pyridin-3-yl)phenyl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3--
yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(pyra-
zin-2-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(2-(m-
ethylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(1-ox-
oisoindolin-4-yl)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(4-(-
1-oxoisoindolin-4-yl)phenyl)urea,
1-(1-(3-(1H-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(1-oxois-
oindolin-4-yl)phenyl)urea
408. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 388.
409. The method of claim 408, said kinase species being activated
or unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
410. The method of claim 408, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
411. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 406.
412. The method of claim 411, said species being activated or
unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
413. The method of claim 411, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
414. A pharmaceutical composition comprising a compound of claim
388 together with a pharmaceutically acceptable carrier
415. The composition of claim 414 including an additive selected
from the group including adjuvants, excipients, diluents, and
stablilizers.
416. A pharmaceutical composition comprising a compound of claim
406 together with a pharmaceutically acceptable carrier
417. The composition of claim 416 including an additive selected
from the group including adjuvants, excipients, diluents, and
stabilizers.
418. A method of treating an individual suffering from a condition
selected from the group consisting of cancer, secondary cancer
growth arising from metastasis, hyperproliferative diseases, and
diseases characterized by hyper-vascularization, comprising the
step of administering to such individual a compound of claim
388.
419. The method of claim 418, said condition being glioblastomas,
ovarian cancer, pancreatic cancer, prostate cancer, lung cancers,
breast cancers, kidney cancers, cervical carcinomas, metastasis of
primary solid tumor secondary sites, ocular diseases characterized
by hyperproliferation leading to blindness including various
retinopathies including diabetic retinopathy and age-related
macular degeneration, or rheumatoid arthritis characterized by the
in-growth of a vascularized pannus.
420. The method of claim 418, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
421. A method of treating an individual suffering from a condition
selected from the group consisting of cancer, secondary cancer
growth arising from metastasis, hyperproliferative diseases, and
diseases characterized by hyper-vascularization, comprising the
step of administering to such individual a compound of claim
406.
422. The method of claim 421, said condition being glioblastomas,
ovarian cancer, pancreatic cancer, prostate cancer, lung cancers,
breast cancers, kidney cancers, cervical carcinomas, metastasis of
primary solid tumor secondary sites, ocular diseases characterized
by hyperproliferation leading to blindness including various
retinopathies including diabetic retinopathy and age-related
macular degeneration, or rheumatoid arthritis characterized by the
in-growth of a vascularized pannus.
423. The method of claim 421, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
424. An adduct comprising a compound of claim 388 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
425. An adduct comprising a compound of claim 406 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
426. Compounds of the formula ##STR1362## wherein A2 is selected
from the group consisting of a Z7-substituted phenyl,
Z7-substituted pyridyl, Z7-substituted pyrimidinyl, Z1-substituted
thienyl, Z1 or Z4'-substituted monocyclic heterocyclyl rings and
other monocyclic heteroaryls, excluding tetrazolyl,
1,2,4-oxadiazolonyl, 1,2,4-triazolonyl, and alkyl-substituted
pyrrolyl wherein the pyrrolyl nitrogen is the site of attachment to
the A1 ring; A1 is selected from the group consisting of R2' and
R7-substituted phenyl, pyridyl, or pyrimidinyl, R2-substituted
monocyclic 5-membered ring heteroaryl, and R2'-substituted
monocyclic heterocyclyl moieties; W and Y are CHR4, NR3, or O and
wherein W and Y are not simultaneously O; X is O, S, or NR3; Each
R2 is independently and individually selected from the group
consisting of C1-C6alkyl, branched C3-C7alkyl, C1-C6fluoroalkyl,
wherein the alkyl group is partially or fully fluorinated,
monocyclic heteroaryl, and R19 substituted C3-C8carbocyclyl wherein
R19 is H and C1-C6alkyl; each R2' is selected from the group
consisting of halogen and R2; each R3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, C3-C7cycloalkyl, or phenyl; each R3' is
independently and individually selected from the group consisting
of C2-C6alkyl, branched C3-C7alkyl, C3-C7cycloalkyl, aryl,
arylalkyl, heteroaryl, and heteroarylalkyl; each R4 is selected
from the group consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; each R5 is
independently and individually selected from the group consisting
of ##STR1363## and wherein the symbol (##) is the point of
attachment to respective R8, R10, Z1, Z4', Z5, Z6 and Z7 moieties
containing a R5 moiety; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R5 may cyclize to form a C3-C7
heterocyclyl ring; wherein each R6 is independently and
individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, phenyl, heteroaryl, and
heterocyclyl; each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or C1-C3alkoxy;
each R8 is independently and individually selected from the group
consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, branchedC4-C7alkyl,
carbocyclyl, phenyl, C1-C6phenylalkyl, heteroaryl or
heteroarylC1-C6alkyl, heterocyclyl, heterocyclylC1-C6alkyl, OH,
C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2, or R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; each R10 is independently and individually
selected from the group consisting of CO.sub.2H,
CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; D comprises a moiety taken from group consisting
of ##STR1364## wherein the symbol (***) is the point of attachment
to the Y group of formula I; wherein E1A is taken from the groups
consisting of carbocyclyl, mono- and poly-heterocyclyl and mono-
and poly-heteroaryl; wherein E1B is taken from the groups
consisting of phenyl and naphthyl; wherein E2A is taken from the
group consisting of naphthyl, a 5-membered ring heteroaryl, or a
fused bicyclic heteroaryl; wherein E2B is taken from the group
consisting of phenyl, pyridyl, and pyrimidyl; X1 is selected from
the group consisting of O, S, NR3, --C(.dbd.O)--,
--O--(CH.sub.2)n-, --S--(CH.sub.2)n-, --NR3-(CH.sub.2)n-,
--O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1A or
E1B ring and the E2A or E2B ring are directly linked by a covalent
bond; and wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1A or E1B or E2A or E2B are directly linked to the Y
group of formula I; X3 is selected from the group consisting of
NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2).sub.n--, --O--(CH.sub.2)q-O--,
--O--(CH.sub.2)q-NR3-, --N(R3)-(CH.sub.2)q-N(R3)-,
--(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2).sub.n--,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)q-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the either
the E1B ring or E2B ring are directly linked by a covalent bond;
and wherein the carbon atoms of --(CH2)q-, C2-C5alkenyl, and
C2-C5alkynyl moieties of X3 may be further substituted by one or
more C1-C6alkyl; X4 is selected from the group consisting of C1-C6
alkyl, C3-C6 branched alkyl; each Z1 is a substituent attached to a
ring carbon and is independently and individually selected from the
group consisting of hydroxyC1-C6alkyl, C2-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1365## ##STR1366## cyano wherein
the site of attachment to the A2 ring is meta to the point of
attachment to the A1 ring and wherein A2 is phenyl, and cyano
wherein the site of attachment is to a substitutable position when
A2 is pyridyl, pyrimidinyl or a five-membered ring; Wherein the
asterisk (*) indicates the point of attachment of the Z1 moiety to
the A2 ring; in the event that Z1 contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z1 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z1 may cyclize to form a C3-C7 heterocyclyl ring;
wherein Z1' is independently and individually selected from the
group consisting of H, C1-C6alkyl, C3-C7cycloalkyl,
hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, (R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4' is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1367## ##STR1368## wherein the symbol
(#) indicates the point of attachment of the Z4' moiety to the A1
ring of formula I; in the event that Z4' contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1]-C6alkyls; each Z7 is a substituent attached to a ring
carbon and is independently and individually selected from the
group consisting of hydroxyC2-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R6).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--CO,
(R4).sub.2N--CO, --SO.sub.2R3', SOR3, --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6,
(CH.sub.2).sub.nN(R4)C(O)N(R4).sub.2, (CH.sub.2).sub.nN(R4)C(O)R5,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1369## cyano wherein the site of
attachment to the A2 ring is meta to the point of attachment to the
A1 ring and wherein A2 is phenyl, and cyano wherein the site of
attachment is to a substitutable position when A2 is pyridyl,
pyrimidinyl or a five-membered ring; In the foregoing definition of
Z7, alkyl moieties may optionally be substituted by one or more
C1-C6alkyl; Wherein the asterisk (*) indicates the point of
attachment of the Z1 moiety to the A2 ring; in the event that Z7
contains an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; wherein two R3 moieties
are independently and individually taken from the group consisting
of C1-C6alkyl and branched C3-C6alkyl and are attached to the same
nitrogen heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl
ring; wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl ring; and
n is 0-4; p is 1-4; q is 2-6, r is 0 or 1; and tautomers,
diastereomers, geometric isomers, enantiomers, hydrates, prodrugs,
and salts of any of the foregoing.
427. The compounds of claim 426 wherein E1A is selected from the
group consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
furyl, imidazolyl, pyridyl, and pyrimidinyl; E2A is selected from
the group comprising naphthyl, pyrrolyl, furyl, thienyl, oxazolyl,
thiazolyl, isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl,
oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl, pyrazinyl,
pyridazinyl, triazinyl and fused bicyclic rings selected from the
group comprising indolyl, isoindolyl, isoindolinyl, isoindolonyl,
indazolyl, benzofuranyl, benzothienyl, benzothiazolyl,
benzothiazolonyl, benzoxazolyl, benzoxazolonyl, benzisoxazolyl,
benzisothiazolyl, benzimidazolyl, benzimidazolonyl, benztriazolyl,
imidazopyridinyl, imidazopyrimidinyl, imidazolonopyrimidinyl,
dihydropurinonyl, pyrrolopyrimidinyl, purinyl, pyrazolopyridinyl,
pyrazolopyrimidinyl, isoxazolopyrimidinyl, isothiazolopyrimidinyl,
furylopyrimidinyl, thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl.
428. The compounds of claim 426 wherein D comprises a moiety taken
from the group consisting of carbocyclyl and a moiety of the
formula ##STR1370## X2 is selected from the group consisting of
C1-C6 alkyl, C3-C6 branched alkyl, or a direct bond wherein E2A or
E2B is directly linked to the Y group of formula I.
429. The compounds of claim 428 wherein the E2A ring is selected
from the group comprising naphthyl, pyrrolyl, furyl, thienyl,
oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl,
pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl,
pyrazinyl, pyridazinyl, triazinyl and fused bicyclic rings selected
from the group comprising indolyl, isoindolyl, isoindolinyl,
isoindolonyl, indazolyl, benzofuranyl, benzothienyl,
benzothiazolyl, benzothiazolonyl, benzoxazolyl, benzoxazolonyl,
benzisoxazolyl, benzisothiazolyl, benzimidazolyl, benzimidazolonyl,
benztriazolyl, imidazopyridinyl, imidazopyrimidinyl,
imidazolonopyrimidinyl, dihydropurinonyl, pyrrolopyrimidinyl,
purinyl, pyrazolopyridinyl, pyrazolopyrimidinyl,
isoxazolopyrimidinyl, isothiazolopyrimidinyl, furylopyrimidinyl,
thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl;
wherein E2B is selected from the group consisting of phenyl,
pyridyl and pyrimidyl.
430. The compounds of claim 426 wherein A2 is selected from the
group consisting of ##STR1371## ##STR1372## Z5 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, halogen, fluoroalkyl, cyano, hydroxyl, alkoxy,
oxo, aminocarbonyl, carbonylamino, aminosulfonyl, sulfonylamino,
--N(R3).sub.2, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --R5, --O--(CH.sub.2)q-O-Alkyl,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-O-Alkyl,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --O--(CH.sub.2)q-R5, and
--N(R3)-(CH.sub.2)q-R5; wherein two R3 moieties are independently
and individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring; and
n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v is 1 or 2.
431. The compounds of claim 430, wherein A2 is selected from the
group consisting of ##STR1373## and wherein the symbol (**) is the
point of attachment to the A1 ring for formula I.
432. The compounds of claim 431, wherein A2 is selected from the
group consisting of ##STR1374## and wherein the symbol (**) is the
point of attachment to the A1 ring of formula I.
433. The compounds of claim 427 wherein said A2 group is defined as
set forth in claim 430.
434. The compounds of claim 433 wherein said A2 group is defined as
set forth in claim 431.
435. The compounds of claim 433 wherein said A2 group is defined as
set forth in claim 432.
436. The compounds of claim 428 wherein said A2 group is defined as
set forth in claim 430.
437. The compounds of claim 436 wherein said A2 group is defined as
set forth in claim 431.
438. The compounds of claim 436 wherein said A2 group is defined as
set forth in claim 432.
439. The compounds of claims 426, 430, 433, 436, wherein A1 is
selected from the group consisting of ##STR1375## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I.
440. The compounds of claims 426, 430, 433, 436, wherein A1 is
selected from the group consisting of ##STR1376## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
441. The compounds of claims 426, 430, 433, 436, wherein A1 is
selected from the group consisting of ##STR1377## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
442. The compounds of claims 426, 430, 433, 436, wherein: (1) W and
Y are each NH, and X.dbd.O; (2) W.dbd.NH, Y.dbd.CHR4 and X.dbd.O;
or (3) W.dbd.CHR4, Y.dbd.NH, and X.dbd.O.
443. The compounds of claims 426, 430, 433, 436, wherein W and Y
are each NH and X.dbd.O.
444. Compounds of the formula ##STR1378## wherein A2 is selected
from the group consisting of ##STR1379## wherein the symbol (**)
denotes the attachment to the A1 moiety of formula I; A1 is
selected from the group consisting of ##STR1380## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I; X is O, S, or NR3; D comprises a member of 2,3-dichlorophenyl,
2,3-difluorophenyl, 2,4-difluorophenyl, 3,4-difluorophenyl,
2,5-difluorophenyl, 3,5-difluorophenyl, 2,3,5-trifluorophenyl,
2,4,5-trifluorophenyl, 2,3,4-trifluorophenyl,
3,4,5-trifluorophenyl, 3-phenoxyphenyl, 4-phenoxyphenyl,
cyclohexyl, ##STR1381## ##STR1382## ##STR1383## ##STR1384##
##STR1385## wherein E1A is taken from the groups consisting of
cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, pyrrolidinyl
piperidinyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
furyl, imidazolyl, pyridyl, and pyrimidinyl; wherein E1B is taken
from the groups consisting of phenyl and naphthyl; wherein E2A is
taken from the group comprising naphthyl, pyrrolyl, furyl, thienyl,
oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl,
pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl,
pyrazinyl, pyridazinyl, triazinyl and fused bicyclic rings selected
from the group comprising indolyl, isoindolyl, isoindolinyl,
isoindolonyl, indazolyl, benzofuranyl, benzothienyl,
benzothiazolyl, benzothiazolonyl, benzoxazolyl, benzoxazolonyl,
benzisoxazolyl, benzisothiazolyl, benzimidazolyl, benzimidazolonyl,
benztriazolyl, imidazopyridinyl, imidazopyrimidinyl,
imidazolonopyrimidinyl, dihydropurinonyl, pyrrolopyrimidinyl,
purinyl, pyrazolopyridinyl, pyrazolopyrimidinyl,
isoxazolopyrimidinyl, isothiazolopyrimidinyl, furylopyrimidinyl,
thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl;
wherein E2B is taken from the group consisting of phenyl, pyridyl,
and pyrimidyl; wherein the symbol (***) denotes the attachment to
the Y moiety of formula I; X1 is selected from the group consisting
of O, S, NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I; X3
is selected from the group consisting of NR3, --C(.dbd.O)--,
--O--(CH.sub.2)n-, --S--(CH.sub.2)n-, --NR3-(CH2)n-,
--O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)q-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the either
the E1B ring or E2B ring are directly linked by a covalent bond;
and wherein the carbon atoms of --(CH2)q-, C2-C5alkenyl, and
C2-C5alkynyl moieties of X3 may be further substituted by one or
more C1-C6alkyl; X4 is selected from the group consisting of C1-C6
alkyl, C3-C6 branched alkyl; Each R2 is independently and
individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, C1-C6fluoroalkyl, wherein the alkyl group is
partially or fully fluorinated, monocyclic heteroaryl, and R19
substituted C3-C8carbocyclyl wherein R19 is H and C1-C6alkyl; each
R2' is selected from the group consisting of halogen and R2; each
R3 is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, C3-C7carbocyclyl,
or phenyl; wherein two R3 moieties independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C7alkyl are attached to the same nitrogen heteroatom, the two R3
moieties may cyclize to form a C3-C7 heterocyclyl ring; each R4 is
selected from the group consisting of H, C1-C6alkyl, hydroxyC1-C6
alkyl, dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched
C3-C7alkyl, branched hydroxyC1-C6 alkyl, branched
C1-C6alkoxyC1-C6alkyl, branched dihydroxyC1-C6alkyl, carbocyclyl,
hydroxyl substituted carbocyclyl, alkoxy substituted carbocyclyl,
dihydroxy substituted carbocyclyl, phenyl, heteroaryl,
heterocyclyl, phenylC1-C6alkyl, heteroarylC1-C6alkyl, and
heterocyclylC1-C6alkyl; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom may cyclize to form a C3-C7
heterocyclyl ring; each R5 is independently and individually
selected from the group consisting of ##STR1386## and wherein the
symbol (##) is the point of attachment to respective R8, R10, Z4,
Z5, Z6 or A2 ring moieties containing a R5 moiety; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R5
may cyclize to form a C3-C7 heterocyclyl ring; wherein each R6 is
independently and individually selected from the group consisting
of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl, phenyl,
heteroaryl, and heterocyclyl; each R7 is selected from the group
consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl moiety
is partially or fully fluorinated, C1-C3alkyl, cyclopropyl, cyano,
or C1-C3alkoxy; each R8 is independently and individually selected
from the group consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein
the alkyl moiety is partially or fully fluorinated,
branchedC4-C7alkyl, carbocyclyl, phenyl, C1-C6phenylalkyl,
heteroaryl or heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2,
or R5; wherein two R3 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; wherein Z1' is independently and individually
selected from the group consisting of H, C1-C6alkyl,
C3-C7cycloalkyl, hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4 is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1387## ##STR1388## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; each Z7 is a substituent attached to a ring
carbon and is independently and individually selected from the
group consisting of hydroxyC2-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R6).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--CO,
(R4).sub.2N--CO, --SO.sub.2R3', SOR3, --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6,
(CH.sub.2).sub.nN(R4)C(O)N(R4).sub.2, (CH.sub.2).sub.nN(R4)C(O)R5,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1389## cyano wherein the site of
attachment to the A2 ring is meta to the point of attachment to the
A1 ring and wherein A2 is phenyl, and cyano wherein the site of
attachment is to a substitutable position when A2 pyridyl,
pyrimidinyl, or a five-membered ring; In the foregoing definition
of Z7, alkyl moieties may optionally be substituted by one or more
C1-C6alkyl; Wherein the asterisk (*) indicates the point of
attachment of the Z1 moiety to the A2 ring; in the event that Z7
contains an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; wherein two R3 moieties
are independently and individually taken from the group consisting
of C1-C6alkyl and branched C3-C6alkyl and are attached to the same
nitrogen heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl
ring; wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl ring; and
n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v is 1 or 2; and
tautomers, diastereomers, geometric isomers, enantiomers, hydrates,
prodrugs and salts of any of the foregoing.
445. Most preferred compounds from claim 444 are
1-(3-t-butyl-1-(3-(pyridin-3-yl)phenyl)-1H-pyrazol-5-yl)-3-(2,3-dichlorop-
henyl)urea,
1-(1-(3-(1H-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3-dichlo-
rophenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
1-(1-(3-(1-amino-1-oxopropan-2-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2-
,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(2-(2-hydroxyethylamino)-2-oxoethyl)phenyl)-1H-pyrazol--
5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)phenyl)-1H-pyr-
azol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(2-((S)-3-(dimethylamino)pyrrolidin-1-yl)-2-oxoethyl)ph-
enyl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-((2,4,5-trioxoimidazolidin-1-yl)methyl)phenyl)-1H-pyraz-
ol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-((4,5-dioxo-2,2-dioxo-2,1,3-thiadiaol-yl)methyl)phenyl)-
-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-carbamimidoylphenyl)-1H-pyrazol-5-yl)-3-(2,3-dichloroph-
enyl)urea, 1
(1-(3-(N-hydroxycarbamimidoyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3-d-
ichlorophenyl)urea,
1-(1-(4-(N-hydroxycarbamimidoyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(2-hydroxyethyl)phenyl)-1H-pyrazol-5-yl)-3-(2,3-dichlor-
ophenyl)urea,
1-(3-t-butyl-1-(3-(5-oxo-4,5-dihydro-1,3,4-oxadiazol-2-yl)phenyl)-1H-pyra-
zol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-cyanophenyl)-1H-pyrazol-5-yl)-3-(2,3,4-trifluorophenyl)-
urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,-
4,5-trifluorophenyl)urea,
2-(3-(3-t-butyl-5-(3-(2,3-difluorophenyl)ureido)-1H-pyrazol-1-yl)phenyl)a-
cetic acid,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(pyri-
din-3-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(2-(m-
ethylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(8-me-
thyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(3-(-
8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea.
446. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 426.
447. The method of claim 446, said kinase species being activated
or unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
448. The method of claim 446, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
449. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 444.
450. The method of claim 449, said species being activated or
unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
451. The method of claim 449, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
452. A pharmaceutical composition comprising a compound of claim
426 together with a pharmaceutically acceptable carrier
453. The composition of claim 452 including an additive selected
from the group including adjuvants, excipients, diluents, and
stablilizers.
454. A pharmaceutical composition comprising a compound of claim
444 together with a pharmaceutically acceptable carrier
455. The composition of claim 454 including an additive selected
from the group including adjuvants, excipients, diluents, and
stablilizers.
456. A method of treating an individual suffering from a condition
selected from the group consisting of cancer, hyperproliferative
diseases, or diseases characterized angiogenesis, comprising the
step of administering to such individual a compound of claim
426.
457. The method of claim 456, said condition being melanomas,
glioblastomas, ovarian cancer, pancreatic cancer, prostate cancer,
lung cancers, breast cancers, kidney cancers, cervical carcinomas,
metastisis of primary solid tumor secondary sites, ocular diseases
characterized by hyperproliferation leading to blindness including
various retinopathies including diabetic retinopathy and
age-related macular degeneration, rheumatoid arthritis
characterized by the in-growth of a vascularized pannus, or a
disease caused by a mutation in the RAS-RAF-MEK-ERK-MAP kinase
pathway.
458. The method of claim 456, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
459. A method of treating an individual suffering from a condition
selected from the group consisting of cancer and hyperproliferative
diseases, comprising the step of administering to such individual a
compound of claim 444.
460. The method of claim 459 said condition being melanomas,
glioblastomas, ovarian cancer, pancreatic cancer, prostate cancer,
lung cancers, breast cancers, kidney cancers, cervical carcinomas,
metastisis of primary solid tumor secondary sites, ocular diseases
characterized by hyperproliferation leading to blindness including
various retinopathies including diabetic retinopathy and
age-related macular degeneration, rheumatoid arthritis
characterized by the in-growth of a vascularized pannus, or a
disease caused by a mutation in the RAS-RAF-MEK-ERK-MAP kinase
pathway.
461. The method of claim 459, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
462. An adduct comprising a compound of claim 426 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
463. An adduct comprising a compound of claim 444 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
464. Compounds of the formula ##STR1390## wherein A2 is selected
from the group consisting of a Z7-substituted phenyl,
Z7-substituted pyridyl, Z7-substituted pyrimidinyl, Z1-substituted
thienyl, Z1 or Z4'-substituted monocyclic heterocyclyl rings and
other monocyclic heteroaryls, excluding tetrazolyl,
1,2,4-oxadiazolonyl, 1,2,4-triazolonyl, and alkyl-substituted
pyrrolyl wherein the pyrrolyl nitrogen is the site of attachment to
the A1 ring; A1 is selected from the group consisting of R2' and
R7-substituted phenyl, pyridyl, or pyrimidinyl, R2-substituted
monocyclic 5-membered ring heteroaryl, and R2'-substituted
monocyclic heterocyclyl moieties; W and Y are CHR4, NR3, or O and
wherein W and Y are not simultaneously O; X is O, S, or NR3; each
R2 is selected from the group consisting of monocyclic heteroaryl,
C1-C6alkyl, branched C3-C7alkyl, a R19-substituted C3-C8carbocyclyl
wherein R19 is H or C1-C6alkyl, C1-C6fluoroalkyl wherein the alkyl
group is partially or fully fluorinated, and phenyl wherein the
phenyl group is optionally substituted by one or more fluorine
substituents or chlorine; each R2' is selected from the group
consisting of halogen and R2; each R3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, C3-C7cycloalkyl, or phenyl; each R3' is
independently and individually selected from the group consisting
of C2-C6alkyl, branched C3-C7alkyl, C3-C7cycloalkyl, aryl,
arylalkyl, heteroaryl, and heteroarylalkyl; each R4 is selected
from the group consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; each R5 is
independently and individually selected from the group consisting
of ##STR1391## and wherein the symbol (##) is the point of
attachment to respective R8, R10, Z1, Z4', Z5, Z6 and Z7 moieties
containing a R5 moiety; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R5 may cyclize to form a C3-C7
heterocyclyl ring; wherein each R6 is independently and
individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, phenyl, heteroaryl, and
heterocyclyl; each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or C1-C3alkoxy;
each R8 is independently and individually selected from the group
consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, branchedC4-C7alkyl,
carbocyclyl, phenyl, C1-C6phenylalkyl, heteroaryl or
heteroarylC1-C6alkyl, heterocyclyl, heterocyclylC1-C6alkyl, OH,
C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2, or R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; each R10 is independently and individually
selected from the group consisting of CO.sub.2H,
CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; D comprises a moiety taken from group consisting
of ##STR1392## wherein the symbol (***) is the point of attachment
to the Y group of formula I; wherein E1A is taken from the groups
consisting of carbocyclyl, mono- and poly-heterocyclyl and mono-
and poly-heteroaryl; wherein E1B is taken from the groups
consisting of phenyl and naphthyl; wherein E2A is taken from the
group consisting of naphthyl, a 5-membered ring heteroaryl, or a
fused bicyclic heteroaryl; wherein E2B is taken from the group
consisting of phenyl, pyridyl, and pyrimidyl; X1 is selected from
the group consisting of O, S, NR3, --C(.dbd.O)--,
--O--(CH.sub.2)n-, --S--(CH.sub.2)n-, --NR3-(CH.sub.2)n-,
--O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1A or
E1B ring and the E2A or E2B ring are directly linked by a covalent
bond; and wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1A or E1B or E2A or E2B are directly linked to the Y
group of formula I; X3 is selected from the group consisting of
NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2).sub.n--, --O--(CH.sub.2)q-O--,
--O--(CH.sub.2)q-NR3-, --N(R3)-(CH.sub.2)q-N(R3)-,
--(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2).sub.n--,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2).sub.q--, C2-C5 alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the either
the E1B ring or E2B ring are directly linked by a covalent bond;
and wherein the carbon atoms of --(CH2)q-, C2-C5alkenyl, and
C2-C5alkynyl moieties of X3 may be further substituted by one or
more C1-C6alkyl; X4 is selected from the group consisting of C1-C6
alkyl, C3-C6 branched alkyl; each Z1 is a substituent attached to a
ring carbon and is independently and individually selected from the
group consisting of hydroxyC1-C6alkyl, C2-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1393## ##STR1394## wherein the
site of attachment to the A2 ring is meta to the point of
attachment to the A1 ring and wherein A2 is phenyl, and cyano
wherein the site of attachment is to a substitutable position when
A2 is pyridyl, pyrimidinyl or a five-membered ring; Wherein the
asterisk (*) indicates the point of attachment of the Z1 moiety to
the A2 ring; in the event that Z1 contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z1 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z1 may cyclize to form a C3-C7 heterocyclyl ring;
wherein Z1' is independently and individually selected from the
group consisting of H, C1-C6alkyl, C3-C7cycloalkyl,
hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, (R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4' is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1395## ##STR1396## wherein the symbol
(#) indicates the point of attachment of the Z4' moiety to the A1
ring of formula I; in the event that Z4' contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; each Z7 is a substituent attached to a ring
carbon and is independently and individually selected from the
group consisting of hydroxyC2-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R6).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--CO,
(R4).sub.2N--CO, --SO.sub.2R3', SOR3, --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6,
(CH.sub.2).sub.nN(R4)C(O)N(R4).sub.2, (CH.sub.2).sub.nN(R4)C(O)R5,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1397## cyano wherein the site of
attachment to the A2 ring is meta to the point of attachment to the
A1 ring and wherein A2 is phenyl, and cyano wherein the site of
attachment is to a substitutable position when A2 is pyridyl,
pyrimidinyl or a five-membered ring; In the foregoing definition of
Z7, alkyl moieties may optionally be substituted by one or more
C1-C6alkyl; Wherein the asterisk (*) indicates the point of
attachment of the Z1 moiety to the A2 ring; in the event that Z7
contains an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; wherein two R3 moieties
are independently and individually taken from the group consisting
of C1-C6alkyl and branched C3-C6alkyl and are attached to the same
nitrogen heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl
ring; wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl ring; and
n is 0-4; p is 1-4; q is 2-6, r is 0 or 1; and tautomers,
diastereomers, geometric isomers, enantiomers, hydrates, prodrugs,
and salts of any of the foregoing.
465. The compounds of claim 464 wherein E1A is selected from the
group consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
furyl, imidazolyl, pyridyl, and pyrimidinyl; E2A is selected from
the group comprising naphthyl, pyrrolyl, furyl, thienyl, oxazolyl,
thiazolyl, isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl,
oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl, pyrazinyl,
pyridazinyl, triazinyl and fused bicyclic rings selected from the
group comprising indolyl, isoindolyl, isoindolinyl, isoindolonyl,
indazolyl, benzofuranyl, benzothienyl, benzothiazolyl,
benzothiazolonyl, benzoxazolyl, benzoxazolonyl, benzisoxazolyl,
benzisothiazolyl, benzimidazolyl, benzimidazolonyl, benztriazolyl,
imidazopyridinyl, imidazopyrimidinyl, imidazolonopyrimidinyl,
dihydropurinonyl, pyrrolopyrimidinyl, purinyl, pyrazolopyridinyl,
pyrazolopyrimidinyl, isoxazolopyrimidinyl, isothiazolopyrimidinyl,
furylopyrimidinyl, thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl.
466. The compounds of claim 464 wherein D comprises a moiety taken
from the group consisting of carbocyclyl and a moiety of the
formula ##STR1398## X2 is selected from the group consisting of
C1-C6 alkyl, C3-C6 branched alkyl, or a direct bond wherein E2A or
E2B is directly linked to the Y group of formula I.
467. The compounds of claim 466 wherein the E2A ring is selected
from the group comprising naphthyl, pyrrolyl, furyl, thienyl,
oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl,
pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl,
pyrazinyl, pyridazinyl, triazinyl and fused bicyclic rings selected
from the group comprising indolyl, isoindolyl, isoindolinyl,
isoindolonyl, indazolyl, benzofuranyl, benzothienyl,
benzothiazolyl, benzothiazolonyl, benzoxazolyl, benzoxazolonyl,
benzisoxazolyl, benzisothiazolyl, benzimidazolyl, benzimidazolonyl,
benztriazolyl, imidazopyridinyl, imidazopyrimidinyl,
imidazolonopyrimidinyl, dihydropurinonyl, pyrrolopyrimidinyl,
purinyl, pyrazolopyridinyl, pyrazolopyrimidinyl,
isoxazolopyrimidinyl, isothiazolopyrimidinyl, furylopyrimidinyl,
thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl;
wherein E2B is selected from the group consisting of phenyl,
pyridyl and pyrimidyl.
468. The compounds of claim 464 wherein A2 is selected from the
group consisting of ##STR1399## ##STR1400## Z5 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, halogen, fluoroalkyl, cyano, hydroxyl, alkoxy,
oxo, aminocarbonyl, carbonylamino, aminosulfonyl, sulfonylamino,
--N(R3).sub.2, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --R5, --O--(CH.sub.2)q-O-Alkyl,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-O-Alkyl,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --O--(CH.sub.2)q-R5, and
--N(R3)-(CH.sub.2)q-R5; wherein two R3 moieties are independently
and individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring; and
n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v is 1 or 2.
469. The compounds of claim 468, wherein A2 is selected from the
group consisting of ##STR1401## and wherein the symbol (**) is the
point of attachment to the A1 ring for formula I.
470. The compounds of claim 4696, wherein A2 is selected from the
group consisting of ##STR1402## and wherein the symbol (**) is the
point of attachment to the A1 ring of formula I.
471. The compounds of claim 465 wherein said A2 group is defined as
set forth in claim 468.
472. The compounds of claim 471 wherein said A2 group is defined as
set forth in claim 469.
473. The compounds of claim 471 wherein said A2 group is defined as
set forth in claim 470.
474. The compounds of claim 466 wherein said A2 group is defined as
set forth in claim 468.
475. The compounds of claim 474 wherein said A2 group is defined as
set forth in claim 469.
476. The compounds of claim 474 wherein said A2 group is defined as
set forth in claim 470.
477. The compounds of claims 464, 468, 471, 474, wherein A1 is
selected from the group consisting of ##STR1403## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
478. The compounds of claims 464, 468, 471, 474, wherein A1 is
selected from the group consisting of ##STR1404## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I.
479. The compounds of claims 464, 468, 471, 474, wherein A1 is
selected from the group consisting of ##STR1405## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I;
480. The compounds of claims 464, 468, 471, 474, wherein: (1) W and
Y are each NH, and X.dbd.O; (2) W.dbd.NH, Y.dbd.CHR4 and X.dbd.O;
or (3) W.dbd.CHR4, Y.dbd.NH, and X.dbd.O.
481. The compounds of claims 464, 468, 471, 474, wherein W and Y
are each NH and X.dbd.O.
482. Compounds of the formula ##STR1406## wherein A2 is selected
from the group consisting of ##STR1407## wherein the symbol (**)
denotes the attachment to the A1 moiety of formula I; A1 is
selected from the group consisting of ##STR1408## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I; X is O, S, or NR3; D comprises a member of 2,3-dichlorophenyl,
2,4-dichlorophenyl, 3,4-dichlorophenyl, 3,5-dichlorophenyl,
3-chlorophenyl, 4-chlorophenyl, 3-bromophenyl, 4-bromophenyl,
3-trifluoromethylphenyl, 3-trifluoromethyl-4-chlorophenyl,
2,3,4-trifluorophenyl, 2,3,4-trifluorophenyl,
2,4,5-trifluorophenyl, 2,3,5-trifluorophenyl,
3,4,5-trifluorophenyl, 2,3-difluorophenyl, 2,4-difluorophenyl,
2,5-difluorophenyl, 3,4-difluorophenyl, 2-fluorophenyl,
3-fluorophenyl, 4-fluorophenyl, 3-cyanophenyl, 3-phenoxyphenyl, 4
phenoxyphenyl, 1-naphthyl-2,3-dihydro-1H-inden-1-yl,
1,2,3,4-tetrahydronaphthalen 1-yl, benzo[d][1,3]dioxol-5-yl or
benzo[d][1,3]dioxol-4-yl, ##STR1409## ##STR1410## ##STR1411##
##STR1412## ##STR1413## wherein E1A is taken from the groups
consisting of cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
furyl, imidazolyl, pyridyl, and pyrimidinyl; wherein E1B is taken
from the groups consisting of phenyl and naphthyl; wherein E2A is
taken from the group comprising naphthyl, pyrrolyl, furyl, thienyl,
oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl,
pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl,
pyrazinyl, pyridazinyl, triazinyl and fused bicyclic rings selected
from the group comprising indolyl, isoindolyl, isoindolinyl,
isoindolonyl, indazolyl, benzofuranyl, benzothienyl,
benzothiazolyl, benzothiazolonyl, benzoxazolyl, benzoxazolonyl,
benzisoxazolyl, benzisothiazolyl, benzimidazolyl, benzimidazolonyl,
benztriazolyl, imidazopyridinyl, imidazopyrimidinyl,
imidazolonopyrimidinyl, dihydropurinonyl, pyrrolopyrimidinyl,
purinyl, pyrazolopyridinyl, pyrazolopyrimidinyl,
isoxazolopyrimidinyl, isothiazolopyrimidinyl, furylopyrimidinyl,
thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl;
wherein E2B is taken from the group consisting of phenyl, pyridyl,
and pyrimidyl; wherein the symbol (***) denotes the attachment to
the Y moiety of formula I; X1 is selected from the group consisting
of O, S, NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2) p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I; X3
is selected from the group consisting of NR3, --C(.dbd.O)--,
--O--(CH.sub.2)n-, --S--(CH.sub.2)n-, --NR3-(CH.sub.2).sub.n--,
--O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)q-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the either
the E1B ring or E2B ring are directly linked by a covalent bond;
and wherein the carbon atoms of --(CH2)q-, C2-C5alkenyl, and
C2-C5alkynyl moieties of X3 may be further substituted by one or
more C1-C6alkyl; X4 is selected from the group consisting of C1-C6
alkyl, C3-C6 branched alkyl; each R2 is selected from the group
consisting of monocyclic heteroaryl, C1-C6alkyl, branched
C3-C7alkyl, a R19-substituted C3-C8carbocyclyl wherein R19 is H or
C1-C6alkyl, C1-C6fluoroalkyl wherein the alkyl group is partially
or fully fluorinated, and phenyl wherein the phenyl group is
optionally substituted by one or more fluorine substituents or
chlorine; each R2' is selected from the group consisting of halogen
and R2; each R3 is independently and individually selected from the
group consisting of H, C1-C6alkyl, branched C3-C7alkyl,
C3-C7carbocyclyl, or phenyl; wherein two R3 moieties independently
and individually taken from the group consisting of C1-C6alkyl and
branched C3-C7alkyl are attached to the same nitrogen heteroatom,
the two R3 moieties may cyclize to form a C3-C7 heterocyclyl ring;
each R4 is selected from the group consisting of H, C1-C6alkyl,
hydroxyC1-C6 alkyl, dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
branched C3-C7alkyl, branched hydroxyC1-C6 alkyl, branched
C1-C6alkoxyC1-C6alkyl, branched dihydroxyC1-C6alkyl, carbocyclyl,
hydroxyl substituted carbocyclyl, alkoxy substituted carbocyclyl,
dihydroxy substituted carbocyclyl, phenyl, heteroaryl,
heterocyclyl, phenylC1-C6alkyl, heteroarylC1-C6alkyl, and
heterocyclylC1-C6alkyl; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom may cyclize to form a C3-C7
heterocyclyl ring; each R5 is independently and individually
selected from the group consisting of ##STR1414## and wherein the
symbol (##) is the point of attachment to respective R8, R10, Z4,
Z5, Z6 or A2 ring moieties containing a R5 moiety; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R5
may cyclize to form a C3-C7 heterocyclyl ring; wherein each R6 is
independently and individually selected from the group consisting
of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl, phenyl,
heteroaryl, and heterocyclyl; each R7 is selected from the group
consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl moiety
is partially or fully fluorinated, C1-C3alkyl, cyclopropyl, cyano,
or C1-C3alkoxy; each R8 is independently and individually selected
from the group consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein
the alkyl moiety is partially or fully fluorinated,
branchedC4-C7alkyl, carbocyclyl, phenyl, C1-C6phenylalkyl,
heteroaryl or heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2,
or R5; wherein two R3 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; each R13 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, carbocyclyl, hydroxyC2-C7alkyl, C1-C6alkoxyC2-C7alkyl,
(R4).sub.2N--CO, (R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.q,
R5-C2-C6alkylN(R4)-(CH.sub.2).sub.q,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.q,
R5-C2-C6alkyl-O--(CH.sub.2).sub.q, --(CH.sub.2).sub.qN(R4)C(O)R8,
aryl, arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl,
heterocyclyl, heterocyclylC1-C6alkyl, aryloxyC2-C6alkyl,
heteroaryloxyC2-C6alkyl, heterocyclyloxyC2-C6alkyl,
arylaminoC2-C6alkyl, heteroarylaminoC2-C6alkyl, and
heterocyclylaminoC2-C6alkyl; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R13 may cyclize to form a C3-C7
heterocyclyl ring; wherein Z1' is independently and individually
selected from the group consisting of H, C1-C6alkyl,
C3-C7cycloalkyl, hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4 is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR1415## ##STR1416## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I, in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; each Z7 is a substituent attached to a ring
carbon and is independently and individually selected from the
group consisting of hydroxyC2-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R6).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--CO,
(R4).sub.2N--CO, --SO.sub.2R3', SOR3, --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6,
(CH.sub.2).sub.nN(R4)C(O)N(R4).sub.2, (CH.sub.2).sub.nN(R4)C(O)R5,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR1417## cyano wherein the site of
attachment to the A2 ring is meta to the point of attachment to the
A1 ring and wherein A2 is phenyl, and cyano wherein the site of
attachment is to a substitutable position when A2 is pyridyl,
pyrimidinyl or a five-membered ring; In the foregoing definition of
Z7, alkyl moieties may optionally be substituted by one or more
C1-C6alkyl; Wherein the asterisk (*) indicates the point of
attachment of the Z1 moiety to the A2 ring; in the event that Z7
contains an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; wherein two R3 moieties
are independently and individually taken from the group consisting
of C1-C6alkyl and branched C3-C6alkyl and are attached to the same
nitrogen heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl
ring; wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl ring; and
n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v is 1 or 2; and
tautomers, diastereomers, geometric isomers, enantiomers, hydrates,
prodrugs and salts of any of the foregoing.
483. Most preferred compounds from claim 482:
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(pyri-
din-3-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(2-(m-
ethylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(8-me-
thyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(3-(-
8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(1-(3-(1H-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3-dichlo-
rophenyl)urea,
2-(3-(5-(3-(2,3-dichlorophenyl)ureido)-3-(3-fluorophenyl)-1H-pyrazol-1-yl-
)phenyl)acetic acid,
2-(3-(5-(3-(2,3-dichlorophenyl)ureido)-3-(2-fluorophenyl)-1H-pyrazol-1-yl-
)phenyl)acetic acid,
2-(4-(5-(3-(2,3-dichlorophenyl)ureido)-3-(3-fluorophenyl)-1H-pyrazol-1-yl-
)phenyl)acetic acid,
2-(4-(5-(3-(2,3-dichlorophenyl)ureido)-3-(2-fluorophenyl)-1H-pyrazol-1-yl-
)phenyl)acetic acid,
2-(4-(3-cyclopentyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)phen-
yl)acetic acid,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-(3-fluorophenyl)-1H-pyrazol-5-yl)-3-
-(2,3-dichlorophenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-(2-fluorophenyl)-1H-pyrazol-5-yl)-3-
-(2,3-dichlorophenyl)urea,
1-(2,3-dichlorophenyl)-3-(3-(2-fluorophenyl)-1-(3-(2-(2-hydroxyethylamino-
)-2-oxoethyl)phenyl)-1H-pyrazol-5-yl)urea,
1-(2,3-dichlorophenyl)-3-(1-(3-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)p-
henyl)-3-(2-fluorophenyl)-1H-pyrazol-5-yl)urea,
1-(3-t-butyl-1-(3-(2-((S)-3-hydroxypyrrolidin-1-yl)-2-oxoethyl)phenyl)-1H-
-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(2-((R)-3-(dimethylamino)pyrrolidin-1-yl)-2-oxoethyl)ph-
enyl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
1-(2,3-dichlorophenyl)-3-(1-(4-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)p-
henyl)-3-(2-fluorophenyl)-1H-pyrazol-5-yl)urea,
(R)-1-(3-t-butyl-1-(4-(2-(3-hydroxypyrrolidin-1-yl)-2-oxoethyl)phenyl)-1H-
-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
(R)-1-(3-t-butyl-1-(4-(2-(3-methoxypyrrolidin-1-yl)-2-oxoethyl)phenyl)-1H-
-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
(R)-1-(3-t-butyl-1-(4-(2-(3-(dimethylamino)pyrrolidin-1-yl)-2-oxoethyl)ph-
enyl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(2,3-dichlorophenyl)-3-(3-(2-fluorophenyl)-1-(3-(hydroxymethyl)phenyl)--
1H-pyrazol-5-yl)urea,
1-(3-cyclopentyl-1-(3-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)phenyl)-1H-
-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-cyclopentyl-1-(3-(2-(2-hydroxyethylamino)-2-oxoethyl)phenyl)-1H-pyra-
zol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(5-oxo-4,5-dihydro-1,3,4-oxadiazol-2-yl)phenyl)-1H-pyra-
zol-5-yl)-3-(2,3-dichlorophenyl)urea.
1-(1-(3-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)phenyl)-3-(2-fluoropheny-
l)-1H-pyrazol-5-yl)-3-(naphthalen-1-yl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-(2-fluorophenyl)-1H-pyrazol-5-yl)-3-
-(naphthalen-1-yl)urea,
2-(3-(3-(2-fluorophenyl)-5-(3-(naphthalen-1-yl)ureido)-1H-pyrazol-1-yl)ph-
enyl)acetic acid,
484. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 464.
485. The method of claim 484, said kinase species being activated
or unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
486. The method of claim 484, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
487. A method of modulating a kinase activity of a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing, comprising the step of
contacting said species with a compound of claim 482.
488. The method of claim 487, said species being activated or
unactivated, and the species is modulated by phosphorylation,
sulfation, fatty acid acylation, glycosylation, nitrosylation,
cystinylation, or oxidation.
489. The method of claim 487, said kinase activity selected from
the group consisting of catalysis of phospho transfer reactions,
kinase cellular localization, and recruitment of other proteins
into signaling complexes through modulation of kinase
conformation.
490. A pharmaceutical composition comprising a compound of claim
464 together with a pharmaceutically acceptable carrier.
491. The composition of claim 490 including an additive selected
from the group including adjuvants, excipients, diluents, and
stablilizers.
492. A pharmaceutical composition comprising a compound of claim
482 together with a pharmaceutically acceptable carrier.
493. The composition of claim 492 including an additive selected
from the group including adjuvants, excipients, diluents, and
stablilizers.
494. A method of treating an individual suffering from a condition
selected from the group consisting of inflammation, osteoarthritis,
respiratory diseases, stroke, systemic shock, immunological
diseases, and cardiovascular disease comprising the step of
administering to such individual a compound of claim 464.
495. The method of claim 494, said method including the step of
administering said molecule to an individual undergoing treatment
for a condition selected from the group consisting of human
inflammation, rheumatoid arthritis, rheumatoid spondylitis,
ostero-arthritis, asthma, gouty arthritis, sepsis, septic shock,
endotoxic shock, Gram-negative sepsis, toxic shock syndrome, adult
respiratory distress syndrome, stroke, reperfusion injury, neural
trauma, neural ischemia, psoriasis, restenosis, chronic pulmonary
inflammatory disease, bone resorptive diseases, graft-versus-host
reaction, Chron's disease, ulcerative colitis, inflammatory bowel
disease, pyresis, and combinations thereof.
496. The method of claim 494, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
497. A method of treating an individual suffering from a condition
selected from the group consisting of inflammation, osteoarthritis,
respiratory diseases, stroke, systemic shock, immunological
diseases, and cardiovascular disease comprising the step of
administering to such individual a compound of claim 482.
498. The method of claim 497, said method including the step of
administering said molecule to an individual undergoing treatment
for a condition selected from the group consisting of human
inflammation, rheumatoid arthritis, rheumatoid spondylitis,
ostero-arthritis, asthma, gouty arthritis, sepsis, septic shock,
endotoxic shock, Gram-negative sepsis, toxic shock syndrome, adult
respiratory distress syndrome, stroke, reperfusion injury, neural
trauma, neural ischemia, psoriasis, restenosis, chronic pulmonary
inflammatory disease, bone resorptive diseases, graft-versus-host
reaction, Chron's disease, ulcerative colitis, inflammatory bowel
disease, pyresis, and combinations thereof.
499. The method of claim 497, said compound being administered by a
method selected from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
500. An adduct comprising a compound of claim 464 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
501. An adduct comprising a compound of claim 482 bound with a
species of a wild-type kinase, oncogenic forms thereof, aberrant
fusion proteins thereof and polymorphs of any of the foregoing.
502. The method of claims 21, 22, 23, 24, 25, or 26, wherein the
kinase is abl kinase, bcr-abl kinase, or disease polymorphs
thereof.
503. An adduct of claims 37 or 38, wherein the kinase is abl
kinase, bcr-abl kinase, or disease polymorphs thereof.
504. The method of claims 76, 77, 78, 79, 80, or 81, wherein the
kinase is abl kinase, bcr-abl kinase, or disease polymorphs
thereof.
505. An adduct of claims 92 or 93, wherein the kinase is abl
kinase, bcr-abl kinase, or disease polymorphs thereof.
506. The method of claims 356, 357, 358, 359, 360, or 361, wherein
the kinase is abl kinase, bcr-abl kinase, or disease polymorphs
thereof.
507. An adduct of claims 372 or 373, wherein the kinase is abl
kinase, bcr-abl kinase, or disease polymorphs thereof.
508. The method of claims 128, 129, 130, 131, 132, or 133, wherein
the kinase is VEGFR-2 kinase or disease polymorphs thereof.
509. An adduct of claims 144 or 145, wherein the kinase is VEGFR-2
kinase or disease polymorphs thereof.
510. The method of claims 166, 167, 168, 169, 170, or 171, wherein
the kinase is VEGFR-2 kinase or disease polymorphs thereof.
511. An adduct of claims 182 or 183, wherein the kinase is VEGFR-2
kinase or disease polymorphs thereof.
512. The method of claims 408, 409, 410, 411, 412, or 413, wherein
the kinase is VEGFR-2 kinase or disease polymorphs thereof.
513. An adduct of claims 424 or 425, wherein the kinase is VEGFR-2
kinase or disease polymorphs thereof.
514. The method of claims 204, 205, 206, 207, 208, or 209, wherein
the kinase is B-raf 5 kinase, Valine599Glutamic acid mutated B-raf
kinase, C-raf kinase or disease polymorphs of any of the
foregoing.
515. An adduct of claims 220 or 221, wherein the kinase is B-raf
kinase, Valine599Glutamic acid mutated B-raf kinase, C-raf kinase
or disease polymorphs of any of the foregoing.
516. The method of claims 242, 243, 244, 245, 246, or 247, wherein
the kinase is B-raf kinase, Valine599Glutamic acid mutated B-raf
kinase, C-raf kinase or disease polymorphs of any of the
foregoing.
517. An adduct of claims 258 or 259, wherein the kinase is B-raf
kinase, Valine599Glutamic acid mutated B-raf kinase, C-raf kinase
or disease polymorphs of any of the foregoing.
518. The method of claims 446, 447, 448, 449, 450, or 451, wherein
the kinase is B-raf kinase, Valine599Glutamic acid mutated B-raf
kinase, C-raf kinase or disease polymorphs of any of the
foregoing.
519. An adduct of claims 462 or 463, wherein the kinase is B-raf
kinase, Valine599Glutamic acid mutated B-raf kinase, C-raf kinase
or disease polymorphs of any of the foregoing.
520. The method of claims 280, 281, 282, 283, 284, or 285, wherein
the kinase is p-38 alpha kinase or disease polymorphs thereof.
521. An adduct of claims 296 or 297, wherein the kinase is wherein
the kinase is p-38 alpha kinase or disease polymorphs thereof.
522. The method of claims 318, 319, 320, 321, 322, or 323, wherein
the kinase is p-38 alpha kinase or disease polymorphs thereof.
523. An adduct of claims 334 or 335, wherein the kinase is wherein
the kinase is p-38 alpha kinase or disease polymorphs thereof.
524. The method of claims 484, 485, 486, 487, 488, or 489, wherein
the kinase is p-38 alpha kinase or disease polymorphs thereof.
525. An adduct of claims 500 or 501, wherein the kinase is wherein
the kinase is p-38 alpha kinase or disease polymorphs thereof.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application claims the benefit of: (1) Provisional
Application Ser. No. 60/639,087 filed Dec. 23, 2004; (2)
Provisional Application Ser. No. 60/638,986, filed Dec. 23, 2004;
(3) Provisional Application Ser. No. 60/638,987, filed Dec. 23,
2004; (4) Provisional Application Ser. No. 60/638,968, filed Dec.
23, 2004; These four provisional applications are incorporated by
reference herein.
Enzyme Modulators for Treatment of Cancers and Hyperproliferative
Diseases
FIELD OF THE INVENTION
[0002] The present invention relates to novel kinase inhibitors and
modulator compounds useful for the treatment of various diseases.
More particularly, the invention is concerned with such compounds,
kinase/compound adducts, methods of treating diseases, and methods
of synthesis of the compounds. Preferrably, the compounds are
useful for the modulation of kinase activity of C-Abl, c-Kit,
VEGFR, PDGFR, Raf and P38 kinases and disease polymorphs
thereof.
BACKGROUND OF THE INVENTION
[0003] Several members of the protein kinase family have been
clearly implicated in the pathogenesis of various proliferative
diseases and thus represent important targets for treatment of
these diseases. Some of the proliferative diseases relevant to this
invention include cancer, rheumatoid arthritis, atherosclerosis,
and retinopathies. Important examples of kinases which have been
shown to cause or contribute to the pathogensis of these diseases
include C-Abl kinase and the oncogenic fusion protein BCR-Abl
kinase; PDGF receptor kinase; VEGF receptor kinases; MAP kinase
p38.alpha.; and the RAF kinase family.
[0004] C-Abl kinase is an important non-receptor tyrosine kinase
involved in cell signal transduction. This ubiquitously expressed
kinase--upon activation by upstream signaling factors including
growth factors, oxidative stress, integrin stimulation, and
ionizing radiation--localizes to the cell plasma membrane, the cell
nucleus, and other cellular compartments including the actin
cytoskeleton (Van Etten, Trends Cell Biol. (1999) 9: 179). There
are two normal isoforms of Abl kinase: Abl-1A and Abl-1B. The
N-terminal half of c-Abl kinase is important for autoinhibition of
the kinase domain catalytic activity (Pluk et al, Cell (2002) 108:
247). Details of the mechanistic aspects of this autoinhibition
have recently been disclosed (Nagar et al, Cell (2003) 112: 859).
The N-terminal myristolyl amino acid residue of Abl-1B has been
shown to intramolecularly occupy a hydrophobic pocket formed from
alpha-helices in the C-lobe of the kinase domain. Such
intramolecular binding induces a novel binding area for
intramolecular docking of the SH2 domain and the SH3 domain onto
the kinase domain, thereby distorting and inhibiting the catalytic
activity of the kinase. Thus, an intricate intramolecular negative
regulation of the kinase activity is brought about by these
N-terminal regions of c-Abl kinase. An aberrant dysregulated form
of c-Abl is formed from a chromosomal translocation event, referred
to as the Philadelphia chromosome (P. C. Nowell et al, Science
(1960) 132: 1497; J. D. Rowley, Nature (1973) 243: 290). This
abnormal chromosomal translocation leads aberrant gene fusion
between the Abl kinase gene and the breakpoint cluster region (BCR)
gene, thus encoding an aberrant protein called Bcr-Abl (G. Q. Daley
et al, Science (1990) 247: 824; M. L. Gishizky et al, Proc. Natl.
Acad. Sci. USA (1993) 90: 3755; S. Li et al, J. Exp. Med. (1999)
189: 1399). the Bcr-Abl fusion protein does not include the
regulatory myristolylation site (B. Nagar et al, Cell (2003) 112:
859) and as a result functions as an oncoprotein which causes
chronic myeloid leukemia (CML). CML is a malignancy of pluripotent
hematopoietic stem cells. The p210 form of Bcr-Abl is seen in 95%
of patients with CML, and in 20% of patients with acute lymphocytic
leukemia. A p185 form has also been disclosed and has been linked
to being causative of up to 10% of patients with acute lymphocytic
leukemia.
[0005] Growth factor receptor kinases contribute to the growth and
metastasis of tumors by stimulating the proliferation of
endothelial cells, fibroblasts, smooth muscle cells, and matrix
proteins. Conditions such as hypoxia can induce tumor cells to
secrete growth factors which subsequently result in the growth of
new blood vessels to support the tumor. These growth factors
include platelet derived growth factor (PDGF) and transforming
growth factor-beta (TGF-beta), which subsequently stimulate
secretion of other growth factors including vascular endothelial
growth factor (VEGF), fibroblast growth factor, and epidermal
growth factor (EGF). The formation of new blood vessels, which is
known as angiogenesis, also provides the tumor with a route to
metastasize to remote secondary sites. Inhibiting angiogenic
factors that support stromal growth has been proposed as a useful
therapy for treating cancers (R. M. Shaheen et al, Cancer Research
(1999) 59: 5412; R. M. Shaheen et al, Cancer Research (2001) 61:
1464). Mutations of the PGDF receptor have also been identified
which constituitively active in absence of growth factor. VEGF can
also stimulate the formation of new lymphatic vessels through
direct action on the so-called VEGF-3 receptor, providing yet
another pathway for tumor metastasis. Among the three known VEGF
receptors, in particular the so-called VEGFR2 (otherwise known as
the kinase insert domain-containing receptor tyrosine kinase or
KDR) has been demonstrated to be responsible for the role of VEGF
in tumor angiogenesis.
[0006] A major signaling pathway downstream of cell surface growth
factor receptor activation is the Ras-RAF-MEK-ERK-MAP kinase
pathway (Peyssonnaux, C. et al, Biol. Cell (2001) 93: 53-62,
Cancers arise when mutations occur in one or more of the proteins
involved in this signaling cascade. Cell proliferation and
differentiation become dysregulated and cell survival mechanisms
are activated which allow unregulated cancer cells to override
protective programmed cell death surveillance. Mutations in the
p21-Ras protein have been shown to be a major cause of
dysregulation of this signaling pathway, leading to the development
of human cancers. P21-Ras mutations have been identified in
approximately 30% of human cancers (Bolton et al, Ann. Rep. Med.
Chem. (1994) 29: 165-174). Cancer-causing mutations in the P21-Ras
protein lead to a constituitively active signaling cascade, causing
unregulated activation of the downstream components of the
RAF-MEK-ERK-MAP kinase pathway (Magnuson et al., Semin. Cancer
Biol. (1994) .delta.: 247-253). The three RAF kinases which
participate in this signaling cascade are known as ARAF, BRAF, and
CRAF (Peyssonnaux, C. et al, Biol. Cell (2001) 93: 53-62; Avruch,
J., Recent Prog. Horm. Res. (2001) 56: 127-155; Kolch, W., Biochem.
J. (2000) 351: 289-305). These RAF kinase isoforms are all
activated by Ras, and thus are activated in cancers that result
from mutated and upregulated p21-Ras protein activity. In addition
to activation of this signaling cascade at the initial p21-Ras
protein level, mutations have also been found in BRAF kinase which
results in activation of the cascade downstream from p21-Ras
(Davies, H., et al, Nature (2002) 417: 949-954). A dominant single
site mutation at position 599 in the BRAF kinase was shown to be
particularly aggressive and linked to approximately 80% of the
observed human malignant melanomas. This mutation substitutes the
negatively charged amino acid glutamic acid for the normally
occurring neutral amino acid valine. This single site mutation is
sufficient to render the mutated BRAF kinase constituitively
active, resulting in signaling pathway dysregulation and human
cancer. Hence small molecule inhibitors of BRAF kinase are a
rational approach to the treatment of human malignancy, whether the
signaling mutation is at the level of the upstream p21-Ras protein
or at the level of BRAF kinase.
[0007] The MAP kinase p38.alpha. has recently been identified as an
important mechanistic target for the treatment of inflammatory
diseases. Inhibition of the MAP kinase p38-alpha has been
demonstrated to result in the suppression the production and
release the proinflammatory mediators TNF-alpha, IL-1 beta, IL-6,
IL-8 and other proinflammatory cytokines (Chen, Z. et al, Chem.
Rev. (2001) 101: 2449). Recently, p38-alpha kinase has been
implicated in the regulation of tissue factor expression in
monocytes, suggesting a role for inhibition of p38-alpha kinase in
the treatment of thrombotic disorders and atherosclerosis (Chu, A.
J., et al. J. Surg. Res. (2001) 101: 85-90; Eto, M., et al,
Circulation (2002) 105: 1756-1759). The p38-alpha kinase has also
been shown to be involved in thrombin-induced proinflammatory
conditions (V. Marin, et al, Blood, Aug. 1, 2001, 98: 667-673).
Validation of this approach has been achieved by the successful
application of various protein therapeutic agents for the treatment
of severe chronic inflammatory disease. Monoclonal antibodies to
TNF have shown effectiveness in the treatment of rheumatoid
arthritis, ulcerative colitis, and Crohn's disease (Rankin, E. C.
C., et al, British J. Rheum. (1997) 35: 334-342; Stack, W. A., et
al. Lancet (1997) 349: 521-524). Enbrel (etanercept), a soluble TNF
receptor, has been developed by Immunex, Inc., and marketed
currently by Amgen for the treatment of rheumatoid arthritis
(Brower et al, Nature Biotechnology (1997) 15: 1240; Pugsley, M.
K., Curr. Opin. Invest. Drugs (2001) 2: 1725). Ro 45-2081, a
recombinant soluble TNF-alpha receptor chimeric protein, has also
shown effectiveness in the treatment of the acute phase of lung
injury and in animal models of allergic lung disease (Renzetti, et
al, Inflamm Res. (1997) 46: S143). Remicade (infliximab) is a
monoclonal TNF-alpha antibody that has shown effectiveness in the
treatment of rheumatoid arthritis and Crohn's disease (Bondeson, J.
et al, Int. J. Clin. Pract. (2001) 55: 211).
[0008] Importantly, small molecule inhibitors of kinase activity
have been shown to produce therapeutic benefit as anticipated. The
most important example thus far is Gleevec (Imatinib), which is an
inhibitor of BCR-Abl kinase (J. Zimmermann et al, WO 99/03854; N.
von Bubnoff et al, Cancer Research (2003) 63: 6395; B. J. Druker et
al, Nature Medicine (1996) 2: 561; J. Zimmermann et al, Bioorganic
and Medicinal Chemistry Letters (1997) 7: 187). Gleevec has been
shown to produce clinical remissions in CML patients. However,
resistance to the effects of Gleevec have often been encountered
(M. E. Gorre et al, Science (2001) 293: 876). Over 17 mutations of
Bcr-Abl kinase have been associated with Gleevec resistance (N. von
Bubnoff et al, Lancet (2002) 359: 487; S. Branford et al, Blood
(2002) 99: 3472; C. Roche-Lestienne et al, Blood (2002) 100: 1014;
N. P. Shah et al, Cancer Cell (2002) 2: 117; A. Hochhaus et al,
Leukemia (2002) 16: 2190; H. K. Al-Ali et al, Hematology (2004) 5:
55). These mutations are primarily found in the kinase active site
domain of Bcr-Abl, and frequently occur in regions proximal to the
ATP binding pocket. ##STR1##
[0009] The majority of small molecule kinase inhibitors that have
been reported have been shown to bind in one of three ways. Most of
the reported inhibitors interact with the ATP binding domain of the
active site and exert their effects by competing with ATP for
occupancy. Other inhibitors have been shown to bind to a separate
hydrophobic region of the protein known as the
"DFG-in-conformation" pocket, and still others have been shown to
bind to both the ATP domain and the "DFG-in-conformation" pocket.
Examples specific to inhibitors of RAF kinases can be found in
Lowinger et al, Current Pharmaceutical Design (2002) 8: 2269-2278;
Dumas, J. et al., Current Opinion in Drug Discovery &
Development (2004) 7: 600-616; Dumas, J. et al, WO 2003068223 A1
(2003); Dumas, J., et al, WO 9932455 A1 (1999), and Wan, P. T.,
Cell (2004) 116: 855-867
[0010] Physiologically, kinases are regulated by a common
activation/deactivation mechanism wherein a specific activation
loop sequence of the kinase protein binds into a specific pocket on
the same protein which is referred to as the switch control pocket.
Such binding occurs when specific amino acid residues of the
activation loop are modified for example by phosphorylation,
oxidation, or nitrosylation. The binding of the activation loop
into the switch pocket results in a conformational change of the
protein into its active form (Huse, M. and Kuriyan, J. Cell (109)
275-282.)
SUMMARY OF THE INVENTION
[0011] The present invention describes novel potent and selective
inhibitors of CAbl kinase, VEGFR2/KDR kinase, and BRAF kinase. The
compounds of this invention inhibit kinase activity in a novel way
by binding into the "switch pocket" remote from the ATP-cofactor
pocket with or without concomitant binding into the
"DFG-in-conformation" pocket. X-ray structures determined from
small molecule/BRAF co-crystals have confirmed this novel mode of
binding to the kinase by the compounds of this present invention,
and illustrate the novel features of this binding mode when
compared to inhibitors which anchor or bind into the ATP pocket of
BRAF kinase. The novel inhibitors of the present invention in some
cases also exhibit a preference for inhibiting the oncogenic mutant
form of a kinase (V599E-BRAF) and a sparing of normal wild-type
kinase that lack the cancer-causing mutation, wherein the oncogenic
mutation is a modification of a critical binding amino acid residue
of the switch control pocket. An example of this profile has been
identified for BRAF, wherein mutation of the valine 599 residue to
a glutamic acid residue results in an oncogenic form of BRAF and
for which it has been found that compounds of this invention
inhibit the oncogenic mutant form of BRAF but not the wild type
BRAF. This desirable feature of inhibitor selectivity enables the
use of a BRAF inhibitor to treat mammalian cancer caused by mutant
V559E BRAF kinase, while sparing the normal wildtype BRAF kinase
present in non-cancerous cells. Enhanced safety and selectivity
realized from this "wild-type kinase-sparing" provides safer
inhibitors that target the cancer-causing forms of BRAF kinase.
[0012] FIGS. 1 and 2 further illustrates the novel binding
interaction for the compounds of this invention with kinases. In
FIG. 1, the known interactions of kinase inhibitors reported
previously are defined as directed to a combination of the ATP
binding domain, an adjacent binding area known as the ATP binding
domain hinge region, and in some cases a third domain known as the
"DFG-in conformation" kinase pocket.
[0013] The binding modality of the compounds of this invention is
illustrated in FIG. 2. The unique feature is the necessary
engagement of another binding domain within the kinase referred to
as the switch pocket. Compounds of this invention uniquely and
necessarily bind within the switch pocket, and optionally the
"DFG-in conformation" domain, and optionally to the ATP binding
domain hinge region. This unique binding modality confers upon
compounds of this invention a novel mechanism to modulate kinase
activity as well as significant advantages over previously
described kinase inhibitors in achieving a therapeutically
important degree of selectivity for the preferred target over
inhibitors which occupy the ATP binding domain. The novel binding
modality of the compounds of this invention also avoids mutations
within the ATP binding domain which commonly confer resistance to
inhibition by compounds which require interaction with the ATP
binding domain.
[0014] Compounds of the present invention find utility in the
treatment of mammalian cancers and especially human cancers
including but not limited to malignant melanoma, colorectal cancer,
ovarian cancer, papillary thyroid carcinoma, non small cell lung
cancer, and mesothelioma. Compounds of the present invention also
find utility in the treatment of rheumatoid arthritis and
retinopathies including diabetic retinal neuropathy and macular
degeneration.
BRIEF DESCRIPTION OF THE DRAWING
[0015] FIG. 1 is an illustration of the kinase binding domains of
known kinase inhibitors; and
[0016] FIG. 2 is an illustration of the binding modality of
compounds of the present invention to kinases.
DESCRIPTION OF THE PREFERRED EMBODIMENTS
[0017] The following descriptions refer to various compounds and
moieties thereof. Generally, the following definitions apply to
these descriptions, with the understanding that in some instances
the descriptions are further limited. However, as broadly defined,
the following definitions apply.
[0018] Carbocyclyl refers to monocyclic saturated carbon rings
taken from cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, and
cycloheptanyl;
[0019] Aryl refers to monocyclic or fused bicyclic ring systems
characterized by delocalized .pi. electrons (aromaticity) shared
among the ring carbon atoms of at least one carbocyclic ring;
preferred aryl rings are taken from phenyl, naphthyl,
tetrahydronaphthyl, indenyl, and indanyl;
[0020] Heteroaryl refers to monocyclic or fused bicyclic ring
systems characterized by delocalized .pi. electrons (aromaticity)
shared among the ring carbon or heteroatoms including nitrogen,
oxygen, or sulfur of at least one carbocyclic or heterocyclic ring;
heteroaryl rings are taken from, but not limited to, pyrrolyl,
furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl,
imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl,
tetrazolyl, pyridinyl, pyrimidinyl, pyrazinyl, pyridazinyl,
triazinyl, indolyl, isoindolyl, isoindolinyl, indazolyl,
benzofuranyl, benzothienyl, benzothiazolyl, benzothiazolonyl,
benzoxazolyl, benzoxazolonyl, benzisoxazolyl, benzisothiazolyl,
benzimidazolyl, benzimidazolonyl, benztriazolyl, imidazopyridinyl,
dihydropurinonyl, pyrrolopyrimidinyl, purinyl, pyrazolopyridinyl,
pyrazolopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, or
benzoxazepinyl;
[0021] Heterocyclyl refers to monocyclic rings containing carbon
and heteroatoms taken from oxygen, nitrogen, or sulfur and wherein
there is not delocalized .pi. electrons (aromaticity) shared among
the ring carbon or heteroatoms; heterocyclyl rings include, but are
not limited to, oxetanyl, azetadinyl, tetrahydrofuranyl,
pyrrolidinyl, oxazolinyl, oxazolidinyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, piperazinyl, azepinyl, oxepinyl, diazepinyl,
tropanyl, homotropanyl;
[0022] Poly-aryl refers to two or more monocyclic or fused bicyclic
ring systems characterized by delocalized .pi. electrons
(aromaticity) shared among the ring carbon atoms of at least one
carbocyclic ring wherein the rings contained therein are optionally
linked together.
[0023] Poly-heteroaryl refers to two or more monocyclic or fused
bicyclic systems characterized by delocalized .pi. electrons
(aromaticity) shared among the ring carbon or heteroatoms including
nitrogen, oxygen, or sulfur of at least one carbocyclic or
heterocyclic ring wherein the rings contained therein are
optionally linked together, wherein at least one of the monocyclic
or fused bicyclic rings of the poly-heteroaryl system is taken from
heteroaryl as defined broadly above and the other rings are taken
from either aryl, heteroaryl, or heterocyclyl as defined broadly
above;
[0024] Poly-heterocyclyl refers to two or more monocyclic or fused
bicyclic ring systems containing carbon and heteroatoms taken from
oxygen, nitrogen, or sulfur and wherein there is not delocalized
.pi. electrons (aromaticity) shared among the ring carbon or
heteroatoms wherein the rings contained therein are optionally
linked, wherein at least one of the monocyclic or fused bicyclic
rings of the poly-heteroaryl system is taken from heterocyclyl as
defined broadly above and the other rings are taken from either
aryl, heteroaryl, or heterocyclyl as defined broadly above;
[0025] Lower alkyl refers to straight or branched chain
C1-C6alkyls;
[0026] Substituted in connection with a moiety refers to the fact
that a further substituent may be attached to the moiety to any
acceptable location on the moiety.
[0027] The term salts embraces pharmaceutically acceptable salts
commonly used to form alkali metal salts and to form addition salts
of free acids or free bases. The nature of the salt is not
critical, provided that it is pharmaceutically-acceptable. Suitable
pharmaceutically-acceptable acid addition salts may be prepared
from an inorganic acid or from an organic acid. Examples of such
inorganic acids are hydrochloric, hydrobromic, hydroiodic, nitric,
carbonic, sulfuric and phosphoric acid. Appropriate organic acids
may be selected from aliphatic, cycloaliphatic, aromatic,
araliphatic, heterocyclyl, carboxylic and sulfonic classes of
organic acids, example of which are formic, acetic, propionic,
succinic, glycolic, gluconic, lactic, malic, tartaric, citric,
ascorbic, glucuronic, maleic, fumaric, pyruvic, aspartic, glutamic,
benzoic, anthranilic, mesylic, stearic, salicylic,
p-hydroxybenzoic, phenylacetic, mandelic, embonic (pamoic),
methanesulfonic, ethanesulfonic, benzenesulfonic, pantothenic,
toluenesulfonic, 2-hydroxyethanesulfonic, sulfanilic,
cyclohexylaminosulfonic, algenic, (3-hydroxybutyric, galactaric and
galacturonic acid. Suitable pharmaceutically-acceptable base
addition salts of compounds of Formula I include metallic salts and
organic salts. More preferred metallic salts include, but are not
limited to appropriate alkali metal (group Ia) salts, alkaline
earth metal (group IIa) salts and other physiological acceptable
metals. Such salts can be made from aluminum, calcium, lithium,
magnesium, potassium, sodium and zinc. Preferred organic salts can
be made from tertiary amines and quaternary ammonium salts,
including in part, tromethamine, diethylamine,
N,N'-dibenzylethylenediamine, chloroprocaine, choline,
diethanolamine, ethylenediamine, meglumine (N-methylglucamine) and
procaine.
[0028] The term prodrug refers to derivatives of active compounds
which revert in vivo into the active form. For example, a
carboxylic acid form of an active drug may be esterified to create
a prodrug, and the ester is subsequently converted in vivo to
revert to the carboxylic acid form. See Ettmayer et. al, J. Med.
Chem, 2004, 47(10), 2393-2404 and Lorenzi et. al, J. Pharm. Exp.
Therpeutics, 2005, 883-8900 for reviews.
Protein Definitions
[0029] PGDF refers to platelet-derived growth factor; PGDFR refers
to platelet-derived growth factor receptor; VEGF refers to vascular
endothelial growth factor; VEGFR refers to vascular endothelial
growth factor receptor; MAP kinase refers to mitogen-activated
protein kinase; BCR refers to breakpoint cluster region; CML refers
to chronic myeloid leukemia; TGF-beta refers to transforming growth
factor beta; EGF refers to epidermal growth factor; KDR refers to
kinase insert domain-containing receptor; TNF refers to tumor
necrosis factor; ATP refers to adenosine triphosphate;
DFG-in-conformation refers to the tripeptide sequence
aspartylphenylalanylglycyl in the kinase protein sequence; V599E
refers to the mutational replacement of valine 599 of BRAF kinase
by glutamic acid; FGFR refers to fibroblast growth factor receptor;
TrkA refers to tyrosine receptor kinase type A and neurotrophic
tyrosine kinase type 1 (NTRK1); TrkB refers to tyrosine receptor
kinase type B and neurotrophic tyrosine kinase type 2 (NTRK2);
EPHA1, EPHA2, EPHA3, EPHA4, EPHA5, EPHA6, EPHA7, EPHA8, EPHA9,
EPHA10, EPHB1, EPHB2, EPHB3, EPHB4, EPHB5, EPHB6, EPHB7, and EPHB8
refers to members of the ephrin receptor subfamily of the receptor
tyrosine kinases.
1. First Aspect of the Invention --C-Abl Kinase Modulator
Compounds, Methods, Preparations and Adducts
1.1 Generally--A2 Bicyclic Compounds
[0030] The invention includes compounds of the formula ##STR2##
wherein A2 is selected from the group consisting of bicyclic fused
aryl, bicyclic fused heteroaryl, and bicyclic fused heterocyclyl
rings, each A2 moiety presenting a proximal ring bonded with A1 and
a distal ring attached to the proximal ring, and either the distal
ring has a heteroatom in the ring structure thereof and/or the
distal ring has Z2 or Z3 substituents; A1 is selected from the
group consisting of R2' and R7-substituted phenyl, pyridyl, or
pyrimidinyl, R2-substituted monocyclic 5-membered ring heteroaryl,
and R2'-substituted monocyclic heterocyclyl moieties; W and Y are
CHR4, NR3, or O and wherein W and Y are not simultaneously O; X is
O, S, or NR3; D comprises a member of the group consisting of Z5-
or Z6-substituted mono- and poly-aryl, of Z5- or Z6-substituted
mono- and poly-heteroaryl, of Z5- or Z6-substituted mono- and
poly-heterocyclyl, of Z5- or Z6-substituted mono- and
poly-arylalkyl, of Z5- or Z6-substituted mono- and poly-aryl
branched alkyl, of Z5- or Z6-substituted mono- and
poly-heteroarylalkyl, of Z5- or Z6-substituted mono- and
poly-heteroaryl branched alkyl, of Z5- or Z6-substituted mono- and
poly-heterocyclylalkyl, of Z5- or Z6-substituted mono- and
poly-heterocyclyl branched alkyl, alkyl, and carbocyclyl moieties;
each Z2 is independently and individually selected from the group
consisting of hydroxyl, hydroxyC1-C6alkyl, cyano, (R3).sub.2N--,
(R4).sub.2N--, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl, carboxyl,
carboxyC1-C6alkyl, C1-C6alkoxycarbonyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2,
(R4).sub.2NSO.sub.2, --SO.sub.2R5-, --(CH.sub.2).sub.nN(R4)C(O)R8,
.dbd.O, .dbd.NOH, .dbd.N(OR6), heteroarylC1-C6alkyl,
heterocyclylC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, heterocyclylaminoC1-C6alkyl, or moieties
of the formulae ##STR3## wherein the symbol (#) indicates the point
of attachment of the Z2 moiety to the A2 ring of formula I; in the
event that Z2 contains an alkyl or alkylene moiety, such moieties
may be further substituted with one or more C1-C6alkyls; wherein
two R3 moieties are independently and individually taken from the
group consisting of C1-C6alkyl and branched C3-C6alkyl and are
attached to the same nitrogen heteroatom of Z2 may cyclize to form
a C3-C7 heterocyclyl ring; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z2 may cyclize to form a C3-C7
heterocyclyl ring; each Z3 is independently and individually
selected from the group consisting of H, C1-C6alkyl, hydroxyl,
hydroxyC1-C6alkyl, cyano, C1-C6alkoxy, C1-C6alkoxyC1-C6alkyl,
halogen, CF.sub.3, (R3).sub.2N--, (R4).sub.2N--,
(R4).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, --R8C(.dbd.O)--,
(R4).sub.2N--CO--C1-C6alkyl, carboxyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R3).sub.2NSO.sub.2, --SO.sub.2R3, SOR3, (R4).sub.2NSO.sub.2,
--SO.sub.2R4, --SOR4, --(CH.sub.2).sub.nN(R4)C(O)R8,
--C.dbd.(NOH)R6, --C.dbd.(NOR3)R6, heteroaryl, heterocyclyl,
heteroarylC1-C6alkyl, heterocyclylC1-C6alkyl, heteroaryloxy,
heterocyclyloxy, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylamino, heteroarylamino,
heterocyclylamino, arylaminoC1-C6alkyl, heteroarylaminoC1-C6alkyl,
heterocyclylaminoC1-C6alkyl, or moieties of the formulae ##STR4##
wherein the symbol (#) indicates the point of attachment of the Z3
moiety to the A2 ring of formula I; in the event that Z3 contains
an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; wherein two R3 moieties
are independently and individually taken from the group consisting
of C1-C6alkyl and branched C3-C6alkyl and are attached to the same
nitrogen heteroatom of Z3 may cyclize to form a C3-C7 heterocyclyl
ring; wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z3 may cyclize to form a C3-C7 heterocyclyl ring;
each Z5 is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; each R2 is selected from the group consisting of
alkyl, branched alkyl, fluoroalkyl, wherein the alkyl group is
partially or fully fluorinated, and R19 substituted
C3-C8carbocyclyl wherein R19 is H and C1-C6alkyl; each R2' is
selected from the group consisting of halogen and R2; each R3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl;
each R4 is selected from the group consisting of H, C1-C6alkyl,
hydroxyC1-C6 alkyl, dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
branched C3-C7alkyl, branched hydroxyC1-C6 alkyl, branched
C1-C6alkoxyC1-C6alkyl, branched dihydroxyC1-C6alkyl, carbocyclyl,
hydroxyl substituted carbocyclyl, alkoxy substituted carbocyclyl,
dihydroxy substituted carbocyclyl, phenyl, heteroaryl,
heterocyclyl, phenylC1-C6alkyl, heteroarylC1-C6alkyl, and
heterocyclylC1-C6alkyl; each R5 is independently and individually
selected from the group consisting of ##STR5## and wherein the
symbol (##) is the point of attachment to respective R8, R10, Z2,
or Z3, moieties containing a R5 moiety; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of R5 may cyclize to
form a C3-C7 heterocyclyl ring; each R6 is independently and
individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, phenyl, heteroaryl, and
heterocyclyl; each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or C1-C3alkoxy;
each R8 is independently and individually selected from the group
consisting of C1-C6alkyl, branched C3-C7alkyl, fluoroalkyl wherein
the alkyl moiety is partially or fully fluorinated, carbocyclyl,
phenyl, C1-C6phenylalkyl, heteroaryl or heteroarylC1-C6alkyl,
heterocyclyl, heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2,
N(R4).sub.2, or R5; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of R8 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of R8 may cyclize to form a C3-C7 heterocyclyl ring;
each R10 is independently and individually selected from the group
consisting of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH,
C1-C6alkoxy, --N(R4).sub.2; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1;
and tautomers, diastereomers, geometric isomers, enantiomers,
hydrates, prodrugs and salts of any of the foregoing. 1.1.1
Preferred D Moieties 1.1.1a
[0031] Preferrably, the compounds of formula I above contain D
moieties of the formula ##STR6## wherein E1 is selected from the
group consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl;
wherein the symbol (***) is the point of attachment to the Y group
of formula I; X1 is selected from the group consisting of O, S,
NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I; and
wherein the carbon atoms of --(CH.sub.2)n-, --(CH.sub.2)q-,
--(CH.sub.2)p-, C2-C5alkenyl, and C2-C5alkynyl of X2 can be further
substituted by one or more C1-C6alkyl; and E2 is selected from the
group comprising cyclopentyl, cyclohexyl, phenyl, naphthyl,
pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
triazolyl, tetrazolyl, pyridinyl, pyrimidinyl, pyrazinyl,
pyridazinyl, triazinyl, fused bicyclic rings selected from the
group comprising indolyl, isoindolyl, isoindolinyl, isoindolonyl,
indazolyl, benzofuranyl, benzothienyl, benzothiazolyl,
benzothiazolonyl, benzoxazolyl, benzoxazolonyl, benzisoxazolyl,
benzisothiazolyl, benzimidazolyl, benzimidazolonyl, benztriazolyl,
imidazopyridinyl, imidazopyrimidinyl, imidazolonopyrimidinyl,
dihydropurinonyl, pyrrolopyrimidinyl, purinyl, pyrazolopyridinyl,
pyrazolopyrimidinyl, isoxazolopyrimidinyl, isothiazolopyrimidinyl,
furylopyrimidinyl, thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl,
non-fused bicyclic rings comprising pyridylpyridiminyl
pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl,
imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl; and n is 0-4; p
is 1-4; q is 2-6. 1.1.1b
[0032] Additional preferred D moieties comprise carbocyclyls and a
moiety of the formula ##STR7## X2 is selected from the group
consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct bond
wherein E2 is directly linked to the Y group of formula I.
1.1.1c
[0033] More preferred D moieties from 1.1.1b comprise the compounds
of Formula III wherein the E2 ring is selected from the group
comprising cyclopentyl, cyclohexyl, phenyl, naphthyl, pyrrolyl,
furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl,
imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl,
tetrazolyl, pyridinyl, pyrimidinyl, pyrazinyl, pyridazinyl,
triazinyl, fused bicyclic rings selected from the group comprising
indolyl, isoindolyl, isoindolinyl, isoindolonyl, indazolyl,
benzofuranyl, benzothienyl, benzothiazolyl, benzothiazolonyl,
benzoxazolyl, benzoxazolonyl, benzisoxazolyl, benzisothiazolyl,
benzimidazolyl, benzimidazolonyl, benztriazolyl, imidazopyridinyl,
imidazopyrimidinyl, imidazolonopyrimidinyl, dihydropurinonyl,
pyrrolopyrimidinyl, purinyl, pyrazolopyridinyl,
pyrazolopyrimidinyl, isoxazolopyrimidinyl, isothiazolopyrimidinyl,
furylopyrimidinyl, thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl,
non-fused bicyclic rings comprising pyridylpyridiminyl
pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl,
imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl.
1.1.2 Preferred A2 Moieties
1.1.2a
[0034] Preferred A2 moieties of Formula I are selected from the
group consisting of ##STR8## ##STR9## ##STR10## ##STR11## ##STR12##
and wherein the symbol (**) is the point of attachment to the A1
ring of formula I; and wherein indicates either a saturated or an
unsaturated bond; wherein each Z3 and Z5 may be independently
attached to either of the rings making up the foregoing bicyclic
structures; each R9 is independently and individually selected from
the group consisting of H, F, C1-C6alkyl, branched C4-C7alkyl,
carbocyclyl, phenyl, phenyl C1-C6alkyl, heterocyclyl and
heterocyclylC1-C6alkyl; each R13 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, carbocyclyl, hydroxyC2-C7alkyl, C1-C6alkoxyC2-C7alkyl,
(R4).sub.2N--CO, (R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.q,
R5-C2-C6alkylN(R4)-(CH.sub.2).sub.q,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.q,
R5-C2-C6alkyl-O--(CH.sub.2).sub.q, --(CH.sub.2).sub.qN(R4)C(O)R8,
aryl, arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl,
heterocyclyl, heterocyclylC1-C6alkyl, aryloxyC2-C6alkyl,
heteroaryloxyC2-C6alkyl, heterocyclyloxyC2-C6alkyl,
arylaminoC2-C6alkyl, heteroarylaminoC2-C6alkyl, and
heterocyclylaminoC2-C6alkyl; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R13 may cyclize to form a C3-C7
heterocyclyl ring; each R14 is independently and respectively
selected from the group consisting of H and C1-C6alkyl; V, V1, and
V2 are each independently and respectively selected from the group
consisting of O and H.sub.2; each Z4 is a substituent attached to a
ring nitrogen and is independently and individually selected from
the group consisting of H, C1-C6alkyl, hydroxyC2-C6alkyl,
C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR13## wherein the symbol (#) indicates
the point of attachment of the Z4 moiety to the A2 ring for formula
I; in the event that Z4 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z4 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z4 may cyclize to
form a C3-C7 heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r
is 0 or 1; v is 1 or 2. 1.1.2b
[0035] More preferred A2 moieties are selected from the group
consisting of ##STR14## ##STR15## and wherein the symbol (**) is
the point of attachment to the A1 ring for formula I; wherein each
Z3 and Z5 is independently attached to either aryl or heteroaryl
ring of the A2 bicyclic ring. 1.1.2c
[0036] Still more preferred A2 moieties are selected from the group
consisting of ##STR16## ##STR17## and wherein the symbol (**) is
the point of attachment to the A1 ring of formula I; wherein each
Z3 and Z5 is independently attached to either aryl or heteroaryl
ring of the A2 bicyclic ring. 1.1.3 Preferred Classes of Compounds
1.1.3a
[0037] Compounds as defined in 1.1.1a wherein the A2 group is
defined in 1.1.2a.
1.1.3b
[0038] Compounds as defined in 1.1.3a wherein the A2 group is
defined in 1.1.2b.
1.1.3c
[0039] Compounds as defined in 1.1.3a wherein the A2 group is
defined in 1.1.2c.
1.1.3d
[0040] Compounds as defined in 1.1.1b wherein the A2 group is
defined in 1.1.2a.
1.1.3e
[0041] Compounds as defined in 1.1.3c wherein the A2 group is
defined in 1.1.2b.
1.1.3f
[0042] Compounds as defined in 1.1.3c wherein the A2 group is
defined in 1.1.2c.
1.1.4 Preferred A1 Moieties
1.1.4a
[0043] A1 moieties are selected from the group consisting of
##STR18## wherein the symbol (*) denotes the attachment to the W
moiety of formula I and the symbol (**) denotes the attachment to
the A2 moiety of formula I; each R7 is selected from the group
consisting of halogen, C1-C3fluoroalkyl wherein the alkyl moiety is
partially or fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or
C1-C3alkoxy. 1.1.4b
[0044] Preferred A1 moieties are selected from the group consisting
of ##STR19## wherein the symbol (*) denotes the attachment to the W
moiety of formula I and the symbol (**) denotes the attachment to
the A2 moiety of formula I. 1.1.4c
[0045] Still more preferred A1 moieties are selected from the group
consisting of ##STR20## wherein the symbol (*) denotes the
attachment to the W moiety of formula I and the symbol (**) denotes
the attachment to the A2 moiety of formula I. 1.1.5 Preferred W and
Y Moieties 1.1.5a
[0046] (1) W and Y are each NH, and X.dbd.O; (2) W.dbd.NH,
Y.dbd.CHR4 and X.dbd.O; or (3) W.dbd.CHR4, Y.dbd.NH, and
X.dbd.O.
1.1.5b
[0047] W and Y are each NH and X.dbd.O.
1.1.6 Further Preferred Compounds
1.1.6a
[0048] Further preferred compounds are of the formula ##STR21##
wherein A2 is selected from the group consisting of ##STR22##
wherein each Z3 and Z5 is independently attached to either aryl or
heteroaryl ring of the A2 bicyclic ring; wherein the symbol (**)
denotes the attachment to the A1 moiety of formula I; A1 is
selected from the group consisting of ##STR23## wherein the symbol
(*) denotes the attachment to the W moiety of formula I and the
symbol (**) denotes the attachment to the A2 moiety of formula I; X
is O, S, or NR3; D is selected from the group consisting of
2,3-dichlorophenyl, 2-fluorophenyl, 3-fluorophenyl, 4-fluorophenyl,
3-cyanophenyl, 2,3-difluorophenyl, 2,4-difluorophenyl,
3,4-difluorophenyl, 2,5-difluorophenyl, 3,5-difluorophenyl,
2,3,5-trifluorophenyl, 2,4,5-trifluorophenyl,
2,3,4-trifluorophenyl, 3,4,5-trifluorophenyl, 4-cyanophenyl,
3-fluoro-5-cyanophenyl, 3-(R8SO.sub.2)-phenyl,
3-(hydroxyC1-C3alkyl)-phenyl, 3-(R3O--N.dbd.C(R6))-phenyl,
3-phenoxyphenyl, 4 phenoxyphenyl, ##STR24## ##STR25## ##STR26##
##STR27## ##STR28## wherein E1 is selected from the group
consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl;
X1 is selected from the group consisting of O, S, NR3,
--C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I; and
wherein the carbon atoms of --(CH.sub.2)n-, --(CH.sub.2)q-,
--(CH.sub.2)p-, C2-C5alkenyl, and C2-C5alkynyl of X2 can be further
substituted by one or more C1-C6alkyl; each R2 is selected from the
group consisting of alkyl, branched alkyl, fluoroalkyl, wherein the
alkyl group is partially or fully fluorinated, and R19 substituted
C3-C8carbocyclyl wherein R19 is H and C1-C6alkyl; each R2' is
selected from the group consisting of halogen and R2; each R3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl;
wherein two R3 moieties independently and individually taken from
the group consisting of C1-C6alkyl and branched C3-C7alkyl are
attached to the same nitrogen heteroatom, the two R3 moieties may
cyclize to form a C3-C7 heterocyclyl ring; each R4 is selected from
the group consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom may
cyclize to form a C3-C7 heterocyclyl ring; each R5 is independently
and individually selected from the group consisting of ##STR29##
and wherein the symbol (##) is the point of attachment to
respective R8, R10, R13, Z2, Z3, Z4, Z5, or A2 ring moieties
containing a R5 moiety; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R5 may cyclize to form a C3-C7
heterocyclyl ring; wherein each R6 is independently and
individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, phenyl, heteroaryl, and
heterocyclyl; each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or C1-C3alkoxy;
each R8 is independently and individually selected from the group
consisting of C1-C6alkyl, branched C3-C7alkyl, fluoroalkyl wherein
the alkyl moiety is partially or fully fluorinated, carbocyclyl,
phenyl, C1-C6phenylalkyl, heteroaryl or heteroarylC1-C6alkyl,
heterocyclyl, heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2,
N(R4).sub.2, or R5; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of R8 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of R8 may cyclize to form a C3-C7 heterocyclyl ring;
each R10 is independently and individually selected from the group
consisting of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH,
C1-C6alkoxy, --N(R4).sub.2; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; each R13 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, carbocyclyl, hydroxyC2-C7alkyl, C1-C6alkoxyC2-C7alkyl,
(R4).sub.2N--CO, (R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.q,
R5-C2-C6alkylN(R4)-(CH.sub.2).sub.q,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.q,
R5-C2-C6alkyl-O--(CH.sub.2).sub.q, --(CH.sub.2).sub.qN(R4)C(O)R8,
aryl, arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl,
heterocyclyl, heterocyclylC1-C6alkyl, aryloxyC2-C6alkyl,
heteroaryloxyC2-C6alkyl, heterocyclyloxyC2-C6alkyl,
arylaminoC2-C6alkyl, heteroarylaminoC2-C6alkyl, and
heterocyclylaminoC2-C6alkyl; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R13 may cyclize to form a C3-C7
heterocyclyl ring; each R14 is independently and respectively
selected from the group consisting of H and C1-C6alkyl; V, V1, and
V2 are each independently and respectively selected from the group
consisting of O and H.sub.2; each Z3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyl, hydroxyC1-C6alkyl, cyano, C1-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, halogen, CF.sub.3, (R3).sub.2N--,
(R4).sub.2N--, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, R8CO--,
(R4).sub.2N--CO--C1-C6alkyl, carboxyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R3).sub.2NSO.sub.2, --SO.sub.2R3, SOR3, (R4).sub.2NSO.sub.2,
--SO.sub.2R4, --SOR4, --(CH.sub.2).sub.nN(R4)C(O)R8,
--C.dbd.(NOH)R6, --C.dbd.(NOR3)R6, heteroaryl, heterocyclyl,
heteroarylC1-C6alkyl, heterocyclylC1-C6alkyl, heteroaryloxy,
heterocyclyloxy, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylamino, heteroarylamino,
heterocyclylamino, arylaminoC1-C6alkyl, heteroarylaminoC1-C6alkyl,
heterocyclylaminoC1-C6alkyl, or moieties of the formulae ##STR30##
wherein the symbol (#) indicates the point of attachment of the Z3
moiety to the A2 ring of formula I; in the event that Z3 contains
an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; wherein two R3 moieties
are independently and individually taken from the group consisting
of C1-C6alkyl and branched C3-C6alkyl and are attached to the same
nitrogen heteroatom of Z3 may cyclize to form a C3-C7 heterocyclyl
ring; wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z3 may cyclize to form a C3-C7 heterocyclyl ring;
each Z4 is a substituent attached to a ring nitrogen and is
independently and individually selected from the group consisting
of H, C1-C6alkyl, hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl,
(R4).sub.2N--C2-C6alkyl, (R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR31## wherein the symbol (#) indicates
the point of attachment of the Z4 moiety to the A2 ring for formula
I; in the event that Z4 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z4 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z4 may cyclize to
form a C3-C7 heterocyclyl ring; Z5 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, halogen, fluoroalkyl, cyano, hydroxyl, alkoxy,
oxo, aminocarbonyl, carbonylamino, aminosulfonyl, sulfonylamino,
--N(R3).sub.2, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --R5, --O--(CH.sub.2)q-O-Alkyl,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-O-Alkyl,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --O--(CH.sub.2)q-R5, and
--N(R3)-(CH.sub.2)q-R5; wherein two R3 moieties are independently
and individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring;
Each Z6 is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, hydroxyl,
C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8, (R4).sub.2N--, --R5,
--N(R4)COR8, --N(R3)SO.sub.2R6-, --CON(R3).sub.2, --CON(R4).sub.2,
--COR5, --SO.sub.2NHR4, heteroaryl, heterocyclyl, heteroaryloxy,
heterocyclyloxy, arylamino, heteroarylamino, and heterocyclylamino;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z6 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z6 may cyclize to
form a C3-C7 heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r
is 0 or 1; v is 1 or 2; and tautomers, diastereomers, geometric
isomers, enantiomers, hydrates, prodrugs and salts of any of the
foregoing. 1.1.6b
[0049] The following specific compounds are most preferred:
1-(3-t-butyl-1-(1-(methanesulfonylureidoamidomethyl)naphthalen-3-yl)-1H-p-
yrazol-5-yl)3-(2,3-dichlorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
1-(1-(4-(2-aminoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3--
dichlorophenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(2-
,3-dichlorophenyl)urea,
(3S)-6-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-1,2,3-
,4-tetrahydroisoquinoline-3-carboxylic acid,
6-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-1,2,3,4-te-
trahydroisoquinoline-3-carboxylic acid,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,3,4-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,4-
,5-trifluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)naphthalen-2-y-
l)-1H-pyrazol-5-yl)-3-(2,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-((1-amino-1-oxo-methylamino)methyl)naphthalen-2-yl)-1H--
pyrazol-5-yl)-3-(2,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(2-
,4,5-trifluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,3,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)naphthalen-2-y-
l)-1H-pyrazol-5-yl)-3-(2,3,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,3-
,5-trifluorophenyl)urea,
1-(1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3,5-
-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-((1-amino-1-oxo-methylamino)methyl)naphthalen-2-yl)-1H--
pyrazol-5-yl)-3-(2,3,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(3,4-
,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)naphthalen-2-y-
l)-1H-pyrazol-5-yl)-3-(3,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(3,5-
-difluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(3,5-difluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,5-difluorophenyl)urea,
1-(3-t-butyl-1-(4-(2-(1,3-dihydroxypropan-2-ylamino)-2-oxoethyl)naphthale-
n-2-yl)-1H-pyrazol-5-yl)-3-(2,5-difluorophenyl)urea,
1-(1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-cya-
nophenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-cyanophenyl)urea,
1-(3-t-butyl-1-(1H-indol-5-yl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phe-
nyl)urea,
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-y-
loxy)phenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(4-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)naphthalen-2-y-
l)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(3-(-
pyridin-3-yloxy)phenyl)urea,
1-(1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(py-
ridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(5-chloropyridin-3-yloxy)phenyl)urea,
6-(3-t-butyl-5-(3-(3-(pyridin-3-yloxy)phenyl)ureido)-1H-pyrazol-1-yl)-1,2-
,3,4-tetrahydroisoquinoline-3-carboxylic acid,
1-(3-t-butyl-1-(3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazo-
l-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(3-(methylcarbamoyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1-
H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1-(methylcarbamoyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1-
H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(py-
ridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(quinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phe-
nyl)urea,
1-(3-cyclopentyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-
-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-(piperazin-1-yl)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2-
-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(1-(2-(2-aminoethylamino)quinolin-6-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-cyclopentyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-(dimethylamino)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-((R)-3-(dimethylamino)pyrrolidin-1-yl)quinolin-6-yl)-1H-
-pyrazol-5-yl)-3-(4-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(1-(2-aminoquinolin-6-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(2-(methylcar-
bamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-(methylamino)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2-(m-
ethylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-(1-oxoisoindolin-4-yl)phenyl)urea,
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(4-(1-oxoisoindolin-4-yl-
)phenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(4-(1--
oxoisoindolin-4-yl)phenyl)urea,
6-(3-t-butyl-5-(3-(4-(1-oxoisoindolin-4-yl)phenyl)ureido)-1H-pyrazol-1-yl-
)-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-
-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(8--
methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazo-
l-5-yl)-3-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl-
)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3--
(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(1H-indol-5-yl)-1H-pyrazol-5-yl)-3-(3-(8-methyl-7-oxo-7,8--
dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(2-(piperazin-1-yl)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(8-
-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea,
1-(3-t-butyl-1-(2-(piperazin-1-yl)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-me-
thyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea
1.1.7 Methods
1.1.7a Methods of Protein Modulation
[0050] The invention includes methods of modulating kinase activity
of a variety of kinases, e.g. C-Abl kinase, BCR-Abl kinase. The
kinases may be wildtype kinases, oncogenic forms thereof, aberrant
fusion proteins thereof or polymorphs of any of the foregoing. The
method comprises the step of contacting the kinase species with
compounds of the invention and especially those set forth in
sections 1.1 and 1.1.6a. The kinase species may be activated or
unactivated, and the species may be modulated by phosphorylations,
sulfation, fatty acid acylations glycosylations, nitrosylation,
cystinylation (i.e. proximal cysteine residues in the kinase react
with each other to form a disulfide bond) or oxidation. The kinase
activity may be selected from the group consisting of catalysis of
phospho transfer reactions, kinase cellular localization, and
recruitment of other proteins into signaling complexes through
modulation of kinase conformation.
[0051] The methods of the invention may also involve the step of
inducing, synergizing, or promoting the binding of a second
modulator compound of said kinase, especially C-Abl kinase or
BCR-Abl kinase, to form a ternary adduct, such co-incident binding
resulting in enhanced biological modulation of the kinase when
compared to the biological modulation of the protein affected by
either of said compounds alone. The second compound may interact at
a substrate, co-factor or regulatory site on the kinase, with the
second site being distinct from the site of interaction of the
first compound. For example, the second site may be an ATP
co-factor site. The second compounds may be taken from the group
consisting of
N-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)-4-((4-methylpi-
perazin-1-yl)methyl)benzamide (Gleevec);
N-(2-chloro-6-methylphenyl)-2-(6-(4-(2-hydroxyethyl)piperazin-1-yl)-2-met-
hylpyrimidin-4-ylamino)thiazole-5-carboxamide (BMS-354825);
6-(2,6-dichlorophenyl)-2-(3-(hydroxymethyl)phenylamino)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one (PD 166326);
6-(2,6-dichlorophenyl)-8-methyl-2-(3-(methylthio)phenylamino)pyrido[2,3-d-
]pyrimidin-7(8H)-one (PD 173955);
6-(2,6-dichlorophenyl)-2-(4-fluoro-3-methylphenylamino)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one (PD 180970);
6-(2,6-dichlorophenyl)-2-(4-ethoxyphenylamino)-8-methylpyrido[2,3-d]pyrim-
idin-7(8H)-one (PD 173958);
6-(2,6-dichlorophenyl)-2-(4-fluorophenylamino)-8-methylpyrido[2,3-d]pyrim-
idin-7(8H)-one (PD 173956);
6-(2,6-dichlorophenyl)-2-(4-(2-(diethylamino)ethoxy)phenylamino)-8-methyl-
pyrido[2,3-d]pyrimidin-7(8H)-one (PD 166285);
2-(4-(2-aminoethoxy)phenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one;
N-(3-(6-(2,6-dichlorophenyl)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrim-
idin-2-ylamino)phenyl)acetamide (SKI DV-MO16);
2-(4-aminophenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 1-10);
6-(2,6-dichlorophenyl)-2-(3-hydroxyphenylamino)-8-methylpyrido[2,3-d]pyri-
midin-7(8H)-one (SKI DV2-89);
2-(3-aminophenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 2-43);
N-(4-(6-(2,6-dichlorophenyl)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrim-
idin-2-ylamino)phenyl)acetamide (SKI DV-M017);
6-(2,6-dichlorophenyl)-2-(4-hydroxyphenylamino)-8-methylpyrido[2,3-d]pyri-
midin-7(8H)-one (SKI DV-MO17);
6-(2,6-dichlorophenyl)-2-(3-ethylphenylamino)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 2 87).
1.1.7b Treatment Methods
[0052] The methods of the invention also include treating
individuals suffering from a condition selected from the group
consisting of cancer and hyperproliferative diseases. These methods
comprise administering to such individuals compounds of the
invention, and especially those of section 1.1 and 1.1.6a.
Exemplary conditions include chronic myelogenous leukemia, acute
lymphocytic leukemia, gastrointestinal stromal tumors, and
hypereosinophillic syndrome. The administration method is not
critical, and may be from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
1.1.8 Pharmaceutical Preparations
[0053] The compounds of the invention, especially those of 1.1 and
1.1.6a may form a part of a pharmaceutical composition by combining
one or more such compounds with a pharmaceutically acceptable
carrier. Additionally, the compositions may include an additive
selected from the group consisting of adjuvants, excipients,
diluents, and stablilizers.
1.1.9 Kinase/Compound Adducts
[0054] The invention also provides adducts in the form of compounds
of the invention bound with a species of kinase such as a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing. The compounds are
advantageously selected from the groups defined in sections 1.1 and
1.1.6a.
1.2 Generally--Monocyclic A2 Compounds with Polycyclic E2 Rings
[0055] The invention includes compounds of the formula ##STR32##
wherein A2 is selected from the group consisting of a
Z1-substituted phenyl, Z1-substituted pyridyl, Z1-substituted
pyrimidinyl, Z1-substituted thienyl, Z1 or Z4'-substituted
monocyclic heterocyclyl rings, and other monocyclic heteroaryls,
excluding tetrazolyl, 1,2,4-oxadiazolonyl, 1,2,4-triazolonyl, and
alkyl-substituted pyrrolyl wherein the pyrrolyl nitrogen is the
site of attachment to the A1 ring; A1 is selected from the group
consisting of R2' and R7-substituted phenyl, pyridyl, or
pyrimidinyl, R2-substituted monocyclic 5-membered ring heteroaryl,
and R2'-substituted monocyclic heterocyclyl moieties; W and Y are
CHR4, NR3, or O and wherein W and Y are not simultaneously O; X is
O, S, or NR3; each Z1 is a substituent attached to a ring carbon
and is independently and individually selected from the group
consisting of hydroxyC1-C6alkyl, C2-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR33## cyano wherein the site of
attachment to the A2 ring is meta to the point of attachment to the
A1 ring and wherein A2 is phenyl, and cyano wherein the site of
attachment is to a substitutable position when A2 is pyridyl,
pyrimidinyl or a five-membered ring; wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z1 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; each Z4' is a substituent attached
to a ring nitrogen and is independently and individually selected
from the group consisting of hydroxyC2-C6alkyl,
C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR34## wherein the symbol (#) indicates
the point of attachment of the Z4' moiety to the A1 ring of formula
I; in the event that Z4' contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z4' may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z4' may cyclize to
form a C3-C7 heterocyclyl ring; each R2 is selected from the group
consisting of alkyl, branched alkyl, fluoroalkyl, wherein the alkyl
group is partially or fully fluorinated, and R19 substituted
C3-C8carbocyclyl wherein R19 is H and C1-C6alkyl; each R2' is
selected from the group consisting of halogen and R2; each R3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, branched C3-C7alkyl, C3-C7cycloalkyl, or phenyl;
each R3' is independently and individually selected from the group
consisting of C2-C6alkyl, branched C3-C7alkyl, C3-C7cycloalkyl,
aryl, arylalkyl, heteroaryl, and heteroarylalkyl; each R4 is
selected from the group consisting of H, C1-C6alkyl, hydroxyC1-C6
alkyl, dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched
C3-C7alkyl, branched hydroxyC1-C6 alkyl, branched
C1-C6alkoxyC1-C6alkyl, branched dihydroxyC1-C6alkyl, carbocyclyl,
hydroxyl substituted carbocyclyl, alkoxy substituted carbocyclyl,
dihydroxy substituted carbocyclyl, phenyl, heteroaryl,
heterocyclyl, phenylC1-C6alkyl, heteroarylC1-C6alkyl, and
heterocyclylC1-C6alkyl; each R5 is independently and individually
selected from the group consisting of ##STR35## and wherein the
symbol (##) is the point of attachment to respective R8, R10, Z1,
Z4', Z5, Z6 or A2 ring moieties containing a R5 moiety; wherein two
R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R5
may cyclize to form a C3-C7 heterocyclyl ring; wherein each R6 is
independently and individually selected from the group consisting
of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl, phenyl,
heteroaryl, and heterocyclyl; each R7 is selected from the group
consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl moiety
is partially or fully fluorinated, C1-C3alkyl, cyclopropyl, cyano,
or C1-C3alkoxy; each R8 is independently and individually selected
from the group consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein
the alkyl moiety is partially or fully fluorinated,
branchedC4-C7alkyl, carbocyclyl, phenyl, C1-C6phenylalkyl,
heteroaryl or heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2,
or R5; wherein two R3 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; D comprises a moiety taken from group consisting
of moieties of the formula ##STR36## wherein the symbol (***) is
the point of attachment to the Y group of formula I; wherein E2 is
taken from the group consisting of poly-aryl, poly-heteroaryl,
mono- and poly heterocyclyl, and carbocyclyl; wherein E1 is taken
from the group consisting of mono- and poly-aryl, mono- and
poly-heteroaryl, mono- and poly heterocyclyl and carbocyclyl; X1 is
selected from the group consisting of O, S, NR3, --C(.dbd.O)--,
--O--(CH.sub.2)n-, --S--(CH.sub.2)n-, --NR3-(CH.sub.2)n-,
--O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein either E1 or E2 is directly linked to the Y group of
formula I; and n is 0-4; p is 1-4; q is 2-6, r is 0 or 1; and
tautomers, diastereomers, geometric isomers, enantiomers, hydrates,
prodrugs, and salts of any of the foregoing. 1.2.1 Preferred D
Moieties 1.2.1a
[0056] Preferably, the compounds of formula I in 1.2 contain D
moieties wherein E1 is selected from the group consisting
cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, pyrrolidinyl
piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl;
[0057] wherein E2 is comprises the group consisting of cyclopentyl,
cyclohexyl, non-fused bicyclic rings comprising pyridylpyridiminyl
pyrimidinylpyrimidinyl, oxazolylpyrimidinyl, thiazolylpyrimidinyl,
imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl.
1.2.1b
[0058] Additionally preferred D moieties of formula I in 1.2
comprise a formula ##STR37## wherein X2 is selected from the group
consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct bond
wherein E2 is directly linked to the Y group of formula I.
1.2.1c
[0059] More preferred D moieties of 1.2.1b are wherein E2 is
cyclopentyl, cyclohexyl, non-fused bicyclic rings comprising
pyridylpyridiminyl pyrimidinylpyrimidinyl, oxazolylpyrimidinyl,
thiazolylpyrimidinyl, imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl.
1.2.2 Preferred A2 Moieties
[0060] 1.2.2a ##STR38## ##STR39## and wherein the symbol (**) is
the point of attachment to the A1 ring of formula I; each Z4 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl,
(R4).sub.2N--C2-C6alkyl, (R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR40## wherein the symbol (#) indicates
the point of attachment of the Z4 moiety to the A2 ring for formula
I; in the event that Z4 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z4 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z4 may cyclize to
form a C3-C7 heterocyclyl ring; Z5 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, halogen, fluoroalkyl, cyano, hydroxyl, alkoxy,
oxo, aminocarbonyl, carbonylamino, aminosulfonyl, sulfonylamino,
--N(R3).sub.2, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --R5, --O--(CH.sub.2)q-O-Alkyl,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-O-Alkyl,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --O--(CH.sub.2)q-R5, and
--N(R3)-(CH.sub.2)q-R5; wherein two R3 moieties are independently
and individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring; and
n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v is 1 or 2. 1.2.2b
[0061] More preferred A2 moieties are selected from the group
consisting of ##STR41## and wherein the symbol (**) is the point of
attachment to the A1 ring for formula I. 1.2.2c
[0062] Even more preferred A2 moieties are selected from the group
consisting of ##STR42## and wherein the symbol (**) is the point of
attachment to the A1 ring of formula I. 1.2.3 Preferred Classes of
Compounds 1.2.3a
[0063] Compounds as defined in 1.2.1a wherein the A2 group is
defined in 1.2.2a.
1.2.3b
[0064] Compounds as defined in 1.2.3a wherein the A2 group is
defined in 1.2.2b.
1.2.3c
[0065] Compounds as defined in 1.2.3a wherein the A2 group is
defined in 1.2.2c.
1.2.3d
[0066] Compounds as defined in 1.2.1b wherein the A2 group is
defined in 1.2.2a.
1.2.3e
[0067] Compounds as defined in 1.2.3c wherein the A2 group is
defined in 1.2.2b.
1.2.3f
[0068] Compounds as defined in 1.2.3c wherein the A2 group is
defined in 1.2.2c.
1.2.4 Preferred A1 Moieties
1.2.4a
[0069] These preferred A1 moieties are defined in 1.1.4a.
1.2.4b
[0070] These more preferred A1 moieties are defined in 1.1.4b.
1.2.4c
[0071] These even more preferred A1 moieties are defined in
1.1.4c.
1.2.5 Preferred W and Y Moieties
1.2.5a
[0072] (1) W and Y are each NH, and X.dbd.O; (2) W.dbd.NH,
Y.dbd.CHR4 and X.dbd.O; or (3) W.dbd.CHR4, Y.dbd.NH, and
X.dbd.O.
1.2.5b
[0073] W and Y are each NH and X.dbd.O.
1.2.6 Further Preferred Compounds
1.2.6a
[0074] The invention includes compounds of the formula ##STR43##
wherein A2 is selected from the group consisting of ##STR44## and
wherein the symbol (**) is the point of attachment to the A1 ring
of formula I.
[0075] A1 is selected from the group consisting of ##STR45##
wherein the symbol (*) denotes the attachment to the W moiety of
formula I and the symbol (**) denotes the attachment to the A2
moiety of formula I; X is O, S, or NR3; D comprises a member of
##STR46## ##STR47## wherein E1 is selected from the group
consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl;
wherein the symbol (***) denotes the attachment to the Y moiety of
formula I; X1 is selected from the group consisting of O, S, NR3,
--C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I;
each Z1 is a substituent attached to a ring carbon and is
independently and individually selected from the group consisting
of hydroxyC1-C6alkyl, C2-C6alkoxy, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR48## cyano wherein the site of
attachment to the A2 ring is meta to the point of attachment to the
A1 ring and wherein A2 is phenyl, and cyano wherein the site of
attachment is to a substitutable position when A2 is pyridyl,
pyrimidinyl or a five-membered ring;
[0076] In the foregoing definition of Z1, alkyl moieties may
optionally be substituted by one or more C1-C6alkyl;
Wherein the asterisk (*) indicates the point of attachment of the
Z1 moiety to the A2 ring;
in the event that Z1 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more
C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring;
[0077] wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z1 may cyclize to form a C3-C7 heterocyclyl ring;
each Z4 is a substituent attached to a ring nitrogen and is
independently and individually selected from the group consisting
of H, C1-C6alkyl, hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl,
(R4).sub.2N--C2-C6alkyl, (R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR49## wherein the symbol (#) indicates
the point of attachment of the Z4 moiety to the A2 ring for formula
I; in the event that Z4 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z4 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z4 may cyclize to
form a C3-C7 heterocyclyl ring; each Z4' is a substituent attached
to a ring nitrogen and is independently and individually selected
from the group consisting of hydroxyC2-C6alkyl,
C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR50## wherein the symbol (#) indicates
the point of attachment of the Z4' moiety to the A1 ring of formula
I; in the event that Z4' contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z4' may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z4' may cyclize to
form a C3-C7 heterocyclyl ring; Z5 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, halogen, fluoroalkyl, cyano, hydroxyl, alkoxy,
oxo, aminocarbonyl, carbonylamino, aminosulfonyl, sulfonylamino,
--N(R3).sub.2, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --R5, --O--(CH.sub.2)q-O-Alkyl,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-O-Alkyl,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --O--(CH.sub.2)q-R5, and
--N(R3)-(CH.sub.2)q-R5; wherein two R3 moieties are independently
and individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring;
Each Z6 is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, hydroxyl,
C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8, (R4).sub.2N--, --R5,
--N(R4)COR8, --N(R3)SO.sub.2R6-, --CON(R3).sub.2, --CON(R4).sub.2,
--COR5, --SO.sub.2NHR4, heteroaryl, heterocyclyl, heteroaryloxy,
heterocyclyloxy, arylamino, heteroarylamino, and heterocyclylamino;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z6 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z6 may cyclize to
form a C3-C7 heterocyclyl ring; each R2 is selected from the group
consisting of alkyl, branched alkyl, fluoroalkyl, wherein the alkyl
group is partially or fully fluorinated, and R19 substituted
C3-C8carbocyclyl wherein R19 is H and C1-C6alkyl; each R2' is
selected from the group consisting of halogen and R2; each R3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, branched C3-C7alkyl, C3-C7cycloalkyl, or phenyl;
each R3' is independently and individually selected from the group
consisting of C2-C6alkyl, branched C3-C7alkyl, C3-C7cycloalkyl,
aryl, arylalkyl, heteroaryl, and heteroarylalkyl; each R4 is
selected from the group consisting of H, C1-C6alkyl, hydroxyC1-C6
alkyl, dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched
C3-C7alkyl, branched hydroxyC1-C6 alkyl, branched
C1-C6alkoxyC1-C6alkyl, branched dihydroxyC1-C6alkyl, carbocyclyl,
hydroxyl substituted carbocyclyl, alkoxy substituted carbocyclyl,
dihydroxy substituted carbocyclyl, phenyl, heteroaryl,
heterocyclyl, phenylC1-C6alkyl, heteroarylC1-C6alkyl, and
heterocyclylC1-C6alkyl; each R5 is independently and individually
selected from the group consisting of ##STR51## and wherein the
symbol (##) is the point of attachment to respective R8, R10, Z1,
Z4', Z5, Z6 or A2 ring moieties containing a R5 moiety; wherein two
R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R5
may cyclize to form a C3-C7 heterocyclyl ring; wherein each R6 is
independently and individually selected from the group consisting
of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl, phenyl,
heteroaryl, and heterocyclyl; each R7 is selected from the group
consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl moiety
is partially or fully fluorinated, C1-C3alkyl, cyclopropyl, cyano,
or C1-C3alkoxy; each R8 is independently and individually selected
from the group consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein
the alkyl moiety is partially or fully fluorinated,
branchedC4-C7alkyl, carbocyclyl, phenyl, C1-C6phenylalkyl,
heteroaryl or heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2,
or R5; wherein two R3 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2; and tautomers, diastereomers, geometric isomers,
enantiomers, hydrates, prodrugs and salts of any of the foregoing.
1.2.6b
[0078] The following specific compounds are most preferred:
1-(3-t-butyl-1-(3-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)phenyl)-1H-pyr-
azol-5-yl)-3-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-methy-
l-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea,
1-(2-(3-(2-amino-2-oxoethyl)phenyl)-5-t-butylthiophen-3-yl)-3-(4-methyl-3-
-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea,
1-(1-(3-(1H-pyrazol-4-yl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(4-(6-(-
thiazol-4-yl)pyrimidin-4-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(3-(-
4-(pyridin-3-yl)pyrimidin-2-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(3-(-
4-(isoxazol-4-yl)pyrimidin-2-ylamino)phenyl)urea,
1-(1-(3-(1H-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-methyl-3-
-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea
1.2.7 Methods
1.2.7a Methods of Protein Modulation
[0079] The invention includes methods of modulating kinase activity
of a variety of kinases, e.g. C-Abl kinase, BCR-Abl kinase. The
kinases may be wildtype kinases, oncogenic forms thereof, aberrant
fusion proteins thereof or polymorphs of any of the foregoing. The
method comprises the step of contacting the kinase species with
compounds of the invention and especially those set forth in
sections 1.2 and 1.2.6a. The kinase species may be activated or
unactivated, and the species may be modulated by phosphorylations,
sulfation, fatty acid acylations glycosylations, nitrosylation,
cystinylation (i.e. proximal cysteine residues in the kinase react
with each other to form a disulfide bond) or oxidation. The kinase
activity may be selected from the group consisting of catalysis of
phospho transfer reactions, kinase cellular localization, and
recruitment of other proteins into signaling complexes through
modulation of kinase conformation.
[0080] The methods of the invention may also involve the step of
inducing, synergizing, or promoting the binding of a second
modulator compound of said kinase, especially C-Abl kinase or
BCR-Abl kinase, to form a ternary adduct, such co-incident binding
resulting in enhanced biological modulation of the kinase when
compared to the biological modulation of the protein affected by
either of said compounds alone. The second compound may interact at
a substrate, co-factor or regulatory site on the kinase, with the
second site being distinct from the site of interaction of the
first compound. For example, the second site may be an ATP
co-factor site. The second compounds may be taken from the group
consisting of
N-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)-4-((4-methylpi-
perazin-1-yl)methyl)benzamide (Gleevec);
N-(2-chloro-6-methylphenyl)-2-(6-(4-(2-hydroxyethyl)piperazin-1-yl)-2-met-
hylpyrimidin-4-ylamino)thiazole-5-carboxamide (BMS-354825);
6-(2,6-dichlorophenyl)-2-(3-(hydroxymethyl)phenylamino)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one (PD 166326);
6-(2,6-dichlorophenyl)-8-methyl-2-(3-(methylthio)phenylamino)pyrido[2,3-d-
]pyrimidin-7(8H)-one (PD 173955);
6-(2,6-dichlorophenyl)-2-(4-fluoro-3-methylphenylamino)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one (PD180970);
6-(2,6-dichlorophenyl)-2-(4-ethoxyphenylamino)-8-methylpyrido[2,3-d]pyrim-
idin-7(8H)-one (PD 173958);
6-(2,6-dichlorophenyl)-2-(4-fluorophenylamino)-8-methylpyrido[2,3-d]pyrim-
idin-7(8H)-one (PD 173956);
6-(2,6-dichlorophenyl)-2-(4-(2-(diethylamino)ethoxy)phenylamino)-8-methyl-
pyrido[2,3-d]pyrimidin-7(8H)-one (PD 166285);
2-(4-(2-aminoethoxy)phenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one;
N-(3-(6-(2,6-dichlorophenyl)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrim-
idin-2-ylamino)phenyl)acetamide (SKI DV-MO16);
2-(4-aminophenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 1-10);
6-(2,6-dichlorophenyl)-2-(3-hydroxyphenylamino)-8-methylpyrido[2,3-d]pyri-
midin-7(8H)-one (SKI DV2-89);
2-(3-aminophenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 2-43);
N-(4-(6-(2,6-dichlorophenyl)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrim-
idin-2-ylamino)phenyl)acetamide (SKI DV-M017);
6-(2,6-dichlorophenyl)-2-(4-hydroxyphenylamino)-8-methylpyrido[2,3-d]pyri-
midin-7(8H)-one (SKI DV-MO17);
6-(2,6-dichlorophenyl)-2-(3-ethylphenylamino)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 2 87).
1.2.7b Treatment Methods
[0081] The methods of the invention also include treating
individuals suffering from a condition selected from the group
consisting of cancer and hyperproliferative diseases. These methods
comprise administering to such individuals compounds of the
invention, and especially those of section 1.2 and 1.2.6a.
Exemplary conditions include chronic myelogenous leukemia, acute
lymphocytic leukemia, gastrointestinal stromal tumors, and
hypereosinophillic syndrome. The administration method is not
critical, and may be from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
1.2.8 Pharmaceutical Preparations
[0082] The compounds of the invention, especially those of 1.2 and
1.2.6a may form a part of a pharmaceutical composition by combining
one or more such compounds with a pharmaceutically acceptable
carrier. Additionally, the compositions may include an additive
selected from the group consisting of adjuvants, excipients,
diluents, and stablilizers.
1.2.9 Kinase/Compound Adducts
[0083] The invention also provides adducts in the form of compounds
of the invention bound with a species of kinase such as a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing. The compounds are
advantageously selected from the groups defined in sections 1.2 and
1.2.6a. 1.3 Generally--Monocyclic A2 Compounds with Monocyclic E2
Rings ##STR52## wherein A2 is selected from the group consisting of
a Z7-substituted phenyl, Z7-substituted pyridyl, Z7-substituted
pyrimidinyl, Z1-substituted thienyl, Z1 or Z4'-substituted
monocyclic heterocyclyl rings and other monocyclic heteroaryls,
excluding tetrazolyl, 1,2,4-oxadiazolonyl, 1,2,4-triazolonyl, and
alkyl-substituted pyrrolyl wherein the pyrrolyl nitrogen is the
site of attachment to the A1 ring; A1 is selected from the group
consisting of R2' and R7-substituted phenyl, pyridyl, or
pyrimidinyl, R2-substituted monocyclic 5-membered ring heteroaryl,
and R2'-substituted monocyclic heterocyclyl moieties; W and Y are
CHR4, NR3, or O and wherein W and Y are not simultaneously O; X is
O, S, or NR3; each R2 is selected from the group consisting of
alkyl, branched alkyl, fluoroalkyl, wherein the alkyl group is
partially or fully fluorinated, and R19 substituted
C3-C8carbocyclyl wherein R19 is H and C1-C6alkyl; each R2' is
selected from the group consisting of halogen and R2; each R3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, branched C3-C7alkyl, C3-C7cycloalkyl, or phenyl;
each R3' is independently and individually selected from the group
consisting of C2-C6alkyl, branched C3-C7alkyl, C3-C7cycloalkyl,
aryl, arylalkyl, heteroaryl, and heteroarylalkyl; each R4 is
selected from the group consisting of H, C1-C6alkyl, hydroxyC1-C6
alkyl, dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched
C3-C7alkyl, branched hydroxyC1-C6 alkyl, branched
C1-C6alkoxyC1-C6alkyl, branched dihydroxyC1-C6alkyl, carbocyclyl,
hydroxyl substituted carbocyclyl, alkoxy substituted carbocyclyl,
dihydroxy substituted carbocyclyl, phenyl, heteroaryl,
heterocyclyl, phenylC1-C6alkyl, heteroarylC1-C6alkyl, and
heterocyclylC1-C6alkyl; each R5 is independently and individually
selected from the group consisting of ##STR53## and wherein the
symbol (##) is the point of attachment to respective R8, R10, Z1,
Z4', Z5, Z6 and Z7 moieties containing a R5 moiety; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R5
may cyclize to form a C3-C7 heterocyclyl ring; wherein each R6 is
independently and individually selected from the group consisting
of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl, phenyl,
heteroaryl, and heterocyclyl; each R7 is selected from the group
consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl moiety
is partially or fully fluorinated, C1-C3alkyl, cyclopropyl, cyano,
or C1-C3alkoxy; each R8 is independently and individually selected
from the group consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein
the alkyl moiety is partially or fully fluorinated,
branchedC4-C7alkyl, carbocyclyl, phenyl, C1-C6phenylalkyl,
heteroaryl or heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2,
or R5; wherein two R3 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; D comprises a moiety taken from group consisting
of ##STR54## wherein the symbol (***) is the point of attachment to
the Y group of formula I; wherein E1A is taken from the groups
consisting of carbocyclyl, mono- and poly-heterocyclyl and mono-
and poly-heteroaryl; wherein E1B is taken from the groups
consisting of phenyl and naphthyl; wherein E2A is taken from the
group consisting of naphthyl, a 5-membered ring heteroaryl, or a
fused bicyclic heteroaryl; wherein E2B is taken from the group
consisting of phenyl, pyridyl, and pyrimidyl; X1 is selected from
the group consisting of O, S, NR3, --C(.dbd.O)--,
--O--(CH.sub.2)n-, --S--(CH.sub.2)n-, --NR3-(CH.sub.2)n-,
--O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1A or
E1B ring and the E2A or E2B ring are directly linked by a covalent
bond; and wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1A or E1B or E2A or E2B are directly linked to the Y
group of formula I; X3 is selected from the group consisting of
NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)q-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the either
the E1B ring or E2B ring are directly linked by a covalent bond;
and wherein the carbon atoms of --(CH2)q-, C2-C5alkenyl, and
C2-C5alkynyl moieties of X3 may be further substituted by one or
more C1-C6alkyl; X4 is selected from the group consisting of C1-C6
alkyl, C3-C6 branched alkyl; each Z1 is a substituent attached to a
ring carbon and is independently and individually selected from the
group consisting of hydroxyC1-C6alkyl, C2-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR55## and cyano wherein the site of
attachment to the A2 ring is meta to the point of attachment to the
A1 ring and wherein A2 is phenyl, cyano wherein the site of
attachment is to a substitutable position when A2 is pyridyl,
pyrimidinyl or a five-membered ring; Wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z1 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; each Z4' is a substituent attached
to a ring nitrogen and is independently and individually selected
from the group consisting of hydroxyC2-C6alkyl,
C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR56## wherein the symbol (#) indicates
the point of attachment of the Z4' moiety to the A1 ring of formula
I; in the event that Z4' contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
each Z7 is a substituent attached to a ring carbon and is
independently and individually selected from the group consisting
of hydroxyC2-C6alkyl, C1-C6alkoxyC1-C6alkyl, (R6).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--CO,
(R4).sub.2N--CO, --SO.sub.2R3', SOR3, --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6,
(CH.sub.2).sub.nN(R4)C(O)N(R4).sub.2, (CH.sub.2).sub.nN(R4)C(O)R5,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR57## cyano wherein the site of
attachment to the A2 ring is meta to the point of attachment to the
A1 ring and wherein A2 is phenyl, and cyano wherein the site of
attachment is to a substitutable position when A2 is pyridyl,
pyrimidinyl or a five-membered ring; In the foregoing definition of
Z7, alkyl moieties may optionally be substituted by one or more
C1-C6alkyl; Wherein the asterisk (*) indicates the point of
attachment of the Z1 moiety to the A2 ring; in the event that Z7
contains an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; wherein two R3 moieties
are independently and individually taken from the group consisting
of C1-C6alkyl and branched C3-C6alkyl and are attached to the same
nitrogen heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl
ring; wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl ring; and
n is 0-4; p is 1-4; q is 2-6, r is 0 or 1; and tautomers,
diastereomers, geometric isomers, enantiomers, hydrates, prodrugs,
and salts of any of the foregoing. 1.3.1 Preferred D Moieties
1.3.1a
[0084] Preferably, the compounds of formula I in 1.3 contain D
moieties wherein E1A is selected from the group consisting
cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, pyrrolidinyl
piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl;
[0085] wherein E2A is comprises the group consisting of
cyclopentyl, cyclohexyl, non-fused bicyclic rings comprising
pyridylpyridiminyl pyrimidinylpyrimidinyl, oxazolylpyrimidinyl,
thiazolylpyrimidinyl, imidazolylpyrimidinyl, isoxazolylpyrimidinyl,
isothiazolylpyrimidinyl, pyrazolylpyrimidinyl,
triazolylpyrimidinyl, oxadiazoylpyrimidinyl,
thiadiazoylpyrimidinyl, morpholinylpyrimidinyl,
dioxothiomorpholinylpyrimidinyl, thiomorpholinylpyrimidinyl, and
heterocyclyls selected from the group comprising oxetanyl,
azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl,
oxazolidinyl, imidazolonyl, pyranyl, thiopyranyl,
tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl,
thiomorpholinyl, dioxothiomorpholinyl, piperazinyl, azepinyl,
oxepinyl, diazepinyl, tropanyl, and homotropanyl.
1.3.1b
[0086] Additionally preferred D moieties of formula I in 1.3
comprise a formula ##STR58## X2 is selected from the group
consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct bond
wherein E2A or E2B is directly linked to the Y group of formula I.
1.3.1c
[0087] More preferred D moieties of 1.3.1b are wherein the E2A ring
is selected from the group comprising naphthyl, pyrrolyl, furyl,
thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl,
pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl,
pyrazinyl, pyridazinyl, triazinyl and fused bicyclic rings selected
from the group comprising indolyl, isoindolyl, isoindolinyl,
isoindolonyl, indazolyl, benzofuranyl, benzothienyl,
benzothiazolyl, benzothiazolonyl, benzoxazolyl, benzoxazolonyl,
benzisoxazolyl, benzisothiazolyl, benzimidazolyl, benzimidazolonyl,
benztriazolyl, imidazopyridinyl, imidazopyrimidinyl,
imidazolonopyrimidinyl, dihydropurinonyl, pyrrolopyrimidinyl,
purinyl, pyrazolopyridinyl, pyrazolopyrimidinyl,
isoxazolopyrimidinyl, isothiazolopyrimidinyl, furylopyrimidinyl,
thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl.
1.3.2 Preferred A2 Moieties
1.3.2a
[0088] Preferably, the compounds of formula I in section 1.3
contain A2 moieties as defined in section 1.2.2a.
1.3.2b
[0089] More preferred A2 moieties are selected from the group
consisting of ##STR59## wherein the symbol (**) is the point of
attachment to the A1 ring for formula I. 1.3.2c
[0090] Even more preferred A2 moieties are selected from the group
consisting of ##STR60## and wherein the symbol (**) is the point of
attachment to the A1 ring of formula I. 1.3.3 Preferred Classes of
Compounds 1.3.3a
[0091] Compounds as defined in 1.3.1a wherein the A2 group is
defined in 1.3.2a.
1.3.3b
[0092] Compounds as defined in 1.3.3a wherein the A2 group is
defined in 1.3.2b.
1.3.3c
[0093] Compounds as defined in 1.3.3a wherein the A2 group is
defined in 1.3.2c.
1.3.3d
[0094] Compounds as defined in 1.3.1b wherein the A2 group is
defined in 1.3.2a.
1.3.3e
[0095] Compounds as defined in 1.3.3c wherein the A2 group is
defined in 1.3.2b.
1.3.3f
[0096] Compounds as defined in 1.3.3c wherein the A2 group is
defined in 1.3.2c.
1.3.4 Preferred A1 Moieties
1.3.4a
[0097] These preferred A1 moieties are defined in 1.1.4a.
1.3.4b
[0098] These more preferred A1 moieties are defined in 1.1.4b.
1.3.4c
[0099] These even more preferred A1 moieties are defined in
1.1.4c.
1.3.5 Preferred W and Y Moieties
1.3.5a
[0100] (1) W and Y are each NH, and X.dbd.O; (2) W.dbd.NH,
Y.dbd.CHR4 and X.dbd.O; or (3) W.dbd.CHR4, Y.dbd.NH, and
X.dbd.O.
1.3.5b
[0101] W and Y are each NH and X.dbd.O.
1.3.6 Further Preferred Compounds
1.3.6a
[0102] The invention includes compounds of the formula ##STR61##
wherein A2 is selected from the group consisting of ##STR62##
wherein the symbol (**) denotes the attachment to the A1 moiety of
formula I; A1 is selected from the group consisting of ##STR63##
wherein the symbol (*) denotes the attachment to the W moiety of
formula I and the symbol (**) denotes the attachment to the A2
moiety of formula I; X is O, S, or NR3; D comprises a member of
2,3-dichlorophenyl, 2-fluorophenyl, 3-fluorophenyl, 4-fluorophenyl,
3-cyanophenyl, 2,3-difluorophenyl, 2,4-difluorophenyl,
3,4-difluorophenyl, 2,5-difluorophenyl, 3,5-difluorophenyl,
2,3,5-trifluorophenyl, 2,4,5-trifluorophenyl,
2,3,4-trifluorophenyl, 3,4,5-trifluorophenyl, 4-cyanophenyl,
3-fluoro-5-cyanophenyl, 3-(R8SO.sub.2)-phenyl,
3-(hydroxyC1-C3alkyl)-phenyl, 3-(R30-N.dbd.C(R6))-phenyl,
3-phenoxyphenyl, 4 phenoxyphenyl, ##STR64## ##STR65## ##STR66##
##STR67## ##STR68## wherein E1A is taken from the groups consisting
of cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, pyrrolidinyl
piperidinyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
furyl, imidazolyl, pyridyl, and pyrimidinyl; wherein E1B is taken
from the groups consisting of phenyl and naphthyl; wherein E2A is
taken from the group comprising naphthyl, pyrrolyl, furyl, thienyl,
oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl,
pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl,
pyrazinyl, pyridazinyl, triazinyl and f fused bicyclic rings
selected from the group consisting of indolyl, isoindolyl,
isoindolinyl, isoindolonyl, indazolyl, benzofuranyl, benzothienyl,
benzothiazolyl, benzothiazolonyl, benzoxazolyl, benzoxazolonyl,
benzisoxazolyl, benzisothiazolyl, benzimidazolyl, benzimidazolonyl,
benztriazolyl, imidazopyridinyl, imidazopyrimidinyl,
imidazolonopyrimidinyl, dihydropurinonyl, pyrrolopyrimidinyl,
purinyl, pyrazolopyridinyl, pyrazolopyrimidinyl,
isoxazolopyrimidinyl, isothiazolopyrimidinyl, furylopyrimidinyl,
thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl;
wherein E2B is taken from the group consisting of phenyl, pyridyl,
and pyrimidyl; wherein the symbol (***) denotes the attachment to
the Y moiety of formula I; X1 is selected from the group consisting
of O, S, NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I;
each R2 is selected from the group consisting of alkyl, branched
alkyl, fluoroalkyl, wherein the alkyl group is partially or fully
fluorinated, and R19 substituted C3-C8carbocyclyl wherein R19 is H
and C1-C6alkyl; X3 is selected from the group consisting of NR3,
--C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)q-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the either
the E1B ring or E2B ring are directly linked by a covalent bond;
and wherein the carbon atoms of --(CH2)q-, C2-C5alkenyl, and
C2-C5alkynyl moieties of X3 may be further substituted by one or
more C1-C6alkyl; X4 is selected from the group consisting of C1-C6
alkyl, C3-C6 branched alkyl; each R2' is selected from the group
consisting of halogen and R2; each R3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl; wherein two R3
moieties independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C7alkyl are attached to
the same nitrogen heteroatom, the two R3 moieties may cyclize to
form a C3-C7 heterocyclyl ring; each R4 is selected from the group
consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom may
cyclize to form a C3-C7 heterocyclyl ring; each R5 is independently
and individually selected from the group consisting of ##STR69##
and wherein the symbol (##) is the point of attachment to
respective R8, R10, Z4, Z5, Z6 or A2 ring moieties containing a R5
moiety; wherein two R4 moieties independently and individually
taken from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of R5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein each R6 is independently and individually selected from the
group consisting of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl,
phenyl, heteroaryl, and heterocyclyl; each R7 is selected from the
group consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, C1-C3alkyl, cyclopropyl,
cyano, or C1-C3alkoxy; each R8 is independently and individually
selected from the group consisting of C1-C6alkyl, C1-C6 fluoroalkyl
wherein the alkyl moiety is partially or fully fluorinated,
branchedC4-C7alkyl, carbocyclyl, phenyl, C1-C6phenylalkyl,
heteroaryl or heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2,
or R5; wherein two R3 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; each Z1 is a substituent attached to a ring
carbon and is independently and individually selected from the
group consisting of hydroxyC1-C6alkyl, C2-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NCR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR70##
[0103] In the foregoing definition of Z1, alkyl moieties may
optionally be substituted by one or more C1-C6alkyl;
Wherein the asterisk (*) indicates the point of attachment of the
Z1 moiety to the A2 ring;
in the event that Z1 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more
C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring;
[0104] wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z1 may cyclize to form a C3-C7 heterocyclyl ring;
each Z4 is a substituent attached to a ring nitrogen and is
independently and individually selected from the group consisting
of H, C1-C6alkyl, hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl,
(R4).sub.2N--C2-C6alkyl, (R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR71## wherein the symbol (#) indicates
the point of attachment of the Z4 moiety to the A2 ring for formula
I; in the event that Z4 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z4 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z4 may cyclize to
form a C3-C7 heterocyclyl ring; Z5 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, halogen, fluoroalkyl, cyano, hydroxyl, alkoxy,
oxo, aminocarbonyl, carbonylamino, aminosulfonyl, sulfonylamino,
--N(R3).sub.2, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-N(R4).sub.2, --R5, --O--(CH.sub.2)q-O-Alkyl,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-O-Alkyl,
--N(R3)--(CH.sub.2)q-N(R4).sub.2, --O--(CH.sub.2)q-R5, and
--N(R3)-(CH.sub.2)q-R5; wherein two R3 moieties are independently
and individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z5 may cyclize to form a C3-C7 heterocyclyl ring;
Each Z6 is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, hydroxyl,
C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8, (R4).sub.2N--, --R5,
--N(R4)COR8, --N(R3)SO.sub.2R6-, --CON(R3).sub.2, --CON(R4).sub.2,
--COR5, --SO.sub.2NHR4, heteroaryl, heterocyclyl, heteroaryloxy,
heterocyclyloxy, arylamino, heteroarylamino, and heterocyclylamino;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z6 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z6 may cyclize to
form a C3-C7 heterocyclyl ring; each Z7 is a substituent attached
to a ring carbon and is independently and individually selected
from the group consisting of hydroxyC2-C6alkyl,
C1-C6alkoxyC1-C6alkyl, (R6).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--CO,
(R4).sub.2N--CO, --SO.sub.2R3', SOR3, --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6,
(CH.sub.2).sub.nN(R4)C(O)N(R4).sub.2, (CH.sub.2).sub.nN(R4)C(O)R5,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR72## cyano wherein the site of
attachment to the A2 ring is meta to the point of attachment to the
A1 ring and wherein A2 is phenyl, and cyano wherein the site of
attachment is to a substitutable position when A2 is pyridyl,
pyrimidinyl or a five-membered ring; In the foregoing definition of
Z7, alkyl moieties may optionally be substituted by one or more
C1-C6alkyl; Wherein the asterisk (*) indicates the point of
attachment of the Z1 moiety to the A2 ring; in the event that Z7
contains an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; wherein two R3 moieties
are independently and individually taken from the group consisting
of C1-C6alkyl and branched C3-C6alkyl and are attached to the same
nitrogen heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl
ring; wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z7 may cyclize to form a C3-C7 heterocyclyl ring; and
n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v is 1 or 2; and
tautomers, diastereomers, geometric isomers, enantiomers, hydrates,
prodrugs and salts of any of the foregoing. 1.3.6b
[0105] The following specific compounds are most preferred:
1-(3-t-butyl-1-(3-(pyridin-3-yl)phenyl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3--
yloxy)phenyl)urea,
1-(1-(3-(1H-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(1-oxois-
oindolin-4-yl)phenyl)urea
1.3.7 Methods
1.3.7a Methods of Protein Modulation
[0106] The invention includes methods of modulating kinase activity
of a variety of kinases, e.g. C-Abl kinase, BCR-Abl kinase. The
kinases may be wildtype kinases, oncogenic forms thereof, aberrant
fusion proteins thereof or polymorphs of any of the foregoing. The
method comprises the step of contacting the kinase species with
compounds of the invention and especially those set forth in
sections 1.3 and 1.3.6a. The kinase species may be activated or
unactivated, and the species may be modulated by phosphorylations,
sulfation, fatty acid acylations glycosylations, nitrosylation,
cystinylation (i.e. proximal cysteine residues in the kinase react
with each other to form a disulfide bond) or oxidation. The kinase
activity may be selected from the group consisting of catalysis of
phospho transfer reactions, kinase cellular localization, and
recruitment of other proteins into signaling complexes through
modulation of kinase conformation.
[0107] The methods of the invention may also involve the step of
inducing, synergizing, or promoting the binding of a second
modulator compound of said kinase, especially C-Abl kinase or
BCR-Abl kinase, to form a ternary adduct, such co-incident binding
resulting in enhanced biological modulation of the kinase when
compared to the biological modulation of the protein affected by
either of said compounds alone. The second compound may interact at
a substrate, co-factor or regulatory site on the kinase, with the
second site being distinct from the site of interaction of the
first compound. For example, the second site may be an ATP
co-factor site. The second compounds may be taken from the group
consisting of
N-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)-4-((4-methylpi-
perazin-1-yl)methyl)benzamide (Gleevec);
N-(2-chloro-6-methylphenyl)-2-(6-(4-(2-hydroxyethyl)piperazin-1-yl)-2-met-
hylpyrimidin-4-ylamino)thiazole-5-carboxamide (BMS-354825);
6-(2,6-dichlorophenyl)-2-(3-(hydroxymethyl)phenylamino)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one (PD 166326);
6-(2,6-dichlorophenyl)-8-methyl-2-(3-(methylthio)phenylamino)pyrido[2,3-d-
]pyrimidin-7(8H)-one (PD 173955);
6-(2,6-dichlorophenyl)-2-(4-fluoro-3-methylphenylamino)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one (PD180970);
6-(2,6-dichlorophenyl)-2-(4-ethoxyphenylamino)-8-methylpyrido[2,3-d]pyrim-
idin-7(8H)-one (PD 173958);
6-(2,6-dichlorophenyl)-2-(4-fluorophenylamino)-8-methylpyrido[2,3-d]pyrim-
idin-7(8H)-one (PD 173956);
6-(2,6-dichlorophenyl)-2-(4-(2-(diethylamino)ethoxy)phenylamino)-8-methyl-
pyrido[2,3-d]pyrimidin-7(8H)-one (PD 166285);
2-(4-(2-aminoethoxy)phenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,-
3-d]pyrimidin-7(8H)-one;
N-(3-(6-(2,6-dichlorophenyl)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrim-
idin-2-ylamino)phenyl)acetamide (SKI DV-MO16);
2-(4-aminophenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 1-10);
6-(2,6-dichlorophenyl)-2-(3-hydroxyphenylamino)-8-methylpyrido[2,3-d]pyri-
midin-7(8H)-one (SKI DV2-89);
2-(3-aminophenylamino)-6-(2,6-dichlorophenyl)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 2-43);
N-(4-(6-(2,6-dichlorophenyl)-8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrim-
idin-2-ylamino)phenyl)acetamide (SKI DV-M017);
6-(2,6-dichlorophenyl)-2-(4-hydroxyphenylamino)-8-methylpyrido[2,3-d]pyri-
midin-7(8H)-one (SKI DV-M017);
6-(2,6-dichlorophenyl)-2-(3-ethylphenylamino)-8-methylpyrido[2,3-d]pyrimi-
din-7(8H)-one (SKI DV 2 87).
1.3.7b Treatment Methods
[0108] The methods of the invention also include treating
individuals suffering from a condition selected from the group
consisting of cancer and hyperproliferative diseases. These methods
comprise administering to such individuals compounds of the
invention, and especially those of section 1.3 and 1.3.6a.
Exemplary conditions include chronic myelogenous leukemia, acute
lymphocytic leukemia, gastrointestinal stromal tumors, and
hypereosinophillic syndrome. The administration method is not
critical, and may be from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
1.3.8 Pharmaceutical Preparations
[0109] The compounds of the invention, especially those of 1.3 and
1.3.6a may form a part of a pharmaceutical composition by combining
one or more such compounds with a pharmaceutically acceptable
carrier. Additionally, the compositions may include an additive
selected from the group consisting of adjuvants, excipients,
diluents, and stablilizers.
1.3.9 Kinase/Compound Adducts
[0110] The invention also provides adducts in the form of compounds
of the invention bound with a species of kinase such as a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing. The compounds are
advantageously selected from the groups defined in sections 1.3 and
1.3.6a.
2. Second Aspect of the Invention--VEGFR and PDGFR Kinase Modulator
Compounds, Methods, Preparations and Adducts
2.1 Generally--A2 Bicyclic Compounds
[0111] The invention includes compounds of formula I as defined in
section 1.1, wherein each R2 is selected from the group consisting
of monocyclic heteroaryl, C1-C6alkyl, branched C3-C7alkyl, and R19
substituted C3-C8carbocyclyl wherein R19 is H or C1-C6alkyl,
C1-C6fluoroalkyl wherein the alkyl group is partially or fully
fluorinated, phenyl wherein the phenyl group is optionally
substituted by one or more fluorine substituents,
[0112] wherein Z1' is independently and individually selected from
the group consisting of H, C1-C6alkyl, C3-C7cycloalkyl,
hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, (R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl;
[0113] wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z1' may cyclize to form a C3-C7 heterocyclyl ring;
each Z2 is independently and individually selected from the group
consisting of hydroxyl, hydroxyC1-C6alkyl, cyano, (R3).sub.2N--,
(R4).sub.2N--, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)--(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl, carboxyl,
carboxyC1-C6alkyl, C1-C6alkoxycarbonyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2,
(R4).sub.2NSO.sub.2, --SO.sub.2R5-, --(CH.sub.2).sub.nN(R4)C(O)R8,
.dbd.O, .dbd.NOH, .dbd.N(OR6), heteroarylC1-C6alkyl,
heterocyclylC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, heterocyclylaminoC1-C6alkyl, or moieties
of the formulae ##STR73## ##STR74## wherein the symbol (#)
indicates the point of attachment of the Z2 moiety to the A2 ring
of formula I; in the event that Z2 contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z2 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z2 may cyclize to form a C3-C7 heterocyclyl ring;
each Z3 is independently and individually selected from the group
consisting of H, C1-C6alkyl, hydroxyl, hydroxyC1-C6alkyl, cyano,
C1-C6alkoxy, C1-C6alkoxyC1-C6alkyl, halogen, CF.sub.3,
(R3).sub.2N--, (R4).sub.2N--, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, R8CO--,
(R4).sub.2N--CO--C1-C6alkyl, carboxyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R3).sub.2NSO.sub.2, --SO.sub.2R3, SOR3, (R4).sub.2NSO.sub.2,
--SO.sub.2R4, --SOR4, --(CH.sub.2).sub.nN(R4)C(O)R8,
--C.dbd.(NOH)R6, --C.dbd.(NOR3)R6, heteroaryl, heterocyclyl,
heteroarylC1-C6alkyl, heterocyclylC1-C6alkyl, heteroaryloxy,
heterocyclyloxy, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylamino, heteroarylamino,
heterocyclylamino, arylaminoC1-C6alkyl, heteroarylaminoC1-C6alkyl,
heterocyclylaminoC1-C6alkyl, or moieties of the formulae ##STR75##
##STR76## wherein the symbol (#) indicates the point of attachment
of the Z3 moiety to the A2 ring of formula I; in the event that Z3
contains an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; wherein two R3 moieties
are independently and individually taken from the group consisting
of C1-C6alkyl and branched C3-C6alkyl and are attached to the same
nitrogen heteroatom of Z3 may cyclize to form a C3-C7 heterocyclyl
ring; wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z3 may cyclize to form a C3-C7 heterocyclyl ring;
2.1.1 Preferred D Moieties 2.1.1a
[0114] Preferred compounds of Formula I as defined above in section
2.1 contain D moieties as defined in section 1.1.1a.
2.1.1b
[0115] Additionally preferred compounds of Formula I as defined
above in section 2.1 contain D moieties as defined in section
1.1.1b.
2.1.1c
[0116] More preferred compounds of Formula I as defined above in
section 2.1.1b contain D moieties as defined in section 1.1.1c.
2.1.2 Preferred A2 Moieties
2.1.2a
[0117] Compounds of Formula I as defined above in section 2.1 have
preferred A2 moieties as defined in section 1.1.2a;
2.1.2b More Preferred A2 Moieties
[0118] Compounds of Formula I as defined above in section 2.1 have
more preferred A2 moieties selected from group consisting of
##STR77## ##STR78## ##STR79## ##STR80## and wherein the symbol (**)
is the point of attachment to the A1 ring for formula I; wherein
each Z3 and Z5 is independently attached to either aryl or
heteroaryl ring of the A2 bicyclic ring. 2.1.2c
[0119] Still more preferred compounds of Formula I as defined above
in section 2.1 have A2 moieties selected from group consisting of
##STR81## ##STR82## and wherein the symbol (**) is the point of
attachment to the A1 ring of formula I; wherein each Z3 and Z5 is
independently attached to either aryl or heteroaryl ring of the A2
bicyclic ring. 2.1.3 Preferred Classes of Compounds 2.1.3a
[0120] Compounds as defined in 2.1.1a wherein the A2 group is
defined in 2.1.2a.
2.1.3b
[0121] Compounds as defined in 2.1.3a wherein the A2 group is
defined in 2.1.2b.
2.1.3c
[0122] Compounds as defined in 2.1.3a wherein the A2 group is
defined in 2.1.2c.
2.1.3d
[0123] Compounds as defined in 2.1.1b wherein the A2 group is
defined in 2.1.2a.
2.1.3e
[0124] Compounds as defined in 2.1.3c wherein the A2 group is
defined in 2.1.2b.
2.1.3f
[0125] Compounds as defined in 2.1.3c wherein the A2 group is
defined in 2.1.2c.
2.1.4 Preferred A1 Moieties
2.1.4a
[0126] Compounds of Formula I as defined above in section 2.1 have
preferred A1 moieties selected from group defined in section
1.1.4a;
each R7 is selected from the group consisting of H, halogen,
C1-C3fluoroalkyl wherein the alkyl moiety is partially or fully
fluorinated, C1-C3alkyl, cyclopropyl, cyano, or C1-C3alkoxy;
2.1.4b
[0127] Compounds of Formula I as defined above in section 2.1 have
more preferred A1 moieties selected from group consisting of
##STR83## wherein the symbol (*) denotes the attachment to the W
moiety of formula I and the symbol (**) denotes the attachment to
the A2 moiety of formula I. 2.1.4c
[0128] Compounds of Formula I as defined above in section 2.1 have
even more preferred A1 moieties selected from group consisting of
##STR84## wherein the symbol (*) denotes the attachment to the W
moiety of formula I and the symbol (**) denotes the attachment to
the A2 moiety of formula I. 2.1.5 Preferred W and Y Moieties
2.1.5a
[0129] (1) W and Y are each NH, and X.dbd.O; (2) W.dbd.NH,
Y.dbd.CHR4 and X.dbd.O; or (3) W.dbd.CHR4, Y.dbd.NH, and
X.dbd.O.
2.1.5b
[0130] W and Y are each NH and X.dbd.O.
2.1.6 Further Preferred Compounds
2.1.6a
[0131] Further preferred compounds are of the formula ##STR85##
wherein A2 is selected from the group consisting of ##STR86##
##STR87## wherein each Z3 and Z5 is independently attached to
either aryl or heteroaryl ring of the A2 bicyclic ring; wherein the
symbol (**) denotes the attachment to the A1 moiety of formula I;
A1 is selected from the group consisting of ##STR88## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I; X is O, S, or NR3; D comprises a member of 2,3-dichlorophenyl,
3,4-dichlorophenyl, 3,5-dichlorophenyl, 4-chlorophenyl,
3-chlorophenyl, 3-bromophenyl, 2,3-difluorophenyl,
2,4-difluorophenyl, 3,4-difluorophenyl, 2,5-difluorophenyl,
3,5-difluorophenyl, 2,3,5-trifluorophenyl, 2,4,5-trifluorophenyl,
2,3,4-trifluorophenyl, 3,4,5-trifluorophenyl, 4-cyanophenyl,
3-(R8SO.sub.2)-phenyl, 3-phenoxyphenyl, 4 phenoxyphenyl, ##STR89##
##STR90## ##STR91## ##STR92## wherein E1 is selected from the group
consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl;
wherein the symbol (***) denotes the attachment to the Y moiety of
formula I; X1 is selected from the group consisting of O, S, NR3,
--C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I;
each R2 is selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, and R19 substituted C3-C8carbocyclyl wherein
R19 is H or C1-C6alkyl, C1-C6fluoroalkyl wherein the alkyl group is
partially or fully fluorinated, phenyl wherein the phenyl group is
optionally substituted by one or more fluorine substituents, or
monocyclic heteroaryl; each R2' is selected from the group
consisting of halogen and R2; each R3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl; wherein two R3
moieties independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C7alkyl are attached to
the same nitrogen heteroatom, the two R3 moieties may cyclize to
form a C3-C7 heterocyclyl ring; each R4 is selected from the group
consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom may
cyclize to form a C3-C7 heterocyclyl ring; each R5 is independently
and individually selected from the group consisting of ##STR93##
and wherein the symbol (##) is the point of attachment to
respective R8, R10, R13, Z2, Z3, Z4, Z5, or A2 ring moieties
containing a R5 moiety; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R5 may cyclize to form a C3-C7
heterocyclyl ring; wherein each R6 is independently and
individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, phenyl, heteroaryl, and
heterocyclyl; each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or C1-C3alkoxy;
each R8 is independently and individually selected from the group
consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, branchedC4-C7alkyl,
carbocyclyl, phenyl, C1-C6phenylalkyl, heteroaryl or
heteroarylC1-C6alkyl, heterocyclyl, heterocyclylC1-C6alkyl, OH,
C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2, or R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; each R10 is independently and individually
selected from the group consisting of CO.sub.2H,
CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; each R13 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, carbocyclyl, hydroxyC2-C7alkyl, C1-C6alkoxyC2-C7alkyl,
(R4).sub.2N--CO, (R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.q,
R5-C2-C6alkylN(R4)-(CH.sub.2).sub.q,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.q,
R5-C2-C6alkyl-O--(CH.sub.2).sub.q, --(CH.sub.2).sub.qN(R4)C(O)R8,
aryl, arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl,
heterocyclyl, heterocyclylC1-C6alkyl, aryloxyC2-C6alkyl,
heteroaryloxyC2-C6alkyl, heterocyclyloxyC2-C6alkyl,
arylaminoC2-C6alkyl, heteroarylaminoC2-C6alkyl, and
heterocyclylaminoC2-C6alkyl; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R13 may cyclize to form a C3-C7
heterocyclyl ring; each R14 is independently and respectively
selected from the group consisting of H and C1-C6alkyl; wherein Z1'
is independently and individually selected from the group
consisting of H, C1-C6alkyl, C3-C7cycloalkyl, hydroxyC1-C6alkyl,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, hydroxyl, hydroxyC1-C6alkyl, cyano, C1-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, halogen, CF.sub.3, (R3).sub.2N--,
(R4).sub.2N--, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, R8CO--,
(R4).sub.2N--CO--C1-C6alkyl, carboxyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R3).sub.2NSO.sub.2, --SO.sub.2R3, SOR3, (R4).sub.2NSO.sub.2,
--SO.sub.2R4, --SOR4, --(CH.sub.2).sub.nN(R4)C(O)R8,
--C.dbd.(NOH)R6, --C.dbd.(NOR3)R6, heteroaryl, heterocyclyl,
heteroarylC1-C6alkyl, heterocyclylC1-C6alkyl, heteroaryloxy,
heterocyclyloxy, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylamino, heteroarylamino,
heterocyclylamino, arylaminoC1-C6alkyl, heteroarylaminoC1-C6alkyl,
heterocyclylaminoC1-C6alkyl, or moieties of the formulae ##STR94##
##STR95## wherein the symbol (#) indicates the point of attachment
of the Z3 moiety to the A2 ring of formula I; in the event that Z3
contains an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; wherein two R3 moieties
are independently and individually taken from the group consisting
of C1-C6alkyl and branched C3-C6alkyl and are attached to the same
nitrogen heteroatom of Z3 may cyclize to form a C3-C7 heterocyclyl
ring; wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z3 may cyclize to form a C3-C7 heterocyclyl ring;
each Z4 is independently and individually selected from the group
consisting of H, C1-C6alkyl, hydroxyC2-C6alkyl,
C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR96## ##STR97## wherein the symbol (#)
indicates the point of attachment of the Z4 moiety to the A2 ring
for formula I; in the event that Z4 contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2; V, V1, and V2 are each independently and respectively
selected from the group consisting of O and H.sub.2; and tautomers,
diastereomers, geometric isomers, enantiomers, hydrates, prodrugs,
and salts of any of the foregoing. 2.1.6b
[0132] The following specific compounds of Formula I are more
preferred:
1-(3-t-butyl-1-(1-methyl-1H-indol-5-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorop-
henyl)urea,
1-(3-t-butyl-1-(1H-indazol-5-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)u-
rea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2-
,3-dichlorophenyl)urea,
2-(3-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)naphthal-
en-1-yl)acetic acid,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
1-(3-t-butyl-1-(1-(methylcarbamoyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1-
H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-
-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3-d-
ichlorophenyl)urea,
1-(3-t-butyl-1-(1-carbamimidoyl-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyraz-
ol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,4,5-
-trifluorophenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3,5-
-trifluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,3,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)naphthalen-2-y-
l)-1H-pyrazol-5-yl)-3-(2,3,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3-d-
ifluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,5-difluorophenyl)urea,
1-(3-t-butyl-1-(1H-indol-5-yl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phe-
nyl)urea,
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-y-
loxy)phenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(4-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)naphthalen-2-y-
l)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(3-(-
pyridin-3-yloxy)phenyl)urea,
1-(1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(py-
ridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(5-chloropyridin-3-yloxy)phenyl)urea,
6-(3-t-butyl-5-(3-(3-(pyridin-3-yloxy)phenyl)ureido)-1H-pyrazol-1-yl)-1,2-
,3,4-tetrahydroisoquinoline-3-carboxylic acid,
1-(3-t-butyl-1-(3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazo-
l-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(3-(methylcarbamoyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1-
H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1-(methylcarbamoyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1-
H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(py-
ridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(quinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phe-
nyl)urea,
1-(1-(1-((2,3-dihydroxypropyl)carbamoyl)-1,2,3,4-tetrahydroisoqu-
inolin-6-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-cyclopentyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-(piperazin-1-yl)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2-
-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(1-(2-(2-aminoethylamino)quinolin-6-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-cyclopentyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-(dimethylamino)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-((R)-3-(dimethylamino)pyrrolidin-1-yl)quinolin-6-yl)-1H-
-pyrazol-5-yl)-3-(4-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(1-(2-aminoquinolin-6-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(2-(methylcar-
bamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-(methylamino)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2-(m-
ethylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-(1-oxoisoindolin-4-yl)phenyl)urea,
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(4-(1-oxoisoindolin-4-yl-
)phenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(4-(1--
oxoisoindolin-4-yl)phenyl)urea,
6-(3-t-butyl-5-(3-(4-(1-oxoisoindolin-4-yl)phenyl)ureido)-1H-pyrazol-1-yl-
)-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid,
6-(3-t-butyl-5-(3-(4-(1-oxoisoindolin-4-yl)phenyl)ureido)-1H-pyrazol-1-yl-
)-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid,
2.1.7 Methods
2.1.7a Methods of Protein Modulation
[0133] The invention includes methods of modulating kinase activity
of a variety of kinases, e.g. receptor tyrosine kinases including
VEGFR1, VEGFR2, FLT-1, FLT-3, PDGFRa, PDGFRb, FGFR1, FGFR2, FGFR3,
FGFR4, TrkA, TrkB, EGFR, EPHA1, EPHA2, EPHA3, EPHA4, EPHA5, EPHA6,
EPHA7, EPHA8, EPHA9, EPHA10, EPHB1, EPHB2, EPHB3, EPHB4, EPHB5,
EPHB6, EPHB7, EPHB8. The kinases may be wildtype kinases, oncogenic
forms thereof, aberrant fusion proteins thereof or polymorphs of
any of the foregoing. The method comprises the step of contacting
the kinase species with compounds of the invention and especially
those set forth in sections 2.1 and 2.1.6a. The kinase species may
be activated or unactivated, and the species may be modulated by
phosphorylations, sulfation, fatty acid acylations glycosylations,
nitrosylation, cystinylation (i.e. proximal cysteine residues in
the kinase react with each other to form a disulfide bond) or
oxidation. The kinase activity may be selected from the group
consisting of catalysis of phospho transfer reactions, kinase
cellular localization, and recruitment of other proteins into
signaling complexes through modulation of kinase conformation.
2.1.7b Treatment Methods
[0134] The methods of the invention also include treating
individuals suffering from a condition selected from the group
consisting of cancer, secondary cancer growth arising from
metastasis, hyperproliferative diseases, and diseases characterized
by hyper-vascularization. These methods comprise administering to
such individuals compounds of the invention, and especially those
of section 2.1 and 2.1.6a. Exemplary conditions include
glioblastomas, ovarian cancer, pancreatic cancer, prostate cancer,
lung cancers, breast cancers, kidney cancers, cervical carcinomas,
metastasis of primary solid tumor secondary sites, ocular diseases
characterized by hyperproliferation leading to blindness including
various retinopathies including diabetic retinopathy and
age-related macular degeneration, or rheumatoid arthritis
characterized by the in-growth of a vascularized pannus. The
administration method is not critical, and may be from the group
consisting of oral, parenteral, inhalation, and subcutaneous.
2.1.8 Pharmaceutical Preparations
[0135] The compounds of the invention, especially those of 2.1 and
2.1.6a may form a part of a pharmaceutical composition by combining
one or more such compounds with a pharmaceutically acceptable
carrier. Additionally, the compositions may include an additive
selected from the group consisting of adjuvants, excipients,
diluents, and stablilizers.
2.1.9 Kinase/Compound Adducts
[0136] The invention also provides adducts in the form of compounds
of the invention bound with a species of kinase such as a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing. The compounds are
advantageously selected from the groups defined in sections 2.1 and
2.1.6a.
2.2 Generally--Monocyclic A2 Compounds with Polycyclic E2 Rings
[0137] The invention includes compounds of the formula I as defined
in section 1.2 wherein each R2 is selected from the group
consisting of monocyclic heteroaryl, C1-C6alkyl, branched
C3-C7alkyl, and R19 substituted C3-C8carbocyclyl wherein R19 is H
or C1-C6alkyl, C1-C6fluoroalkyl wherein the alkyl group is
partially or fully fluorinated, phenyl wherein the phenyl group is
optionally substituted by one or more fluorine substituents; each
Z1 is a substituent attached to a ring carbon and is independently
and individually selected from the group consisting of
hydroxyC1-C6alkyl, C2-C6alkoxy, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR98## ##STR99## cyano wherein the
site of attachment to the A2 ring is meta to the point of
attachment to the A1 ring and wherein A2 is phenyl, and cyano
wherein the site of attachment is to a substitutable position when
A2 is pyridyl, pyrimidinyl or a five-membered ring; wherein the
asterisk (*) indicates the point of attachment of the Z1 moiety to
the A2 ring; in the event that Z1 contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z1 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z1 may cyclize to form a C3-C7 heterocyclyl ring;
wherein Z1' is independently and individually selected from the
group consisting of H, C1-C6alkyl, C3-C7cycloalkyl,
hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, (R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4' is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR100## ##STR101## wherein the symbol
indicates the point of attachment of the Z4' moiety to the A1 ring
of formula I; in the event that Z4' contains an alkyl or alkylene
moiety, such moieties may be further substituted with one or more
C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4' may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4' may cyclize to form a C3-C7 heterocyclyl ring;
2.2.1 Preferred D Moieties 2.2.1a
[0138] Preferably, the compounds of formula I in 2.2 contain D
moieties wherein E1 and E2 are as defined in section 1.2.1
2.2.1b
[0139] Additionally preferred D moieties of formula I in 2.2 are as
defined in section 1.2.1b
2.2.1c
[0140] More preferred D moieties of 2.2.1b are wherein E2 is
defined as in section 1.2.1c
2.2.2 Preferred A2 Moieties
2.2.2a
[0141] Compounds of Formula I as defined above in section 2.2 have
preferred A2 moieties as defined in section 1.2.2a;
[0142] wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z1' may cyclize to form a C3-C7 heterocyclyl ring;
each Z4 is a substituent attached to a ring nitrogen and is
independently and individually selected from the group consisting
of H, C1-C6alkyl, hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl,
(R4).sub.2N--C2-C6alkyl, (R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR102## ##STR103## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2. 2.2.2b
[0143] More preferred A2 moieties are selected from the group
consisting of ##STR104## and wherein the symbol (**) is the point
of attachment to the A1 ring for formula I. 2.2.2c
[0144] Even more preferred A2 moieties are selected from the group
consisting of ##STR105## and wherein the symbol (**) is the point
of attachment to the A1 ring of formula I. 2.2.3 Preferred Classes
of Compounds 2.2.3a
[0145] Compounds as defined in 2.2.1a wherein the A2 group is
defined in 2.2.2a.
2.2.3b
[0146] Compounds as defined in 2.2.3a wherein the A2 group is
defined in 2.2.2b.
2.2.3c
[0147] Compounds as defined in 2.2.3a wherein the A2 group is
defined in 2.2.2c.
2.2.3d
[0148] Compounds as defined in 2.2.1b wherein the A2 group is
defined in 2.2.2a.
2.2.3e
[0149] Compounds as defined in 2.2.3c wherein the A2 group is
defined in 2.2.2b.
2.2.3f
[0150] Compounds as defined in 2.2.3c wherein the A2 group is
defined in 2.2.2c.
2.2.4 Preferred A1 Moieties
2.2.4a
[0151] These preferred A1 moieties are defined in 2.1.4a.
2.2.4b
[0152] These more preferred A1 moieties are defined in 2.1.4b.
2.2.4c
[0153] These even more preferred A1 moieties are defined in
2.1.4c.
2.2.5 Preferred W and Y Moieties
2.2.5a
[0154] (1) W and Y are each NH, and X.dbd.O; (2) W.dbd.NH,
Y.dbd.CHR4 and X.dbd.O; or (3) W.dbd.CHR4, Y.dbd.NH, and
X.dbd.O.
2.2.5b
[0155] W and Y are each NH and X.dbd.O.
2.2.6 Further Preferred Compounds
2.2.6a
[0156] Further preferred compounds are of the formula ##STR106##
wherein A2 is selected from the group consisting of ##STR107##
wherein the symbol (**) denotes the attachment to the A1 moiety of
formula I; A1 is selected from the group consisting of ##STR108##
wherein the symbol (*) denotes the attachment to the W moiety of
formula I and the symbol (**) denotes the attachment to the A2
moiety of formula I; X is O, S, or NR3; D comprises a member of
##STR109## wherein E1 is selected from the group consisting
cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, pyrrolidinyl
piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl; wherein the
symbol (***) denotes the attachment to the Y moiety of formula I;
X1 is selected from the group consisting of O, S, NR3,
--C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I;
each R2 is selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, and R19 substituted C3-C8carbocyclyl wherein
R19 is H or C1-C6alkyl, C1-C6fluoroalkyl wherein the alkyl group is
partially or fully fluorinated, phenyl wherein the phenyl group is
optionally substituted by one or more fluorine substituents, or
monocyclic heteroaryl; each R2' is selected from the group
consisting of halogen and R2; each R3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl; wherein two R3
moieties independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C7alkyl are attached to
the same nitrogen heteroatom, the two R3 moieties may cyclize to
form a C3-C7 heterocyclyl ring; each R4 is selected from the group
consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom may
cyclize to form a C3-C7 heterocyclyl ring; each R5 is independently
and individually selected from the group consisting of ##STR110##
and wherein the symbol (##) is the point of attachment to
respective R8, R10, Z1, Z4, Z5, Z6 or A2 ring moieties containing a
R5 moiety; wherein two R4 moieties independently and individually
taken from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of R5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein each R6 is independently and individually selected from the
group consisting of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl,
phenyl, heteroaryl, and heterocyclyl; each R7 is selected from the
group consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, C1-C3alkyl, cyclopropyl,
cyano, or C1-C3alkoxy; each R8 is independently and individually
selected from the group consisting of C1-C6alkyl, C1-C6 fluoroalkyl
wherein the alkyl moiety is partially or fully fluorinated,
branchedC4-C7alkyl, carbocyclyl, phenyl, C1-C6phenylalkyl,
heteroaryl or heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2,
or R5; wherein two R3 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; each Z1 is a substituent attached to a ring
carbon and is independently and individually selected from the
group consisting of hydroxyC1-C6alkyl, C2-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR111## ##STR112## cyano wherein the
site of attachment to the A2 ring is meta to the point of
attachment to the A1 ring and wherein A2 is phenyl, and cyano
wherein the site of attachment is to a substitutable position when
A2 is pyridyl, pyrimidinyl or a five-membered ring; In the
foregoing definition of Z1, alkyl moieties may optionally be
substituted by one or more C1-C6alkyl; Wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z1 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
In the foregoing definition of Z1, alkyl moieties may optionally be
substituted by one or more C1-C6alkyl; Wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z1 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; wherein Z1' is independently and
individually selected from the group consisting of H, C1-C6alkyl,
C3-C7cycloalkyl, hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4 is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR113## ##STR114## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2; and tautomers, diastereomers, geometric isomers,
enantiomers, hydrates, prodrugs and salts of any of the foregoing.
2.2.6b
[0157] The following specific compounds of Formula I are more
preferred:
1-(1-(3-(1H-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(6-(thia-
zol-4-yl)pyrimidin-4-yloxy)phenyl)urea,
1-(2-(3-(2-amino-2-oxoethyl)phenyl)-5-t-butylthiophen-3-yl)-3-(4-(4-(pyri-
din-3-yl)pyrimidin-2-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(4-(i-
soxazol-4-yl)pyrimidin-2-yl)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(4-(p-
yridin-3-yl)pyrimidin-2-yloxy)phenyl)urea,
1-(1-(3-(1H-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(4-(pyri-
din-3-yl)pyrimidin-2-yloxy)phenyl)urea
2.2.7 Methods
2.2.7a Methods of Protein Modulation
[0158] The invention includes methods of modulating kinase activity
of a variety of kinases, e.g. receptor tyrosine kinases including
VEGFR1, VEGFR2, FLT-1, FLT-3, PDGFRa, PDGFRb, FGFR1, FGFR2, FGFR3,
FGFR4, TrkA, TrkB, EGFR, EPHA1, EPHA2, EPHA3, EPHA4, EPHA5, EPHA6,
EPHA7, EPHA8, EPHA9, EPHA10, EPHB1, EPHB2, EPHB3, EPHB4, EPHB5,
EPHB6, EPHB7, EPHB8. The kinases may be wildtype kinases, oncogenic
forms thereof, aberrant fusion proteins thereof or polymorphs of
any of the foregoing. The method comprises the step of contacting
the kinase species with compounds of the invention and especially
those set forth in sections 2.2 and 2.2.6a. The kinase species may
be activated or unactivated, and the species may be modulated by
phosphorylations, sulfation, fatty acid acylations glycosylations,
nitrosylation, cystinylation (i.e. proximal cysteine residues in
the kinase react with each other to form a disulfide bond) or
oxidation. The kinase activity may be selected from the group
consisting of catalysis of phospho transfer reactions, kinase
cellular localization, and recruitment of other proteins into
signaling complexes through modulation of kinase conformation.
2.2.7b Treatment Methods
[0159] The methods of the invention also include treating
individuals suffering from a condition selected from the group
consisting of cancer, secondary cancer growth arising from
metastasis, hyperproliferative diseases, and diseases characterized
by hyper-vascularization. These methods comprise administering to
such individuals compounds of the invention, and especially those
of section 2.2 and 2.2.6a. Exemplary conditions include
glioblastomas, ovarian cancer, pancreatic cancer, prostate cancer,
lung cancers, breast cancers, kidney cancers, cervical carcinomas,
metastasis of primary solid tumor secondary sites, ocular diseases
characterized by hyperproliferation leading to blindness including
various retinopathies including diabetic retinopathy and
age-related macular degeneration, or rheumatoid arthritis
characterized by the in-growth of a vascularized pannus. The
administration method is not critical, and may be from the group
consisting of oral, parenteral, inhalation, and subcutaneous.
2.2.8 Pharmaceutical Preparations
[0160] The compounds of the invention, especially those of 2.2 and
2.2.6a may form a part of a pharmaceutical composition by combining
one or more such compounds with a pharmaceutically acceptable
carrier. Additionally, the compositions may include an additive
selected from the group consisting of adjuvants, excipients,
diluents, and stablilizers.
2.2.9 Kinase/Compound Adducts
[0161] The invention also provides adducts in the form of compounds
of the invention bound with a species of kinase such as a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing. The compounds are
advantageously selected from the groups defined in sections 2.2 and
2.2.6a.
2.3 Generally--Monocyclic A2 Compounds with Monocyclic E2 Rings
[0162] The invention includes compounds of the formula I as defined
in section 1.3 wherein each R2 is selected from the group
consisting of C1-C6alkyl, branched C3-C7alkyl, and R19 substituted
C3-C8carbocyclyl wherein R19 is H or C1-C6alkyl, C1-C6fluoroalkyl
wherein the alkyl group is partially or fully fluorinated, phenyl
wherein the phenyl group is optionally substituted by one or more
fluorine substituents, or monocyclic heteroaryl; wherein each Z1 is
a substituent attached to a ring carbon and is independently and
individually selected from the group consisting of
hydroxyC1-C6alkyl, C2-C6alkoxy, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR115## ##STR116## wherein the site
of attachment to the A2 ring is meta to the point of attachment to
the A1 ring and wherein A2 is phenyl, and cyano wherein the site of
attachment is to a substitutable position when A2 is pyridyl,
pyrimidinyl or a five-membered ring; Wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z1 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; wherein Z1' is independently and
individually selected from the group consisting of H, C1-C6alkyl,
C3-C7cycloalkyl, hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4' is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR117## ##STR118## wherein the symbol
(#) indicates the point of attachment of the Z4' moiety to the A1
ring of formula I; in the event that Z4' contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; each Z7 is a substituent attached to a ring
carbon and is independently and individually selected from the
group consisting of hydroxyC2-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R6).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--CO,
(R4).sub.2N--CO, --SO.sub.2R3', SOR3, --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6,
(CH.sub.2).sub.nN(R4)C(O)N(R4).sub.2, (CH.sub.2).sub.nN(R4)C(O)R5,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR119## ##STR120## cyano wherein the
site of attachment to the A2 ring is meta to the point of
attachment to the A1 ring and wherein A2 is phenyl, and cyano
wherein the site of attachment is to a substitutable position when
A2 is pyridyl, pyrimidinyl or a five-membered ring; In the
foregoing definition of Z7, alkyl moieties may optionally be
substituted by one or more C1-C6alkyl; Wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z7 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z7 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z7 may cyclize to
form a C3-C7 heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6, r
is 0 or 1; and tautomers, diastereomers, geometric isomers,
enantiomers, hydrates, prodrugs, and salts of any of the foregoing.
2.3.1 Preferred D Moieties 2.3.1a
[0163] Preferably, the compounds of formula I in 2.3 contain D
moieties wherein E1 and E2 are as defined in section 1.3.1a.
2.3.1b
[0164] Additionally preferred D moieties of formula I in 2.3 are as
defined in section 1.3.1b.
2.3.1c
[0165] More preferred D moieties of 2.2.1b are wherein E2 is
defined as in section 1.3.1c.
2.3.2 Preferred A2 Moieties
2.3.2a
[0166] Compounds of Formula I as defined above in section 2.3 have
preferred A2 moieties as defined in section 2.2.2a.
2.3.2b
[0167] More preferred A2 moieties are selected from the group
consisting of ##STR121## and wherein the symbol (**) is the point
of attachment to the A1 ring for formula I. 2.3.2c
[0168] Even more preferred A2 moieties are selected from the group
consisting of ##STR122## and wherein the symbol (**) is the point
of attachment to the A1 ring of formula I. 2.3.3 Preferred Classes
of Compounds 2.3.3a
[0169] Compounds as defined in 2.3.1a wherein the A2 group is
defined in 2.3.2a.
2.3.3b
[0170] Compounds as defined in 2.3.3a wherein the A2 group is
defined in 2.3.2b.
2.3.3c
[0171] Compounds as defined in 2.3.3a wherein the A2 group is
defined in 2.3.2c.
2.3.3d
[0172] Compounds as defined in 2.3.1b wherein the A2 group is
defined in 2.3.2a.
2.3.3e
[0173] Compounds as defined in 2.3.3c wherein the A2 group is
defined in 2.3.2b.
2.3.3f
[0174] Compounds as defined in 2.3.3c wherein the A2 group is
defined in 2.3.2c.
2.3.4 Preferred A1 Moieties
2.3.4a
[0175] These preferred A1 moieties are defined in 2.1.4a.
2.3.4b
[0176] These more preferred A1 moieties are defined in 2.1.4b.
2.3.4c
[0177] These even more preferred A1 moieties are defined in
2.1.4c.
2.3.5 Preferred W and Y Moieties
2.3.5a
[0178] (1) W and Y are each NH, and X.dbd.O; (2) W.dbd.NH,
Y.dbd.CHR4 and X.dbd.O; or (3) W.dbd.CHR4, Y.dbd.NH, and
X.dbd.O.
2.3.5b
[0179] W and Y are each NH and X.dbd.O.
2.3.6 Further Preferred Compounds
2.3.6a
[0180] Further preferred compounds are of the formula ##STR123##
wherein A2 is selected from the group consisting of ##STR124##
wherein the symbol (**) denotes the attachment to the A1 moiety of
formula I; A1 is selected from the group consisting of ##STR125##
wherein the symbol (*) denotes the attachment to the W moiety of
formula I and the symbol (**) denotes the attachment to the A2
moiety of formula I; X is O, S, or NR3; D comprises a member of
2,3-dichlorophenyl, 3,4-dichlorophenyl, 3,5-dichlorophenyl,
4-chlorophenyl, 3-chlorophenyl, 3-bromophenyl, 2,3-difluorophenyl,
2,4-difluorophenyl, 3,4-difluorophenyl, 2,5-difluorophenyl,
3,5-difluorophenyl, 2,3,5-trifluorophenyl, 2,4,5-trifluorophenyl,
2,3,4-trifluorophenyl, 3,4,5-trifluorophenyl, 4-cyanophenyl,
3-(R8SO.sub.2)-phenyl, 3-phenoxyphenyl, 4 phenoxyphenyl, ##STR126##
##STR127## ##STR128## ##STR129## ##STR130## wherein E1A is taken
from the groups consisting of cyclopropyl, cyclobutyl, cyclopentyl,
cyclohexyl, pyrrolidinyl piperidinyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, furyl, imidazolyl, pyridyl, and pyrimidinyl; wherein
E1B is taken from the groups consisting of phenyl and naphthyl;
wherein E2A is taken from the group comprising naphthyl, pyrrolyl,
furyl, thienyl, oxazolyl, thiazolyl, isoxazolyl, isothiazolyl,
imidazolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl,
tetrazolyl, pyrazinyl, pyridazinyl, triazinyl and fused bicyclic
rings selected from the group comprising indolyl, isoindolyl,
isoindolinyl, isoindolonyl, indazolyl, benzofuranyl, benzothienyl,
benzothiazolyl, benzothiazolonyl, benzoxazolyl, benzoxazolonyl,
benzisoxazolyl, benzisothiazolyl, benzimidazolyl, benzimidazolonyl,
benztriazolyl, imidazopyridinyl, imidazopyrimidinyl,
imidazolonopyrimidinyl, dihydropurinonyl, pyrrolopyrimidinyl,
purinyl, pyrazolopyridinyl, pyrazolopyrimidinyl,
isoxazolopyrimidinyl, isothiazolopyrimidinyl, furylopyrimidinyl,
thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl;
wherein E2B is taken from the group consisting of phenyl, pyridyl,
and pyrimidyl; wherein the symbol (***) denotes the attachment to
the Y moiety of formula I; X1 is selected from the group consisting
of O, S, NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I;
each R2 is selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, and R19 substituted C3-C8carbocyclyl wherein
R19 is H or C1-C6alkyl, C1-C6fluoroalkyl wherein the alkyl group is
partially or fully fluorinated, phenyl wherein the phenyl group is
optionally substituted by one or more fluorine substituents, or
monocyclic heteroaryl; X3 is selected from the group consisting of
NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)q-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the either
the E1B ring or E2B ring are directly linked by a covalent bond;
and wherein the carbon atoms of --(CH2)q-, C2-C5alkenyl, and
C2-C5alkynyl moieties of X3 may be further substituted by one or
more C1-C6alkyl; X4 is selected from the group consisting of C1-C6
alkyl, C3-C6 branched alkyl; each R2' is selected from the group
consisting of halogen and R2; each R3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl; wherein two R3
moieties independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C7alkyl are attached to
the same nitrogen heteroatom, the two R3 moieties may cyclize to
form a C3-C7 heterocyclyl ring; each R4 is selected from the group
consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom may
cyclize to form a C3-C7 heterocyclyl ring; each R5 is independently
and individually selected from the group consisting of ##STR131##
and wherein the symbol (##) is the point of attachment to
respective R8, R10, Z4, Z5, Z6 or A2 ring moieties containing a R5
moiety; wherein two R4 moieties independently and individually
taken from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of R5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein each R6 is independently and individually selected from the
group consisting of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl,
phenyl, heteroaryl, and heterocyclyl; each R7 is selected from the
group consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, C1-C3alkyl, cyclopropyl,
cyano, or C1-C3 alkoxy; each R8 is independently and individually
selected from the group consisting of C1-C6alkyl, C1-C6 fluoroalkyl
wherein the alkyl moiety is partially or fully fluorinated,
branchedC4-C7alkyl, carbocyclyl, phenyl, C1-C6phenylalkyl,
heteroaryl or heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2,
or R5; wherein two R3 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; wherein Z1' is independently and individually
selected from the group consisting of H, C1-C6alkyl,
C3-C7cycloalkyl, hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4 is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR132## ##STR133## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; each Z7 is a substituent attached to a ring
carbon and is independently and individually selected from the
group consisting of hydroxyC2-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R6).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--CO,
(R4).sub.2N--CO, --SO.sub.2R3', SOR3, --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6,
(CH.sub.2).sub.nN(R4)C(O)N(R4).sub.2, (CH.sub.2).sub.nN(R4)C(O)R5,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR134## ##STR135## cyano wherein the
site of attachment to the A2 ring is meta to the point of
attachment to the A1 ring and wherein A2 is phenyl, and cyano
wherein the site of attachment is to a substitutable position when
A2 is pyridyl, pyrimidinyl or a five-membered ring; In the
foregoing definition of Z7, alkyl moieties may optionally be
substituted by one or more C1-C6alkyl; Wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z7 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z7 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z7 may cyclize to
form a C3-C7 heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r
is 0 or 1; v is 1 or 2; and tautomers, diastereomers, geometric
isomers, enantiomers, hydrates, prodrugs and salts of any of the
foregoing. 2.3.6b
[0181] The following specific compounds of Formula I are more
preferred:
1-(1-(3-(1H-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3-dichlo-
rophenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(pyri-
din-3-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-(trifluoromethyl)-1H-pyrazol-5-yl)--
3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(3-(pyridin-3-yl)phenyl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3--
yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(pyra-
zin-2-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(2-(m-
ethylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(1-ox-
oisoindolin-4-yl)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(4-(-
1-oxoisoindolin-4-yl)phenyl)urea,
1-(1-(3-(1H-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(1-oxois-
oindolin-4-yl)phenyl)urea
2.3.7 Methods
2.3.7a Methods of Protein Modulation
[0182] The invention includes methods of modulating kinase activity
of a variety of kinases, e.g. receptor tyrosine kinases including
VEGFR1, VEGFR2, FLT-1, FLT-3, PDGFRa, PDGFRb, FGFR1, FGFR2, FGFR3,
FGFR4, TrkA, TrkB, EGFR, EPHA1, EPHA2, EPHA3, EPHA4, EPHA5, EPHA6,
EPHA7, EPHA8, EPHA9, EPHA10, EPHB1, EPHB2, EPHB3, EPHB4, EPHB5,
EPHB6, EPHB7, EPHB8. The kinases may be wildtype kinases, oncogenic
forms thereof, aberrant fusion proteins thereof or polymorphs of
any of the foregoing. The method comprises the step of contacting
the kinase species with compounds of the invention and especially
those set forth in sections 2.3 and 2.3.6a. The kinase species may
be activated or unactivated, and the species may be modulated by
phosphorylations, sulfation, fatty acid acylations glycosylations,
nitrosylation, cystinylation (i.e. proximal cysteine residues in
the kinase react with each other to form a disulfide bond) or
oxidation. The kinase activity may be selected from the group
consisting of catalysis of phospho transfer reactions, kinase
cellular localization, and recruitment of other proteins into
signaling complexes through modulation of kinase conformation.
2.3.7b Treatment Methods
[0183] The methods of the invention also include treating
individuals suffering from a condition selected from the group
consisting of cancer, secondary cancer growth arising from
metastasis, hyperproliferative diseases, and diseases characterized
by hyper-vascularization. These methods comprise administering to
such individuals compounds of the invention, and especially those
of section 2.3 and 2.3.6a. Exemplary conditions include
glioblastomas, ovarian cancer, pancreatic cancer, prostate cancer,
lung cancers, breast cancers, kidney cancers, cervical carcinomas,
metastasis of primary solid tumor secondary sites, ocular diseases
characterized by hyperproliferation leading to blindness including
various retinopathies including diabetic retinopathy and
age-related macular degeneration, or rheumatoid arthritis
characterized by the in-growth of a vascularized pannus. The
administration method is not critical, and may be from the group
consisting of oral, parenteral, inhalation, and subcutaneous.
2.3.8 Pharmaceutical Preparations
[0184] The compounds of the invention, especially those of 2.3 and
2.3.6a may form a part of a pharmaceutical composition by combining
one or more such compounds with a pharmaceutically acceptable
carrier. Additionally, the compositions may include an additive
selected from the group consisting of adjuvants, excipients,
diluents, and stablilizers.
2.3.9 Kinase/Compound Adducts
[0185] The invention also provides adducts in the form of compounds
of the invention bound with a species of kinase such as a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing. The compounds are
advantageously selected from the groups defined in sections 2.3 and
2.3.6a.
3. First Aspect of the Invention--Raf Kinase Modulator Compounds,
Methods, Preparations and Adducts
3.1 Generally--A2 Bicyclic Compounds
[0186] The invention includes compounds of formula I as defined in
section 2.1, wherein each R2 is independently and individually
selected from the group consisting of C1-C6alkyl, branched
C3-C7alkyl, C1-C6fluoroalkyl, wherein the alkyl group is partially
or fully fluorinated, monocyclic heteroaryl, and R19 substituted
C3-C8carbocyclyl wherein R19 is H and C1-C6alkyl.
3.1.1 Preferred D Moieties
3.1.1a
[0187] Preferred compounds of Formula I as defined above in section
3.1 contain D moieties as defined in section 1.1.1a.
3.1.1b
[0188] Additionally preferred compounds of Formula I as defined
above in section 3.1 contain D moieties as defined in section
1.1.1b.
3.1.1c
[0189] More preferred compounds of Formula I as defined above in
section 3.1.1b contain D moieties as defined in section 1.1.1c.
3.1.2 Preferred A2 Moieties
3.1.2a
[0190] Compounds of Formula I as defined above in section 3.1 have
preferred A2 moieties as defined in section 1.1.2a.
3.1.2b More Preferred A2 Moieties
[0191] Compounds of Formula I as defined above in section 3.1 have
more preferred A2 moieties selected from group consisting of
##STR136## ##STR137## and wherein the symbol (**) is the point of
attachment to the A1 ring for formula I; wherein each Z3 and Z5 is
independently attached to either aryl or heteroaryl ring of the A2
bicyclic ring. 3.1.2c
[0192] Still more preferred compounds of Formula I as defined above
in section 3.1 have A2 moieties selected from group consisting of
##STR138## and wherein the symbol (**) is the point of attachment
to the A1 ring of formula I; wherein each Z3 and Z5 is
independently attached to either aryl or heteroaryl ring of the A2
bicyclic ring. 3.1.3 Preferred Classes of Compounds 3.1.3a
[0193] Compounds as defined in 3.1.1a wherein the A2 group is
defined in 3.1.2a.
3.1.3b
[0194] Compounds as defined in 3.1.3a wherein the A2 group is
defined in 3.1.2b.
3.1.3c
[0195] Compounds as defined in 3.1.3a wherein the A2 group is
defined in 3.1.2c.
3.1.3d
[0196] Compounds as defined in 3.1.1b wherein the A2 group is
defined in 3.1.2a.
3.1.3e
[0197] Compounds as defined in 3.1.3c wherein the A2 group is
defined in 3.1.2b.
3.1.3f
[0198] Compounds as defined in 3.1.3c wherein the A2 group is
defined in 3.1.2c.
3.1.4 Preferred A1 Moieties
3.1.4a
[0199] Compounds of Formula I as defined above in section 3.1 have
preferred A1 moieties selected from group defined in section
1.1.4a;
wherein each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or
C1-C3alkoxy;
3.1.4b
[0200] Compounds of Formula I as defined above in section 3.1 have
more preferred A1 moieties selected from group consisting of
##STR139## wherein the symbol (*) denotes the attachment to the W
moiety of formula I and the symbol (**) denotes the attachment to
the A2 moiety of formula I. 3.1.4c
[0201] Compounds of Formula I as defined above in section 3.1 have
even more preferred A1 moieties selected from group consisting of
##STR140## wherein the symbol (*) denotes the attachment to the W
moiety of formula I and the symbol (**) denotes the attachment to
the A2 moiety of formula I. 3.1.5 Preferred W and Y Moieties
3.1.5a
[0202] (1) W and Y are each NH, and X.dbd.O; (2) W.dbd.NH,
Y.dbd.CHR4 and X.dbd.O; or (3) W.dbd.CHR4, Y.dbd.NH, and
X.dbd.O.
3.1.5b
[0203] W and Y are each NH and X.dbd.O.
3.1.6 Further Preferred Compounds
3.1.6a
[0204] Further preferred compounds are of the formula ##STR141##
wherein A2 is selected from the group consisting of ##STR142##
##STR143## wherein each Z3 and Z5 is independently attached to
either aryl or heteroaryl ring of the A2 bicyclic ring; wherein the
symbol (**) denotes the attachment to the A1 moiety of formula I;
A1 is selected from the group consisting of ##STR144## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I; X is O, S, or NR3; D comprises a member of 2,3-dichlorophenyl,
2,3-difluorophenyl, 2,4-difluorophenyl, 3,4-difluorophenyl,
2,5-difluorophenyl, 3,5-difluorophenyl, 2,3,5-trifluorophenyl,
2,4,5-trifluorophenyl, 2,3,4-trifluorophenyl,
3,4,5-trifluorophenyl, 3-phenoxyphenyl, 4-phenoxyphenyl,
cyclohexyl, ##STR145## ##STR146## ##STR147## ##STR148## ##STR149##
wherein E1 is selected from the group consisting cyclopropyl,
cyclobutyl, cyclopentyl, cyclohexyl, pyrrolidinyl, piperidinyl,
phenyl, thienyl, oxazolyl, thiazoyl, isoxazolyl, isothiazolyl,
pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl, furyl, imidazolyl,
pyridyl, pyrimidinyl, and napthyl; wherein the symbol (***) denotes
the attachment to the Y moiety of formula I; X1 is selected from
the group consisting of O, S, NR3, --C(.dbd.O)--,
--O--(CH.sub.2)n-, --S--(CH.sub.2)n-, --NR3-(CH.sub.2)n-,
--O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I;
Each R2 is independently and individually selected from the group
consisting of C1-C6alkyl, branched C3-C7alkyl, C1-C6fluoroalkyl,
wherein the alkyl group is partially or fully fluorinated,
monocyclic heteroaryl, and R19 substituted C3-C8carbocyclyl wherein
R19 is H and C1-C6alkyl; each R2' is selected from the group
consisting of halogen and R2; each R3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl; wherein two R3
moieties independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C7alkyl are attached to
the same nitrogen heteroatom, the two R3 moieties may cyclize to
form a C3-C7 heterocyclyl ring; each R4 is selected from the group
consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom may
cyclize to form a C3-C7 heterocyclyl ring; each R5 is independently
and individually selected from the group consisting of ##STR150##
and wherein the symbol (##) is the point of attachment to
respective R8, R10, R13, Z2, Z3, Z4, Z5, or A2 ring moieties
containing a R5 moiety; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R5 may cyclize to form a C3-C7
heterocyclyl ring; wherein each R6 is independently and
individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, phenyl, heteroaryl, and
heterocyclyl; each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or C1-C3alkoxy;
each R8 is independently and individually selected from the group
consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, branchedC4-C7alkyl,
carbocyclyl, phenyl, C1-C6phenylalkyl, heteroaryl or
heteroarylC1-C6alkyl, heterocyclyl, heterocyclylC1-C6alkyl, OH,
C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2, or R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; each R10 is independently and individually
selected from the group consisting of CO.sub.2H,
CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; each R13 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, carbocyclyl, hydroxyC2-C7alkyl, C1-C6alkoxyC2-C7alkyl,
(R4).sub.2N--CO, (R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.q,
R5-C2-C6alkylN(R4)-(CH.sub.2).sub.q,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.q,
R5-C2-C6alkyl-O--(CH.sub.2).sub.q, --(CH.sub.2).sub.qN(R4)C(O)R8,
aryl, arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl,
heterocyclyl, heterocyclylC1-C6alkyl, aryloxyC2-C6alkyl,
heteroaryloxyC2-C6alkyl, heterocyclyloxyC2-C6alkyl,
arylaminoC2-C6alkyl, heteroarylaminoC2-C6alkyl, and
heterocyclylaminoC2-C6alkyl; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R13 may cyclize to form a C3-C7
heterocyclyl ring; each R14 is independently and respectively
selected from the group consisting of H and C1-C6alkyl; wherein Z1'
is independently and individually selected from the group
consisting of H, C1-C6alkyl, C3-C7cycloalkyl, hydroxyC1-C6alkyl,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, hydroxyl, hydroxyC1-C6alkyl, cyano, C1-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, halogen, CF.sub.3, (R3).sub.2N--,
(R4).sub.2N--, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, R8CO--,
(R4).sub.2N--CO--C1-C6alkyl, carboxyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R3).sub.2NSO.sub.2, --SO.sub.2R3, SOR3, (R4).sub.2NSO.sub.2,
--SO.sub.2R4, --SOR4, --(CH.sub.2).sub.nN(R4)C(O)R8,
--C.dbd.(NOH)R6, --C.dbd.(NOR3)R6, heteroaryl, heterocyclyl,
heteroarylC1-C6alkyl, heterocyclylC1-C6alkyl, heteroaryloxy,
heterocyclyloxy, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylamino, heteroarylamino,
heterocyclylamino, arylaminoC1-C6alkyl, heteroarylaminoC1-C6alkyl,
heterocyclylaminoC1-C6alkyl, or moieties of the formulae ##STR151##
##STR152## wherein the symbol (#) indicates the point of attachment
of the Z3 moiety to the A2 ring of formula I; in the event that Z3
contains an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; wherein two R3 moieties
are independently and individually taken from the group consisting
of C1-C6alkyl and branched C3-C6alkyl and are attached to the same
nitrogen heteroatom of Z3 may cyclize to form a C3-C7 heterocyclyl
ring; wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z3 may cyclize to form a C3-C7 heterocyclyl ring;
each Z4 is independently and individually selected from the group
consisting of H, C1-C6alkyl, hydroxyC2-C6alkyl,
C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR153## ##STR154## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)--(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2; V, V1, and V2 are each independently and respectively
selected from the group consisting of O and H.sub.2; and tautomers,
diastereomers, geometric isomers, enantiomers, hydrates, prodrugs,
and salts of any of the foregoing. 3.1.6b
[0205] The following specific compounds are most preferred:
1-(3-t-butyl-1-(3-hydroxy-2,3-dihydro-1H-inden-5-yl)-1H-pyrazol-5-yl)-3-(-
2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(hydroxyimino)-2,3-dihydro-1H-inden-5-yl)-1H-pyrazol-5--
yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(1-methyl-1H-indol-5-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorop-
henyl)urea,
1-(3-t-butyl-1-(1H-indazol-5-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)u-
rea,
1-(3-t-butyl-1-(indolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)-
urea,
1-(1-(1-acetylindolin-6-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3-dichlo-
rophenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3-d-
ichlorophenyl)urea,
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea-
,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3--
dichlorophenyl)urea,
1-(1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3-d-
ichlorophenyl)urea,
1-(3-t-butyl-1-(4-((1-methylsulfonylamino-1-oxo-methylamino)methyl)naphth-
alen-2-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
2-(3-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)naphthal-
en-1-yl)acetic acid,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
1-(3-t-butyl-1-(quinolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)ure-
a,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3--
(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(1-oxo-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl-
)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(2-(methylsulfonyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-
-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
(3S)-6-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-1,2,3-
,4-tetrahydroisoquinoline-3-carboxylic acid,
1-(3-t-butyl-1-(3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazo-
l-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-
-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3-d-
ichlorophenyl)urea,
1-(3-t-butyl-1-(1-carbamimidoyl-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyraz-
ol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-2,3,4,5-tetrahydro-1H-benzo[d]azepin-7-yl)-1H-pyraz-
ol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(methylsulfonyl)-2,3,4,5-tetrahydro-1H-benzo[d]azepin-7-
-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(4-oxo-3,4-dihydroquinazolin-7-yl)-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,3,4-trifluorophenyl)urea,
1-(3-t-butyl-1-(quinolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3,4-trifluorophenyl)-
urea,
1-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5--
yl)-3-(2,3,4-trifluorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3,4-
-trifluorophenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,4,5-
-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,4-
,5-trifluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)naphthalen-2-y-
l)-1H-pyrazol-5-yl)-3-(2,4,5-trifluorophenyl)urea,
1-(1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,4,5-
-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-((1-amino-1-oxo-methylamino)methyl)naphthalen-2-yl)-1H--
pyrazol-5-yl)-3-(2,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(quinolin-6-yl)-1H-pyrazol-5-yl)-3-(2,4,5-trifluorophenyl)-
urea,
1-(3-t-butyl-1-((3S)-3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-7-yl)-
-1H-pyrazol-5-yl)-3-(2,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(2-
,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-
-(2,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3,5-
-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)naphthalen-2-y-
l)-1H-pyrazol-5-yl)-3-(2,3,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,3-
,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(quinolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3,5-trifluorophenyl)-
urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(-
2,3,5-trifluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(3,4,5-trifluorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(3,5-
-difluorophenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3-d-
ifluorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,3-
-difluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,3-difluorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-
-(2,3-difluorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,4-
-difluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,4-difluorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(2,4-d-
ifluorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(4-fluorophenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-phenoxyphenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-
-(3-phenoxyphenyl)urea,
1-(3-t-butyl-1-(1H-indol-5-yl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phe-
nyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazo-
l-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(3-(-
pyridin-3-yloxy)phenyl)urea,
1-(1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(py-
ridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(5-chloropyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(py-
ridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(1-(2-(2-aminoethylamino)quinolin-6-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-cyclopentyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-(dimethylamino)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(1-(2-aminoquinolin-6-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(2-(methylcar-
bamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-(methylamino)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2-(m-
ethylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-
-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-cyclopentyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(8--
methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazo-
l-5-yl)-3-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl-
)urea,
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(3-(8-methyl-7-oxo-
-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(3-(8--
methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-t-butyl-1-(1H-indol-5-yl)-1H-pyrazol-5-yl)-3-(3-(8-methyl-7-oxo-7,8--
dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(3-cyclopentyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-y-
l)-3-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea-
,
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(-
4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea.
3.1.7 Methods
3.1.7a Methods of Protein Modulation
[0206] The invention includes methods of modulating kinase activity
of RAF kinases and other kinases in the RAS-RAF-MEK-ERK-MAP kinase
pathway including, but not limited to, A-Raf, B-Rat, and C-Raf. The
kinases may be wildtype kinases, oncogenic forms thereof, aberrant
fusion proteins thereof or polymorphs of any of the foregoing. The
method comprises the step of contacting the kinase species with
compounds of the invention and especially those set forth in
sections 3.1 and 3.1.6a. The kinase species may be activated or
unactivated, and the species may be modulated by phosphorylations,
sulfation, fatty acid acylations glycosylations, nitrosylation,
cystinylation (i.e. proximal cysteine residues in the kinase react
with each other to form a disulfide bond) or oxidation. The kinase
activity may be selected from the group consisting of catalysis of
phospho transfer reactions, kinase cellular localization, and
recruitment of other proteins into signaling complexes through
modulation of kinase conformation.
3.1.7b Treatment Methods
[0207] The methods of the invention also include treating
individuals suffering from a condition selected from the group
consisting of cancer and hyperproliferative diseases. These methods
comprise administering to such individuals compounds of the
invention, and especially those of section 3.1 and 3.1.6a.
condition being melanomas, glioblastomas, ovarian cancer,
pancreatic cancer, prostate cancer, lung cancers, breast cancers,
kidney cancers, cervical carcinomas, metastisis of primary solid
tumor secondary sites, ocular diseases characterized by
hyperproliferation leading to blindness including various
retinopathies including diabetic retinopathy and age-related
macular degeneration, rheumatoid arthritis characterized by the
in-growth of a vascularized pannus, or a disease caused by a
mutation in the RAS-RAF-MEK-ERK-MAP kinase pathway. The
administration method is not critical, and may be from the group
consisting of oral, parenteral, inhalation, and subcutaneous.
3.1.8 Pharmaceutical Preparations
[0208] The compounds of the invention, especially those of 3.1 and
3.1.6a may form a part of a pharmaceutical composition by combining
one or more such compounds with a pharmaceutically acceptable
carrier. Additionally, the compositions may include an additive
selected from the group consisting of adjuvants, excipients,
diluents, and stablilizers.
3.1.9 Kinase/Compound Adducts
[0209] The invention also provides adducts in the form of compounds
of the invention bound with a species of kinase such as a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing. The compounds are
advantageously selected from the groups defined in sections 3.1 and
3.1.6a.
3.2 Generally--Monocyclic A2 Compounds with Polycyclic E2 Rings
[0210] The invention includes compounds of the formula I as defined
in section 2.2, wherein each R2 is independently and individually
selected from the group consisting of C1-C6alkyl, branched
C3-C7alkyl, C1-C6fluoroalkyl, wherein the alkyl group is partially
or fully fluorinated, monocyclic heteroaryl, and R19 substituted
C3-C8carbocyclyl wherein R19 is H and C1-C6alkyl;
3.2.1 Preferred D Moieties
3.2.1a
[0211] Preferably, the compounds of formula I in 3.2 contain D
moieties wherein E1 and E2 are as defined in section 1.2.1
3.2.1b
[0212] Additionally preferred D moieties of formula I in 3.2 are as
defined in section 1.2.1b
3.2.1c
[0213] More preferred D moieties of 3.2.1b are where E2 is defined
as in section 1.2.1c
3.2.2 Preferred A2 Moieties
3.2.2a
[0214] Compounds of Formula I as defined above in section 3.2 have
preferred A2 moieties as defined in section 2.2.2a;
3.2.2b
[0215] More preferred A2 moieties are selected from the group
consisting of ##STR155## and wherein the symbol (**) is the point
of attachment to the A1 ring for formula I. 3.2.2c
[0216] Even more preferred A2 moieties are selected from the group
consisting of ##STR156## and wherein the symbol (**) is the point
of attachment to the A1 ring of formula I. 3.2.3 Preferred Classes
of Compounds 3.2.3a
[0217] Compounds as defined in 3.2.1a wherein the A2 group is
defined in 3.2.2a.
3.2.3b
[0218] Compounds as defined in 3.2.3a wherein the A2 group is
defined in 3.2.2b.
3.2.3c
[0219] Compounds as defined in 3.2.3a wherein the A2 group is
defined in 3.2.2c.
3.2.3d
[0220] Compounds as defined in 3.2.1b wherein the A2 group is
defined in 3.2.2a.
3.2.3e
[0221] Compounds as defined in 3.2.3c wherein the A2 group is
defined in 3.2.2b.
3.2.3f
[0222] Compounds as defined in 3.2.3c wherein the A2 group is
defined in 3.2.2c.
3.2.4 Preferred A1 Moieties
3.2.4a
[0223] These preferred A1 moieties are defined in 3.1.4a.
3.2.4b
[0224] These more preferred A1 moieties are defined in 3.1.4b.
3.2.4c
[0225] These even more preferred A1 moieties are defined in
3.1.4c.
3.2.5 Preferred W and Y Moieties
3.2.5a
[0226] (1) W and Y are each NH, and X.dbd.O; (2) W.dbd.NH,
Y.dbd.CHR4 and X.dbd.O; or (3) W.dbd.CHR4, Y.dbd.NH, and
X.dbd.O.
3.2.5b
[0227] W and Y are each NH and X.dbd.O.
3.2.6 Further Preferred Compounds
3.2.6a
[0228] Further preferred compounds are of the formula ##STR157##
wherein A2 is selected from the group consisting of ##STR158##
wherein the symbol (**) denotes the attachment to the A1 moiety of
formula I; A1 is selected from the group consisting of ##STR159##
wherein the symbol (*) denotes the attachment to the W moiety of
formula I and the symbol (**) denotes the attachment to the A2
moiety of formula I; X is O, S, or NR3; D comprises a member of
##STR160## ##STR161## wherein E1 is selected from the group
consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl;
wherein the symbol (***) denotes the attachment to the Y moiety of
formula I; X1 is selected from the group consisting of O, S, NR3,
--C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I;
Each R2 is independently and individually selected from the group
consisting of C1-C6alkyl, branched C3-C7alkyl, C1-C6fluoroalkyl,
wherein the alkyl group is partially or fully fluorinated,
monocyclic heteroaryl, and R19 substituted C3-C8carbocyclyl wherein
R19 is H and C1-C6alkyl; each R2' is selected from the group
consisting of halogen and R2; each R3 is independently and
individually selected from the group consisting of H, C1-C6alkyl,
branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl; wherein two R3
moieties independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C7alkyl are attached to
the same nitrogen heteroatom, the two R3 moieties may cyclize to
form a C3-C7 heterocyclyl ring; each R4 is selected from the group
consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom may
cyclize to form a C3-C7 heterocyclyl ring; each R5 is independently
and individually selected from the group consisting of ##STR162##
and wherein the symbol (##) is the point of attachment to
respective R8, R10, Z1, Z4, Z5, Z6 or A2 ring moieties containing a
R5 moiety; wherein two R4 moieties independently and individually
taken from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of R5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein each R6 is independently and individually selected from the
group consisting of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl,
phenyl, heteroaryl, and heterocyclyl; each R7 is selected from the
group consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, C1-C3alkyl, cyclopropyl,
cyano, or C1-C3alkoxy; each R8 is independently and individually
selected from the group consisting of C1-C6alkyl, C1-C6 fluoroalkyl
wherein the alkyl moiety is partially or fully fluorinated,
branchedC4-C7alkyl, carbocyclyl, phenyl, C1-C6phenylalkyl,
heteroaryl or heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2,
or R5; wherein two R3 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; each Z1 is a substituent attached to a ring
carbon and is independently and individually selected from the
group consisting of hydroxyC1-C6alkyl, C2-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR163## ##STR164## cyano wherein the
site of attachment to the A2 ring is meta to the point of
attachment to the A1 ring and wherein A2 is phenyl, and cyano
wherein the site of attachment is to a substitutable position when
A2 is pyridyl, pyrimidinyl or a five-membered ring; In the
foregoing definition of Z1, alkyl moieties may optionally be
substituted by one or more C1-C6alkyl; Wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z1 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
In the foregoing definition of Z1, alkyl moieties may optionally be
substituted by one or more C1-C6alkyl; Wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z1 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; wherein Z1' is independently and
individually selected from the group consisting of H, C1-C6alkyl,
C3-C7cycloalkyl, hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4 is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR165## ##STR166## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)--(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2; and tautomers, diastereomers, geometric isomers,
enantiomers, hydrates, prodrugs and salts of any of the foregoing.
3.2.6b
[0229] The following specific compounds of Formula I are more
preferred:
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-methy-
l-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea,
1-(3-t-butyl-1-(3-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)phenyl)-1H-pyr-
azol-5-yl)-3-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea,
1-(2-(3-(2-amino-2-oxoethyl)phenyl)-5-t-butylthiophen-3-yl)-3-(4-(4-(pyri-
din-3-yl)pyrimidin-2-yloxy)phenyl)urea,
1-(3-t-butyl-1-(3-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)phenyl)-1H-pyr-
azol-5-yl)-3-(4-(6-(thiazol-4-yl)pyrimidin-4-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(4-(p-
yridin-3-yl)pyrimidin-2-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(4-(i-
soxazol-4-yl)pyrimidin-2-ylamino)phenyl)urea
3.2.7 Methods
3.2.7a Methods of Protein Modulation
[0230] The invention includes methods of modulating kinase activity
of RAF kinases and other kinases in the RAS-RAF-MEK-ERK-MAP kinase
pathway including, but not limited to, A-Raf, B-Raf, and C-Raf. The
kinases may be wildtype kinases, oncogenic forms thereof, aberrant
fusion proteins thereof or polymorphs of any of the foregoing. The
method comprises the step of contacting the kinase species with
compounds of the invention and especially those set forth in
sections 3.2 and 3.2.6a. The kinase species may be activated or
unactivated, and the species may be modulated by phosphorylations,
sulfation, fatty acid acylations glycosylations, nitrosylation,
cystinylation (i.e. proximal cysteine residues in the kinase react
with each other to form a disulfide bond) or oxidation. The kinase
activity may be selected from the group consisting of catalysis of
phospho transfer reactions, kinase cellular localization, and
recruitment of other proteins into signaling complexes through
modulation of kinase conformation.
3.2.7b Treatment Methods
[0231] The methods of the invention also include treating
individuals suffering from a condition selected from the group
consisting of cancer and hyperproliferative diseases. These methods
comprise administering to such individuals compounds of the
invention, and especially those of section 3.2 and 3.2.6a.
condition being melanomas, glioblastomas, ovarian cancer,
pancreatic cancer, prostate cancer, lung cancers, breast cancers,
kidney cancers, cervical carcinomas, metastisis of primary solid
tumor secondary sites, ocular diseases characterized by
hyperproliferation leading to blindness including various
retinopathies including diabetic retinopathy and age-related
macular degeneration, rheumatoid arthritis characterized by the
in-growth of a vascularized pannus, or a disease caused by a
mutation in the RAS-RAF-MEK-ERK-MAP kinase pathway. The
administration method is not critical, and may be from the group
consisting of oral, parenteral, inhalation, and subcutaneous.
3.2.8 Pharmaceutical Preparations
[0232] The compounds of the invention, especially those of 3.2 and
3.2.6a may form a part of a pharmaceutical composition by combining
one or more such compounds with a pharmaceutically acceptable
carrier. Additionally, the compositions may include an additive
selected from the group consisting of adjuvants, excipients,
diluents, and stablilizers.
3.2.9 Kinase/Compound Adducts
[0233] The invention also provides adducts in the form of compounds
of the invention bound with a species of kinase such as a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing. The compounds are
advantageously selected from the groups defined in sections 3.2 and
3.2.6a.
3.3 Generally--Monocyclic A2 Compounds with Monocyclic E2 Rings
[0234] The invention includes compounds of the formula I as defined
in section 2.3 wherein each R2 is independently and individually
selected from the group consisting of C1-C6alkyl, branched
C3-C7alkyl, C1-C6fluoroalkyl, wherein the alkyl group is partially
or fully fluorinated, monocyclic heteroaryl, and R19 substituted
C3-C8carbocyclyl wherein R19 is H and C1-C6alkyl.
3.3.1 Preferred D Moieties
3.3.1a
[0235] Preferably, the compounds of formula I in 3.3 contain D
moieties wherein E1 and E2 are as defined in section 1.3.1a.
3.3.1b
[0236] Additionally preferred D moieties of formula I in 3.3 are as
defined in section 1.3.1b.
3.3.1c
[0237] More preferred D moieties of 3.2.1b are wherein E2 is
defined as in section 1.3.1c.
3.3.2 Preferred A2 Moieties
3.3.2a
[0238] Compounds of Formula I as defined above in section 3.3 have
preferred A2 moieties as defined in section 2.2.2a.
3.3.2b
[0239] More preferred A2 moieties are selected from the group
consisting of ##STR167## and wherein the symbol (**) is the point
of attachment to the A1 ring for formula I. 3.3.2c
[0240] Even more preferred A2 moieties are selected from the group
consisting of ##STR168## and wherein the symbol (**) is the point
of attachment to the A1 ring of formula I. 3.3.3 Preferred Classes
of Compounds 3.3.3a
[0241] Compounds as defined in 3.3.1a wherein the A2 group is
defined in 3.3.2a.
3.3.3b
[0242] Compounds as defined in 3.3.3a wherein the A2 group is
defined in 3.3.2b.
3.3.3c
[0243] Compounds as defined in 3.3.3a wherein the A2 group is
defined in 3.3.2c.
3.3.3d
[0244] Compounds as defined in 3.3.1b wherein the A2 group is
defined in 3.3.2a.
3.3.3e
[0245] Compounds as defined in 3.3.3c wherein the A2 group is
defined in 3.3.2b.
3.3.3f
[0246] Compounds as defined in 3.3.3c wherein the A2 group is
defined in 3.3.2c.
3.3.4 Preferred A1 Moieties
3.3.4a
[0247] These preferred A1 moieties are defined in 3.1.4a.
3.3.4b
[0248] These more preferred A1 moieties are defined in 3.1.4b.
3.3.4c
[0249] These even more preferred A1 moieties are defined in
3.1.4c.
3.3.5 Preferred W and Y Moieties
3.3.5a
[0250] (1) W and Y are each NH, and X.dbd.O; (2) W.dbd.NH,
Y.dbd.CHR4 and X.dbd.O; or (3) W.dbd.CHR4, Y.dbd.NH, and
X.dbd.O.
3.3.5b
[0251] W and Y are each NH and X.dbd.O.
3.3.6 Further Preferred Compounds
3.3.6a
[0252] Further preferred compounds are of the formula ##STR169##
wherein A2 is selected from the group consisting of ##STR170##
wherein the symbol (**) denotes the attachment to the A1 moiety of
formula I; A1 is selected from the group consisting of ##STR171##
wherein the symbol (*) denotes the attachment to the W moiety of
formula I and the symbol (**) denotes the attachment to the A2
moiety of formula I; X is O, S, or NR3; D comprises a member of
2,3-dichlorophenyl, 2,3-difluorophenyl, 2,4-difluorophenyl,
3,4-difluorophenyl, 2,5-difluorophenyl, 3,5-difluorophenyl,
2,3,5-trifluorophenyl, 2,4,5-trifluorophenyl,
2,3,4-trifluorophenyl, 3,4,5-trifluorophenyl, 3-phenoxyphenyl,
4-phenoxyphenyl, cyclohexyl, ##STR172## ##STR173## ##STR174##
##STR175## ##STR176## wherein E1A is taken from the groups
consisting of cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, thienyl, oxazolyl, thiazolyl, isoxazolyl,
isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl, thiadiazolyl,
furyl, imidazolyl, pyridyl, and pyrimidinyl; wherein E1B is taken
from the groups consisting of phenyl and naphthyl; wherein E2A is
taken from the group comprising naphthyl, pyrrolyl, furyl, thienyl,
oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, imidazolyl,
pyrazolyl, oxadiazolyl, thiadiazolyl, triazolyl, tetrazolyl,
pyrazinyl, pyridazinyl, triazinyl and fused bicyclic rings selected
from the group comprising indolyl, isoindolyl, isoindolinyl,
isoindolonyl, indazolyl, benzofuranyl, benzothienyl,
benzothiazolyl, benzothiazolonyl, benzoxazolyl, benzoxazolonyl,
benzisoxazolyl, benzisothiazolyl, benzimidazolyl, benzimidazolonyl,
benztriazolyl, imidazopyridinyl, imidazopyrimidinyl,
imidazolonopyrimidinyl, dihydropurinonyl, pyrrolopyrimidinyl,
purinyl, pyrazolopyridinyl, pyrazolopyrimidinyl,
isoxazolopyrimidinyl, isothiazolopyrimidinyl, furylopyrimidinyl,
thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl;
wherein E2B is taken from the group consisting of phenyl, pyridyl,
and pyrimidyl; wherein the symbol (***) denotes the attachment to
the Y moiety of formula I; X1 is selected from the group consisting
of O, S, NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I; X3
is selected from the group consisting of NR3, --C(.dbd.O)--,
--O--(CH.sub.2)n-, --S--(CH.sub.2)n-, --NR3-(CH.sub.2)n-,
--O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)q-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the either
the E1B ring or E2B ring are directly linked by a covalent bond;
and wherein the carbon atoms of --(CH2)q-, C2-C5alkenyl, and
C2-C5alkynyl moieties of X3 may be further substituted by one or
more C1-C6alkyl; X4 is selected from the group consisting of C1-C6
alkyl, C3-C6 branched alkyl; Each R2 is independently and
individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, C1-C6fluoroalkyl, wherein the alkyl group is
partially or fully fluorinated, monocyclic heteroaryl, and R19
substituted C3-C8carbocyclyl wherein R19 is H and C1-C6alkyl; each
R2' is selected from the group consisting of halogen and R2; each
R3 is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, C3-C7carbocyclyl,
or phenyl; wherein two R3 moieties independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C7alkyl are attached to the same nitrogen heteroatom, the two R3
moieties may cyclize to form a C3-C7 heterocyclyl ring; each R4 is
selected from the group consisting of H, C1-C6alkyl, hydroxyC1-C6
alkyl, dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched
C3-C7alkyl, branched hydroxyC1-C6 alkyl, branched
C1-C6alkoxyC1-C6alkyl, branched dihydroxyC1-C6alkyl, carbocyclyl,
hydroxyl substituted carbocyclyl, alkoxy substituted carbocyclyl,
dihydroxy substituted carbocyclyl, phenyl, heteroaryl,
heterocyclyl, phenylC1-C6alkyl, heteroarylC1-C6alkyl, and
heterocyclylC1-C6alkyl; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom may cyclize to form a C3-C7
heterocyclyl ring; each R5 is independently and individually
selected from the group consisting of ##STR177## and wherein the
symbol (##) is the point of attachment to respective R8, R10, Z4,
Z5, Z6 or A2 ring moieties containing a R5 moiety; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R5
may cyclize to form a C3-C7 heterocyclyl ring; wherein each R6 is
independently and individually selected from the group consisting
of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl, phenyl,
heteroaryl, and heterocyclyl; each R7 is selected from the group
consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl moiety
is partially or fully fluorinated, C1-C3alkyl, cyclopropyl, cyano,
or C1-C3alkoxy; each R8 is independently and individually selected
from the group consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein
the alkyl moiety is partially or fully fluorinated,
branchedC4-C7alkyl, carbocyclyl, phenyl, C1-C6phenylalkyl,
heteroaryl or heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2,
or R5; wherein two R3 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; wherein Z1' is independently and individually
selected from the group consisting of H, C1-C6alkyl,
C3-C7cycloalkyl, hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4 is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR178## ##STR179## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; each Z7 is a substituent attached to a ring
carbon and is independently and individually selected from the
group consisting of hydroxyC2-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R6).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--CO,
(R4).sub.2N--CO, --SO.sub.2R3', SOR3, --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6,
(CH.sub.2).sub.nN(R4)C(O)N(R4).sub.2, (CH.sub.2).sub.nN(R4)C(O)R5,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR180## ##STR181## cyano wherein the
site of attachment to the A2 ring is meta to the point of
attachment to the A1 ring and wherein A2 is phenyl, and cyano
wherein the site of attachment is to a substitutable position when
A2 is pyridyl, pyrimidinyl or a five-membered ring; In the
foregoing definition of Z7, alkyl moieties may optionally be
substituted by one or more C1-C6alkyl; Wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z7 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z7 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z7 may cyclize to
form a C3-C7 heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r
is 0 or 1; v is 1 or 2; and tautomers, diastereomers, geometric
isomers, enantiomers, hydrates, prodrugs and salts of any of the
foregoing. 3.3.6b
[0253] The following specific compounds of Formula I are more
preferred:
1-(3-t-butyl-1-(3-(pyridin-3-yl)phenyl)-1H-pyrazol-5-yl)-3-(2,3-dichlorop-
henyl)urea,
1-(1-(3-(1H-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3-dichlo-
rophenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
1-(1-(3-(1-amino-1-oxopropan-2-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2-
,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(2-(2-hydroxyethylamino)-2-oxoethyl)phenyl)-1H-pyrazol--
5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)phenyl)-1H-pyr-
azol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(2-((S)-3-(dimethylamino)pyrrolidin-1-yl)-2-oxoethyl)ph-
enyl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-((2,4,5-trioxoimidazolidin-1-yl)methyl)phenyl)-1H-pyraz-
ol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-((4,5-dioxo-2,2-dioxo-2,1,3-thiadiaol-yl)methyl)phenyl)-
-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-carbamimidoylphenyl)-1H-pyrazol-5-yl)-3-(2,3-dichloroph-
enyl)urea,
1-(1-(3-(N-hydroxycarbamimidoyl)phenyl)-3-t-butyl-1H-pyrazol-5--
yl)-3-(2,3-dichlorophenyl)urea,
1-(1-(4-(N-hydroxycarbamimidoyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(2-hydroxyethyl)phenyl)-1H-pyrazol-5-yl)-3-(2,3-dichlor-
ophenyl)urea,
1-(3-t-butyl-1-(3-(5-oxo-4,5-dihydro-1,3,4-oxadiazol-2-yl)phenyl)-1H-pyra-
zol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-cyanophenyl)-1H-pyrazol-5-yl)-3-(2,3,4-trifluorophenyl)-
urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,-
4,5-trifluorophenyl)urea,
2-(3-(3-t-butyl-5-(3-(2,3-difluorophenyl)ureido)-1H-pyrazol-1-yl)phenyl)a-
cetic acid,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(pyri-
din-3-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(2-(m-
ethylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(8-me-
thyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(3-(-
8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea.
3.3.7 Methods
3.3.7a Methods of Protein Modulation
[0254] The invention includes methods of modulating kinase activity
of RAF kinases and other kinases in the RAS-RAF-MEK-ERK-MAP kinase
pathway including, but not limited to, A-Raf, B-Raf, and C-Raf. The
kinases may be wildtype kinases, oncogenic forms thereof, aberrant
fusion proteins thereof or polymorphs of any of the foregoing. The
method comprises the step of contacting the kinase species with
compounds of the invention and especially those set forth in
sections 3.3 and 3.3.6a. The kinase species may be activated or
unactivated, and the species may be modulated by phosphorylations,
sulfation, fatty acid acylations glycosylations, nitrosylation,
cystinylation (i.e. proximal cysteine residues in the kinase react
with each other to form a disulfide bond) or oxidation. The kinase
activity may be selected from the group consisting of catalysis of
phospho transfer reactions, kinase cellular localization, and
recruitment of other proteins into signaling complexes through
modulation of kinase conformation.
3.3.7b Treatment Methods
[0255] The methods of the invention also include treating
individuals suffering from a condition selected from the group
consisting of cancer and hyperproliferative diseases. These methods
comprise administering to such individuals compounds of the
invention, and especially those of section 3.3 and 3.3.6a.
condition being melanomas, glioblastomas, ovarian cancer,
pancreatic cancer, prostate cancer, lung cancers, breast cancers,
kidney cancers, cervical carcinomas, metastisis of primary solid
tumor secondary sites, ocular diseases characterized by
hyperproliferation leading to blindness including various
retinopathies including diabetic retinopathy and age-related
macular degeneration, rheumatoid arthritis characterized by the
in-growth of a vascularized pannus, or a disease caused by a
mutation in the RAS-RAF-MEK-ERK-MAP kinase pathway. The
administration method is not critical, and may be from the group
consisting of oral, parenteral, inhalation, and subcutaneous.
3.3.8 Pharmaceutical Preparations
[0256] The compounds of the invention, especially those of 3.3 and
3.3.6a may form a part of a pharmaceutical composition by combining
one or more such compounds with a pharmaceutically acceptable
carrier. Additionally, the compositions may include an additive
selected from the group consisting of adjuvants, excipients,
diluents, and stablilizers.
3.3.9 Kinase/Compound Adducts
[0257] The invention also provides adducts in the form of compounds
of the invention bound with a species of kinase such as a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing. The compounds are
advantageously selected from the groups defined in sections 3.3 and
3.3.6a.
4. First Aspect of the Invention--P38 Kinase Modulator Compounds,
Methods, Preparations and Adducts
4.1 Generally--A2 Bicyclic Compounds
[0258] The invention includes compounds of formula I as defined in
section 2.1, wherein R2 is selected from the group consisting of
monocyclic heteroaryl, C1-C6alkyl, branched C3-C7alkyl, a
R19-substituted C3-C8carbocyclyl wherein R19 is H or C1-C6alkyl,
C1-C6fluoroalkyl wherein the alkyl group is partially or fully
fluorinated, and phenyl wherein the phenyl group is optionally
substituted by one or more fluorine substituents or chlorine;
4.1.1 Preferred D Moieties
4.1.1a
[0259] Preferred compounds of Formula I as defined above in section
4.1 contain D moieties as defined in section 1.1.1a.
4.1.1b
[0260] Additionally preferred compounds of Formula I as defined
above in section 4.1 contain D moieties as defined in section
1.1.1b.
4.1.1c
[0261] More preferred compounds of Formula I as defined above in
section 4.1.1b contain D moieties as defined in section 1.1.1c.
4.1.2 Preferred A2 Moieties
4.1.2a
[0262] Compounds of Formula I as defined above in section 4.1 have
preferred A2 moieties as defined in section 1.1.2a.
4.1.2b More Preferred A2 Moieties
[0263] Compounds of Formula I as defined above in section 4.1 have
more preferred A2 moieties selected from group consisting of
##STR182## ##STR183## ##STR184## ##STR185## and wherein the symbol
(**) is the point of attachment to the A1 ring for formula I;
wherein each Z3 and Z5 is independently attached to either aryl or
heteroaryl ring of the A2 bicyclic ring. 4.1.2c
[0264] Still more preferred compounds of Formula I as defined above
in section 4.1 have A2 moieties selected from group consisting of
##STR186## ##STR187## and wherein the symbol (**) is the point of
attachment to the A1 ring of formula I; wherein each Z3 and Z5 is
independently attached to either aryl or heteroaryl ring of the A2
bicyclic ring. 4.1.3 Preferred Classes of Compounds 4.1.3a
[0265] Compounds as defined in 4.1.1a wherein the A2 group is
defined in 4.1.2a.
4.1.3b
[0266] Compounds as defined in 4.1.3a wherein the A2 group is
defined in 4.1.2b.
4.1.3c
[0267] Compounds as defined in 4.1.3a wherein the A2 group is
defined in 4.1.2c.
4.1.3d
[0268] Compounds as defined in 4.1.1b wherein the A2 group is
defined in 4.1.2a.
4.1.3e
[0269] Compounds as defined in 4.1.3c wherein the A2 group is
defined in 4.1.2b.
4.1.3f
[0270] Compounds as defined in 4.1.3c wherein the A2 group is
defined in 4.1.2c.
4.1.4 Preferred A1 Moieties
4.1.4a
[0271] Compounds of Formula I as defined above in section 4.1 have
preferred A1 moieties selected from group defined in section
4.1.4a;
wherein each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or
C1-C3alkoxy;
4.1.4b
[0272] Compounds of Formula I as defined above in section 4.1 have
more preferred A1 moieties selected from group consisting of
##STR188## wherein the symbol (*) denotes the attachment to the W
moiety of formula I and the symbol (**) denotes the attachment to
the A2 moiety of formula I. 4.1.4c
[0273] Compounds of Formula I as defined above in section 4.1 have
even more preferred A1 moieties selected from group consisting of
##STR189## wherein the symbol (*) denotes the attachment to the W
moiety of formula I and the symbol (**) denotes the attachment to
the A2 moiety of formula I. 4.1.5 Preferred W and Y Moieties
4.1.5a
[0274] (1) W and Y are each NH, and X.dbd.O; (2) W.dbd.NH,
Y.dbd.CHR4 and X.dbd.O; or (3) W.dbd.CHR4, Y.dbd.NH, and
X.dbd.O.
4.1.5b
[0275] W and Y are each NH and X.dbd.O.
4.1.6 Further Preferred Compounds
4.1.6a
[0276] Further preferred compounds are of the formula ##STR190##
wherein A2 is selected from the group consisting of ##STR191##
##STR192## wherein each Z3 and Z5 is independently attached to
either aryl or heteroaryl ring of the A2 bicyclic ring; wherein the
symbol (**) denotes the attachment to the A1 moiety of formula I;
A1 is selected from the group consisting of ##STR193## wherein the
symbol (*) denotes the attachment to the W moiety of formula I and
the symbol (**) denotes the attachment to the A2 moiety of formula
I; X is O, S, or NR3; D comprises a member of 2,3-dichlorophenyl,
2,4-dichlorophenyl, 3,4-dichlorophenyl, 3,5-dichlorophenyl,
3-chlorophenyl, 4-chlorophenyl, 3-bromophenyl, 4-bromophenyl,
3-trifluoromethylphenyl, 3-trifluoromethyl-4-chlorophenyl,
2,3,4-trifluorophenyl, 2,3,4-trifluorophenyl,
2,4,5-trifluorophenyl, 2,3,5-trifluorophenyl,
3,4,5-trifluorophenyl, 2,3-difluorophenyl, 2,4-difluorophenyl,
2,5-difluorophenyl, 3,4-difluorophenyl, 2-fluorophenyl,
3-fluorophenyl, 4-fluorophenyl, 3-cyanophenyl, 3-phenoxyphenyl, 4
phenoxyphenyl, 1-naphthyl-2,3-dihydro-1H-inden-1-yl,
1,2,3,4-tetrahydronaphthalen 1-yl, benzo[d][1,3]dioxol-5-yl or
benzo[d][1,3]dioxol-4-yl, ##STR194## ##STR195## ##STR196##
##STR197## ##STR198## wherein E1 is selected from the group
consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl;
wherein the symbol (***) denotes the attachment to the Y moiety of
formula I; X1 is selected from the group consisting of O, S, NR3,
--C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I;
each R2 is selected from the group consisting of monocyclic
heteroaryl, C1-C6alkyl, branched C3-C7alkyl, a R19-substituted
C3-C8carbocyclyl wherein R19 is H or C1-C6alkyl, C1-C6fluoroalkyl
wherein the alkyl group is partially or fully fluorinated, and
phenyl wherein the phenyl group is optionally substituted by one or
more fluorine substituents or chlorine; each R2' is selected from
the group consisting of halogen and R2; each R3 is independently
and individually selected from the group consisting of H,
C1-C6alkyl, branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl;
wherein two R3 moieties independently and individually taken from
the group consisting of C1-C6alkyl and branched C3-C7alkyl are
attached to the same nitrogen heteroatom, the two R3 moieties may
cyclize to form a C3-C7 heterocyclyl ring; each R4 is selected from
the group consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom may
cyclize to form a C3-C7 heterocyclyl ring; each R5 is independently
and individually selected from the group consisting of ##STR199##
and wherein the symbol (##) is the point of attachment to
respective R8, R10, R13, Z2, Z3, Z4, Z5, or A2 ring moieties
containing a R5 moiety; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R5 may cyclize to form a C3-C7
heterocyclyl ring; wherein each R6 is independently and
individually selected from the group consisting of C1-C6alkyl,
branched C3-C7alkyl, carbocyclyl, phenyl, heteroaryl, and
heterocyclyl; each R7 is selected from the group consisting of H,
halogen, C1-C3fluoroalkyl wherein the alkyl moiety is partially or
fully fluorinated, C1-C3alkyl, cyclopropyl, cyano, or C1-C3alkoxy;
each R8 is independently and individually selected from the group
consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, branchedC4-C7alkyl,
carbocyclyl, phenyl, C1-C6phenylalkyl, heteroaryl or
heteroarylC1-C6alkyl, heterocyclyl, heterocyclylC1-C6alkyl, OH,
C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2, or R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R8 may cyclize to form a C3-C7
heterocyclyl ring; each R10 is independently and individually
selected from the group consisting of CO.sub.2H,
CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; each R13 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, carbocyclyl, hydroxyC2-C7alkyl, C1-C6alkoxyC2-C7alkyl,
(R4).sub.2N--CO, (R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.q,
R5-C2-C6alkylN(R4)-(CH.sub.2).sub.q,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.q,
R5-C2-C6alkyl-O--(CH.sub.2).sub.q, --(CH.sub.2).sub.qN(R4)C(O)R8,
aryl, arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl,
heterocyclyl, heterocyclylC1-C6alkyl, aryloxyC2-C6alkyl,
heteroaryloxyC2-C6alkyl, heterocyclyloxyC2-C6alkyl,
arylaminoC2-C6alkyl, heteroarylaminoC2-C6alkyl, and
heterocyclylaminoC2-C6alkyl; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R13 may cyclize to form a C3-C7
heterocyclyl ring; each R14 is independently and respectively
selected from the group consisting of H and C1-C6alkyl; wherein Z1'
is independently and individually selected from the group
consisting of H, C1-C6alkyl, C3-C7cycloalkyl, hydroxyC1-C6alkyl,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z3 is
independently and individually selected from the group consisting
of H, C1-C6alkyl, hydroxyl, hydroxyC1-C6alkyl, cyano, C1-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, halogen, CF.sub.3, (R3).sub.2N--,
(R4).sub.2N--, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, R8CO--,
(R4).sub.2N--CO--C1-C6alkyl, carboxyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R3).sub.2NSO.sub.2, --SO.sub.2R3, SOR3, (R4).sub.2NSO.sub.2,
--SO.sub.2R4, --SOR4, --(CH.sub.2).sub.nN(R4)C(O)R8,
--C.dbd.(NOH)R6, --C.dbd.(NOR3)R6, heteroaryl, heterocyclyl,
heteroarylC1-C6alkyl, heterocyclylC1-C6alkyl, heteroaryloxy,
heterocyclyloxy, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylamino, heteroarylamino,
heterocyclylamino, arylaminoC1-C6alkyl, heteroarylaminoC1-C6alkyl,
heterocyclylaminoC1-C6alkyl, or moieties of the formulae ##STR200##
##STR201## wherein the symbol (#) indicates the point of attachment
of the Z3 moiety to the A2 ring of formula I; in the event that Z3
contains an alkyl or alkylene moiety, such moieties may be further
substituted with one or more C1-C6alkyls; wherein two R3 moieties
are independently and individually taken from the group consisting
of C1-C6alkyl and branched C3-C6alkyl and are attached to the same
nitrogen heteroatom of Z3 may cyclize to form a C3-C7 heterocyclyl
ring; wherein two R4 moieties independently and individually taken
from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z3 may cyclize to form a C3-C7 heterocyclyl ring;
each Z4 is independently and individually selected from the group
consisting of H, C1-C6alkyl, hydroxyC2-C6alkyl,
C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR202## ##STR203## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2; V, V1, and V2 are each independently and respectively
selected from the group consisting of O and H.sub.2; and tautomers,
diastereomers, geometric isomers, enantiomers, hydrates, prodrugs,
and salts of any of the foregoing. 4.1.6b
[0277] The following specific compounds are most preferred:
1-(3-t-butyl-1-(3-hydroxy-2,3-dihydro-1H-inden-5-yl)-1H-pyrazol-5-yl)-3-2-
,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-oxo-2,3-dihydro-1H-inden-5-yl)-1H-pyrazol-5-yl)-3-(2,3--
dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(hydroxyimino)-2,3-dihydro-1H-inden-5-yl)-1H-pyrazol-5--
yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(indolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea-
,
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)ure-
a,
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
2-(3-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)naphthal-
en-1-yl)acetic acid,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
1-(3-t-butyl-1-(2-(methylsulfonyl)-1,2,3,4-tetrahydroisoquinolin-7-yl)-1H-
-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(2-(methylsulfonyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-
-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(1-(methylcarbamoyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1-
H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(2-oxo-2,3,4,5-tetrahydro-1H-benzo[d]azepin-7-yl)-1H-pyraz-
ol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(methylsulfonyl)-2,3,4,5-tetrahydro-1H-benzo[d]azepin-7-
-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(1-(3-carbamoyl-2,3-dihydro-1H-inden-5-yl)-3-cyclopentyl-1H-pyrazol-5-y-
l)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(indolin-6-yl)-1H-pyrazol-5-yl)-3-(naphthalen-1-yl)urea,
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(naphthalen-1-yl)urea,
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-
-(3-(pyridin-3-yloxy)phenyl)urea,
1-(3-t-butyl-1-(3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazo-
l-5-yl)-3-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl-
)urea,
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(3-(8-methyl-7-oxo-
-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
4.1.7 Methods
4.1.7a Methods of Protein Modulation
[0278] The invention includes methods of modulating kinase activity
of the p38 family of kinases including, but not limited to
p38-alpha and other MAP kinases. The kinases may be wildtype
kinases, oncogenic forms thereof, aberrant fusion proteins thereof
or polymorphs of any of the foregoing. The method comprises the
step of contacting the kinase species with compounds of the
invention and especially those set forth in sections 4.1 and
4.1.6a. The kinase species may be activated or unactivated, and the
species may be modulated by phosphorylations, sulfation, fatty acid
acylations glycosylations, nitrosylation, cystinylation (i.e.
proximal cysteine residues in the kinase react with each other to
form a disulfide bond) or oxidation. The kinase activity may be
selected from the group consisting of catalysis of phospho transfer
reactions, kinase cellular localization, and recruitment of other
proteins into signaling complexes through modulation of kinase
conformation.
4.1.7b Treatment Methods
[0279] The methods of the invention also include treating
individuals suffering from a condition selected from the group
consisting of inflammation, osteoarthritis, respiratory diseases,
stroke, systemic shock, immunological diseases, and cardiovascular
disease. These methods comprise administering to such individuals
compounds of the invention, and especially those of section 4.1 and
4.1.6a, said condition being human inflammation, rheumatoid
arthritis, rheumatoid spondylitis, ostero-arthritis, asthma, gouty
arthritis, sepsis, septic shock, endotoxic shock, Gram-negative
sepsis, toxic shock syndrome, adult respiratory distress syndrome,
stroke, reperfusion injury, neural trauma, neural ischemia,
psoriasis, restenosis, chronic pulmonary inflammatory disease, bone
resorptive diseases, graft-versus-host reaction, Chron's disease,
ulcerative colitis, inflammatory bowel disease, pyresis, and
combinations thereof. The administration method is not critical,
and may be from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
4.1.8 Pharmaceutical Preparations
[0280] The compounds of the invention, especially those of 4.1 and
4.1.6a may form a part of a pharmaceutical composition by combining
one or more such compounds with a pharmaceutically acceptable
carrier. Additionally, the compositions may include an additive
selected from the group consisting of adjuvants, excipients,
diluents, and stablilizers.
4.1.9 Kinase/Compound Adducts
[0281] The invention also provides adducts in the form of compounds
of the invention bound with a species of kinase such as a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing. The compounds are
advantageously selected from the groups defined in sections 4.1 and
4.1.6a.
4.2 Generally--Monocyclic A2 Compounds with Polycyclic E2 Rings
[0282] The invention includes compounds of the formula I as defined
in section 2.2, wherein R2 is selected from the group consisting of
monocyclic heteroaryl, C1-C6alkyl, branched C3-C7alkyl, a
R19-substituted C3-C8carbocyclyl wherein R19 is H or C1-C6alkyl,
C1-C6fluoroalkyl wherein the alkyl group is partially or fully
fluorinated, and phenyl wherein the phenyl group is optionally
substituted by one or more fluorine substituents or chlorine;
4.2.1 Preferred D Moieties
4.2.1a
[0283] Preferably, the compounds of formula I in 4.2 contain D
moieties wherein E1 and E2 are as defined in section 1.2.1
4.2.1b
[0284] Additionally preferred D moieties of formula I in 4.2 are as
defined in section 1.2.1b
4.2.1c
[0285] More preferred D moieties of 4.2.1b are where E2 is defined
as in section 1.2.1c
4.2.2 Preferred A2 Moieties
4.2.2a
[0286] Compounds of Formula I as defined above in section 4.2 have
preferred A2 moieties as defined in section 2.2.2a;
4.2.2b
[0287] More preferred A2 moieties are selected from the group
consisting of ##STR204## and wherein the symbol (**) is the point
of attachment to the A1 ring for formula I. 4.2.2c
[0288] Even more preferred A2 moieties are selected from the group
consisting of ##STR205## and wherein the symbol (**) is the point
of attachment to the A1 ring of formula I. 4.2.3 Preferred Classes
of Compounds 4.2.3a
[0289] Compounds as defined in 4.2.1a wherein the A2 group is
defined in 4.2.2a.
4.2.3b
[0290] Compounds as defined in 4.2.3a wherein the A2 group is
defined in 4.2.2b.
4.2.3c
[0291] Compounds as defined in 4.2.3a wherein the A2 group is
defined in 4.2.2c.
4.2.3d
[0292] Compounds as defined in 4.2.1b wherein the A2 group is
defined in 4.2.2a.
4.2.3e
[0293] Compounds as defined in 4.2.3c wherein the A2 group is
defined in 4.2.2b.
4.2.3f
[0294] Compounds as defined in 4.2.3c wherein the A2 group is
defined in 4.2.2c.
4.2.4 Preferred A1 Moieties
4.2.4a
[0295] These preferred A1 moieties are defined in 4.1.4a.
4.2.4b
[0296] These more preferred A1 moieties are defined in 4.1.4b.
4.2.4c
[0297] These even more preferred A1 moieties are defined in
4.1.4c.
4.2.5 Preferred W and Y Moieties
4.2.5a
[0298] (1) W and Y are each NH, and X.dbd.O; (2) W.dbd.NH,
Y.dbd.CHR4 and X.dbd.O; or (3) W.dbd.CHR4, Y.dbd.NH, and
X.dbd.O.
4.2.5b
[0299] W and Y are each NH and X.dbd.O.
4.2.6 Further Preferred Compounds
4.2.6a
[0300] Further preferred compounds are of the formula ##STR206##
wherein A2 is selected from the group consisting of ##STR207##
wherein the symbol (**) denotes the attachment to the A1 moiety of
formula I; A1 is selected from the group consisting of ##STR208##
wherein the symbol (*) denotes the attachment to the W moiety of
formula I and the symbol (**) denotes the attachment to the A2
moiety of formula I; X is O, S, or NR3; D comprises a member of
##STR209## ##STR210## wherein E1 is selected from the group
consisting cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
pyrrolidinyl piperidinyl, phenyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, furyl, imidazolyl, pyridyl, pyrimidinyl and naphthyl;
wherein the symbol (***) denotes the attachment to the Y moiety of
formula I; X1 is selected from the group consisting of O, S, NR3,
--C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)--C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2)p-, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I;
each R2 is selected from the group consisting of monocyclic
heteroaryl, C1-C6alkyl, branched C3-C7alkyl, a R19-substituted
C3-C8carbocyclyl wherein R19 is H or C1-C6alkyl, C1-C6fluoroalkyl
wherein the alkyl group is partially or fully fluorinated, and
phenyl wherein the phenyl group is optionally substituted by one or
more fluorine substituents or chlorine; each R2' is selected from
the group consisting of halogen and R2; each R3 is independently
and individually selected from the group consisting of H,
C1-C6alkyl, branched C3-C7alkyl, C3-C7carbocyclyl, or phenyl;
wherein two R3 moieties independently and individually taken from
the group consisting of C1-C6alkyl and branched C3-C7alkyl are
attached to the same nitrogen heteroatom, the two R3 moieties may
cyclize to form a C3-C7 heterocyclyl ring; each R4 is selected from
the group consisting of H, C1-C6alkyl, hydroxyC1-C6 alkyl,
dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl, branched C3-C7alkyl,
branched hydroxyC1-C6 alkyl, branched C1-C6alkoxyC1-C6alkyl,
branched dihydroxyC1-C6alkyl, carbocyclyl, hydroxyl substituted
carbocyclyl, alkoxy substituted carbocyclyl, dihydroxy substituted
carbocyclyl, phenyl, heteroaryl, heterocyclyl, phenylC1-C6alkyl,
heteroarylC1-C6alkyl, and heterocyclylC1-C6alkyl; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom may
cyclize to form a C3-C7 heterocyclyl ring; each R5 is independently
and individually selected from the group consisting of ##STR211##
and wherein the symbol (##) is the point of attachment to
respective R8, R10, Z1, Z4, Z5, Z6 or A2 ring moieties containing a
R5 moiety; wherein two R4 moieties independently and individually
taken from the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of R5 may cyclize to form a C3-C7 heterocyclyl ring;
wherein each R6 is independently and individually selected from the
group consisting of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl,
phenyl, heteroaryl, and heterocyclyl; each R7 is selected from the
group consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl
moiety is partially or fully fluorinated, C1-C3alkyl, cyclopropyl,
cyano, or C1-C3alkoxy; each R8 is independently and individually
selected from the group consisting of C1-C6alkyl, C1-C6 fluoroalkyl
wherein the alkyl moiety is partially or fully fluorinated,
branchedC4-C7alkyl, carbocyclyl, phenyl, C1-C6phenylalkyl,
heteroaryl or heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2,
or R5; wherein two R3 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; each Z1 is a substituent attached to a ring
carbon and is independently and individually selected from the
group consisting of hydroxyC1-C6alkyl, C2-C6alkoxy,
C1-C6alkoxyC1-C6alkyl, (R4).sub.2NC1-C6alkyl,
(R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--C(.dbd.O)--,
(R4).sub.2N--C(.dbd.O)--, (R4).sub.2N--CO--C1-C6alkyl,
C1-C6alkoxycarbonyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, (R3).sub.2NSO.sub.2, SOR3,
(R4).sub.2NSO.sub.2, --SO.sub.2R3', --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6, --(CH.sub.2).sub.nN(R4)C(O)R8,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR212## ##STR213## ##STR214## cyano
wherein the site of attachment to the A2 ring is meta to the point
of attachment to the A1 ring and wherein A2 is phenyl, and cyano
wherein the site of attachment is to a substitutable position when
A2 is pyridyl, pyrimidinyl or a five-membered ring; In the
foregoing definition of Z1, alkyl moieties may optionally be
substituted by one or more C1-C6alkyl; Wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z1 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
In the foregoing definition of Z1, alkyl moieties may optionally be
substituted by one or more C1-C6alkyl; Wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z1 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z1 may cyclize to
form a C3-C7 heterocyclyl ring; wherein Z1' is independently and
individually selected from the group consisting of H, C1-C6alkyl,
C3-C7cycloalkyl, hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4 is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR215## ##STR216## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--R5, --O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)--(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r is 0 or 1; v
is 1 or 2; and tautomers, diastereomers, geometric isomers,
enantiomers, hydrates, prodrugs and salts of any of the foregoing.
4.2.6b
[0301] The following specific compounds of Formula I are more
preferred:
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-methy-
l-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea,
1-(3-t-butyl-1-(3-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)phenyl)-1H-pyr-
azol-5-yl)-3-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea
4.2.7 Methods
4.2.7a Methods of Protein Modulation
[0302] The invention includes methods of modulating kinase activity
of the p38 family of kinases including, but not limited to
p38-alpha and other MAP kinases. The kinases may be wildtype
kinases, oncogenic forms thereof, aberrant fusion proteins thereof
or polymorphs of any of the foregoing. The method comprises the
step of contacting the kinase species with compounds of the
invention and especially those set forth in sections 4.2 and
4.2.6a. The kinase species may be activated or unactivated, and the
species may be modulated by phosphorylations, sulfation, fatty acid
acylations glycosylations, nitrosylation, cystinylation (i.e.
proximal cysteine residues in the kinase react with each other to
form a disulfide bond) or oxidation. The kinase activity may be
selected from the group consisting of catalysis of phospho transfer
reactions, kinase cellular localization, and recruitment of other
proteins into signaling complexes through modulation of kinase
conformation.
4.2.7b Treatment Methods
[0303] The methods of the invention also include treating
individuals suffering from a condition selected from the group
consisting of inflammation, osteoarthritis, respiratory diseases,
stroke, systemic shock, immunological diseases, and cardiovascular
disease. These methods comprise administering to such individuals
compounds of the invention, and especially those of section 4.2 and
4.2.6a, said condition being human inflammation, rheumatoid
arthritis, rheumatoid spondylitis, ostero-arthritis, asthma, gouty
arthritis, sepsis, septic shock, endotoxic shock, Gram-negative
sepsis, toxic shock syndrome, adult respiratory distress syndrome,
stroke, reperfusion injury, neural trauma, neural ischemia,
psoriasis, restenosis, chronic pulmonary inflammatory disease, bone
resorptive diseases, graft-versus-host reaction, Chron's disease,
ulcerative colitis, inflammatory bowel disease, pyresis, and
combinations thereof. The administration method is not critical,
and may be from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
4.2.8 Pharmaceutical Preparations
[0304] The compounds of the invention, especially those of 4.2 and
4.2.6a may form a part of a pharmaceutical composition by combining
one or more such compounds with a pharmaceutically acceptable
carrier. Additionally, the compositions may include an additive
selected from the group consisting of adjuvants, excipients,
diluents, and stablilizers.
4.2.9 Kinase/Compound Adducts
[0305] The invention also provides adducts in the form of compounds
of the invention bound with a species of kinase such as a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing. The compounds are
advantageously selected from the groups defined in sections 4.2 and
4.2.6a.
4.3 Generally--Monocyclic A2 Compounds with Monocyclic E2 Rings
[0306] The invention includes compounds of the formula I as defined
in section 2.3 wherein R2 is selected from the group consisting of
monocyclic heteroaryl, C1-C6alkyl, branched C3-C7alkyl, a
R19-substituted C3-C8carbocyclyl wherein R19 is H or C1-C6alkyl,
C1-C6fluoroalkyl wherein the alkyl group is partially or fully
fluorinated, and phenyl wherein the phenyl group is optionally
substituted by one or more fluorine substituents or chlorine;
4.3.1 Preferred D Moieties
4.3.1a
[0307] Preferably, the compounds of formula I in 4.3 contain D
moieties wherein E1 and E2 are as defined in section 1.3.1a.
4.3.1b
[0308] Additionally preferred D moieties of formula I in 4.3 are as
defined in section 1.3.1b.
4.3.1c
[0309] More preferred D moieties of 3.2.1b are wherein E2 is
defined as in section 1.3.1c.
4.3.2 Preferred A2 Moieties
4.3.2a
[0310] Compounds of Formula I as defined above in section 4.3 have
preferred A2 moieties as defined in section 2.2.2a.
4.3.2b
[0311] More preferred A2 moieties are selected from the group
consisting of ##STR217## and wherein the symbol (**) is the point
of attachment to the A1 ring for formula I. 4.3.2c
[0312] Even more preferred A2 moieties are selected from the group
consisting of ##STR218## and wherein the symbol (**) is the point
of attachment to the A1 ring of formula I. 4.3.3 Preferred Classes
of Compounds 4.3.3a
[0313] Compounds as defined in 4.3.1a wherein the A2 group is
defined in 4.3.2a.
4.3.3b
[0314] Compounds as defined in 4.3.3a wherein the A2 group is
defined in 4.3.2b.
4.3.3c
[0315] Compounds as defined in 4.3.3a wherein the A2 group is
defined in 4.3.2c.
4.3.3d
[0316] Compounds as defined in 4.3.1b wherein the A2 group is
defined in 4.3.2a.
4.3.3e
[0317] Compounds as defined in 4.3.3c wherein the A2 group is
defined in 4.3.2b.
4.3.3f
[0318] Compounds as defined in 4.3.3c wherein the A2 group is
defined in 4.3.2c.
4.3.4 Preferred A1 Moieties
4.3.4a
[0319] These preferred A1 moieties are defined in 4.1.4a.
4.3.4b
[0320] These more preferred A1 moieties are defined in 4.1.4b.
4.3.4c
[0321] These even more preferred A1 moieties are defined in
4.1.4c.
4.3.5 Preferred W and Y Moieties
4.3.5a
[0322] (1) W and Y are each NH, and X.dbd.O; (2) W.dbd.NH,
Y.dbd.CHR4 and X.dbd.O; or (3) W.dbd.CHR4, Y.dbd.NH, and
X.dbd.O.
4.3.5b
[0323] W and Y are each NH and X.dbd.O.
4.3.6 Further Preferred Compounds
4.3.6a
[0324] Further preferred compounds are of the formula ##STR219##
wherein A2 is selected from the group consisting of ##STR220##
wherein the symbol (**) denotes the attachment to the A1 moiety of
formula I; A1 is selected from the group consisting of ##STR221##
wherein the symbol (*) denotes the attachment to the W moiety of
formula I and the symbol (**) denotes the attachment to the A2
moiety of formula I; X is O, S, or NR3; D comprises a member of
2,3-dichlorophenyl, 2,4-dichlorophenyl, 3,4-dichlorophenyl,
3,5-dichlorophenyl, 3-chlorophenyl, 4-chlorophenyl, 3-bromophenyl,
4-bromophenyl, 3-trifluoromethylphenyl,
3-trifluoromethyl-4-chlorophenyl, 2,3,4-trifluorophenyl,
2,3,4-trifluorophenyl, 2,4,5-trifluorophenyl,
2,3,5-trifluorophenyl, 3,4,5-trifluorophenyl, 2,3-difluorophenyl,
2,4-difluorophenyl, 2,5-difluorophenyl, 3,4-difluorophenyl,
2-fluorophenyl, 3-fluorophenyl, 4-fluorophenyl, 3-cyanophenyl,
3-phenoxyphenyl, 4 phenoxyphenyl,
1-naphthyl-2,3-dihydro-1H-inden-1-yl, 1,2,3,4-tetrahydronaphthalen
1-yl, benzo[d][1,3]dioxol-5-yl or benzo[d][1,3]dioxol-4-yl,
##STR222## ##STR223## ##STR224## ##STR225## ##STR226## wherein E1A
is taken from the groups consisting of cyclopropyl, cyclobutyl,
cyclopentyl, cyclohexyl, pyrrolidinyl piperidinyl, thienyl,
oxazolyl, thiazolyl, isoxazolyl, isothiazolyl, pyrrolyl, pyrazolyl,
oxadiazolyl, thiadiazolyl, furyl, imidazolyl, pyridyl, and
pyrimidinyl; wherein E1B is taken from the groups consisting of
phenyl and naphthyl; wherein E2A is taken from the group comprising
naphthyl, pyrrolyl, furyl, thienyl, oxazolyl, thiazolyl,
isoxazolyl, isothiazolyl, imidazolyl, pyrazolyl, oxadiazolyl,
thiadiazolyl, triazolyl, tetrazolyl, pyrazinyl, pyridazinyl,
triazinyl and fused bicyclic rings selected from the group
comprising indolyl, isoindolyl, isoindolinyl, isoindolonyl,
indazolyl, benzofuranyl, benzothienyl, benzothiazolyl,
benzothiazolonyl, benzoxazolyl, benzoxazolonyl, benzisoxazolyl,
benzisothiazolyl, benzimidazolyl, benzimidazolonyl, benztriazolyl,
imidazopyridinyl, imidazopyrimidinyl, imidazolonopyrimidinyl,
dihydropurinonyl, pyrrolopyrimidinyl, purinyl, pyrazolopyridinyl,
pyrazolopyrimidinyl, isoxazolopyrimidinyl, isothiazolopyrimidinyl,
furylopyrimidinyl, thienopyrimidinyl, phthalimidyl, phthalimidinyl,
pyrazinylpyridinyl, pyridinopyrimidinyl, pyrimidinopyrimidinyl,
cinnolinyl, quinoxalinyl, quinazolinyl, quinolinyl, isoquinolinyl,
phthalazinyl, benzodioxyl, indolinyl,
benzisothiazoline-1,1,3-trionyl, dihydroquinolinyl,
tetrahydroquinolinyl, dihydroisoquinolyl, tetrahydroisoquinolinyl,
benzoazepinyl, benzodiazepinyl, benzoxapinyl, benzoxazepinyl;
wherein E2B is taken from the group consisting of phenyl, pyridyl,
and pyrimidyl; wherein the symbol (***) denotes the attachment to
the Y moiety of formula I; X1 is selected from the group consisting
of O, S, NR3, --C(.dbd.O)--, --O--(CH.sub.2)n-, --S--(CH.sub.2)n-,
--NR3-(CH.sub.2)n-, --O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)--C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2)n-,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2).sub.p--, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the E1
ring and the E2 ring are directly linked by a covalent bond; and
wherein the carbon atoms of --(CH2)n-, --(CH2)q-, (CH2)p,
C2-C5alkenyl, and C2-C5alkynyl moieties of X1 may be further
substituted by one or more C1-C6alkyl; X2 is selected from the
group consisting of C1-C6 alkyl, C3-C6 branched alkyl, or a direct
bond wherein E1 is directly linked to the Y group of formula I; X3
is selected from the group consisting of NR3, --C(.dbd.O)--,
--O--(CH.sub.2)n-, --S--(CH.sub.2)n-, --NR3-(CH.sub.2)n-,
--O--(CH.sub.2)q-O--, --O--(CH.sub.2)q-NR3-,
--N(R3)-(CH.sub.2)q-N(R3)-, --(CH.sub.2)n-N(R4)-C(.dbd.O)--,
--(CH.sub.2)n-N(R4)-C(.dbd.O)(CH.sub.2).sub.n--,
--(CH.sub.2)n-CO--N(R4)-, --(CH.sub.2).sub.q--, C2-C5alkenyl,
C2-C5alkynyl, C3-C6cycloalkyl, and a direct bond wherein the either
the E1B ring or E2B ring are directly linked by a covalent bond;
and wherein the carbon atoms of --(CH2)q-, C2-C5alkenyl, and
C2-C5alkynyl moieties of X3 may be further substituted by one or
more C1-C6alkyl; X4 is selected from the group consisting of C1-C6
alkyl, C3-C6 branched alkyl; each R2 is selected from the group
consisting of monocyclic heteroaryl, C1-C6alkyl, branched
C3-C7alkyl, a R19-substituted C3-C8carbocyclyl wherein R19 is H or
C1-C6alkyl, C1-C6fluoroalkyl wherein the alkyl group is partially
or fully fluorinated, and phenyl wherein the phenyl group is
optionally substituted by one or more fluorine substituents or
chlorine; each R2' is selected from the group consisting of halogen
and R2; each R3 is independently and individually selected from the
group consisting of H, C1-C6alkyl, branched C3-C7alkyl,
C3-C7carbocyclyl, or phenyl; wherein two R3 moieties independently
and individually taken from the group consisting of C1-C6alkyl and
branched C3-C7alkyl are attached to the same nitrogen heteroatom,
the two R3 moieties may cyclize to form a C3-C7 heterocyclyl ring;
each R4 is selected from the group consisting of H, C1-C6alkyl,
hydroxyC1-C6 alkyl, dihydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
branched C3-C7alkyl, branched hydroxyC1-C6 alkyl, branched
C1-C6alkoxyC1-C6alkyl, branched dihydroxyC1-C6alkyl, carbocyclyl,
hydroxyl substituted carbocyclyl, alkoxy substituted carbocyclyl,
dihydroxy substituted carbocyclyl, phenyl, heteroaryl,
heterocyclyl, phenylC1-C6alkyl, heteroarylC1-C6alkyl, and
heterocyclylC1-C6alkyl; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom may cyclize to form a C3-C7
heterocyclyl ring; each R5 is independently and individually
selected from the group consisting of ##STR227## and wherein the
symbol (##) is the point of attachment to respective R8, R10, Z4,
Z5, Z6 or A2 ring moieties containing a R5 moiety; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R5
may cyclize to form a C3-C7 heterocyclyl ring; wherein each R6 is
independently and individually selected from the group consisting
of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl, phenyl,
heteroaryl, and heterocyclyl; each R7 is selected from the group
consisting of H, halogen, C1-C3fluoroalkyl wherein the alkyl moiety
is partially or fully fluorinated, C1-C3alkyl, cyclopropyl, cyano,
or C1-C3alkoxy; each R8 is independently and individually selected
from the group consisting of C1-C6alkyl, C1-C6 fluoroalkyl wherein
the alkyl moiety is partially or fully fluorinated,
branchedC4-C7alkyl, carbocyclyl, phenyl, C1-C6phenylalkyl,
heteroaryl or heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, OH, C1-C6alkoxy, N(R3).sub.2, N(R4).sub.2,
or R5; wherein two R3 moieties are independently and individually
taken from the group consisting of C1-C6alkyl and branched
C3-C6alkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; wherein two R4
moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of R8
may cyclize to form a C3-C7 heterocyclyl ring; each R10 is
independently and individually selected from the group consisting
of CO.sub.2H, CO.sub.2C1-C6alkyl, CO--N(R4).sub.2, OH, C1-C6alkoxy,
--N(R4).sub.2; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R10 may cyclize to form a C3-C7
heterocyclyl ring; each R13 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, carbocyclyl, hydroxyC2-C7alkyl, C1-C6alkoxyC2-C7alkyl,
(R4).sub.2N--CO, (R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonyl, C1-C6alkoxycarbonylC1-C6alkyl,
(R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.q,
R5-C2-C6alkylN(R4)-(CH.sub.2).sub.q,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.q,
R5-C2-C6alkyl-O--(CH.sub.2).sub.q, --(CH.sub.2).sub.qN(R4)C(O)R8,
aryl, arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl,
heterocyclyl, heterocyclylC1-C6alkyl, aryloxyC2-C6alkyl,
heteroaryloxyC2-C6alkyl, heterocyclyloxyC2-C6alkyl,
arylaminoC2-C6alkyl, heteroarylaminoC2-C6alkyl, and
heterocyclylaminoC2-C6alkyl; wherein two R4 moieties independently
and individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of R13 may cyclize to form a C3-C7
heterocyclyl ring; wherein Z1' is independently and individually
selected from the group consisting of H, C1-C6alkyl,
C3-C7cycloalkyl, hydroxyC1-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R4).sub.2N--C1-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-(CH.sub.2).sub.p,
(R4).sub.2N--C2-C6alkylO--(CH.sub.2).sub.p,
(R4).sub.2N--CO--C1-C6alkyl, carboxyC1-C6alkyl,
C1-C6alkoxycarbonylC1-C6alkyl, --(CH.sub.2).sub.pN(R4)C(O)R8, aryl,
arylC1-C6alkyl, heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, aryloxyC1-C6alkyl, heteroaryloxyC1-C6alkyl,
heterocyclyloxyC1-C6alkyl, arylaminoC1-C6alkyl,
heteroarylaminoC1-C6alkyl, or heterocyclylaminoC1-C6alkyl; wherein
two R4 moieties independently and individually taken from the group
consisting of C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and
alkoxyalkyl and are attached to the same nitrogen heteroatom of Z1'
may cyclize to form a C3-C7 heterocyclyl ring; each Z4 is a
substituent attached to a ring nitrogen and is independently and
individually selected from the group consisting of H, C1-C6alkyl,
hydroxyC2-C6alkyl, C1-C6alkoxyC2-C6alkyl, (R4).sub.2N--C2-C6alkyl,
(R4).sub.2N--C2-C6alkylN(R4)-C2-C6alkyl,
(R4).sub.2N--C2-C6alkyl-O--C2-C6alkyl, (R4).sub.2N--CO--C2-C6alkyl,
carboxyC2-C6alkyl, C1-C6alkoxycarbonylC2-C6alkyl,
--C2-C6alkylN(R4)C(O)R8, R8-C(.dbd.NR3)-, --SO.sub.2R8, --COR8,
heteroaryl, heteroarylC1-C6alkyl, heterocyclyl,
heterocyclylC1-C6alkyl, heteroaryloxyC2-C6alkyl,
heterocyclyloxyC2-C6alkyl, arylaminoC2-C6alkyl,
heteroarylaminoC2-C6alkyl, heterocyclylaminoC2-C6alkyl, and
moieties of the formulae ##STR228## ##STR229## wherein the symbol
(#) indicates the point of attachment of the Z4 moiety to the A2
ring for formula I; in the event that Z4 contains an alkyl or
alkylene moiety, such moieties may be further substituted with one
or more C1-C6alkyls; wherein two R3 moieties are independently and
individually taken from the group consisting of C1-C6alkyl and
branched C3-C6alkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring;
wherein two R4 moieties independently and individually taken from
the group consisting of C1-C6alkyl, branched C3-C6alkyl,
hydroxyalkyl, and alkoxyalkyl and are attached to the same nitrogen
heteroatom of Z4 may cyclize to form a C3-C7 heterocyclyl ring; Z5
is independently and individually selected from the group
consisting of H, C1-C6alkyl, branched C3-C7alkyl, halogen,
fluoroalkyl, cyano, hydroxyl, alkoxy, oxo, aminocarbonyl,
carbonylamino, aminosulfonyl, sulfonylamino, --N(R3).sub.2,
--O--(CH.sub.2)q-N(R4).sub.2, --N(R3)-(CH2)q-N(R4).sub.2, --R5,
--O--(CH.sub.2)q-O-Alkyl, --O--(CH.sub.2)q-N(R4).sub.2,
--N(R3)-(CH.sub.2)q-O-Alkyl, --N(R3)-(CH.sub.2)q-N(R4).sub.2,
--O--(CH.sub.2)q-R5, and --N(R3)-(CH.sub.2)q-R5; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z5 may cyclize to form a C3-C7
heterocyclyl ring; Each Z6 is independently and individually
selected from the group consisting of H, C1-C6alkyl, branched
C3-C7alkyl, hydroxyl, C1-C6alkoxy, (R3).sub.2N--, --N(R3)COR8,
(R4).sub.2N--, --R5, --N(R4)COR8, --N(R3)SO.sub.2R6-,
--CON(R3).sub.2, --CON(R4).sub.2, --COR5, --SO.sub.2NHR4,
heteroaryl, heterocyclyl, heteroaryloxy, heterocyclyloxy,
arylamino, heteroarylamino, and heterocyclylamino; wherein two R3
moieties are independently and individually taken from the group
consisting of C1-C6alkyl and branched C3-C6alkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; wherein two R4 moieties independently and
individually taken from the group consisting of C1-C6alkyl,
branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and are attached
to the same nitrogen heteroatom of Z6 may cyclize to form a C3-C7
heterocyclyl ring; each Z7 is a substituent attached to a ring
carbon and is independently and individually selected from the
group consisting of hydroxyC2-C6alkyl, C1-C6alkoxyC1-C6alkyl,
(R6).sub.2NC1-C6alkyl, (R4).sub.2NC2-C6alkylN(R4)-(CH.sub.2).sub.n,
(R4).sub.2NC2-C6alkylO--(CH.sub.2).sub.n, (R3).sub.2N--CO,
(R4).sub.2N--CO, --SO.sub.2R3', SOR3, --SOR4, --C(.dbd.O)R6,
--C(.dbd.NOH)R6, --C(.dbd.NOR3)R6,
(CH.sub.2).sub.nN(R4)C(O)N(R4).sub.2, (CH.sub.2).sub.nN(R4)C(O)R5,
monocyclic heteroaryl, monocyclic heterocyclyl, monocyclic
heteroarylC1-C6alkyl, monocyclic heterocyclylC1-C6alkyl, monocyclic
heteroaryloxy, monocyclic heterocyclyloxy, monocyclic
heteroaryloxyC1-C6alkyl, monocyclic heterocyclyloxyC1-C6alkyl,
arylamino, monocyclic heteroarylamino, monocyclic
heterocyclylamino, arylaminoC1-C6alkyl, monocyclic
heteroarylaminoC1-C6alkyl, monocyclic heterocyclylaminoC1-C6alkyl,
or moieties of the formulae ##STR230## ##STR231## cyano wherein the
site of attachment to the A2 ring is meta to the point of
attachment to the A1 ring and wherein A2 is phenyl, and cyano
wherein the site of attachment is to a substitutable position when
A2 is pyridyl, pyrimidinyl or a five-membered ring; In the
foregoing definition of Z7, alkyl moieties may optionally be
substituted by one or more C1-C6alkyl; Wherein the asterisk (*)
indicates the point of attachment of the Z1 moiety to the A2 ring;
in the event that Z7 contains an alkyl or alkylene moiety, such
moieties may be further substituted with one or more C1-C6alkyls;
wherein two R3 moieties are independently and individually taken
from the group consisting of C1-C6alkyl and branched C3-C6alkyl and
are attached to the same nitrogen heteroatom of Z7 may cyclize to
form a C3-C7 heterocyclyl ring; wherein two R4 moieties
independently and individually taken from the group consisting of
C1-C6alkyl, branched C3-C6alkyl, hydroxyalkyl, and alkoxyalkyl and
are attached to the same nitrogen heteroatom of Z7 may cyclize to
form a C3-C7 heterocyclyl ring; and n is 0-4; p is 1-4; q is 2-6; r
is 0 or 1; v is 1 or 2; and tautomers, diastereomers, geometric
isomers, enantiomers, hydrates, prodrugs and salts of any of the
foregoing. 4.3.6b
[0325] The following specific compounds of Formula I are more
preferred:
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(pyri-
din-3-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(2-(m-
ethylcarbamoyl)pyridin-4-yloxy)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(8-me-
thyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(3-(-
8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea,
1-(1-(3-(1H-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3-dichlo-
rophenyl)urea,
2-(3-(5-(3-(2,3-dichlorophenyl)ureido)-3-(3-fluorophenyl)-1H-pyrazol-1-yl-
)phenyl)acetic acid,
2-(3-(5-(3-(2,3-dichlorophenyl)ureido)-3-(2-fluorophenyl)-1H-pyrazol-1-yl-
)phenyl)acetic acid,
2-(4-(5-(3-(2,3-dichlorophenyl)ureido)-3-(3-fluorophenyl)-1H-pyrazol-1-yl-
)phenyl)acetic acid,
2-(4-(5-(3-(2,3-dichlorophenyl)ureido)-3-(2-fluorophenyl)-1H-pyrazol-1-yl-
)phenyl)acetic acid,
2-(4-(3-cyclopentyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)phen-
yl)acetic acid,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-(3-fluorophenyl)-1H-pyrazol-5-yl)-3-
-(2,3-dichlorophenyl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-(2-fluorophenyl)-1H-pyrazol-5-yl)-3-
-(2,3-dichlorophenyl)urea,
1-(2,3-dichlorophenyl)-3-(3-(2-fluorophenyl)-1-(3-(2-(2-hydroxyethylamino-
)-2-oxoethyl)phenyl)-1H-pyrazol-5-yl)urea,
1-(2,3-dichlorophenyl)-3-(1-(3-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)p-
henyl)-3-(2-fluorophenyl)-1H-pyrazol-5-yl)urea,
1-(3-t-butyl-1-(3-(2-((S)-3-hydroxypyrrolidin-1-yl)-2-oxoethyl)phenyl)-1H-
-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(2-((R)-3-(dimethylamino)pyrrolidin-1-yl)-2-oxoethyl)ph-
enyl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(1-(4-(2-amino-2-oxoethyl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea,
1-(2,3-dichlorophenyl)-3-(1-(4-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)p-
henyl)-3-(2-fluorophenyl)-1H-pyrazol-5-yl)urea,
(R)-1-(3-t-butyl-1-(4-(2-(3-hydroxypyrrolidin-1-yl)-2-oxoethyl)phenyl)-1H-
-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
(R)-1-(3-t-butyl-1-(4-(2-(3-methoxypyrrolidin-1-yl)-2-oxoethyl)phenyl)-1H-
-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
(R)-1-(3-t-butyl-1-(4-(2-(3-(dimethylamino)pyrrolidin-1-yl)-2-oxoethyl)ph-
enyl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(2,3-dichlorophenyl)-3-(3-(2-fluorophenyl)-1-(3-(hydroxymethyl)phenyl)--
1H-pyrazol-5-yl)urea,
1-(3-cyclopentyl-1-(3-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)phenyl)-1H-
-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-cyclopentyl-1-(3-(2-(2-hydroxyethylamino)-2-oxoethyl)phenyl)-1H-pyra-
zol-5-yl)-3-(2,3-dichlorophenyl)urea,
1-(3-t-butyl-1-(3-(5-oxo-4,5-dihydro-1,3,4-oxadiazol-2-yl)phenyl)-1H-pyra-
zol-5-yl)-3-(2,3-dichlorophenyl)urea.
1-(1-(3-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)phenyl)-3-(2-fluoropheny-
l)-1H-pyrazol-5-yl)-3-(naphthalen-1-yl)urea,
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-(2-fluorophenyl)-1H-pyrazol-5-yl)-3-
-(naphthalen-1-yl)urea,
2-(3-(3-(2-fluorophenyl)-5-(3-(naphthalen-1-yl)ureido)-1H-pyrazol-1-yl)ph-
enyl)acetic acid,
4.3.7 Methods
4.3.7a Methods of Protein Modulation
[0326] The invention includes methods of modulating kinase activity
of the p38 family of kinases including, but not limited to
p38-alpha and other MAP kinases. The kinases may be wildtype
kinases, oncogenic forms thereof, aberrant fusion proteins thereof
or polymorphs of any of the foregoing. The method comprises the
step of contacting the kinase species with compounds of the
invention and especially those set forth in sections 4.3 and
4.3.6a. The kinase species may be activated or unactivated, and the
species may be modulated by phosphorylations, sulfation, fatty acid
acylations glycosylations, nitrosylation, cystinylation (i.e.
proximal cysteine residues in the kinase react with each other to
form a disulfide bond) or oxidation. The kinase activity may be
selected from the group consisting of catalysis of phospho transfer
reactions, kinase cellular localization, and recruitment of other
proteins into signaling complexes through modulation of kinase
conformation.
4.3.7b Treatment Methods
[0327] The methods of the invention also include treating
individuals suffering from a condition selected from the group
consisting of inflammation, osteoarthritis, respiratory diseases,
stroke, systemic shock, immunological diseases, and cardiovascular
disease. These methods comprise administering to such individuals
compounds of the invention, and especially those of section 4.3 and
4.3.6a, said condition being human inflammation, rheumatoid
arthritis, rheumatoid spondylitis, ostero-arthritis, asthma, gouty
arthritis, sepsis, septic shock, endotoxic shock, Gram-negative
sepsis, toxic shock syndrome, adult respiratory distress syndrome,
stroke, reperfusion injury, neural trauma, neural ischemia,
psoriasis, restenosis, chronic pulmonary inflammatory disease, bone
resorptive diseases, graft-versus-host reaction, Chron's disease,
ulcerative colitis, inflammatory bowel disease, pyresis, and
combinations thereof. The administration method is not critical,
and may be from the group consisting of oral, parenteral,
inhalation, and subcutaneous.
4.3.8 Pharmaceutical Preparations
[0328] The compounds of the invention, especially those of 4.3 and
4.3.6a may form a part of a pharmaceutical composition by combining
one or more such compounds with a pharmaceutically acceptable
carrier. Additionally, the compositions may include an additive
selected from the group consisting of adjuvants, excipients,
diluents, and stablilizers.
4.3.9 Kinase/Compound Adducts
[0329] The invention also provides adducts in the form of compounds
of the invention bound with a species of kinase such as a wild-type
kinase, oncogenic forms thereof, aberrant fusion proteins thereof
and polymorphs of any of the foregoing. The compounds are
advantageously selected from the groups defined in sections 4.3 and
4.3.6a.
5. Fifth Aspect of the Invention--Compound Synthesis
[0330] Recently, Cu(II)-catalyzed cross coupling reactions have
been described for Cu(II) catalyzed cross coupling reactions of
aryl or heteroaryl metal reactants with NH-containing heterocycles.
These methods have been described by P. Y. S. Lam et al,
Tetrahedron Letters (1998) 39: 2941), P. Y. S. Lam et al, Journal
of the American Chemical Society (2000) 122: 7600; D. M. T. Chan et
al, Tetrahedron Letters (2003) 44: 3863; D. M. T. Chan et al,
Tetrahedron Letters (1998) 39: 2933; D. A. Evans et al, Tetrahedron
Letters (1998) 39: 2937.
5.1 Novel Syntheses
[0331] The present invention further provides novel methods for
synthesizing the useful compounds. Broadly speaking, the synthesis
method comprises the steps: providing a ring compound of the
formula ##STR232## wherein s is 3 or 4, the ring compound has two
double bonds and one reactable ring NH moiety, Q is independently
and individually selected from the group consisting of N and CR2,
and R15 is selected from the group consisting of lower alkyl,
branched lower alkyl, benzyl, substituted benzyl, or other suitable
carboxylic acid protecting group; each R2 is selected from the
group consisting of C1-C6alkyl, branched C3-C7alkyl, carbocyclyl,
C1-C6fluoroalkyl wherein the alkyl group is partially or fully
fluorinated; reacting said ring compound with a compound of the
formula A3P-M
[0332] In the presence of a transition metal catalyst;
wherein A3P is a protected form of A3;
[0333] wherein A3 comprises a member of the group consisting of
mono- and poly-aryl, mono- and poly-heteroaryl, mono- and
poly-heterocyclyl moieties, P is a protective group wherein A3 is
chemically protected so as not to interfere with the reaction of
A3P-M with ##STR233## wherein A3P-M is taken from the group
consisting of A3P--B(OH).sub.2, -A3P--B(OR16).sub.2,
-A3P--B(R17).sub.3M2, -A3P--Si(R18).sub.3, or A3P--Sn(R16).sub.3,
wherein R16 is taken from lower alkyl or branched lower alkyl, R17
is halogen, R18 is lower alkoxy, and M2 is Li, K, or Na, and from
the formulae ##STR234## wherein v is 1 or 2; said reaction
generating an intermediate compound of the formula ##STR235##
converting said intermediate compound to the carboxylic acid form
thereof ##STR236## subjecting said carboxylic acid to a Curtiuss
rearrangement in the presence of a compound of formula D1-NH.sub.2,
to yield a compound of the formula ##STR237## where D1 is selected
from the group consisting of mono- and poly-aryl, mono- and
poly-heteroaryl, mono- and poly-heterocyclyl.
[0334] Preferrably, first step of the method involves using a ring
compound taken from the group consisting of ##STR238## A3P-M is
taken from A3P--B(OH).sub.2, A3P--B(OR16).sub.2, or boroxines
(A3PBO).sub.3; said reaction generating an intermediate compound of
the formula ##STR239## and being catalyzed by a copper(II)
catalyst, in an inert solvent taken from the group consisting of
dichloromethane, dichloroethane, and N-methylpyrrolidinone, in the
presence of a base taken from the group consisting of triethylamine
and pyridine, at temperatures ranging from ambient to about
130.degree. C., wherein the reaction is exposed to an atmosphere
containing oxygen; Converting said intermediate compound to the
carboxylic acid form thereof ##STR240## and subjecting said acid
form compound to a Curtiuss rearrangement in the presence of a
compound of formula D1-NH.sub.2, such rearrangement mediated by the
use of diphenylphosphoryl azidate in an inert solvent taken from
the group consisting of toluene, tetrahydrofuran, and
dimethoxyethane, and in the presence of a base taken from the group
consisting of triethylamine, pyridine, and di-iso-propylethylamine,
at temperatures ranging from 80.degree. C. to 110.degree. C. to
yield a desired compound of the formula ##STR241##
[0335] Still more preferably, the starting ring compound is
selected from the group consisting of ##STR242## A3P-M is taken
from A3P--B(OH).sub.2, A3P--B(OR15).sub.2, or boroxines
(A3PBO).sub.3; said reaction generating an intermediate compound of
the formula ##STR243## said catalyst comprising copper(II) acetate,
said reaction being carried in an inert solvent, selected from the
group consisting of dichloromethane, dichloroethane, and
N-methylpyrrolidinone, in the presence of a base from the group
consisting of triethylamine and pyridine, and in the presence of 4
angstrom sieves at ambient temperature, wherein the reaction is
exposed to air, to generate an intermediate compound of the formula
##STR244## converting said intermediate compound to the carboxylic
acid form thereof ##STR245## subjecting said carboxylic acid form
intermediate to a Curtiuss rearrangement in the presence of a
compound of formula D1-NH.sub.2, such rearrangement mediated by the
use of diphenylphosphoryl azidate in an inert solvent taken from
the group consisting of toluene, and in the presence of
triethylamine at temperatures ranging from 80.degree. C. to
110.degree. C. to yield a desired compound of the formula.
##STR246## 5.2 Other Syntheses
[0336] The preparation of intermediates containing A1 rings and
their subsequent conversion into compounds of Formula I is
illustrated in the following schemes. Throughout this
specification, A2P refers to a protected form of A2, as defined
above, wherein the Z1, Z2, Z3, or Z4 moieties or heteroatoms
attached to A2 are suitably protected to allow their use in
multi-step chemistry.
[0337] The preparation of intermediates wherein A1 is taken from
pyrazolyl A1-1 is illustrated in Schemes 1 through 4. Scheme 1
illustrates the preparation of hydrazines 2. If the amine
precursors 1 are readily available, they are converted to the
hydrazines 2 by a diazotization/reduction sequence. Preferred
conditions react 1 with NaNO.sub.2 in aqueous HCl to form the
diazonium salt at about 0C in aqueous solvent or an aqueous/organic
cosolvent. The diazonium salt is not isolated, but directly reduced
by reaction with SnCl.sub.2.2H.sub.20 under acidic conditions,
preferably aqueous HCl at between about 0C and room temperature.
The hydrazines 2 are isolated as the HCl addition salts. If the
amine precursors 1 are not directly available, they can be formed
from the nitro-substituted A2P precursors 3 by reduction,
preferably with iron/HCl, SnCl.sub.2.2H.sub.20, or catalytic
hydrogenation, to give the requisite amines 1. Conversion to the
hydrazines 2 is accomplished as described above. Alternatively,
reaction of the aryl or heteroaryl bromides 4 with benzophenone
hydrazone and a palladium catalyst, preferably with Pd(OAc).sub.2
and DPPF as ligand, can afford the protected hydrazines 5, which
are deprotected under acidic conditions, preferably
p-toluenesulfonic acid or ethanolic HCl, to give rise to the
desired hydrazines 2 (Hartwig, J. F., et al, Angew. Chem. Int. Ed.
(1998) 37: 2090; Haddad, N., et al, Tetrahedron Letters (2002) 43:
2171-2173). Alternatively, reaction of the aryl or heteroaryl
iodides 6 with t-butylcarbazate and a copper (I) catalyst,
preferably CuI in DMF at about 80C with Cs.sub.2CO.sub.3 base and a
ligand such as 1,10-phenanthroline, can afford the BOC-protected
hydrazines 7, which are converted to the desired hydrazines 2 by
treatment with acid (M. Woltor et al, Organic Letters (2001) 3:
3803-3805). ##STR247##
[0338] Preparation of pyrazoles 9 and 11 are illustrated in Scheme
2. Reaction of hydrazines 8 with beta-ketonitriles in an alcoholic
solvent, preferably EtOH, and an acid catalyst, preferably HCl or
p-toluenesulfonic acid, at about 80C gives aminopyrazoles 9.
Analogous treatment of hydrazines 8 with the ethyl
2-(methoxyimino)-4-oxobutanoates 10 affords the pyrazole ethyl
esters 11 (Lam, P. Y., Journal of Medicinal Chemistry (2003) 46:
4405-4418). ##STR248##
[0339] The aminopyrazoles 9 are converted into the desired pyrazole
ureas 12 of Formula I (see Scheme 3) by methods described in Scheme
30 for the conversion of the aminothiophene into ureas of Formula
I. ##STR249##
[0340] Alternatively, pyrazole ureas of Formula I can be formed
from the pyrazole ethyl esters 11 by a sequence illustrated in
Scheme 4. Conversion of esters 11 to the carboxylic acids 13 is
accomplished by saponification or by treatment with aqueous acid.
Curtius-type rearrangement of 13, preferably by treatment with
ethyl chloroformate and base, preferably triethylamine, in an
organic solvent, preferably THF at about 0C, and then forming the
acyl azide by reaction with sodium azide, and quenching of the in
situ rearranged isocyanate with D-NH.sub.2 gives rise to the
desired pyrazole ureas 14 of Formula I (E1 Haddad, M. et al,
Journal of Heterocyclic Chemistry (2000) 37: 1247-1252).
##STR250##
[0341] The synthesis of pyrazoles of formula I wherein A1 is A1-2
is exemplified in Scheme 5. Aryl halide 15 (bromo or iodo
(preferred)) is reacted with acetylene 16 [CAS 22537-06-0] under
standard palladium cross-coupling conditions to yield 17. As
described by Coispeau et. al (Bull. Chem. Soc. France, 1970,
689-696), 17 reacts monosubstituted hydrazines in the presence of
catalytic mineral acid to yield pyrazole 18, which is readily
nitrated under standard conditions at the 4-position to yield 19.
Catalytic hydrogenation or reduction utilizing iron/HCl or tin (II)
chloride of 19 yields 20, which can be coupled and deprotected as
shown in Scheme 6 to yield urea 21. ##STR251##
[0342] The aminopyrazoles 20 are converted into the desired
pyrazole ureas 21 of Formula I by methods described in Scheme 30.
##STR252##
[0343] The synthesis of pyrazoles of formula I wherein A1 is A1-3
is exemplified in Scheme 7. Substituted pyrazole 22 is
preferentially halogenated (brominated or iodinated) at the
4-position to yield 23 (see: Bull. Chem. Soc. France, 1967, 328 and
J. Gen. Chem. USSR, 1963, 33, 503). Coupling of 23 with boronic
acid 24 under standard conditions yields 25, which is nitrated at
the 3-position under standard conditions to yield 26. Catalytic
hydrogenation or reduction of 26 utilizing iron/HCl or tin (II)
chloride yields amine 27 that can be elaborated to deprotected urea
28 of Formula I using the same strategies as outlined in Scheme 30.
##STR253##
[0344] The synthesis of pyrroles of formula I wherein A1 is A1-4 is
exemplified in Scheme 8. Substituted 1,4-dicarbonyl compound 29
(see Scheme 8) is reacted with amine 30 in THF or toluene to yield
intermediate pyrrole 31, which, after nitration, reduction (see
Scheme 1), urea coupling and deprotection (see Scheme 30) yields
pyrazole compounds 34 of Formula I. ##STR254##
[0345] The synthesis of pyrroles of formula I wherein A1 is A1-5 is
exemplified in Scheme 9. Substituted aldehydes 35 cyclocondense
with amines 36 when reacted with hot acetic acid (See: J. Chem.
Soc. Perkin Trans. 1, 1975, 1910). After workup, the resulting
solid is immediately subjected to the action of potassium ethoxide
in ethanol at room temperature to yield pyrrole 37. Elaboration of
amine 37 employing the same strategy as shown in Scheme 30 affords
deprotected ureas 38 of Formula I. ##STR255##
[0346] The synthesis of pyrroles of formula I wherein A1 is A1-6 is
exemplified in Scheme 10. Diethylmaleate 39 is reacted with halide
40 in the presence of NaBr, NiBr.sub.2 and ethanol (Tetrahedron
Letters, 1999, 40(33), 5993) to yield product 41. Reduction of the
diacid with LAH in ether to the diol followed by oxidation under
Swern or MnO.sub.2 conditions to yield dialdehyde 42. In situ
cyclization with amine 43 yields pyrrole 44. Nitration of 44 and
reduction yields amine 46 which is elaborated to deprotected ureas
47 of Formula I according to the methods described in Scheme 30.
##STR256##
[0347] The preparation of intermediates containing ring A1-7 is
illustrated in Schemes 11 through 13. Scheme 11 illustrates the
preparation of imidazole intermediate 50. Reaction of 48 with 49,
affords 50 (cf. Little, T. L. et al. J. Org. Chem. 1994, 59 (24),
7299-7305). ##STR257##
[0348] Cross-coupling reaction of 50 is accomplished by two
different methods. Scheme 12 illustrates the method of Kiyomori, A.
et al. (Tetrahedron Lett. 1999, 40 (14), 2657) wherein 50 is
reacted with a suitable A2P--I in the presence of Cs.sub.2CO.sub.3
as base and Cu(OTf).sub.2 as catalyst. In another preferred mode 50
is cross-coupled with an A2P--B(OH).sub.3 under Cu(OAc).sub.2
catalysis in the presence of pyridine (Chan, D. M. T. et al.
Tetrahedron Lett. 2003, 44 (19), 3863). In yet another mode,
nucleophilic aromatic substitution between 50 and A2P--F (or Cl) in
the presence of an inorganic base also provides 51. ##STR258##
[0349] The preparation of compounds of Formula I wherein A1 is A1-7
is illustrated in Scheme 13. The acetamidoimidazoles 51 are first
deprotected to the aminoimidazoles 52 and then reacted under one of
the preferred modes described in Scheme 30 to give ureas 53 of
Formula I. ##STR259##
[0350] Scheme 14 illustrates the preparation of oxazole
intermediates 56. Readily available acid chlorides 54 are converted
to the corresponding acyl nitrites 55 by the action of cyanide
anion, according to the method of Tanaka, M. et al. (Synthesis
1981, 12, 973-4). Employing the conditions of Lakhan, R. et al. (J.
Heterocycl. Chem. 1988, 25 (5), 1413-1417) reaction of 55 with
R2-CHO and NH.sub.4OAc gives oxazoles 56. ##STR260##
[0351] The elaboration of 56 to compounds of Formula I wherein A1
is A1-8, is illustrated in Scheme 15. Conversion of amines 56 to
ureas 57 is accomplished by methods analogous to that shown
previously in Scheme 30. ##STR261##
[0352] Preparation of compounds of Formula I wherein A1 is A1-9 is
illustrated in schemes 16 and 17. Scheme 16 illustrates the
preparation of oxazole intermediates 61. Beginning with 58, the
aldehyde function is elaborated through a Strecker synthesis
(Kendall, E. C. et al. Org. Synth. CV 1, 21) to provide
amino-nitriles 59. Acylation with R2COCl in the presence of a base
generates intermediate 60. Alternatively, 59 can be coupled with
R2COOH in the presence of a peptide-coupling or dehydrating agent
and a base to also give 60. Finally, treatment of 60 with a strong
organic acid (cf. EP 816347) or mineral acid (Kille, G. et al.
Bull. Soc. Chim. France 1967, 11, 4619) afford the desired
aminooxazoles 61. ##STR262##
[0353] The elaboration of 61 to 62, as shown in Scheme 17, is
completely analogous to that shown previously in Scheme 30.
##STR263##
[0354] Compounds of Formula I wherein A1 is A1-10 are prepared as
shown in schemes 18 through 20. The preparation of thiazole
intermediates of formula 67 is illustrated in Schemes 18 through
20. In one preferred mode, acylated intermediate 60, from Scheme 16
(see above), is treated with a thionating reagent such as
P.sub.4S.sub.10 or Lawesson's Reagent to make 63. This, in turn,
when treated with strong acid affords the desired 64, by analogy to
Scheme 16. ##STR264##
[0355] In an alternate preferred mode (Scheme 19), 59, from Scheme
16 (see above) is treated with R2-CHO in the presence of elemental
sulfur and a base, according to the method of Gerwald, et al. (J
Prakt. Chem. 1973, 513, 539) to generate 66. Deprotection under
aqueous acidic conditions generates 64. ##STR265##
[0356] The elaboration of 64 to 67, as shown in Scheme 20, is
completely analogous to that shown in Scheme 30. ##STR266##
[0357] The preparation of compounds of Formula I wherein A1 is
A1-11 is illustrated in Schemes 21 and 22. A2P-containing
hydrazines, 68, are acylated with R2COCl in the presence of a base
to generate intermediates 69. Alternatively, 68 can be coupled with
R2COOH in the presence of a peptide-coupling or dehydrating agent
and a base to also give 69. Halogenation under the conditions of
Joseph, B. et al. (J. Carbohydrate Chem. 1993, 12, 1127-38) or
Sakamoto, T. et al. (Chem. Pharm. Bull. 1988, 36, 800-802) afford
hydrazinoyl halides 70. Treatment with base generates the reactive
1,3-dipoles 71 which are trapped with cyanamide to give
aminotriazoles 72, in accordance with precedent (EP 285893).
##STR267##
[0358] The elaboration of 72 to 73, as shown in Scheme 22, is
accomplished according the methods illustrated in Scheme 30.
##STR268##
[0359] Preparation of compounds of Formula I wherein A1 is A1-12 is
illustrated in scheme 23. The preparation of the furan intermediate
of formula 81 follows the reported procedure of Toro, A. et al. (J.
Org. Chem. 2003, 68 (18), 6847). 74 is acylated as described
previously, treated with the dilithio species of 76 and finally
cyclized with HBr to give 77. Introduction of the A2P moiety is
accomplished by several different methods. In one preferred mode,
using the method of Pridgen, L. et al. (J. Org. Chem. 1982, 47,
1590-1592), 77 is cross-coupled with an A2P--MgBr in the presence
of a nickel catalyst to generate 79. In a second preferred mode,
reported by Hervet, M. et al. (Helvetica Chim. Acta. 2003, 86 (10),
3461), 79 may be obtained by cross-coupling with a stannane in the
presence of a palladium catalyst. In a third preferred mode
reported by Burke, M. et al. (Science 2003, 302 (5645), 613-618),
the cross-coupling may be accomplished under Suzuki conditions with
an appropriate boronic acid. Finally, in a fourth preferred mode,
77 is converted to a boronate species, 78, which is then subjected
to Suzuki coupling conditions with the requisite A2P--X.
Deprotonation of 79 and quenching of the anion with CO.sub.2
delivers acid 80. Subjecting 80 to Curtius rearrangement conditions
in the presence of D-NH.sub.2 to trap the intermediate isocyanate
provides 81 using methods analogous to that illustrated in Scheme
4. ##STR269##
[0360] Preparation of compounds of Formula I wherein A1 is A1-13 is
illustrated in schemes 24 and 25. Scheme 24 illustrates the
preparation of furan intermediates 85. The 1,4-dicarbonyl starting
materials 82 are reacted with para-methylbenzenesulphonic acid
(TsOH) in a suitable solvent such as toluene to afford furan 83.
Nitration of 83 affords 84, which is reduced with iron/HCl, tin
(II) chloride, or catalytic hydrogenation conditions to give the
3-aminofuran intermediates 85. ##STR270##
[0361] The aminofurans 85 are converted into the desired furanyl
ureas 86 of Formula I by methods described in Scheme 30.
##STR271##
[0362] The preparation of compounds of Formula I wherein A1 is
A1-14 is illustrated in schemes 26 and 27. Scheme 26 illustrates
the preparation of 4,5-disubstituted 2-aminothiophenes 92 according
to methods reported by Knoll et al (Knoll, A. et al, Synthesis
(1984) 51-53; Knoll, A. et al, J. Prakt. Chem. (1985), 327:
463-470). The compound 87 is reacted with an excess of formamide
derivatives 88 in methanol to afford
N-(3-aminothioacryloyl)-formamidines 89. A mixture of substituted
N-(3-aminothioacryloyl)-formamidines, 89 and substituted bromides,
90 in a protic solvent, such as methanol or ethanol, is heated,
preferably at a reflux temperature. The product thiophene-imines,
91 are treated with aqueous acid to obtain the thiophene-amines 92.
##STR272##
[0363] The aminothiophenes 92 are converted into the desired
thiophenyl ureas of Formula I by methods described in Scheme 30.
##STR273##
[0364] Scheme 28 illustrates the preparation of 1,4-dicarbonyl
starting materials 96 for the preparation of compounds of Formula
I, wherein A1 is A1-13. One preferred method utilizes a
1,4-conjugate addition procedure, Scheme 28 (a), to transform 94 to
96 by reaction with the unsaturated ketone 95 in the presence of a
suitable base such as a lithium, sodium, or potassium amide or
hydride base. Another preferred method, Scheme 28 (b), makes use of
a transmetallation reaction, converting 97, wherein X1 is halogen,
to an organometallic species 98 wherein the metal is magnesium,
nickel, or cadmium. In situ reaction of 98 with acid chloride 99
gives rise to the 1,4-dicarbonyl species 96 after acid-catalyzed
removal of the ketal protecting group. Alternative reaction of 98
wherein the metal is lithium with the Weinreb amide 100 also
affords 96 after acid-catalyzed removal of the ketal protecting
group. A third preferred method, illustrated in Scheme 28 (c),
makes use of a palladium-catalyzed reaction between the readily
available boronic acid 101 and a suitable 2-pyridyl ester 102 as
reported by Chatani et al (Organic Letters (2004) .delta.:
3597-3599). ##STR274##
[0365] The 1,4-dicarbonyl starting materials 96 are reacted with
Lawesson's reagent in a suitable solvent such as THF or toluene to
afford thiophene 103. Nitration of 103 affords 104, which is
reduced with iron/HCl, tin (II) chloride, or catalytic
hydrogenation conditions to give the 3-aminothiophene intermediates
105 (Scheme 29). ##STR275##
[0366] The preparation of compounds of Formula I are illustrated in
Scheme 30. The aminothiophenes 106 are reacted with carbonyl
diimidazole (CDI) or phosgene CO(Cl).sub.2 to give isocyanates 107.
Alternatively, 106 can be reacted with p-nitrophenyl chloroformate
to give the p-nitrophenylcarbamates 108 as synthetic equivalents to
isocyanates 107. Reaction of isocyanates 107, or the corresponding
p-nitrophenylcarbamates 108, with readily available amines
D-NH.sub.2 affords ureas 109. Alternatively, 106 is reacted with
isocyanates 110 or the p-nitrophenylcarbamates 111 to give ureas
109. Removal of the A2P protecting groups from 109 affords the
desired compounds of Formula 112. ##STR276##
[0367] The preparation of compounds of Formula I wherein A1 is
A1-16 is illustrated in Schemes 31 and 32. Scheme 31 illustrates
the preparation of 2,4-disubstituted N-protected-anilines 117. The
commercially available starting materials 113 are converted to
4-substituted anilines 114 by nitration, followed by reduction with
iron/HCl, tin (II) chloride, or catalytic hydrogenation conditions.
The reaction of 4-substituted anilines 114 with bromine in acetic
acid gives 2-brominated anilines 115. The amino groups of 115 are
protected to allow their use in Suzuki coupling reactions to obtain
117. ##STR277##
[0368] The Suzuki coupled intermediates 117 are converted into the
desired phenyl ureas 118 of Formula I by methods described in
Scheme 30. ##STR278##
[0369] The preparation of compounds of Formula I is illustrated in
Schemes 33 and 34. Scheme 33 illustrates the preparation of
2,5-disubstituted 2-aminopyridines 125. The commercially available
starting material 119 is reacted with sodium nitrate to afford
1-methyl-3,5-dinitro-2-pyridone 120. The reaction of 120 with
ketones 121 in the presence of NH.sub.3 gives alkyl and/or
aryl-substituted 3-nitropyridine derives 122 (Tohda, Y. et al,
Bull. Chem. Soc. of Jpn (1990), 63: 2820-2827). Reduction followed
by selective bromination of 122 affords 123 (Canibano, V. et al,
Synthesis (2001) 14: 2175-2179). The amino group of 123 is
protected to give 124. 124 is reacted with a variety of Suzuki
coupling reagents to obtain 125. ##STR279##
[0370] The aminopyridines 125 are converted into the desired
pyridyl ureas 126 of Formula I by methods described in Scheme 30.
##STR280##
[0371] The preparation of compounds of Formula I wherein A1 is
A1-18 is illustrated in Schemes 35 and 35a. Scheme 35 illustrates
the preparation of 2,4-disubstituted 5-aminopyridines 132. The
commercially available starting materials 127 are converted to
2-substituted-4-nitropyridines 128 under standard nitration
conditions. Reduction followed by a second nitration of 128 gives
4-amino-2-substituted-5-nitropyridines 129 which can purified by
silica column chromatography from the other isomers. The
4-amino-2-substituted-5-nitropyridines 129 are reacted with HBr and
NaNO2 to afford 4-bromopyridines 130. The bromopyridine 130 is
reacted with a variety of Suzuki coupling reagents to produce 131.
The reduction of the nitro group of 131 with iron/HCl, tin (II)
chloride, or catalytic hydrogenation conditions gives
2,4-disubstituted-5-aminopyridines 132. ##STR281##
[0372] The aminopyridines 132 are converted into the desired
pyridyl ureas 133 of Formula I by methods described in Scheme 30.
##STR282##
[0373] The preparation of compounds of Formula I wherein A1 is
A1-19 is illustrated in Schemes 36 and 37. Scheme 36 demonstrates
the preparation of substituted pyridines 138. Amination of 134 and
subsequent bromination affords 135 as previously reported (J. Am.
Chem. Soc., 1990, 112, 8024 and Heterocycles, 1986, 24, 1815). Thus
3-alkyl pyridines 134 upon reaction with sodamide gives pyridines
135, which are brominated with bromine to give pyridines 136. The
amine functionalities of 136 are acetylated using acetyl chloride
or acetic anhydride to give 137. The brominated intermediates 137
are utilized in Suzuki cross coupling reactions to give
cross-coupled intermediates 138 utilizing procedures describe above
in Scheme 23. ##STR283##
[0374] The preparation of compounds 139 of Formula I are described
in Scheme 37. The aminopyridines 138 are first deprotected and then
reacted under one of the preferred routes described in Scheme 30.
##STR284##
[0375] Preparation of compounds of Formula I wherein A1 is A1-20 is
described in scheme 38 and scheme 39 according to reported
procedures in Tetrahedron Lett., 2002, 43, 9287 and J. Heterocycl.
Chem., 1978, 15, 665. The oximes 140 are reacted with
aminoacetonitrile to afford the cyclodehydrated intermediates which
are hydrogenated to give 141. Bromination of 141 affords 142. The
amine functionalities of 142 are converted to the N-acetate
derivatives 143, which are subjected to Suzuki cross-coupling
reactions as described in scheme 23 to afford cross-coupled
intermediates 144. ##STR285##
[0376] The preparation of compounds of Formula I is illustrated in
Scheme 39. The N-Acetyl functionalities of 144 are removed and the
resulting amines are converted to ureas 145 of Formula I-B as
previously illustrated in scheme 30. ##STR286##
[0377] Synthesis of compounds of Formula I wherein A1 is A1-21 is
described in Scheme 40. As reported by Palanki et al (J. Med. Chem.
2000, 43, 3995-4004) diethyl ethoxymethylenemalonate and
trialkylacetamidine are heated with sodium ethoxide to provide
pyrimidines 146. The hydroxyl groups of 146 are converted to the
bromides by reaction with PBr.sub.3 to afford bromopyrimidines 147.
Intermediates 147 are converted to 148 using Suzuki cross-coupling
methods illustrated above in Scheme 23. The ester functionalities
of 148 are hydrolyzed to acids 149, which are utilized in a Curtius
rearrangement reaction sequence in the presence of amines
D-NH.sub.2 using methods reported above in Scheme 4, to give the
desired ureas 150 of Formula I. ##STR287##
[0378] Preparation of compounds of Formula I wherein A1 is A1-22 is
described in Scheme 41. Readily available substituted acetic acids
151 are converted into the requisite acid chlorides 152 by reaction
with thionyl chloride in the presence of base, preferably
triethylamine or pyridine. The acid chlorides are converted to
amides 153 by reaction with R2NH.sub.2 in the presence of base,
preferably triethylamine or pyridine. Reaction of 153 with
dimethyloxalate in the presence of base, preferably potassium
t-butoxide in DMF, affords hydroxymaleimides 154. Conversion of 154
to the chloro-substituted maleimides 155 is effected by reaction
with thionyl chloride. Displacement of chloride by ammonia converts
155 into the amino-substituted maleimides 156. Reaction of 156 with
isocyanates D-N.dbd.C.dbd.O affords the desired compounds 157 of
Formula I. ##STR288##
[0379] Preparation of compounds of Formula I wherein A1 is A1-23 is
described in Scheme 42 according to methods disclosed by W. Buck et
al, DE 2107146 (1972). Diethyl oxalate 158 is reacted with one
equivalent of R2NH.sub.2 to afford the mono amides 159. Subsequent
reaction with ammonia gives the diamide 160, which is converted to
the acylnitriles 161 by reaction with P.sub.2O.sub.5. Intermediates
161 are reacted with isocyanates A2P--N.dbd.C.dbd.O to give the
imine-substituted hydantoins 162. Reduction of the imine
functionality in 162 gives rise to compounds 163, which are reacted
with isocyanates D-N.dbd.C.dbd.O to give the desired compounds 164
of Formula I. ##STR289##
[0380] Preparation of compounds of Formula I wherein A1 is A1-23 is
described in Scheme 43 according to methods disclosed by A. Sasaki
et al, JP 2000198771 A2. Readily available amines 165 are reacted
with diethyl bromomalonate 166 to afford amino-substituted diethyl
malonates 167. Reaction of 167 with an appropriate
alpha-substituted ethyl acrylate 168 followed by NaCl-induced
decarboxylation, gives the substituted pyrrolidineones 169.
Hydrolysis of the ester functionality of 169 gives rise to 170.
Acids 170 are converted to the desired compounds 171 of Formula I
by two alternative methods. In the first method, 170 is subjected
to a Curtius-type rearrangement in the presence of amines
D-NH.sub.2, to give 171. In the second approach, 170 is first
converted to the primary amides 172, which are then subjected to a
modified Hoffman-type rearrangement utilizing
bis-trifluoroacetoxyiodobenzene to afford rearranged amines that
are trapped with an isocyanate D-N.dbd.C.dbd.O. ##STR290## II.
Synthesis of A2-Containing Intermediates.
[0381] The synthesis of intermediates containing A2 rings taken
from A2-15 through A2-76 and A2-87 through A2-94, required for the
elaboration of compounds in the aforementioned schemes, is
accomplished using readily available precursors and transformations
readily understood in the art. Such A2-containing intermediates are
provided which contain amino, hydrazinyl, carboxyl, or halogen
functionalities useful for coupling to the aforementioned
intermediates containing A1 rings.
[0382] The synthesis of intermediates containing A2 rings taken
from A2-1 through A2-14 and A2-77 through A2-117 are detailed below
in schemes 44 through 93.
[0383] Scheme 44 illustrates the preparation of intermediates A2P
corresponding to A2-1 through A2-6. Readily available halogenated
substituted benzenes, pyridines, pyrimidines, or triazines 172
through 177 are obtained commercially or are available through
diazotization/H-Q2 quench (Sandmeyer reaction) of the corresponding
substituted aryl- or heteroaryl-amines 178 through 183. In cases
where A2 moieties need to be supplied as the substituted
hydrazines, these are either derived from readily available
hydrazines or are derived from the substituted aryl- or
heteroaryl-amines 178 through 183 by diazotization of the amino
groups followed by reduction of the diazonium salts to the
corresponding hydrazines 1184 through 189. ##STR291##
[0384] Scheme 45 illustrates the preparation of intermediates A2P
corresponding to A2-7. Thiourea is reacted with readily available
alpha-halocarbonyl compounds 190, wherein Q2 is chloro or bromo, to
afford aminothiazoles 191. Aminothiazoles 191 are converted to
thiazolylhydrazines 192 by a standard diazotization/reduction
sequence. Alternatively, aminothiazoles 191 are converted to
thiazolyl halides 193, wherein Q2 is chloro or bromo, by a standard
Sandmeyer reaction sequence involving H-Q2 trapping of an in situ
formed diazonium salt. ##STR292##
[0385] Scheme 46 illustrates the preparation of intermediates A2P
corresponding to A2-8. Readily available aminonitriles 194 are
reacted with aldehydes 195 in the presence of sulfur and base,
affording intermediate aminothiazoles 196 after an acid work-up.
Aminothiazoles 196 are converted to the thiazolylhydrazines 197 by
a standard diazotization/reduction sequence. Alternatively,
aminothiazoles 196 are converted to thiazolyl halides 198, wherein
Q2 is chloro or bromo, by a standard Sandmeyer reaction sequence
involving H-Q2 trapping of an in situ formed diazonium salt.
Alternatively, beta-keto esters 199, wherein Q3 is a halogen
leaving group, are reacted with substituted thioamides to afford
thiazolyl esters 200. Esters 200 are hydrolyzed to their
corresponding acids 201, which are then converted into thiazolyl
amines 202 by a Curtius-type rearrangement, or are converted into
thiazolyl halides 203 by a Hunsdiecker reaction. ##STR293##
[0386] Scheme 47 illustrates the preparation of intermediates A2P
corresponding to A2-9. Readily available thioamides 204 and
beta-halo-alpha-keto esters 205 undergo a Hantzch cyclization to
afford thiazolyl esters 206. Esters 206 are hydrolyzed to their
corresponding acids 207, which undergo a Curtius-type rearrangement
to afford the requisite aminothiazoles 208, which then undergo a
standard diazotization/reduction sequence to give thiazolyl
hydrazines 209. Alternatively, acids 207 undergo a Hunsdiecker
reaction to afford the corresponding thiazolyl halides 210, wherein
Q2 is chloro or bromo. ##STR294##
[0387] Scheme 48 illustrates the preparation of intermediates A2P
corresponding to A2-10. Ketal-protected amino ketones 211 are
converted to the oxazolyl esters 212 by reaction with ethyl oxalyl
chloride. Hydrolysis of the esters 212 affords acids 213. Acids 213
are converted to the hydrazines 215 and halides 216 by reaction
sequences described above in Scheme 47. ##STR295##
[0388] Scheme 49 illustrates the preparation of intermediates A2P
corresponding to A2-11. Readily available aminonitriles 217 are
reacted with substituted acid chlorides 218 in the presence of
base, affording intermediate N-acyl aminonitriles 219. Cyclization
of 219 affords the aminooxazoles 220. Conversion of 220 to the
oxazolyl hydrazines 221 or the oxazolyl halides 222 is effected as
described above in Scheme 45. ##STR296##
[0389] Scheme 50 illustrates the preparation of intermediates A2P
corresponding to A2-12. Acyl nitriles 223 are reacted with
aldehydes 195 in the presence of ammonium acetate/acetic acid to
give the aminooxazoles 224 using conditions reported above in
Scheme 46. The aminooxazoles 224 are converted to the hydrazines
225 under standard diazotization/reduction conditions.
Alternatively, alpha-amino-beta-ketoesters 226 are acylated to give
intermediates 227, which are cyclized to the oxazolyl esters 228 in
the presence of a cyclodehydrating reagent such as thionyl
chloride, triphenyl phosphine/carbon tetra-chloride, or Burgess
reagent. Hydrolysis of esters 228 gives rise to acids 229, which
are converted to oxazolyl hydrazines 231 and oxazolyl halides 232
by employing reaction conditions described above in Scheme 47.
##STR297##
[0390] Scheme 51 illustrates the preparation of intermediates A2P
corresponding to A2-13. Aminoketones 232 are reacted with cyanamide
to afford the aminoimidazoles 233. Conversion of 233 to the
corresponding hydrazines 234 and the halides 235 is accomplished by
employing reaction conditions described above in Scheme 45.
##STR298##
[0391] Scheme 52 illustrates the preparation of intermediates A2P
corresponding to A2-14. Alpha, beta-diketoesters 236 are reacted
with substituted aldehydes 195 in the presence of ammonium
acetate/acetic acid to give rise to imidazolyl esters 237.
Imidazole NH protection (wherein P denotes suitable protection of
the imidazole NH bond), followed by ester hydrolysis affords
imidazole acids 238/239, which are converted to the corresponding
hydrazines 242/243 and halides 244/245 by employing reaction
conditions described above in Scheme 47. ##STR299## A2-77
V.dbd.H.sub.2
[0392] The synthesis of compounds of Formula I wherein A2 is A2-77
is shown in Scheme 53. Nitration of commercially available
tetrahydroisoquinoline (246) by the action of H.sub.2SO.sub.4 and
HNO.sub.3 affords 7-nitrotetrahydroisoquinoline 247 (see WO
03/0999284). Protection of 247 as its trifluoroacetamide yields
248, and conversion of the nitro group to the corresponding
hydrazine by (a) reduction of the nitro group, (b) oxidation of the
resulting amino group to the diazonium with NaNO.sub.2, and (c)
reduction of the diazonium with SnCl.sub.2 or FeCl.sub.3 yields
249, which corresponds to the protected form of intermediate A2-77
containing hydrazines (V.dbd.H.sub.2). In the case where the
corresponding halide is required, conversion of the amine 248 to
the diazonium salt, and Sandmeyer displacement with CuI and
KI.sub.3 iodine (see Harrington and Hegedus, J. Org. Chem. 1984,
49(15), 2657-2662) results in iodide 250. ##STR300## A2-77
V.dbd.O
[0393] Synthesis of intermediates containing A2-77 (V.dbd.O) is
shown in Scheme 54. Utilizing the procedure published by Doherty
et. al (see WO 03/0999284), Wittig homologation of commercially
available 2,4-dinitrobenzaldehyde (251) with
ethyl(triphenylphosphoranylidene)-acetate results in propenoate
252. Catalytic hydrogenation in the presence of glacial acetic acid
and ethanol results in the target 1H-quinolin-2-one 253 which,
utilizing the same oxidation/reduction sequence as shown in Scheme
53 results in hydrazine 254 (R15, V.dbd.O) and iodide (255). At the
conclusion of the synthesis that utilizes 254 or 255, reduction of
the amide with LAH under standard conditions provides an optional
synthesis of intermediates containing A2-77 (V.dbd.H.sub.2).
##STR301## A2-78 V1=O, V2=H.
[0394] The synthesis of intermediates containing A2-78 (V1=O,
V2=H.sub.2) is shown in Scheme 55. Commercially available
phenethylamine 256 is converted to the carbamate 257, and then
cyclized utilizing polyphosphoric acid (PPA) to give the
tetrahydroisoquinolone 258. 258 is nitrated under standard
conditions to give 259, which is either converted to hydrazine 260
or iodide 261 using methodology outlined in Scheme 53. ##STR302##
A2-78 V1 and V2=H.sub.2
[0395] The synthesis of intermediates containing A2-78, wherein V1
and V2 are H.sub.2, is shown in Scheme 56. Reduction of 259 with
LAH affords the amino-substituted tetra-hydroisoquinoline which is
selectively protected at the ring nitrogen by reaction with
trifluoroacetic anhydride and base, preferably triethylamine.
Aniline 262 is then converted into the hydrazine 263 or the iodide
264 using methodology outlined in Scheme 54. ##STR303## A2-77 and
A2-98 V.dbd.H.sub.2
[0396] The preparation of intermediates containing A2-77 and A2-98
wherein V is H.sub.2 is illustrated in Scheme 57. In these schemes,
R7 is a suitable moiety that conforms to the generic definition of
Z4 or a protected form of such moiety. Compounds 267 and 268 are
prepared by reductive alkylation of 265 or 266 with an appropriate
aldehyde and sodium triacetoxyborohydride as the reducing agent.
269 and 270 are synthesized from 265 or 266 by simple amide
formation using an acid chloride and base, preferably triethylamine
or pyridine. 271 and 272 are synthesized by amidine or guanidine
formation utilizing a thioamide or a thiourea, respectively.
Intermediates 273, 274, 279, 280, 285 and 286 are prepared by
palladium-catalyzed bromide substitution with benzophenone
hydrazone as described by Haddad et al. (Tetrahedron Lett. 2002,
43, 2171-2173). 273, 274, 279, 280, 285 and 286 are either directly
implemented by reaction with a suitable A1-containing intermediate,
or, if required, first hydrolyzed to hydrazines 275, 276, 281, 282,
287 and 288, respectively, under acidic conditions. The bromide
functionalities in 267 to 272 are substituted by boronic acid
affording 277, 278, 283, 284, 289 and 290, respectively. After
suitably protecting the amidine or guanidine substructure, the
bromide is transformed into an organometallic species such as a
grignard compound, and subsequently reacted with trimethyl borate
to afford 277, 278, 283, 284, 289 and 290 after acid hydrolysis. In
cases where R7 functionalities prohibit the use of organometallic
reagents, the boronic acids are mildly formed from the bromides by
utilizing a procedure employing bis(pinacolato)diboron and
Pd(dppf). ##STR304## A2-78 and A2-99, V1 and V2=H.sub.2
[0397] The preparation of intermediates containing A2-78 or A2-99
wherein V1 and V2 are H.sub.2 is illustrated in Scheme 58. 291 and
292 are converted to intermediates 293 to 316 using methods
described above in Scheme 57. ##STR305## A2-79, V1 and V2=O
[0398] The synthesis of intermediates containing A2-79 wherein V1
and V2 are O is shown in Scheme 59. The commercially available
starting material 2-chloro-4-nitrobenzoic acid 317 is reacted with
dimethyl malonate 318, NaOMe, and catalytic amount of Cu(I)Br to
give 319 using conditions described by Quallich, G. J. et al
(Quallich, G. J. et al, J. Org. Chem. (1998), 63: 4116-4119). The
diester 319 is converted into diacid 320 under basic hydrolytic
conditions. The diacid 320 is reacted with a primary amine
containing a standard amine protecting group (such as benzyl) at
about 115.degree. C. to afford the ring closure product 321.
Reduction of 321 under catalytic hydrogenation conditions gives
322. The dione 322 is converted into the hydrazine (323), bromide
(324) or boronic acid (325) using standard conditions or those
conditions described above in Scheme 47. ##STR306## A2-79, V1 and
V2=H2
[0399] The synthesis of intermediates containing A2-79 wherein V1
and V2 are H.sub.2 is shown in Scheme 60. Reduction of 321 (from
Scheme 59) with NaBH.sub.4 in the presence of BF.sub.3OEt.sub.2
yields the tetrahydroisoquinoline 326. Subsequent reduction of the
nitro functionality of 326 under catalytic hydrogenation conditions
gives 327. Intermediate 327 is converted to the hydrazine 328,
bromide 329 or boronic acid 330 using the methodology described in
Scheme 59. ##STR307## A2-79 V1=O, V2=H.
[0400] The synthesis of intermediates containing A2-79 wherein V1
is O and V2 is H.sub.2 is shown in Scheme 61. The selective
reduction of 321 wherein P is a standard amine protecting group
(from Scheme 59) with NaBH.sub.4 in the presence of TFA gives the
lactam 331 (Snow, R. J. et al, J. Org. Chem., (2002),
45:3394-3405). Reduction of the nitro functionality of 331 under
catalytic hydrogenation conditions yields amine 332. Intermediate
332 is converted into the hydrazine 333, bromide 334 or boronic
acid 335 using the methodology outlined in Scheme 59. ##STR308##
A2-79, V1=H2, V2=O
[0401] The synthesis of intermediates containing A2-79 wherein V1
is H.sub.2 and V2 is O is shown in Scheme 62, utilizing methods
reported by Tamura, Y. et al (Synthesis 1981, 534-537). The
commercially available starting material 4-nitrobenzylamine 336 is
protected with acetyl chloride to yield 337. Intermediate 337 is
treated with .quadrature.-(methylthio)-acetyl chloride to give 338.
Oxidation of 338 with 3-chloroperbenzoic acid gives the sulfoxide
339. Treatment of sulfoxide 339 with p-TsOH yields the lactam 340.
Lactam 340 reacts with Raney Ni to afford the dihydroisoquinolinone
341. Reduction of the nitro functionality of 341 under catalytic
hydrogenation conditions affords amine 342. Intermediate 342 is
converted into the hydrazine 343, bromine 344 or boronic acid 345
using the methodology outlined in Scheme 59. ##STR309## A2-79 and
A2-101, V1 and V2=H.sub.2
[0402] The preparation of intermediates containing A2-79 or A2-101
wherein V1 and V2 are H.sub.2 is illustrated in Scheme 63. 346 and
347 are converted to intermediates 348 to 371 using methods
described above in Scheme 57. ##STR310## A2-80 and A2-102
V.dbd.H.sub.2
[0403] The preparation of intermediates containing A2-80 or A2-102
wherein V is H.sub.2 is illustrated in Scheme 64. 372 and 373 are
converted to intermediates 374 to 397 using methods described above
in Scheme 57. ##STR311## A2-80 V.dbd.O
[0404] The synthesis of intermediates containing A2-80 (V.dbd.O) is
shown in Scheme 65. Acylation of 4-nitroaniline 398, and
Friedel-Crafts alkylation by the action of AlCl.sub.3 results in
400 (see Zhang et. al Huaxue Yanjiu Yu Yingyong, 2002, 14(5),
618-619; Zhang et. al Huaxue Yanjiu Yu Yingyong, 2003, 17(5),
534-529). Elaboration of the nitro group in 400 to the hydrazine
401 (R18, V.dbd.O) and the iodide 402 (R18, V.dbd.O) proceeds under
the same conditions outlined in Schemes 53 and 54. At the
conclusion of the synthesis that utilizes 401 or 402, reduction of
the amide with LAH under standard conditions yields intermediates
A2-80 (V.dbd.H.sub.2). ##STR312##
[0405] Alternatively, 400 can be reduced with LAH to yield 403 and
subsequently protected as the trifluoroacetamide (404), which is
converted to the hydrazine (405, R18, V.dbd.H2) or iodide (406,
R18, V.dbd.H2) (Scheme 66) using the same methodology outlined in
Scheme 53. ##STR313## A2-81 and A2-103
[0406] The preparation of intermediates containing A2-81 and A2-103
is illustrated in Scheme 67. 407 and 408 (see Scheme 54) are
activated either by transformation into the corresponding
thiolactams 409 and 410 using Lawesson's reagent in dioxane or by
transformation into imino ester 411 and 412 using trimethyloxonium
tetrafluorborate. The displacement reaction with a primary amine
(if one R4 is H) or a secondary amine affords amidines 413 and 414
when heated in a suitable solvent such as methanol or dioxane. From
the thiolactam, displacement is supported by addition of mercury
chloride. Structures 415 and 416 can be obtained when the bromide
is reacted with benzophenone hydrazone under palladium catalysis as
described by Haddad et al. (Tetrahedron Lett. 2002, 43, 2171-2173).
415 and 416 can either be directly implemented for reaction with a
suitable A1 intermediate or, if required, first hydrolyzed to
hydrazines 417 and 418 under acidic conditions. The bromide in 413
and 414 can be substituted by a boronic acid affording 419 and 420.
After suitably protecting the amidine substructure, the bromide is
transformed into an organometallic species such as a grignard
compound and subsequently reacted with trimethyl borate to afford
419 and 420 after acid hydrolysis. In cases where R4 or R5
prohibits the use of organometallic reagents, the boronic acid can
be mildly introduced with bis(pinacolato)diboron and Pd(dppf).
##STR314## A2-82 and A2-104
[0407] The preparation of intermediates containing A2-82 or A2-104
is illustrated in Scheme 68. 421 and 422 (Scheme 55) are converted
to intermediates 423 to 434 utilizing the methods described above
in Scheme 67. ##STR315## A2-83 and A2-105
[0408] The preparation of intermediates containing A2-83 or A2-105
is illustrated in Scheme 69. 435 and 436 are converted into
intermediates 437 to 448 using methods described above in Scheme
67. ##STR316## A2-84 and A2-106
[0409] The preparation of intermediates containing A2-84 or A2-106
is illustrated in Scheme 70. 449 and 450 are converted into
intermediates 451 to 462 using methods described above in Scheme
67. ##STR317## A2-85 and A2-86
[0410] The preparation of intermediates containing A2-85 or Ar-86
is illustrated in Scheme 71. 463
(1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid) is commercially
available in each enantiomeric form and as a racemic mixture.
Nitration of 463 with sulfuric acid and potassium nitrate gives a
mixture of 6- and 7-nitrated compounds 464 and 465. According to
the literature (Bioorg. Med. Chem. Lett. 2002, 10, 3529-3544),
these compounds are separated from each other by derivative
crystallization. N-protection with a standard amine protecting
group gives 466 and 467, respectively. Amide formation by reacting
466 or 467 with amines HN(R4).sub.2 or HR5 (fix scheme 71) by
employing an acid-activating reagent, preferably EDCI/HOBt in the
presence of base, preferably triethylamine, afford amides 468, 469,
480 and 481. Deprotection of the amine protecting group gives rise
to nitro compounds 470, 471, 482 and 483. The bromides 472, 473,
484 and 485 are obtained by hydrogenation of the nitro group and
subsequent Sandmeyer reaction via a diazotization/CuBr reaction
sequence. 474, 475, 486 and 487 are prepared by palladium-catalyzed
bromide substitution with benzophenone hydrazone as described by
Haddad et al. (Tetrahedron Lett. 2002, 43, 2171-2173). 474, 475,
486 and 487 are either directly implemented by reaction with a
suitable A1-containing intermediate, or, if required, first
hydrolyzed to hydrazines 476, 477, 488 and 489, respectively, under
acidic conditions. The bromide functionalities in 470, 471, 482 and
483 are substituted by a boronic acid affording 478, 479, 490 and
491. The bromide is transformed into an organometallic species such
as a grignard compound and subsequently reacted with trimethyl
borate to afford 478, 479, 490 and 491 after acid hydrolysis. In
cases where R4 or R5 functionalities prohibit the use of
organometallic reagents, the boronic acids are mildly formed from
the bromides by utilizing a procedure employing
bis(pinacolato)diboron and Pd(dppf). ##STR318## ##STR319##
A2-95
[0411] The synthesis of intermediates containing A2-95 is
illustrated in Scheme 72. Commercially available substituted
benzoic acid 492 is optionally subjected to a reductive amination
reaction employing readily available aldehydes R30-CHO and sodium
triacetoxyborohydride to give 493. Reduction of the nitro
functionalities of 492 or 493 afford the amines 494 and 499.
Conversion of 494 or 499 to the benzotriazoles 495 or 500,
respectively, is effected by treatment with NO.sub.3 anion as
described in WO 04/041274. Conversion of 495 or 500 to substituted
amines 496 or 501, hydrazines 497 or 502, or halides 498 or 503 is
accomplished using conditions described in Scheme 47. ##STR320##
A2-96
[0412] The synthesis of intermediates containing A2-96 is
illustrated in Scheme 73. Commercially available pyridine diester
504 is reacted with sodium borohydride/calcium chloride to give the
selective reduction product 505 (P. Potier et al. Tetrahedron 1975,
31, 419-422).
[0413] Oxidation of the alcohol functionality of 505, preferably
with MnO.sub.2, gives aldehyde 506. Oxime formation, followed by
reduction with zinc/acetic acid, gives pyridinemethanamine 507 (M.
Ohta et al. Chem. Pharm. Bull. 1996, 44 (5), 991-999). Intermediate
507 is converted to its formamide 508, which is subjected to
cyclodehydration with POCl.sub.3 to give the imidazopyridine ester
509 (Q. Li et al. Bioorg. Med. Chem. Lett. (2002) 12, 465-469).
Hydrolysis of the ester 509 affords acid 510. Acid 510 is converted
to the amine 511, hydrazine 512, or halide 513 using conditions
described in Scheme 47. ##STR321## A2-97
[0414] The synthesis of intermediates containing A2-97 is
illustrated in Scheme 74. Readily available 3-acylpyridines 514,
wherein R32 is a substituent which conforms to the definition of a
protected or unprotected Z1 moiety, are converted to the
2-chloropyridines 515 as reported in Can. J. Chem. (1988) 66:
420-428. Displacement of the chloro substituent in 515 with various
hydrazines, wherein R33 conforms to the definition of a protected
or unprotected Z4 moiety, followed by in situ cyclization, gives
pyrazolylpyridines 516. Nitration of 516 under standard conditions
gives 517, which are subjected to reduction to afford the
amino-substituted pyrazolylpyridines 518. Conversion of 518 to
hydrazines 519 or halides 520 is effected as described in Scheme
41. ##STR322## A2-98, V.dbd.O
[0415] Scheme 75 illustrates the preparation of intermediates
containing A2-98 wherein V is O. The commercially available
starting material 7-nitro-3,4-dihydronaphthalen-1(2H)-one 521 is
reacted with hydroxylamine, followed by PCl5, to give lactam 522.
The nitro functionality of 522 is reduced under catalytic
hydrogenation conditions to afford amine 523. The
aminobenzoazepinone 523 is converted into the hydrazine 524,
bromide 525 or boronic acid 526 as described in Scheme 59.
##STR323## A2-98, V.dbd.H.sub.2
[0416] The synthesis of intermediates containing A2-98 wherein V is
H.sub.2 is shown in Scheme 76. 522 (from Scheme 75) is reduced,
preferably with diborane, borane.THF, or borane.Me.sub.2S, to yield
527, which is subsequently protected as the trifluoroacetamide
(528) by reaction with trifluoroacetic anhydride in the presence of
base, preferably triethylamine (TEA). Reduction of the nitro
functionality of 528 under catalytic hydrogenation conditions
affords amine 529, which is converted into the hydrazine 530,
bromide 531 and/or boronic acid 532 using the methodology described
in Scheme 59. ##STR324## A2-99, V1 and V2=O
[0417] Scheme 77 illustrates the preparation of intermediates
containing A2-99 wherein V1 and V2 are O. The commercial available
starting material 2-(2-carboxyethyl)benzoic acid 533 is reacted
with fuming nitric acid to give the nitrobenzoic acid 534. The
nitrobenzoic acid 534 is treated with trifluoroacetamide in the
presence of HOBt and EDCI to give the cyclic imide 535 (Nazar, F.
et al, Tetrahedron Lett., (1999), 40: 3697-3698). The by-products
and excess substituted resin and a tertiary amine-substituted resin
(Flynn, D. L. et al, J. Am. Chem. Soc., (1997), 119: 4874-4881).
Reduction of the nitro functionality of 535 under catalytic
hydrogenation conditions affords the amine-substituted
benzazepinedione 536 (Snow, R. J. et al, J. Org. Chem., (2002), 45:
3394-3405), The benzazpinedione 536 is converted into the hydrazine
537, bromide 538 or boronic acid 539 using the methodology
described in Scheme 59. ##STR325##
[0418] An alternative synthesis of intermediates containing A2-99
wherein V1 and V2 are O is shown in Scheme 78. The commercially
available starting material 2-chloro-5-nitrobenzoic acid 540 yields
541 by reaction with vinyl tri-n-butyltin under Stille
cross-coupling conditions (Littke, A. F. et al, Angew. Chem., Int.
Ed. Engl., (1999), 38: 2411-2413). Intermediate 541 is reacted with
thionyl chloride, followed by a primary amine containing a standard
amine protecting group (such as benzylamine) to obtain the amide
542. Reaction of 542 with acrylic acid in the presence of an
acid-activating reagent, such as EDCI/HOBt in the presence of base,
preferably triethylamine (TEA), affords the diene 543. A Ring
Closing Metathesis (RCM) reaction of 543 utilizing Grubbs' catalyst
gives the benzazepinedione 544. Reduction of 544 under catalytic
hydrogenation conditions produces 545 (Knobloch, K. et al, European
J. of Org. Chem., (2001), 17: 3313-3332). Intermediate 545 is
converted into the hydrazine 546, bromide 547 or boronic acid 548
as described in Scheme 77. Alternatively, intermediate 544 is
selectively reduced at the nitro functionality, preferably with
stannous chloride, to afford amine-substituted benzazepinedione
549, wherein the ring C--C bond is unsaturated. Intermediate 549 is
converted into the hydrazine 550, bromide 551 or boronic acid 552
as described in Scheme 77. ##STR326## A2-99, V1 and V2=H.sub.2
[0419] The synthesis of intermediates containing A2-99 wherein V1
and V2 are H.sub.2 is shown in Scheme 79. Reduction of 545 with LAH
yields the benzoazepine 553. 553 is converted into the hydrazine
554, bromide 555 or boronic acid 556 using the methodology
described in Scheme 59. ##STR327## A2-99, V1=O, V2=H.sub.2
[0420] The synthesis of intermediates containing A2-99 wherein V1
is O and V2 is H.sub.2 is shown in Scheme 80. Allylation of 542,
wherein P is a para-methoxybenzyl (PMB) or BOC protecting group,
with allyl chloride affords the RCM precursor 557. RCM reaction of
557 with Grubbs' catalyst affords the tetrahydrobenzazepinenone
558. Reduction of 558 under catalytic hydrogenation conditions
gives 559 which is reduced at the ring C--C bond and the nitro
functionality (Knobloch, K. et al, European J. of Org. Chem.,
(2001), 17: 3313-3332). 559 is converted into the hydrazine 560,
bromide 561, or boronic acid 562 as described in Scheme 77.
Alternatively, intermediate 558 is selectively reduced at the nitro
functionality, preferably with stannous chloride, to afford
amine-substituted benzazepinedione 563, wherein the ring C--C bond
is unsaturated. Intermediate 562 is converted into the hydrazine
564, bromide 565 or boronic acid 566 as described in Scheme 78.
##STR328## A2-99, V1=H.sub.2, V2=O
[0421] The synthesis of intermediates containing A2-99 wherein V1
is H.sub.2 and V2 is O is shown in Scheme 81. The readily available
starting material N-PMB protected 2-bromo-5-nitrobenzylamine 567 is
reacted with vinyl boronic acid under Suzuki palladium(0)-catalyzed
conditions to yield 568. 568 is coupled with acrylic acid in the
presence of an acid-activating reagent, preferably EDCI/HOBt, in
the presence of base, preferably triethylamine (TEA), to give 569.
RCM reaction of 569 with Grubbs' catalyst affords the
dihydrobenzazepineone 570. Reduction of 570 under catalytic
hydrogenation conditions yields the tetrahydrobenzoazepineone 571
which is reduced at the ring C--C bond and nitro group, with
concomitant removal of the PMB protecting group (Knobloch, K. et
al, European J. of Org. Chem., (2001), 17: 3313-3332). 571 is
converted into the hydrazine 572, bromide 573 or boronic acid 574
as described in Scheme 78. Alternatively, intermediate 570 is
selectively reduced at the nitro functionality, preferably with
stannous chloride, to afford amine-substituted benzazepinedione
575, wherein the ring C--C bond is unsaturated. Intermediate 575 is
converted into the hydrazine 576, bromide 577 or boronic acid 578
as described in Scheme 78. ##STR329## A2-100, V1 and V2=O
[0422] Scheme 82 illustrates the preparation of intermediates
containing A2-100 wherein V1 and V2 are O. The commercially
available starting material 1,2-phenylendiacetic acid 579 is
coupled with trifluoroacetamide under HOBt and EDCI conditions to
give the cyclic imide 580 (Nazar, F. et al, Tetrahedron Lett.,
(1999), 40: 3697-3698). The by-products and excess of reagents can
be removed by using a mixed resin containing sulfonic
acid-substituted resin and a tertiary amine-substituted resin
(Flynn, D. L. et al, J. Am. Chem. Soc., (1997), 119: 4874-4881).
Nitration of 580 produces 581. Reduction of the nitro functionality
of 581 under catalytic hydrogenation conditions affords the
amine-substituted benzazepinedione 582. The amine-substituted
benzazepindione 582 is converted to the hydrazine 583, bromide 584,
or boronic acid 585 using the methodology described in Scheme 59.
##STR330## A2-100, V1 and V2=H2
[0423] The synthesis of intermediates containing A2-100 wherein V1
and V2 are H.sub.2 is shown in Scheme 83. Reduction of 586 with
NaBH.sub.4 in the presence of BF.sub.3.OEt.sub.2 yields the
nitroazepine 587. Protection of 587 with trifluoroacetic anhydride
in the presence of base, preferably triethylamine (TEA), gives 588.
Reduction of the nitro functionality of 588 under catalytic
hydrogenation conditions yields amine 589. Amine 589 is converted
into the hydrazine 590, bromide 591, or boronic acid 592 using the
methodology described in Scheme 59. ##STR331## A2-100, V1=O,
V2=H.sub.2
[0424] The synthesis of intermediates containing A2-100 wherein V1
is O and V2 is H.sub.2 is shown in Scheme 84. The commercially
available starting material 4-nitrophenethylamine 593 is converted
into the hydrazine 594, bromide 595, or boronic acid 596 using the
methodology outlined in Scheme 62. ##STR332## A2-100, V1 and
V2=H2
[0425] The preparation of intermediates containing A2-100 wherein
V1 and V2 are H.sub.2 is illustrated in Scheme 85. 597 is converted
to intermediates 598 to 609 using methods described above in Scheme
57. ##STR333## A2-101, V1 and V2=O
[0426] Scheme 86 illustrates the preparation of intermediates
containing A2-101 wherein V1 and V2 are O. The commercially
available starting material 2-amino-4-nitrobenzoic acid 610 is
converted into 2-iodo-4-nitrobenzoic acid 611 by a Sandmeyer
reaction sequence. The iodobenzoic acid 611 is reacted with
acrylonitrile under Heck conditions to give the unsaturated nitrile
612 (Bumagin, N. A. et al, J. Organometallic Chem. (1989), 371:
397-401). Intermediate 612 is converted into the acid chloride 613
and then subjected to acid-catalyzed cyclization, giving the ring
closure product 614 (Puar, M. S. et al, Tetrahedron (1978), 34:
2887-90). Reduction of the nitro functionality of 614 under
catalytic hydrogenation conditions affords the amine-substituted
benzazepinedione 615 (Knobloch, K. et al, European J. of Org.
Chem., (2001), 17: 3313-3332). Intermediate 615 is converted into
the hydrazine 616, bromide 617, or boronic acid 618 using the
methodology described in Scheme 59. Alternatively, intermediate 614
is selectively reduced at the nitro functionality, preferably with
stannous chloride, to afford amine-substituted benzazepinedione 619
wherein the ring C--C bond is unsaturated. Intermediate 619 is
converted into the hydrazine 620, bromide 621 or boronic acid 622
as described in Scheme 78. ##STR334## ##STR335##
[0427] An alternative synthesis of intermediates containing A2-101
wherein V1 and V2 are O is shown in Scheme 87. The commercially
available starting material 2-chloro-4-nitrobenzoic acid 623,
wherein P is an amine protecting group, preferably a
para-methoxybenzyl (PMB) group, is converted to the hydrazines 629
or 633, bromides 630 or 634, or boronic acids 631, 635 using the
methodology described in Scheme 78. ##STR336## ##STR337## A2-101,
V1 and V2=H.sub.2
[0428] The synthesis of intermediates containing A2-101 wherein V1
and V2 are H.sub.2 is shown in Scheme 88. Reduction of 628 with
NaBH.sub.4 in the presence of BF.sub.3OEt.sub.2 (U.S. Pat. No.
6,121,283) yields the tetrahydroazepine 636. 636 is converted into
the hydrazine 637, bromide 638 or boronic acid 639 using the
methodology described in Scheme 59. ##STR338## A2-101, V1=O,
V2=H
[0429] The synthesis of intermediates containing A2-101 wherein V1
is O and V2 is H.sub.2 is shown in Scheme 89. Intermediate 625 (see
Scheme 87) is converted to the hydrazines 643 or 647, bromides 644
or 648 or boronic acids 645 or 649 as shown in Scheme 89.
##STR339## A2-101, V1=H.sub.2, V2=O
[0430] The synthesis of intermediates containing A2-101 wherein V1
is H.sub.2 and V2 is O is shown in Scheme 90. The readily available
starting material 2-chloro-4-nitrobenzylamine 650 is converted to
the hydrazines 651 or 654, bromides 652 or 655, or boronic acids
653 or 656 using the methodology described in Scheme 81. ##STR340##
A2-102, V.dbd.O
[0431] Scheme 91 illustrates the preparation of intermediates
containing A2-102 wherein V is O, using the methodology reported by
Schultz, C. et al (J. Med. Chem. (1999), 42: 2909-2919). The
commercially available starting material 2-amino-5-nitrobenzoic
acid 657 is converted into the ester 658. The ester 658 is treated
with ethyl 4-chloro-oxobutanoate in the presence of pyridine to
yield 659. Dieckman cyclization of 659 using potassium hydride as
base in mixture of toluene and DMF affords the
dihydrobenzazepineone 660. Heating 660 in wet DMSO yields the
tetrahydrobenzoazepinedione 661. Reduction of the nitro functionaly
of 661 under catalytic hydrogenation conditions, followed by
selective reduction with Et.sub.3SiH (Bleeker, C. et al. Pharmazie,
(1999), 54: 645-650) gives the lactam 662. The lactam 662 is
converted into the hydrazine 663, bromide 664 or boronic acid 665
using the methodology described in Scheme 59. ##STR341##
##STR342##
[0432] An alternative synthesis of intermediates containing A2-102
wherein V is O is shown in Scheme 92. Nitration of tetralin 666
gives 5- and 6-nitrotetralin as a mixture of regioisomers, which is
fractionated to yield 6-nitrotetralin 667. Oxidation of 667 with
CrO.sub.3 affords 6-nitro-1-tetralone 668. The nitrotetralone 668
can be converted into the hydrazine 663, bromide 664 or boronic
acid 665 using the methodology described in Scheme 75. ##STR343##
A2-102, V.dbd.H.sub.2
[0433] The synthesis of intermediates containing A2-102 wherein V
is H.sub.2 is shown in Scheme 93. Intermediate 662 (see Scheme 91)
is treated with LAH to afford the tetrahydrobenzazepine 669. The
tetrahydrobenzazepine 669 is converted into the hydrazine 670
bromide 671 or boronic acid 672 using the methodology described in
Scheme 59. ##STR344## A2-107, V1=O, V2=O; A2-107, V1 and
V2=H.sub.2
[0434] The synthesis of intermediate containing A2-107 is shown in
Scheme 94. Readily available isatoic anhydride 673 is reacted with
amino acid esters to afford the benzdiazepinediones 674. Reduction
of the ring carbonyl groups of 674 with LAH or borane-Me.sub.2S
gives diamines 675 (P.dbd.H). Protection with standard amine
protecting groups (BOC, FMOC, PMB, SEM) affords 675, wherein P is
BOC, FMOC, PMB, SEM, or other standard amine protecting group.
##STR345## A2-107, V1=H.sub.2, V2=O
[0435] The synthesis of intermediates containing A2-107 wherein V1
is H.sub.2 and V2 is O is shown in Scheme 95. Iodination of
ortho-amino benzyl alcohol 676 with ICI affords 677. N-acylation of
677 with protected amino acid esters gives amides 678. Oxidation of
the alcohol functions of 678 to the aldehydes 679 takes place under
standard oxidation conditions, preferably MnO.sub.2, TPAP, or
periodinane oxidation. Removal of the amine protecting groups,
preferably Fmoc, with base, preferably piperidine, with in situ
reduction of the formed imines, preferably with sodium
triacetoxyborohydride, gives benzdiazepinones 680. Amino group
protection, preferably with trifluoroacetic anhydride and base,
preferably triethylamine, gives the desired intermediates 681.
##STR346## ##STR347## A2-107, V1=O; V2=H.sub.2;
[0436] The synthesis of intermediates containing A2-107 wherein V1
is O and V2 is H.sub.2 is shown in Scheme 96. Nucleophilic aromatic
substitution reactions between 682 and various substituted
ethanediamines 683, wherein P is a standard amine protecting group,
affords 684. Amine deprotection, followed by amide formation using
standard acid-activating reagents, including EDCI and base, affords
benzdiazepinones 685. Utilization of diamines 683 wherein R8 is H
affords benzdiazepinones 685 corresponding to the structures
A2-107, wherein V2 is H.sub.2. Utilization of diamines wherein R8
is substituted results in structures A2-107 wherein V2 is H, R8.
##STR348## A2-108 and A2-110, V1 and V2=O
[0437] The preparation of the intermediates containing A2-108 and
A2-110 wherein V1 and V2=O is illustrated in schemes 97 and 98. In
one preferred mode, shown in 97, following the procedure of
Uskokovic, M. et al. (U.S. Pat. No. 3,291,824), a readily available
and suitably substituted anthranilic acid, 686 or 687, is acylated
with an R8-containing alpha-halo acid halide, 688 to give
intermediate 689 or 690. This, in turn, is cyclized by refluxing in
DMF, affording 691 or 692. R' is then converted, if needed, to a
group R (693 or 694) suitable for attachment to any of the A1
moieties disclosed in this invention. For example, when R' is Br or
I, 691 or 692 may be used directly in a metal-mediated
cross-coupling, such as a Heck, Suzuki or Stille protocol (see
Scheme 23). Alternatively, when R' is Br or I, it may be subjected
to Pd-mediated alkoxycarbonylation using a published procedure
(Stille, J. K. et al, J. Org. Chem. 1975, 40 (4), 532; Heck, R. F.,
et al., J. Org. Chem. 1974, 39 (23), 3318) to give an ester. This
functionality is saponified or reduced to afford the carboxylic
acid or aldehyde, respectively. Also, when R' is Br or I, it may be
converted to a boronic ester as shown previously in Scheme 23. When
R' is NO.sub.2, hydrogenation provides the amine. Diazotization,
followed by reduction (see Scheme 30), provides the hydrazine.
##STR349##
[0438] In another preferred mode, shown in Scheme 98, 686 or 687 is
converted to its anhydride, 695 or 696, with phosgene or an
equivalent. Reacting this with an alpha-hydroxy ester 697 in the
presence of a base gives the ester, 698 or 699. Subsequently, the
ring is closed using a peptide-coupling or dehydrating reagent.
Finally, R' is modified to R to give 700 or 701 as detailed above.
##STR350##
[0439] The preparation of the intermediates containing A2-108 and
A2-110 wherein V1 is O and V2 is H.sub.2, or both V1 and V2 are
H.sub.2, is illustrated in Scheme 99. 691 or 692 is thionated with
either Lawesson's reagent or P.sub.4S.sub.10 to give 702 or 703
which is dethionated with Raney nickel to provide 704 or 705.
Reduction of the lactone carbonyl to give the cyclic ether 706 or
707, is effected by using LiBH.sub.4, NaBH.sub.4 or LiAH.sub.4 in
the presence of BF.sub.3OEt.sub.2 using the methods of Pettit, G.
R. et al. (J. Org. Chem. 1960, 25, 875 and J. Org. Chem. 1961, 26,
1685). Conversion of R' to R is carried out as described previously
to give 708 to 711. ##STR351##
[0440] The preparation of the intermediates containing A2-108 and
A2-110 wherein V1 is H.sub.2 and V2 is O is illustrated in Scheme
100. 712 or 713 is esterified and selectively reduced with
LiBH.sub.4, using the method of H. C. Brown et al. (J. Org. Chem.
1982, 47, 4702) to give the primary alcohol. Halogenation gives 714
or 715 wherein X is Cl or Br. Depending on the identity of R'',
reduction or deprotection affords 716 or 717 which is acylated with
718 to provide the alpha-hydroxy amide 719 or 720. Treatment of 719
or 720 with a strong non-nucleophilic base, such as NaH or KH
affords 721 or 722. Conversion of R' to R is carried out as
described previously to give 723 and 724. ##STR352##
[0441] The preparation of the intermediates containing A2-108 and
A2-110 wherein V1 is O or H.sub.2 and V2 is H.sub.2, is illustrated
in Scheme 101. 704 or 705 (V.dbd.O) or 706 or 707 (V.dbd.H, H) can
be converted to 725 or 726 (V.dbd.O) or 727 or 728 (V.dbd.H, H
using the method outlined in Scheme 57. Conversion of R' to R is
carried out as described previously to give 729 to 732. ##STR353##
A2-109, V1 and V2=O; A2-109, V1 and V2=H.sub.2
[0442] The synthesis of intermediates containing A2-109 wherein V1
and V2 are both O or both H.sub.2 is illustrated in Scheme 102. The
readily available bromo-substituted isatoic anhydride 733 is
reacted with amino acid esters 734 to afford amides 735. Hydrolysis
of the ester functionality of 735 gives the carboxylic acids which
are cyclized to afford benzdiazepinediones 736 by employment of a
standard acid-activating reagent, typified by EDC and base,
preferably triethylamine. Reduction of the amide carbonyl functions
of 736 utilizing LAH, diborane, or BH.sub.3.Me.sub.2S gives
benzdiazepines 737. ##STR354## A2-109, V1=O, V2=H.sub.2
[0443] The synthesis of intermediates containing A2-109 wherein V1
is O and V2 is H.sub.2 is illustrated in Scheme 103. Isatoic
anhydride 738 is reacted with acetal-protected amino ketones 739 to
give amides 740. Deprotection of the acetal protection with acid,
preferably p-toluenesulfonic acid or HCl, affords the aldehydes
which are subjected to reductive amination conditions, preferably
sodium triacetoxyborohydride, to give benzdiazepineones 741.
Protection of the ring nitrogen atom with trifluoroacetic anhydride
and base, preferably triethylamine, affords intermediates 742.
##STR355##
[0444] Alternatively, intermediates 741 can be subjected to the
various reactions described in Scheme 57 to afford Z4-substituted
analogs 743 (scheme 104). ##STR356## A2-109, V1=H.sub.2, V2=O
[0445] The synthesis of intermediates containing A2-109 wherein V1
is H.sub.2 and V2 is O is illustrated in Scheme 105. Readily
available 744 is oxidized to the aldehyde 745 using standard
oxidizing reagents, preferably MnO.sub.2, TPAP, or a periodinane.
Reductive amination of 745 with amino acid esters 746, wherein P is
an substituted alkyl protecting group or H, affords intermediates
747. Hydrolysis of the ester function of 747 and cyclization
employing standard acid-activating reagents, including EDC and
base, triethylamine, affords the desired benzdiazepineone
intermediates 748. Concomitant reduction of the lactam carbonyl and
nitro functional groups with LAH gives rise to intermediate
benzdiazepines 749. Selective protection of the ring nitrogen atom
with trifluoroacetic anhydride and base, preferably triethylamine,
gives 750. Alternatively, 748 is converted into Z4-substituted
benzdiazepineones 751 by a sequence involving amine deprotection
and derivatization with Z4 moieties as described in Scheme 57.
Alternatively, 749 is converted into regioisomeric Z4-substituted
benzdiazepineones 752 using methods described in Scheme 57.
##STR357## A2-111, V1 and V2=O; A2-111, V1 and V2=H.sub.2
[0446] The synthesis of intermediates containing A2-111 wherein V1
and V2 are O or V1 and V2 are H.sub.2 is illustrated in Scheme 106.
Nitroaniline 753, wherein P is a substituted alkyl amine
protecting, is coupled with the malonyl half esters 754 employing
standard acid-activating reagents, including EDCI/HOBT or ethyl
chloroformate in the presence of base, preferably triethylamine, to
give amides 755. Reduction of the nitro group under standard
conditions, followed by hydrolysis of the ester functionality
affords acids 756. Cyclization of 756 to benzdiazepinediones 757 is
effected by EDCI/HOBT in the presence of base, preferably
triethylamine. Amide nitrogen deprotection, followed by reduction
of the ring carbonyl functionalities by LAH or borane affords the
requisite benzdiazepines 758. ##STR358## A2-111, V1=O,
V2=H.sub.2
[0447] The synthesis of intermediates containing A2-111 wherein V1
is O and V2 is H.sub.2 is illustrated in Scheme 107. Readily
available 753, wherein P is a substituted alkyl amine protecting
group, is coupled with substituted hydroxy acids 759, wherein P' is
a standard alcohol protecting group, in the presence of an
acid-activating reagent, including but not limited to EDCI/HOBT or
ethyl chloroformate in the presence of a base, preferably
triethylamine, to give amides 760. Reduction of the nitro group
using standard conditions, followed by removal of the alcohol
protecting group P', affords 761. Mild alcohol oxidation,
preferably with MNO2, TPAP, or a periodinane, gives the aldehyde
which is subjected to reductive aminiation cyclization conditions,
preferably sodium triacetoxyborohydride, to afford benzdiazepinones
762. Optional amide deprotection and amine protection using
trifluoroacetic anhydride in the presence of base, preferably
triethylamine, gives trifluoroacetyl protected benzdiazepineones
763. ##STR359## A2-111, V1=O, V2=H.sub.2
[0448] The synthesis of intermediates containing A2-111 wherein V1
is O and V2 is H.sub.2 and the ring amino nitrogen is substituted
with a Z4 moeity, is illustrated in Scheme 108. 762 is converted
into Z4-substituted analogs 764 using conditions described in
Scheme 57. ##STR360## A2-111, V1=H.sub.2, V2=O;
[0449] The synthesis of intermediates containing A2-111 wherein V1
is H.sub.2 and V2 is O is illustrated in Scheme 109. Starting amine
753 is reacted with substituted malonaldehydes 754 under standard
reductive amination conditions, preferably sodium
triacetoxyborohydride, to afford nitro esters 765. Reduction of the
nitro functionality under standard conditions and ester hydrolysis
gives acids 766, which are cyclized to benzdiazepineones 767 in the
presence of an acid-activating reagent, preferably EDCI/HOBt or
ethyl chloroformate in the presence of a base, preferably
triethylamine, to afford benzdiazepineones 767. Protection of the
ring amino nitrogen is effected by reaction of 767 with
t-butoxycarbonyl anhydride, (BOC).sub.2O, in the presence of base,
preferably triethylamine, to give the requisite protected
benzdiazepineones 768. ##STR361## A2-112, V.dbd.O;
[0450] The synthesis of intermediates containing A2-112 wherein V
is O is illustrated in Scheme 110. Using methods described in
Scheme 69, 674 is converted to amidines 769 or 770. ##STR362##
A2-113 and A2-115
[0451] The preparation of the intermediates containing A2-113 and
A2-115 is illustrated in Scheme 111. By analogy to the sequence
shown in Scheme 70, the lactams 771 or 772 are converted to 773
through 776 bearing an exocyclic amine function. Conversion of R'
to R is carried out as described previously to give 777 to 780.
##STR363## A2-114, V.dbd.O
[0452] The synthesis of intermediates containing A2-114 wherein V
is O is illustrated in Scheme 112. Using methods described in
Scheme 69, 738 is converted to amidines 781 or 782. ##STR364##
A2-117, V.dbd.O
[0453] The synthesis of intermediates containing A2-117 wherein V
is O is illustrated in Scheme 113. Using methods described in
Scheme 69, 757 is converted to amidines 783 or 784. ##STR365##
A2-117, V.dbd.H2;
[0454] The synthesis of intermediates containing A2-117 wherein V
is O is illustrated in Scheme 114. Using methods described in
Scheme 69, 763 is converted to amidines 785 or 786. ##STR366## III.
Synthesis of Other Intermediates Synthesis of R5 Intermediates
[0455] When R5 is pyrrolidine (R5-1) [CAS 123-75-1], piperidine
(R5-2) [CAS 110-98-4], azepine [CAS 11-49-9], morpholine (R5-3)
[CAS 110-91-8] or thiomorpholine (R5-4) [CAS 123-90-0], these
materials are purchased from a number of commercial sources. When
R5 is 2-substituted pyrrolidine (R5-12), 2-substituted piperidine
(R5-13), HN(CH.sub.2CON(R4)).sub.2 (R5-14),
HN(CH.sub.2CO.sub.2R4).sub.2 (R5-15), or 4-substituted
oxazolidinone (R5-16), these are prepared from commercially
available precursors using standard methods and performed by one of
ordinary skill in the art.
[0456] When R5 is thiomorpholinsulphone (R5-5) [790, CAS
39093-93-1], the synthesis is shown in Scheme 114. Benzylamine 787
and divinylsulphone 788 are reacted together in refluxing
methylenechloride to yield benzyl-protected thiomorpholinesulphone
789, which upon hydrogenation yields 790. ##STR367##
[0457] When R5 is 4-alkyl-4-piperdinol (R5-6), the synthesis
proceeds as shown in Scheme 115. Commercially available
N-Boc-4-piperdone is reacted with the requisite Grignard or
alkyllithium reagent to yield N-Boc-4-alkyl-4-piperdinol 791, which
is readily deprotected to yield species of type 792. ##STR368##
[0458] When R5 is 4-N-alkylpiperazine (R5-7), the synthesis
proceeds as shown in Scheme 116. Commercially available
N-Boc-piperazine is reacted with a suitable aldehyde under
reductive amination conditions followed by deprotection to yield
species of type 794. When R4=phenyl [CAS 92-54-6], the synthesis
proceeds as published by Bloomer et al (see BioOrg. Med. Chem.
Lett., 2001, 11(14), 1925). ##STR369## Synthesis of Z1, Z2, and Z4
Intermediates
[0459] The syntheses of five-membered heterocycle intermediates Z1,
Z2, and Z4 corresponding to Z1-1 through Z1-21, Z2-1 through Z2-21,
and Z4-1 through Z4-21 are performed as described in U.S.
Continuation-In-Part Application: ANTI-INFLAMMATORY MEDICAMENTS;
Docket No. 34477CIP, attached by reference herein.
Synthesis of Sulfoximes
[0460] The Syntheses of sulfoxime moieties ##STR370## is
accomplished using the method reported by Cho, G. Y., et al,
Organic Letters (2004) 6: 3293-3296. General Methods
[0461] General method A: To a stirring suspension of the starting
pyrazole amine (0.5 mmol, 1.0 eq) in dry THF (2.0 ml) was added
pyridine (5.0 mmol, 10.0 eq). The resulting slurry was stirred at
RT for 1 h, treated with the appropriate isocyanate (1.0 mmol, 2.0
eq) and stirred overnight at RT. The reaction was diluted with
EtOAc and 1M HCl (10 ml) and the layers separated. The aqueous was
extracted with EtOAc (2.times.), and the combined organic extracts
were washed with H.sub.2O (1.times.), satd. NaHCO.sub.3 (1.times.)
and brine (2.times.), dried (MgSO4), filtered, concentrated, and
purified via column chromatography to yield the target
compound.
[0462] General method B: A solution of the starting pyrazole amine
(0.5 mmol, 1.0 eq), triethylamine (2.0 eq) and CDI (2.0 eq) in DMF
(5.0 mL) was stirred at RT for 6 h. The appropriate amine (1.0
mmol, 2 eq) was added and the solution was stirred at RT for 5 h,
then poured into H.sub.2O (50 mL). The mixture was extracted with
CH.sub.2Cl.sub.2 (3.times.50 mL) and the combined organic extracts
were washed with 1N HCl, brine, dried (Na.sub.2SO.sub.4), filtered,
concentrated and purified by preparative TLC to afford the target
compound.
[0463] General method C: To a stirred solution of the starting
ester (0.23 mmol, 1.0 eq) in THF (5 mL) was added LiAlH.sub.4
powder (18 mg, 0.5 mmol) portionwise at 0.degree. C. under N.sub.2.
The mixture was stirred at RT for 2 h, quenched with H.sub.2O, and
extracted with EtOAc. The combined organic layers were washed with
brine, dried (Na.sub.2SO.sub.4), filtered and concentrated to yield
the crude product, which was purified either by preparative TLC or
column chromatography to afford the target compound.
[0464] General method D: To a solution of the starting pyrazole
amine (1 eq) in EtOAc were added 2,2,2-trichloroethylchloroformate
(1.1 eq) and saturated NaHCO.sub.3 (2-3 eq) at 0.degree. C. After
stirring for 3 h at RT, the layers were separated and the aqueous
layer extracted with EtOAc. The combined organic extracts were
washed with brine, dried (Na.sub.2SO.sub.4) and concentrated under
vacuum to yield the crude TROC carbamate of the pyrazole amine. To
the carbamate (1 eq) in DMSO were added diisopropylethylamine (2
eq), the appropriate amine (2 eq) and the mixture was stirred at
60.degree. C. for 16 h or until all the starting carbamate was
consumed. Water was added to the mixture and the product was
extracted with EtOAc (2.times.25 mL). The combined organic extracts
were washed with brine solution, dried (Na.sub.2SO.sub.4) and
concentrated to yield crude product, which was purified by column
chromatography to yield the target compound.
[0465] General method E: A mixture of the starting ester (1 eq) in
an aqueous solution of LiOH (2N, 5 mL) and THF (10 mL) was stirred
overnight at RT. After removal of the organic solvent, the mixture
was extracted with Et.sub.2O. The aqueous layer was then acidified
with 2N HCl to pH 4 and extracted with EtOAc. The combined organic
layers were washed with brine, dried (Na.sub.2SO.sub.4), filtered
and concentrated to give the crude product, which was purified by
reverse phase chromatography to afford the target acid.
[0466] General method F: To the starting Boc-protected amine
dissolved in EtOAc (5 mL) was added 3N HCl/EtOAc (6 mL). The
solution was stirred at RT for 3 h. The solid was filtered and
dried under vacuum to obtain the target amine as the HCl salt.
[0467] General method G: To the starting trifluoroacetamide
protected amine dissolved in MeOH (2 mL) was added 2N sodium
hydroxide solution (2 mL) and the resulting mixture was stirred at
RT for 5 h. The solution was further basified with 2N NaOH (20 mL)
and the mixture was extracted with ether (3.times.20 mL) and
subsequently with 1-butanol (3.times.20 mL). The combined butanol
extracts were concentrated and dried to yield the deprotected
amine.
[0468] General method H: To a suspension of the amine (150 mg, 0.67
mmol) in EtOAc (2 mL) was added aqueous 1N NaOH. The reaction
mixture was cooled to 0.degree. C. and treated with isopropenyl
chloroformate (0.1 mL, 0.94 mmol) over 30 sec. The reaction mixture
was stirred 15 min at 0.degree. C. and 1 h at RT. The reaction was
poured into THF-EtOAc (1:1; 40 mL) and washed with H.sub.2O
(2.times.10 mL) and brine (2.times.10 mL). The organics were dried
(Na.sub.2SO.sub.4), concentrated and the residue purified via
column chromatography to provide the target
(prop-1-en-2-yl)carbamate.
[0469] General method I: PyBop (0.11 g, 0.22 mmol) was added to a
solution of a starting acid (typically 0.2 mmol) in DMF (1 mL) and
was stirred for 5 min at RT. To this mixture was added the
appropriate amine (either neat or 1 mL of 0.5 M dioxane solution)
and the resulting solution stirred for 5 h and was followed by the
addition of 3M HCl (2 mL), water (15 mL) and the aqueous extracted
with EtOAc (2.times.20 mL). The combined organic extracts were
washed with brine, dried (Na.sub.2SO.sub.4), filtered, concentrated
and purified via column chromatography to yield the amide.
[0470] General method J: To a solution of a starting acid
(typically 0.21 mmol) in DMF (2 mL) was added NH.sub.4Cl (56 mg, 1
mmol) or the appropriate amine, i-Pr.sub.2NEt (110 mg, 0.84 mmol),
EDC (60 mg, 0.31 mmol) and HOBT (48 mg, 0.31 mmol). The mixture was
stirred at RT for 6 h, then diluted with EtOAc (30 mL). The organic
extracts were washed with water (2.times.25 mL) and brine, dried
(Na.sub.2SO.sub.4) and concentrated to afford the target amide.
[0471] General method K: To a stirring suspension of a starting
acid (typically 0.11 mmol), and the appropriate amine (1.5 eq,
either neat or in a 0.5 M dioxane solution) and TBTU (1.5 eq) in
DMF (1.1 ml) was added i-Pr.sub.2NEt (5.0 eq). The resulting
solution was stirred at RT overnight and was then diluted with
H.sub.2O (11 ml) and extracted with EtOAc (3.times.). The combined
organics were washed with 1M HCl (1.times.), satd Na.sub.2CO.sub.3
(2.times.), dried (MgSO.sub.4), filtered and evaporation to
provided the target amide.
[0472] General method L: NaH (2.3 g of a 60% dispersion, 57 mmol)
was activated by washing with hexanes (3.times.15 mL). THF (20 mL)
was added and heated to 80.degree. C. At this point a solution of
the appropriate ester (19 mmol) and MeCN (0.91 g, 21 mmol) in THF
(40 mL) was added slowly via syringe. After stirring about 30 min a
vigorous reaction was observed and soon the color of the reaction
turned to dark blue and it was stirred for 10 more min. The
reaction mixture was then poured into a biphasic mixture of ice
cold 5% HCl (100 mL) and EtOAc (100 mL). The organic layer was
separated and aqueous layer was extracted with EtOAc (1.times.50
mL). The combined organic extracts were washed with brine, dried
(MgSO.sub.4) and concentrated to afford the desired
3-oxo-3-substituted-propanenitrile which was used as is in the next
reaction.
[0473] General method M: To a suspension of the appropriate aniline
(1.05 g, 6.95 mmol) in conc. HCl (3 mL) was added a solution of
NaNO.sub.2 (0.57 g, 8.34 mmol) in H.sub.2O (3 mL) at 0.degree. C.
slowly. After stirring for 1 h, to the mixture was added
SnCl.sub.2.2H.sub.2O (2.98 g, 14 mmol) dissolved in conc. HCl (3
mL) at such a rate that the temperature of the mixture was not
allowed to cross 5.degree. C. After stirring for 2 h, a solution of
the appropriate 3-oxo-3-substituted-propanenitrile (8 mmol; general
method L or commercially available) in EtOH (10 mL) was added and
the mixture was heated at 60.degree. C. for 16 h. The mixture was
cooled to RT and the solvent was removed under vacuum. The residue
was basified with solid NaHCO.sub.3 and the product was extracted
with ethyl acetate (2.times.50 ml). The combined organic extracts
were washed with brine, dried (Na.sub.2SO.sub.4) and concentrated
under vacuum to yield the desired pyrazole amine. ##STR371##
[0474] To a solution of m-aminobenzoic acid (200 g, 1.46 mmol) in
conc. HCl (200 mL) was added an aqueous solution (250 mL) of
NaNO.sub.2 (102 g, 1.46 mmol) at 0.degree. C. and the reaction
mixture was stirred for 1 h. A solution of SnCl.sub.2.2H.sub.2O
(662 g, 2.92 mmol) in conc. HCl (2 L) was then added at 0.degree.
C. The reaction solution was stirred for an additional 2 h at RT.
The precipitate was filtered and washed with EtOH and ether to give
3-hydrazinobenzoic acid hydrochloride as a white solid, which was
used for the next reaction without further purification. .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .delta. 10.8 (s, 3H), 8.46 (s, 1H),
7.53 (s, 1H), 7.48 (d, J=7.6 Hz, 1H), 7.37 (m, 1H), 7.21 (d, J=7.6
Hz, 1H).
[0475] A mixture of 3-hydrazinobenzoic acid hydrochloride (200 g,
1.06 mol) and 4,4-dimethyl-3-oxopentanenitrile (146 g, 1.167 mol)
in EtOH (2 L) was heated at reflux overnight. The reaction solution
was evaporated under reduced pressure. The residue was purified by
column chromatography to give
3-(5-amino-3-t-butyl-pyrazol-1-yl)-benzoic acid ethyl ester (116 g,
40%) as a white solid together with
3-(5-amino-3-t-butyl-pyrazol-1-yl)benzoic acid (93 g, 36%).
3-(5-amino-3-t-butyl-pyrazol-1-yl)benzoic acid and ethyl ester.
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.09 (s, 1H), 8.05
(brd, J=8.0 Hz, 1H), 7.87 (brd, J=8.0 Hz, 1H), 7.71 (t, J=8.0 Hz,
1H), 5.64 (s, 1H), 4.35 (q, J=7.2 Hz, 2H), 1.34 (t, J=7.2 Hz, 3H),
1.28 (s, 9H). ##STR372##
[0476] Using general method A, Example A1 (1 g, 3.09 mmol) and
1,2-dichloro-3-isocyanatobenzene (0.7 g, 3.71 mmol) were combined
to afford ethyl
3-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]-1H-pyrazol-1-yl}benzoate
(0.6 g, 41% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
9.24 (brs, 1H), 8.70 (brs, 1H), 8.05 (t, J=1.8 Hz, 1H), 8.00 (t,
J=5.1 Hz, 1H), 7.97-7.93 (m, 1H), 7.84-7.80 (m, 1H), 7.67 (t, J=8.1
Hz, 1H), 7.39 (d, J=4.8 Hz, 2H), 6.39 (s, 1H), 4.31 (q, J=7.2 Hz,
2H), 1.27 (s, 9H), 1.26 (t, J=7.2 Hz, 3H). ##STR373##
[0477] Using general method C, Example A2 (80 mg, 0.17 mmol) was
reduced to afford
1-[3-t-butyl-1-(3-hydroxymethyl-phenyl)-1H-pyrazol-5-yl]-3-(2,3-
-dichlorophenyl)urea (50 mg, 68% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.20 (brs, 1H), 8.75 (brs, 1H), 8.04 (dd,
J=3.6 and 6 Hz 1H) 7.49-7.44 (m 2H), 7.37-7.32 (m, 2H), 7.30-7.28
(m, 2H), 6.37 (s, 1H), 4.56 (s, 2H), 1.24 (s, 9H). ##STR374##
[0478] To a solution of Example A2 (100 mg, 0.21 mmol) in fresh THF
(10 mL) was added dropwise a solution of MeMgBr (1.5 mL, 1.4 in
toluene/THF) at 0.degree. C. under N.sub.2. After stirring for 1 h,
the resulting mixture was allowed to rise to RT and stirred for 1
h. The reaction mixture was quenched by addition of aqueous 1N HCl
(5 mL) and the mixture was extracted with EtOAc (3.times.). The
combined organic layers were washed with brine, dried
(Na.sub.2SO.sub.4), filtered, concentrated and purified via column
chromatography to afford
1-{3-t-butyl-1-[3-(2-hydroxypropan-2-yl)phenyl]-1H-pyrazol-5-yl}-3-(2,3-d-
ichlorophenyl)urea (50 mg, 52% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.19 (brs, 1H), 8.72 (brs, 1H), 8.06 (dd,
J=3.0, and 6.6 Hz, 1H), 7.58 (m, 1H), 7.46-7.43 (m, 2H), 7.32-7.27
(m, 3H), 6.36 (s, 1H), 1.42 (s, 6H), 1.26 (s, 9H). ##STR375##
[0479] To a solution of Example A1 (14.4 g, 50 mmol) and formamide
(4.5 g, 0.1 mol) in DMF (50 mL) was added NaOMe (5.4 g 0.1 mol) at
RT. The mixture was stirred at 100.degree. C. for 2 h, concentrated
and the residue dissolved in EtOAc (150 mL). The organic layer was
washed with H.sub.2O and brine, dried (Na.sub.2SO.sub.4), filtered
and purified by column chromatography to afford
3-(5-amino-3-t-butyl-1H-pyrazol-1-yl)benzamide (6 g, 48%
yield).
[0480] A solution of 3-(5-amino-3-t-butyl-1H-pyrazol-1-yl)benzamide
(5.2 g, 20 mmol) in SOCl.sub.2 (50 mL) was heated at reflux for 6
h. After removal of the solvent, the residue was dissolved in EtOAc
(100 mL). The organic layer was washed with saturated NaHCO.sub.3
and brine, dried (Na.sub.2SO.sub.4), filtered, and purified by
column chromatography to afford
3-(5-amino-3-t-butyl-1H-pyrazol-1-yl)benzonitrile (3.5 g, 73%
yield).
General Experimental for Examples 3-12
[0481] A solution of Example A3 and the appropriate isocyanate
(general method A) or the appropriate aniline (general method B)
were converted to the target compound. TABLE-US-00001 MS (EI)
Example Name (M + H.sup.+) .sup.1H NMR (300 MHz, DMSO-d.sub.6)
##STR376## 1-[3-t-butyl-1-(3- cyanophenyl)-1H- pyrazol-5-yl]-3-(2-
fluorophenyl)urea 55 mg, 29% yield General method A 378 .delta.
8.90 (brs, 2H), 8.04-7.99 (m, 2H), 7.85 (t, J=8.1 Hz, 2H), 7.70 (t,
J=8.1 Hz, 2H), 7.20 (m, 1H), 7.09 (m, 1H), 6.99 (m, 1H), 6.40 (s,
1H), 1.25 (s, 9H) ##STR377## 1-[3-t-butyl-1-(3- cyan-phenyl)-1H-
pyrazol-5-yl]-3-(2,3- difluorophenyl)urea 55 mg, 28% yield General
method B 396 .delta. 9.07 (brs, 1H), 8.92 (s, 1H), 8.00 (s, 1H),
7.88-7.81 (m, 3H), 7.73 (t, J=7.8 Hz, 1H), 7.12-6.97 (m, 2H), 6.40
(s, 1H), 1.25 (s, 9H) ##STR378## 1-(3-t-butyl-1-(3-
cyanophenyl)-1H- pyrazol-5-yl)-3-(3- bromophenyl)urea 38.4 mg, 42%
yield General method A 440 .delta. 7.77-7.70 (m, 3H), 7.52 (s, 1H),
7.46-7.44 (m, 2H), 7.35 (s, 1H), 7.16-7.13 (m, 1H), 7.06-7.04 (m,
2H), 6.35 (s, 1H), 1.29 (s, 9H) ##STR379## 1- (benzo[d][1,3]dioxol-
5-yl)-3-(3-t-butyl-1- (3-cyanophenyl)-1H- pyrazol-5-yl)urea 107.4
mg, 15% yield General method A 404.2 .DELTA. 8.92 (s, 1H), 8.47 (s,
1H), 8.02-8.01 (m, 1H), 7.91-7.89 (m, 1H), 7.86-7.84 (m, 1H),
7.75-7.71 (m, 1H), 7.12-7.11 (m, 1H), 6.82-6.79 (m, 1H), 6.73-6.70
(m, 1H), 6.39 (s, 1H), 5.96 (s, 2H), 1.28 (s, 9H) ##STR380##
1-(3-t-butyl-1-(3- cyanophenyl)-1H- pyrazol-5-yl)-3-(4-
chlorophenyl)urea 264 mg, 37% yield General method A 394.2 .delta.
7.87 (s, 1H), 7.81-7.79 (m, 1H), 7.58-7.53 (m, 3H), 7.26 (brs, 3H),
6.48 (brs, 1H), 1.37 (s, 9H) ##STR381## 1-(3-t-butyl-1-(3-
cyanophenyl)-1H- pyrazol-5-yl)-3-(3- chlorophenyl)urea 32.8 mg, 40%
yield General method A 394.2 .delta. 7.79-7.76 (m, 2H), 7.60 (s,
1H), 7.48-7.44 (3H), 7.26-7.25 (m, 1H), 7.16-7.12 (m, 1H),
7.05-7.01 (m, 2H), 6.37 (s, 1H), 1.31 (s, 9H) ##STR382##
1-(3-t-butyl)-1-(3- cyanophenyl)-1H- pyrazol-5-yl)-3-(2,3-
dichlorophenyl)urea 16.9 mg, 19% yield General method A 428.0
.delta. 8.12-8.09 (m, 1H), 7.95 (s, 1H), 7.85-7.83 (m, 1H),
7.64-7.54 (m, 3H), 7.25-7.19 (m, 2H), 6.52 (s, 1H), 1.40 (s, 9H)
##STR383## 1-(3-t-butyl)-1-(3- cyanophenyl)-1H- pyrazol-5-yl)-3-(3-
methoxyphenyl)urea 15 mg, 19% yield General method A 390.2 .delta.
7.78-7.75 (m, 2H), 7.51-7.44 (m, 2H), 7.33 (s, 1H), 7.24 (s, 1H),
7.18-7.14 (m, 1H), 6.93-6.91 (m, 1H), 6.72-6.70 (m, 1H), 6.65-6.62
(m, 1H), 6.38 (s, 1H), 3.74 (s, 3H), 1.32 (s, 9H) ##STR384##
1-(3-t-butyl)-1-(3-cyanophenyl)-1H- (trifluoromethyl) phenyl)urea
36.7 mg, 41% yield General method A 428.3 .delta. 9.40 (s, 1H),
8.64 (s, 1H), 7.94-7.91 (m, 1H), 7.86-7.84 (m, 1H), 7.75-7.71 (m,
1H), 7.55-7.48 (m, 2H), 7.32-7.31 (m, 1H), 6.44 (s, 1H), 1.30 (s,
9H) ##STR385## 1-(3-t-butyl-1-(3- cyanophenyl)-1H- pyrazol-5-yl)-3-
(3,4,5- trifluorophenyl)urea 68 mg, 55% yield General method D
414.0 (acetone-d.sub.6): .delta. 8.76 (brs, 1H), 8.09 (brs, 1H),
8.02 (t, J=1.6 Hz, 1H,), 7.97 (dt, J=8.0, and 2.0 Hz, 1H,), 7.76
(dt, J=8.0, and 1.4 Hz, 1H,), 7.71 (t, J=8.0 Hz, 1H,), 7.35-7.29
(m, 2H), 6.44 (s, 1H), 1.32 (s, 9H).
[0482] ##STR386##
[0483] Example 9 (80 mg, 0.19 mmol) was suspended in conc. HCl
(0.93 mL) and briskly stirred. More conc. HCl (1 mL) was added
several times to maintain good stirring and keep the solids wetted.
The reaction was stirred at RT for 5 h and 24 h at 40.degree. C.
The reaction was cooled to RT, diluted with H.sub.2O and EtOAc and
the layers separated. The aqueous was extracted with EtOAc
(2.times.). Solids in the aqueous layer were collected by
filtration, rinsed sparingly with H.sub.2O and dried. These solids
were suspended in MeOH, then collected by filtration, rinsed with
MeOH and washed with EtOAc to afford
1-[3-t-butyl-1-(3-carbamoylphenyl)-1H-pyrazol-5-yl]-3-(2,3-dichlorophenyl-
)urea (47.3 mg, 57% yield) as a white solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.81 (brs, 1H), 8.99 (brs, 1H), 8.25 (brs,
1H), 8.08 (s, 1H), 7.99-7.97 (m, 1H), 7.90-7.87 (m, 1H), 7.75-7.71
(m, 1H), 7.60-7.57 (m, 1H), 7.49 (brs, 1H), 7.32-7.28 (m, 2H), 6.38
(brs, 1H), 1.29 (s, 9H); MS (ESI) m/z: 446.3 (M+H.sup.+), 448.3
(M+2H.sup.+). ##STR387##
[0484] To a solution of commercially available
3-methoxyphenylhydrazine hydrochloride (1.0 g, 5.7 mmol) in toluene
(5 mL) was added commercially available pivaloylacetonitrile (0.70
g, 5.5 mmol). The reaction mixture was heated at reflux for 5 h,
filtered and washed with hexane to obtain
3-t-butyl-1-(3-methoxyphenyl)-1H-pyrazol-5-amine (1.22 g, 89%
yield) as its hydrochloride salt as a pale yellow solid which was
used without further purification. .sup.1H NMR (300 MHz,
CDCl.sub.3): .delta. 7.35 (t, J=8.4 Hz, 1H), 7.04 (t, J=2.1 Hz,
1H), 7.00 (dd, J=1.5 and 7.5 Hz, 1H), 6.95 (dd, J=2.1 and 8.4 Hz,
1H), 5.90 (brs, 2H), 5.83 (s, 1H), 3.81 (s, 3H), 1.89 (s, 9H); MS
(EI) m/z: 246 (M+H.sup.+).
General Experimental for Examples 14-17
[0485] Using general method A, a solution of Example A4 (70 mg,
0.29 mmol) and the appropriate isocyanate (0.29 mmol) were
converted to the target compound. TABLE-US-00002 MS (EI) .sup.1H
NMR (300 MHz/ 400MHz, Example Name (M + H.sup.+) CDCl.sub.3)
##STR388## 1-(3-t-butyl-1-(3- methoxyphenyl)-1H-
pyrazol-5-yl)-3-(3,5- dichlorophenyl)urea 59 mg, 48% yield 433
.delta. 7.73 (s, 1H), 7.1-7.3 (m, 3H), 7.03 (t, J=1.8 Hz, 1H),
6.9-7.0 (m, 3H), 6.84 (dd, J=1.8, and 7.5 Hz, 1H), 6.40 (s, 1H),
3.71 (s, 3H), 1.30 (s, 9H) ##STR389## 1-(3-t-butyl-1-(3-
methoxyphenyl)-1H- pyrazol-5-yl)-3-(2,3- dichlorophenyl)urea 62 mg,
50% yield 433 .delta. 8.14 (dd, J=3.3, and 6.6 Hz, 1H), 7.67 (s,
1H), 7.34 (t, J=8.4 Hz, 1H), 7.19 (d, J 3.3 Hz, 1H), 7.18 (s, 1H),
7.0-7.1 (m, 2H), 6.90 (dd, J=2.2, and 7.5 Hz, 1H), 6.72 (s, 1H),
6.44 (s, 1H), 3.81 (s, 3H), 1.39 (s, 9H) ##STR390##
1-(3-t-butyl-1-(3- methoxyphenyl)-1H- pyrazol-5-yl)-3-(4-
cyanophenyl)urea 79 mg, 71% yield 390 .delta. 8.70 (s, 1H), 7.47
(AB quartet, J=8.7 Hz, 2H), 7.40 (AB quartet, J=8.7 Hz, 2H), 7.37
(s, 1H), 7.11 (t, J=7.8 Hz, 1H), 6.7-6.9 (m, 3H), 6.42 (s, 1H),
3.59 (s, 3H), 1.24 (s, 9H) ##STR391## 1-(3-t-butyl-1-(3-
methoxyphenyl)-1H- pyrazol-5-yl)-3-(3- cyanophenyl)urea 35 mg, 50%
yield 390 .delta. 8.14 (s, 1H), 7.61 (s, 1H), 7.52 (m, 1H), 7.35
(t, J=8.0 Hz, 1H), 7.29 (d, J=6.9 Hz, 1H), 7.21 (d, J=8.0 Hz, 1H),
7.18 (s, 1H), 6.90 (s, 1H), 6.88 (d, J=7.6 Hz, 1H), 6.80 (dd,
J=2.4, and 7.6 Hz, 1H), 6.42 (s, 1H), 3.67 (s, 3H), 1.30 (s,
9H)
[0486] ##STR392##
[0487] A mixture of commercially available
(4-methoxyphenyl)-hydrazine (17.4 g, 0.1 mol) and commercially
available pivaloylacetonitrile (13.8 g, 0.11 mol) in EtOH (500 mL)
and conc. HCl (50 mL) was heated at reflux overnight. After removal
of the solvent, the residue was purified by column chromatography
to afford 3-t-butyl-1-(4-methoxyphenyl)-1H-pyrazol-5-amine (20 g,
82% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 7.38 (d,
J=9.0 Hz, 2H), 6.97 (d, J=9.0 Hz, 2H), 5.32 (s, 1H), 4.99 (brs,
2H), 3.75 (s, 3H), 1.17 (s, 9H); MS (ESI) m/z: 246 (M+H.sup.+).
[0488] Using general method A, a solution of the previous compound
(123 mg, 0.29 mmol) and the 1,2-dichloro-3-isocyanatobenzene (98
mg, 0.5 mmol) were combined to afford
1-[3-t-butyl-1-(4-methoxyphenyl)-1H-pyrazol-5-yl]-3-(2,3-dichlorophenyl)u-
rea (65 mg, 30% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 9.12 (s, 1H), 8.75 (s, 1H), 8.05 (m, 1H), 7.38 (d, J=7.2
Hz, 2H), 7.29-7.27 (m, 2H), 7.05 (d, J=6.9 Hz, 2H), 6.33 (s, 1H),
3.79 (s, 3H), 1.24 (s, 9H); MS (ESI) m/z: 433 (M+H.sup.+).
##STR393##
[0489] Using General method A, ethyl
4-(3-t-butyl-5-amino-1H-pyrazol-1-yl)benzoate (1 g, 3.09 mmol,
prepared from ethyl 4-hydrazinobenzoate and pivaloylacetonitrile by
the procedure of Regan, et al., J. Med. Chem., 45, 2994 (2002)) and
1,2-dichloro-3-isocyanato-benzene (0.7 g, 3.71 mmol) were combined
to afford ethyl
4-{3-t-butyl-5-[3-(2,3-dichlorophenyl)-ureido]-1H-pyrazol-1-yl}benzoate
(0.7 g, 48% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
9.20 (brs, 1H), 8.77 (brs, 1H), 8.04 (m, 1H), 7.44 (brs, 4H),
7.29-7.26 (m, 2H), 6.36 (s, 1H), 4.31 (q, J=7.2 Hz, 2H), 1.27 (s,
9H), 1.26 (t, J=7.2 Hz, 3H).
[0490] Using General method C, ethyl
4-{3-t-butyl-5-[3-(2,3-dichlorophenyl)-ureido]-1H-pyrazol-1-yl}benzoate
(80 mg, 0.17 mmol) was reduced to afford
1-{3-t-butyl-1-[4-(hydroxymethyl)-phenyl]-1H-pyrazol-5-yl}-3-(2,3-dichlor-
ophenyl)urea (50 mg, 68% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.20 (brs, 1H), 8.77 (brs, 1H), 8.04 (m, 1H)
7.45 (br s, 4H), 7.30-7.25 (m, 2H), 6.36 (s, 1H), 4.55 (s, 2H),
1.27 (s, 9H). ##STR394##
[0491] Using the same procedure as for Example 2, Example 19 (100
mg, 0.21 mmol) in fresh THF (10 mL) was transformed to
1-{3-t-butyl-1-[4-(2-hydroxypropan-2-yl)phenyl]-1H-pyrazol-5-yl}-3-(2,3-d-
ichlorophenyl)urea (50 mg, 52% yield). .sup.1H NMR (300MHz,
DMSO-d.sub.6): .delta. 9.25 (brs, 1H), 8.79 (brs, 1H), 8.03 (m,
1H), 7.60 (d, J=8.4 Hz, 2H), 7.42 (d, J=8.4 Hz, 2H), 7.30-7.28 (m,
2H), 6.36 (s, 1H), 1.45 (s, 6H), 1.25 (s, 9H). ##STR395##
[0492] A mixture of 1-(3-nitrophenyl)ethanone (82.5 g, 0.5 mol),
p-TsOH (3 g) and sulfur (32 g, 1.0 mol) in morpholine (100 mL) was
heated at reflux for 3 h. After removal of the solvent, the residue
was dissolved in dioxane (100 mL). The mixture was treated with
conc. HCl (100 mL) and then heated at reflux for 5 h. After removal
of the solvent, the residue was extracted with EtOAc (3.times.150
mL). The combined organic extracts were washed with brine, dried
(Na.sub.2SO.sub.4), filtered, and concentrated. The residue was
dissolved in EtOH (250 mL) and SOCl.sub.2 (50 mL) and heated at
reflux for 2 h. After removal of the solvent, the residue was
extracted with EtOAc (3.times.150 mL). The combined organic
extracts were washed with brine, dried (Na.sub.2SO.sub.4),
filtered, concentrated and purified via column chromatography to
afford ethyl (3-nitrophenyl)acetate (40 g). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 8.17 (s, 1H,), 8.11 (d, J=7.2 Hz, 1H), 7.72
(d, J=7.2 Hz, 1H), 7.61 (t, J=7.8 Hz, 1H), 4.08 (q, J=7.2 Hz, 2H),
3.87 (s, 2H), 1.17 (t, J=7.2 Hz, 3H).
[0493] A mixture of ethyl (3-nitrophenyl)acetate (21 g, 0.1 mol)
and 10% Pd/C (2 g) in MeOH (300 mL) was stirred at RT under H.sub.2
40 (psi) for 2 h. The reaction mixture was filtered and the
filtrate was concentrated to afford ethyl (3-aminophenyl)acetate
(17 g). MS (ESI) m/z: 180 (M+H.sup.+).
[0494] To a suspension of (3-aminophenyl)acetic acid (17 g, 94
mmol) in conc. HCl (50 mL) was added dropwise a solution of
NaNO.sub.2 (6.8 g, 0.1 mol) in H.sub.2O at 0.degree. C. The mixture
was stirred for 1 h, after which a solution of SnCl.sub.2.2H.sub.2O
(45 g, 0.2 mol) in conc. HCl was added dropwise at such a rate that
the reaction mixture never rose above 5.degree. C. The resulted
mixture was stirred for 2 h. The precipitate was collected by
suction, and washed with Et.sub.2O to afford
ethyl(3-hydrazinophenyl)acetate (15 g). MS (ESI) m/z: 195
(M+H.sup.+).
[0495] A solution of ethyl (3-hydrazinophenyl)acetate (15 g, 65
mmol) and 4,4-dimethyl-3-oxopentanenitrile (12.5 g, 0.1 mol) in
EtOH (100 mL) containing conc. HCl (25 mL) was heated at reflux
overnight. After removal of the solvent, the residue was washed
with Et.sub.2O to afford ethyl
2-(3-(5-amino-3-t-butyl-1H-pyrazol-1-yl)phenyl)acetate (18 g). MS
(ESI) m/z: 302 (M+H.sup.+). ##STR396##
[0496] Using general method H, Example A5 (1.08 g, 3.18 mmol) was
transformed to ethyl
2-(3-(3-t-butyl-5-((prop-1-en-2-yloxy)carbonyl)-1H-pyrazol-1-yl)phenyl)ac-
etate (1.23 g, 100% yield). .sup.1H NMR (400 MHz, CDCl.sub.3):
.delta. 7.50-7.32 (m, 4H), 6.80-6.48 (brs, 1H), 4.81 (brs, 1H),
4.75 (s, 1H), 4.17 (q, J=7.1 Hz, 2H), 3.70 (s, 2H), 1.98 (brs, 3H),
1.36 (s, 9H), 1.29 (t, J=7.1 Hz, 3H); MS (ESI) m/z: 386.2
(M+H.sup.+). ##STR397##
[0497] To a solution of N-(3-amino-4-methylphenyl)acetamide (5 g,
25 mmol, commercially available) in DMF (5 mL) was added
2-chloro-4-(pyridin-3-yl)-pyrimidine (4 g, 35 mmol, commercially
available) and KI (0.5 g, 3 mmol). After stirring at 100.degree. C.
overnight, the reaction mixture was cooled to 10.degree. C.,
quenched with H.sub.2O, (100 mL), extracted with CH.sub.2Cl.sub.2
(2.times.100 mL) and the combined organic layers were dried
(Na.sub.2SO.sub.4) and concentrated. The residue was dissolved in
conc. HCl (10 mL), stirred at 80.degree. C. for 2 h, and then
concentrated to yield
6-methyl-N'-(4-(pyridin-3-yl)pyrimidin-2-yl)benzene-1,3-diamine
hydrochloride (4.5 g, 65% yield) as the HCl salt. .sup.1H NMR (300
MHz, CDCl.sub.3): .delta. 7.93-7.96 (m, 2H), 7.50-7.47 (m, 1H),
7.47-7.41 (m, 5H), 7.25-7.27 (m, 2H), 2.21(s, 3H); MS (ESI) m/e:
277 (M+H.sup.+). ##STR398##
[0498] Example A6 (150 mg, 0.39 mmol) and Example A7 (108 mg, 0.39
mmol) and N-methylpyrrolidine (8.9 mg, 0.10 mmol) in THF (0.4 mL)
were heated at 55.degree. C. for 24 h. The crude reaction mixture
was chromatographed on silica gel to provide ethyl
2-(3-(3-t-butyl-5-(3-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phe-
nyl)ureido)-1H-pyrazol-1-yl)phenyl)acetate (236 mg, 100% yield) as
a straw-colored solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
9.29 (d, J=1.6 Hz, 1H), 8.99 (s, 1H), 8.85 (s, 1H), 8.69 (dd,
J=4.7, and 1.6 Hz, 1H), 8.51-8.46 (m, 2H), 8.42 (s, 1H), 7.82 (d,
J=1.4 Hz, 1H), 7.54-7.40 (m, 5H), 7.31 (d, J=7.5 Hz, 1H), 7.12 (d,
J=7.5 Hz, 1H), 7.06 (dd, J=8.0, and 2.1 Hz, 1H), 6.40 (s, 1H), 4.07
(q, J=7.0 Hz, 2H), 3.76 (s, 2H), 2.19 (s, 3H), 1.27 (s, 9H), 1.18
(t, J=7.0 Hz, 3H); MS (ESI) m/z: 605.3 (M+H.sup.+).
[0499] To this material (97 mg, 0.16 mmol) was added 7N
N.sub.3/MeOH (1.0 mL, 7.0 mmol) and the resultant solution was
heated to 55.degree. C. overnight in a sealed vessel. The reaction
mixture was concentrated in vacuo and the residue dissolved in
boiling EtOAc. Upon cooling, crystallization ensued. The solid was
collected, pulverized, and suspended in THF (10 mL). 1N HCl (0.15
mmol) was added and the solution was stirred overnight and then
concentrated to dryness. Acetonitrile was added and the suspension
was concentrated to dryness again. To a suspension of the
pumpkin-orange colored solid in MeCN (10 mL) was added just enough
MeOH to affect dissolution. The resultant solution was then
concentrated to about 2 mL by distillation at atmospheric pressure.
The fine orange precipitate that formed was collected by
filtration, washed with MeCN and dried in vacuo to provide
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-methy-
l-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea as the
hydrochloride salt (30 mg, 32% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.44 (brs, 1H), 9.30 (brs, 1H), 9.11 (brs,
1H), 9.01 (m, 1H), 8.92 (m, 1H), 8.62 (m, 2H), 7.95 (m, 1H), 7.83
(s, 1H), 7.56 (m, 2H), 7.45-7.37 (m, 4H), 7.29 (d, J=7.8 Hz, 1H),
7.13 (d, J=7.6 Hz, 1H), 7.07 (d, J=7.3 Hz, 1H), 6.37 (s, 1H), 3.47
(s, 2H), 2.19 (s, 3H), 1.27 (s, 9H); MS (ESI) m/z:
576.2(M+H.sup.+). ##STR399##
[0500] Using the same method as for Example 21, ethyl
2-(3-(3-t-butyl-5-(3-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phe-
nyl)ureido)-1H-pyrazol-1-yl)phenyl)acetate (137 mg, 0.23 mmol) and
1-amino-2,3-dihydroxypropane (49 mg, 0.54 mmol) were combined to
yield
1-(3-t-butyl-1-(3-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)phenyl)-1H-pyr-
azol-5-yl)-3-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea
(81 mg, 69% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
9.29 (dd, J=2.2, and 0.8 Hz, 1H), 8.95 (s, 1H), 8.86 (s, 1H), 8.69
(dd, J=4.8, and 1.6 Hz, 1H), 8.51-8.47 (m, 2H), 8.38 (s, 1H), 8.10
(brt, J=5.8 Hz, 1H), 7.83 (d, J=1.6 Hz, 1H), 7.51 (ddd, J=8.4, 4.7,
and 0.8 Hz, 1H), 7.47-7.42 (m, 3H), 7.36 (m, 1H), 7.31 (brd, J=7.6
Hz, 1H), 7.11 (d, J=8.5 Hz, 1H), 7.05 (dd, J=8.5, and 2.1 Hz, 1H),
6.41 (s, 1H), 4.76 (d, J=4.8 Hz, 1H), 4.51 (t, J=5.8 Hz, 1H), 3.53
(s, 2H), 3.48 (m, 1H), 3.30-3.18 (m, 3H), 2.96 (m, 1H), 2.19 (s,
3H), 1.27 (s, 9H); MS (ESI) m/z: 650.3 (M+H.sup.+). ##STR400##
[0501] To a solution of Example A5 (6.0 g, 20 mmol) and formamide
(1.8 g, 40 mmol) in DMF (20 mL) was added NaOMe (2.1 g, 40 mmol) at
RT. The mixture was heated at reflux for 1 h, concentrated and the
residue was purified via column chromatography to afford
2-[3-(5-amino-3-t-butyl-1H-pyrazol-1-yl)phenyl]acetamide (2.0 g,
40% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 7.44-7.31
(m, 4H), 7.11 (m, 1H), 6.87 (brs, 1H), 5.33 (s, 1H), 5.12 (s, 2H),
3.38 (s, 2H), 1.17 (s, 9H); MS (ESI) m/z: 273 (M+H.sup.+).
##STR401##
[0502] To a solution of 3-hydroxypyridine (5.01 g, 52.7 mmol) in
DMSO (60 mL) was added NaH (1.39 g, 57.9 mmol, 2.31 g of 60%
suspended in oil) and stirred for 30 min at RT. To the slurry was
added 1-fluoro-3-nitrobenzene (9.66 g, 68.5 mmol) and mixture was
heated to 80.degree. C. for 72 h. The mixture was poured into satd
NH.sub.4Cl solution (200 mL), and extracted with EtOAc (3.times.125
mL). The combined organic extracts were washed with H2O (75 mL),
brine, dried (Na.sub.2SO.sub.4) and concentrated to yield a crude
residue which was purified by column chromatography afford (4.43 g,
39% yield) pure 3-(3-nitrophenoxy)pyridine as a syrup. .sup.1H NMR
(400 MHz, Acetone-d.sub.6): .delta. 8.49-8.47 (m, 2H), 8.07-8.05
(m, 1H), 7.85 (t, J=2.4 Hz, 1H), 7.74 (t, J=8.4 Hz, 1H), 7.58-7.53
(m, 2H), 7.51-7.47 (m, 1H); MS (ESI) m/z: 217.0 (M+H.sup.+).
[0503] To a solution of 3-(3-nitrophenoxy)pyridine (4.43 g, 20.5
mmol) in EtOAc (50 mL) was added PtO.sub.2 (0.4 g) and the mixture
was stirred at RT overnight under H.sub.2 (1 atm). The mixture was
filtered through Celite.RTM., the Celite.RTM. washed with EtOAc
(2.times.20 mL) and the combined filtrates concentrated to yield
(3.77 g, 99% yield) pure 3-(pyridin-3-yloxy)benzenamine as a syrup.
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.34-8.32 (m, 2H),
7.40-7.39 (m, 2H), 7.02 (t, J=8.0 Hz, 1H), 6.37-6.35 (m, 1H),
6.02-6.14 (m, 2H), 5.28 (brs, 2H); MS (ESI) m/z: 187.0 (M+H.sup.+).
##STR402##
[0504] To a solution of 3-nitrophenol (0.151 g, 0.733 mmol) in DMSO
(5 mL) was added NaH (35 mg of a 60% dispersion, 0.88 mmol) at
0.degree. C. under Ar atmosphere. After stirring for 30 min,
2-iodopyrazine (0.133 mg, 0.953 mmol) was added and mixture heated
to 85.degree. C. for 4 h. To the mixture was added satd. NH.sub.4Cl
solution (25 mL) and the product extracted with EtOAc (2.times.25
mL). The combined organic extracts were washed with brine, dried
(Na.sub.2SO.sub.4) and concentrated to yield a crude residue which
was purified by column chromatography to afford (97 mg, 61% yield)
2-(3-nitrophenoxy)pyrazine as a white solid. .sup.1H NMR (400 MHz,
CDCl.sub.3): .delta. 8.53 (brs, 1H), 8.38 (d, J=2.4 Hz, 1H),
8.16-8.09 (m, 3H), 7.63 (t, J=8.0 Hz, 1H), 7.57-7.54 (m, 1H); MS
(ESI) m/z: 218.0 (M+H.sup.+).
[0505] To a solution of 2-(3-nitrophenoxy)pyrazine (97 mg, 0.45
mmol) in EtOAc (10 mL) was added PtO.sub.2 (10 mg) and the mixture
was stirred for 4 h under H.sub.2 (1 atm). The mixture was filtered
through Celite.RTM. and the Celite.RTM. was washed with EtOAc
(2.times.5 mL). The combined filtrates were concentrated to yield
(78 mg, 93%) 3-(pyrazi-yloxy)benzenamine as a solid. .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 8.44 (d, J=1.6 Hz, 1H), 8.35 (d,
J=2.4 Hz, 1H), 8.23-8.22 (m, 1H), 7.04 (t, J=8.0 Hz, 1H), 6.43 (dd,
J=8.0 Hz, and 2.0 Hz, 1H), 6.31 (t, J=2.0 Hz, 1H), 6.26 (dd, J=8.0
Hz, 2.0 Hz, 1H), 5.27 (brs, 2H); MS (ESI) m/z: 188.1 (M+H.sup.+).
##STR403##
[0506] To a solution of 2-ethoxymethylenemalonic acid diethyl ester
(59.0 g, 273 mmol) in EtOH (300 mL) was added 2-methyl-isothiourea
(41.5 g, 150 mmol) in an ice-H.sub.2O bath. An EtOHic solution of
EtONa (2M, 300 mL) was added dropwise maintaining the reaction
temperature under 5.degree. C. The mixture was warmed to RT and
stirred for 3 h. After standing overnight, the solvent was removed
under reduced pressure and the residue was dissolved in H.sub.2O
(800 mL) at 0.degree. C. The solution was acidified to pH 3 with
conc. HCl and the precipitate collected by filtration and air-dried
to yield 4-hydroxy-2-methylsulfanyl-pyrimidine-5-carboxylic acid
ethyl ester as a white solid (50.8 g, 87.6% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 8.48 (s, 1H), 4.20 (q, J=9.6 Hz,
2H), 2.51 (s, 3H), 1.23 (t, J=9.6 Hz, 3H).
[0507] A mixture of
4-hydroxy-2-(methylsulfanyl)pyrimidine-5-carboxylic acid ethyl
ester (50 g, 0.234 mmol), POCl.sub.3 (110 mL, 1.17 mmol) and
diethylaniline (70 mL, 0.28 mmol) was refluxed for 5 h. The solvent
was removed under vacuum and the residue was dissolved in ice
H.sub.2O and cautiously neutralized with aqueous NaHCO.sub.3. After
extraction with EtOAc (3.times.400 mL), the organic extracts were
combined, dried and concentrated to give
4-chloro-2-(methylsulfanyl)pyrimidine-5-carboxylic acid ethyl ester
as a yellow solid (42 g, 77% yield). .sup.1H NMR (300 MHz,
CDCl.sub.3): .delta. 8.92 (s, 1H), 4.41 (q, J=7.2 Hz, 2H), 1.40 (t,
J=7.2 Hz, 3H).
[0508] To a solution of
4-chloro-2-(methylsulfanyl)pyrimidine-5-carboxylic acid ethyl ester
(42 g, 0.181 mol) in EtOH (400 mL) was added MeNH.sub.2 (12.3 g,
0.398 mmol) in EtOH (100 mL) at 0.degree. C. and the mixture
stirred for 3 h. The mixture was concentrated to remove most of the
solvent and then partitioned between H.sub.2O (200 mL) and
CH.sub.2Cl.sub.2 (500 mL). The organic layer was washed with brine,
dried and concentrated to give
4-(methylamino)-2-(methylsulfanyl)pyrimidine-5-carboxylic acid
ethyl ester as a white solid (36.0 g, 88% yield). .sup.1H NMR (300
MHz, CDCl.sub.3): .delta. 8.59 (s, 1H), 8.18 (brs, 1H), 4.31 (q,
J=7.2 Hz, 2H), 3.05 (d, J=4.8 Hz, 3H), 2.52 (s, 3H), 1.34 (t, J=7.2
Hz, 3H).
[0509] To a solution of
4-(methylamino)-2-(methylsulfanyl)pyrimidine-5-carboxylic acid
ethyl ester (30 g, 132 mmol) in THF (300 mL) was added LiAlH.sub.4
powder (7.5 g, 198 mmol) at RT. After 1 h, the reaction was
carefully quenched with H.sub.2O (10 mL) and 10% NaOH (7 mL). The
mixture was stirred for 1 h and then filtered. The filtrate was
concentrated to give crude
(4-(methylamino)-2-(methylthio)pyrimidin-5-yl)methanol (22.0 g, 90%
yield), which was used in the next reaction without further
purification. .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 7.79 (s,
1H), 6.79 (m, 1H), 5.04 (t, J=5.4 Hz, 1H), 4.27 (d, J=5.4 Hz, 2H),
2.83 (d, J=4.8 Hz, 3H), 2.40 (s, 3H).
[0510] A mixture of
(4-(methylamino)-2-(methylthio)pyrimidin-5-yl)methanol (22.0 g, 119
mmol) and MnO.sub.2 (44 g, 714 mmol) in CHCl.sub.3 (300 mL) was
stirred at RT for 3 h. The reaction was filtered and the filtrate
concentrated to give
4-(methylamino)-2-(methylsulfanyl)pyrimidine-5-carbaldehyde as a
pale solid (20 g, 92% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.71 (s, 1H), 8.60 (brs, 1H), 8.49 (s, 1H), 2.96 (d, J=4.8
Hz, 3H), 2.48 (s, 3H).
[0511] To a solution of
4-(methylamino)-2-(methylsulfanyl)pyrimidine-5-carbaldehyde (10.0
g, 55 mmol) and (3-nitrophenyl)acetonitrile (10.5 g, 65 mmol) in
DMF (150 mL) was added K.sub.2CO.sub.3 (38 g, 275 mmol) at RT. The
mixture was stirred at 100.degree. C. for 18 h. After cooling, the
reaction was diluted with DMF (50 mL) and filtered. The filtrate
was concentrated to give crude
8-methyl-2-(methylsulfanyl)-6-(3-nitrophenyl)-8H-pyrido[2,3-d]pyrimidin-7-
-ylideneamine (9.0 g, 50% yield) which was used in the next
reaction without further purification.
[0512] A solution of
8-methyl-2-(methylsulfanyl)-6-(3-nitrophenyl)-8H-pyrido[2,3-d]pyrimidin-7-
-ylideneamine (9.0 g, crude product) in Ac.sub.2O (100 mL) was
refluxed for 20 min. The mixture was concentrated to give a brown
solid. The solid was then dissolved in conc. HCl (50 mL) and heated
for 30 min. The reaction mixture was cooled and filtered to give a
brown solid, which was purified by reverse phase chromatography to
give
8-methyl-(2-methylsulfanyl)-6-(3-nitrophenyl)-8H-pyrido[2,3-d]pyrimidin-7-
-one as a white solid (1.1 g, 21% yield, two steps). .sup.1H NMR
(300 MHz, DMSO-d.sub.6): .delta. 8.95 (s, 1H), 8.60 (m, 1H), 8.34
(s, 1H), 8.25 (d, J=5.4 Hz, 1H), 8.16 (d, J=5.1 Hz, 1H), 7.75 (t,
J=5.4 Hz, 1H), 3.68 (t, J=5.4 Hz, 3H), 2.62 (s, 3H).
[0513] To a solution of
8-methyl-2-(methylsulfanyl)-6-(3-nitrophenyl)-8H-pyrido[2,3-d]pyrimidin-7-
-one (1.0 g, 3 mmol) in EtOH (10 mL) was added Raney.RTM. nickel (5
g) and the mixture refluxed for 3 h. After cooling, the reaction
was filtered and the filtrate concentrated to give
8-methyl-6-(3-nitrophenyl)-8H-pyrido[2,3-d]pyrimidin-7-one (0.35 g,
41% yield), which was used in the next reaction without further
purification.
[0514] To a solution of
8-methyl-6-(3-nitrophenyl)-8H-pyrido[2,3-d]pyrimidin-7-one (0.35 g,
1.2 mmol) in EtOH (10 mL) was added Pd (0.2 g). The mixture was
stirred under an atmosphere of H.sub.2 (30 psi) for 1.5 h. After
removal of the catalyst by filtration, the solvent was evaporated
under vacuum to give
6-(3-aminophenyl)-8-methyl-8H-pyrido[2,3-d]pyrimidin-7-one (150 mg,
50% yield) as a white solid. .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 9.08 (d, J=4.2 Hz, 1H), 8.18 (s, 1H), 7.85 (m, 1H), 7.80
(d, J=5.4 Hz, 1H), 7.64 (t, J=7.8 Hz, 1H), 7.43 (d, J=5.4 Hz, 1H),
3.85 (s, 3H). ##STR404## To stirred anhydrous DMF (25 mL) was
slowly added SOCl.sub.2 (125mL) at such a rate that the reaction
temperature was maintained at 40-50.degree. C.
Pyridine-2-carboxylic acid (25 g, 0.2 mol) was added in portions
over 30 min and the resulting mixture was heated at reflux for 16 h
during which time a yellow solid precipitated. After cooling to RT,
the mixture was diluted with toluene (80 mL) and concentrated. This
process was repeated three times. The resulting dry residue was
washed with toluene and dried under reduced pressure to yield
4-chloro-pyridine-2-carbonyl chloride (27.6 g, 79%), which was used
in the next step without purification.
[0515] To a solution of 4-chloro-pyridine-2-carbonyl chloride (27.6
g, 0.16 mol) in anhydrous THF (100 mL) at 0.degree. C. was added
dropwise a solution of MeNH.sub.2 in EtOH. The resulting mixture
was stirred at 3.degree. C. for 4 h. The reaction mixture was
concentrated under reduced pressure to yield a solid, which was
suspended in EtOAc and filtered. The filtrate was washed with brine
(2.times.100 mL), dried and concentrated to yield
4-chloro-N-methylpicolinamide as a yellow solid (16.4 g, 60%
yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 8.78 (d, J=7.2
Hz, 1H), 8.54 (d, J=7.2 Hz, 1H), 7.95 (s, 1H), 7.67-7.65 (m, 1H),
2.79 (d, J=4.8 Hz, 3H); MS (ESI) m/z: 171 (M+H.sup.+).
[0516] A solution of 4-aminophenol (9.6 g, 88 mmol) in anhydrous
DMF (100 mL) was treated with NaH (5.28 g of a 60% dispersion, 132
mmol), and the reddish-brown mixture was stirred at RT for 2 h. The
contents were treated with 4-chloro-N-methylpicolinamide (15 g, 88
mmol) and K.sub.2CO.sub.3 (6.5 g, 44 mmol) and heated at 80.degree.
C. for 8 h. The mixture was cooled to RT and partitioned between
EtOAc and brine. The aqueous phase was extracted with EtOAc. The
combined organic layers were washed with brine (2.times.50 mL),
dried (Na.sub.2SO.sub.4) and concentrated to afford
4-(4-amino-phenoxy)pyridine-2-carboxylic acid methylamide (15 g,
71% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 8.71 (d,
J=1.8 Hz, 1H), 8.43 (d, J=5.7 Hz, 1H), 7.32 (d, J=2.7 Hz, 1H),
7.06-7.03 (m, 1H), 6.76 (dd, J=8.7 Hz, 4H), 5.15 (s, 2H), 2.76 (d,
J=4.8 Hz, 3H); MS (ESI) m/z: 244 (M+H.sup.+). ##STR405##
[0517] A solution of 5-chloro-3-hydroxypyridine (0.45 g, 3.5 mmol)
and NaH (0.15 g of 60% dispersion, 3.83 mmol) in DMSO (10 mL) was
stirred at RT for 30 min and then treated with
1-fluoro-3-nitrobenzene (0.69 g, 4.9 mmol). The mixture was heated
at 120.degree. C. for 24 h, cooled to RT, quenched with satd.
NH.sub.4Cl (50 mL), and extracted with EtOAc (3.times.25 mL). The
combined organic extracts were washed with brine, dried
(Na.sub.2SO.sub.4) and concentrated to yield a crude residue which
was purified via column chromatography using to yield
3-chloro-5-(3-nitrophenoxy)pyridine (0.2 g, 23% yield) as a yellow
solid. .sup.1H NMR (400 MHz, CDCl.sub.3): .quadrature. 8.46 (d,
J=2.0 Hz, 1H), 8.35 (d, J=2.0 Hz, 1H), 8.09 (dd, J=8.4 Hz, 2.0 Hz,
1H), 7.89 (t, J=2.0 Hz, 1H), 7.60 (t, J=8.0 Hz, 1H), 7.41-7.39 (m,
2H); MS (ESI) m/z: 251.0 (M+H.sup.+).
[0518] To a solution of 3-chloro-5-(3-nitrophenoxy)pyridine (0.2 g,
0.8 mmol) in EtOAc (10 mL) was added PtO.sub.2 (0.02 g) and the
mixture was stirred for 4 h under H.sub.2 (1 atm). It was then
filtered through a Celite.RTM. pad and washed with EtOAc (2.times.5
mL). The combined organic extracts were concentrated to afford
3-(5-chloropyridin-3-yloxy)benzenamine (0.165 g, 93% yield) which
was used without further purification. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.39 (d, J=2.0 Hz, 1H), 8.31 (d, J=2.8 Hz,
1H), 7.54-7.53 (m, 1H), 7.05 (t, J=8.0 Hz, 1H), 6.42-6.39 (m, 1H),
6.25-6.19 (m, 2H), 5.33 (brs, 2H); MS (ESI) m/z: 221.0 (M+H.sup.+).
##STR406##
[0519] Using general method A, Example A10 (2.0 g, 6.6 mmol) and
1,2-dichloro-3-isocyanato-benzene (1.1 g, 7.5 mmol) were combined
to afford ethyl
2-(3-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)phenyl)a-
cetate (2.2 g, 68% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 9.22 (s, 1H), 8.75 (s, 1H), 8.05 (m, 1H), 7.46-7.21 (m,
6H), 6.35 (s, 1H), 4.04 (q, J=7.2 Hz, 2H,), 3.72 (s, 2H), 1.24 (s,
9H), 1.16 (t, J=7.2 Hz, 3H); MS (ESI) m/z: 489 (M+H.sup.+).
##STR407##
[0520] Using general method C, Example 23 (100 mg, 0.21 mmol) was
reduced to yield
1-{3-t-butyl-1-[3-(2-hydroxyethyl)phenyl]-1H-pyrazol-5-yl}-3-(2,-
3-dichlorophenyl)urea (60 mg, 64% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.18 (s, 1H), 8.74 (s, 1H), 8.02 (m, 1H),
7.42-7.22 (m, 4H), 6.35 (s, 1H), 3.61 (t, J=7.2 Hz, 2H), 2.76 (t,
J=6.9 Hz, 2H), 1.24 (s, 9H); MS (ESI) m/z: 447 (M+H.sup.+).
General Experimental for Examples 25-29:
[0521] A solution of Example A8 and the appropriate amine were
converted to the target compound using the general method
indicated. TABLE-US-00003 MS (EI) .sup.1H NMR (300 MHz/400 MHz,
Example Name (M + H.sup.+) DMSO-d.sub.6) ##STR408##
1-{1-[3-(2-amino-2- oxoethyl)phenyl]-3-t- butyl-1H-pyrazol-5-
yl}-3-(2,3- dichlorophenyl)urea 60 mg, 26% yield General method B
459 .delta. 9.23 (s, 1H), 8.75 (s, 1H), 8.04 (m, 1H), 7.50 (brs,
1H), 7.45-7.25 (m, 7H), 6.90 (brs, 1H), 6.36 (s, 1H), 3.42 (s, 2H),
1.24 (s, 9H) ##STR409## 1-(1-(3-(2-amino-2- oxoethyl)phenyl)-3-t-
butyl-1H-pyrazol-5- yl)-3-(3-(pyridin-3- yloxy)phenyl)urea 49 mg,
46% yield General method D 485.2 .delta. 9.14 (s, 1H), 8.40-8.37
(m, 3H), 7.52 (brs, 1H), 7.46-7.40 (m, 4H), 7.36-7.25 (m, 4H), 7.09
(dt, J=7.2 Hz, 1.2 Hz, 1H), 6.93 (brs, 1H), 6.69-6.66 (m, 1H), 6.34
(s, 1H), 3.45 (s, 2H), 1.27 (s, 9H) ##STR410## 1-(1-(3-(2-amino-2-
oxoethyl)phenyl)-3-t- butyl-1H-pyrazol-5- yl)-3-(3-(pyrazin-2-
yloxy)phenyl)urea 58 mg, 46% yield General method D 486.2 .delta.
9.35 (s, 1H), 8.57 (s, 1H), 8.53 (d, J=1.2 Hz, 1H), 8.38 (d, J=2.8
Hz, 1H), 8.22 (dd, J=2.8 Hz, 1.6 Hz, 1H), 7.54 (brs, 1H), 7.46-7.29
(m, 6H), 7.15 (dt, J=8.4 Hz, 0.8 Hz, 1H), 6.93 (brs, 1H), 6.80 (dd,
J=8.0 Hz, 1.6 Hz, 1H), 6.35 (s,1H), 3.46 (s, # 2H), 1.27 (s, 9H)
##STR411## 1-(1-(3-(2-amino-2- oxoethyl)phenyl)-3-t-
butyl-1H-pyrazol-5- yl)-3-(3-(8-methyl-7- oxo-7,8-
dihydropyrido[2,3- d]pyrimidin-6- yl)phenyl)urea 56 mg, 45% yield
General method D 551.2 .delta. 9.40 (s, 1H), 9.17 (s, 1H), 9.13 (s,
1H), 8.62 (s, 1H), 8.17 (s, 1H), 7.83 (t,J=1.6 Hz, 1H), 7.57 (brs,
1H), 7.47-7.28 (m, 7H), 6.94 (s, 1H), 6.39 (s, 1H), 3.71 (s, 3H),
3.48 (s, 2H), 1.28 (s, 9H) ##STR412## 1-(1-(3-(2-amino-2-
oxoethyl)phenyl)-3-t- butyl-1H-pyrazol-5- yl)-3-(4-(2-
(methylcarbainoyl)pyridin-4- yloxy)phenyl)urea 60 mg, 40% yield
General method D 542.3 .delta. 9.32 (s, 1H), 8.82 (d, J=3.6 Hz,
1H), 8.57 (s, 1H), 8.51 (d, J=5.6 Hz, 1H), 7.56-7.38 (m, 6H), 7.31
(d, J=7.6 Hz, 1H), 7.16-7.13 (m, 3H), 6.94 (s, 1H), 6.38 (s, 1H),
3.48 (s, 2H), 2.79 (d, J=4.8 Hz, 3H), 1.29 (s, 9H)
[0522] ##STR413##
[0523] To a mixture of (3-aminophenyl)acetic acid ethyl ester (15
g, 84 mmol) in conc. HCl (20 mL) was added sodium nitrite (6 g, 87
mmol) aqueous solution dropwise under ice-salt bath. The resulting
mixture was stirred at 0.degree. C. for 30 min and then added a
solution of SnCl.sub.22H.sub.2O (38 g, 168 mmol) in conc. HCl
dropwise also at such a rate that the reaction mixture never rose
above 5.degree. C. After the addition was completed, the mixture
was stirred for another 2 h at room temperature. The precipitate
was collected by suction and washed with ethyl ether to afford
(3-Hydrazinophenyl)acetic acid ethyl ester hydrochloride (17 g,
88%) as a brown solid. MS (ESI) m/z: 195 (M+H.sup.+). A solution of
(3-hydrazinophenyl)acetic acid ethyl ester hydrochloride (17 g, 74
mmol) and 3-cyclopentyl-3-oxopropionitrile (12.2 g, 88.8 mol) in
alcohol (150 mL) containing conc. HCl (10 mL) was heated to reflux
overnight. After removed of the solvent, the precipitate was
collected by suction and washed with ethyl ether to afford the
crude product, which was purified by column chromatography to
afford [3-(5-amino-3-cyclopentylpyrazol-1-yl)phenyl]acetic acid
ethyl ester hydrochloride (8.8 g, 34% yield) as a yellow solid.
.sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 7.40-7.66 (m, 4H),
5.68 (s, 1H), 4.05 (q, J=7.2 Hz, 2H), 3.75 (s, 2H), 3.00-3.08 (m,
1H), 1.98-2.00 (m, 2H), 1.58-1.70 (m, 6H), 1.17 (t, J=7.2 Hz, 3H);
MS (ESI) m/z: 314 (M+H.sup.+). ##STR414##
[0524] A mixture of Example A14 (0.600 g, 1.7 mmol, 1.0) and 7N
N.sub.3 in MeOH (9.8 ml, 69 mmol, 40 eq) was heated in a sealed
screw-cap vial at 60.degree. C. for 36 h. More 7N N.sub.3 in MeOH
(9.8 ml, 69 mmol, 40 eq) was added and the reaction heated at
60.degree. C. 24 h. The solution was concentrated to a purple
residue of
2-(3-(5-amino-3-cyclopentyl-1H-pyrazol-1-yl)phenyl)acetamide. MS
(ESI) m/z: 285.2 (M+H.sup.+). ##STR415##
[0525] Using general method D, Example A15 (0.1000 g, 0.218 mmol,
1.00 eq) and 4-(4-aminophenyl)isoindolin-1-one (0.0488 g, 0.218
mmol, made according to literature procedures) were combined to
yield
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(4-(-
1-oxoisoindolin-4-yl)phenyl)urea (51.7 mg, 44.5% yield). .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .delta. 9.17 (s, 1H), 8.67 (s, 1H),
8.50 (s, 1H), 7.66-7.62 (m, 2H), 7.59-7.52 (m, 6H), 7.48-7.44 (m,
2H), 7.40-7.37 (m, 1H), 7.32-7.30 (m, 1H), 6.94 (brs, 1H), 6.34 (s,
1H), 5.50 (s, 2H), 3.47 (s, 2H), 3.06-2.98 (m, 1H), 2.03-1.94 (m,
2H), 1.76-1.59 (m, 6H); MS (ESI) m/z: 535.2 (M+H.sup.+).
##STR416##
[0526] Using general method D, Example A15 (0.0805 g, 0.175 mmol,
1.00 eq) and Example A11 (0.0442 g, 0.175 mmol) were combined to
yield
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-cyclopentyl-1H-pyrazol-5-yl)-3-(3-(-
8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(18.3 mg, 19% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
9.16 (s, 1H), 9.15 (s, 1H), 9.11 (s, 1H), 8.44 (s, 1H), 8.17 (s,
1H), 7.83-7.82 (m, 1H), 7.53 (brs, 1H), 7.48-7.44 (m, 3H),
7.39-7.35 (m, 2H), 7.32-7.29 (m, 2H), 6.93 (brs, 1H), 6.34 (s, 1H),
3.71 (s, 3H), 3.46 (s, 2H), 3.05-2.97 (m, 1H), 2.02-1.94 (m, 2H),
1.74-1.59 (m, 6H); MS (ESI) m/z: 563.3 (M+H.sup.+). ##STR417##
[0527] To a suspension of NaH (6.0 g of a 60% dispersion, 0.15 mol)
in THF (100 ml) was added dropwise trifluoroacetic acid ethyl ester
(14.2 g, 0.1 mol) and anhydrous MeCN (50 g, 0.12 mol) in THF (100
ml). The resulting mixture was refluxed overnight, and then cooled
to RT. After removal of the volatiles in vacuo, the residue was
diluted in EtOAc and aqueous 10% HCl. The organic layer was washed
with H.sub.2O and brine, dried (MgSO.sub.4), filtered and
concentrated to yield 15 g of crude
4,4,4-trifluoro-3-oxo-butyronitrile which was used for the next
step reaction without further purification.
[0528] A mixture of ethyl (3-hydrazinophenyl)acetate (8.77 g, 0.028
mol, available from Example A5) and
4,4,4-trifluoro-3-oxo-butyronitrile (5.75 g, 0.042 mol) in EtOH
(200 mL) was heated at reflux overnight. The mixture was
concentrated and the residue purified by column chromatography to
yield ethyl
2-(3-(5-amino-3-(trifluoromethyl)-1H-pyrazol-1-yl)phenyl)acetate (5
g, 57% yield) as a yellow oil. .sup.1H NMR (300 MHz, DMSO-d.sub.6):
7.50-7.43 (m, 3H), 7.30-7.33 (m, 1H), 5.81 (s, 1H), 5.75 (s, 2H),
4.09 (q, J=7.2 Hz, 1H), 3.76 (s, 2H), 3.38 (s, 2H), 1.18 (t, J=7.2
Hz, 3H); MS (ESI) m/z: 314 (M+H.sup.+).
[0529] A solution of ethyl
2-(3-(5-amino-3-(trifluoromethyl)-1H-pyrazol-1-yl)phenyl)acetate (3
g, 9.58 mmol) in conc. NH.sub.4OH (40 mL) was heated at reflux for
2 h. After removal of the solvent, the residue was purified by
column chromatography to afford
2-(3-(5-amino-3-(trifluoromethyl)-1H-pyrazol-1-yl)phenyl)acetamide
(1.8 mg, 66% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): 7.48-7.42
(m, 4H), 7.30 (s, 1H), 6.91 (s, 1H), 5.77 (s, 1H), 5.73-5.72 (m,
2H), 4.44 (s, 2H). MS (ESI) m/z: 285 (M+H.sup.+).
[0530] To a solution of phosgene (0.5 mL of 20% w/v solution in
toluene) in MeCN (1 mL) was added over a period of 10 min a mixture
of Example A9 (0.054 g, 0.29 mmol) and triethylamine (0.076 g, 0.76
mmol) in MeCN (1 mL) at 0.degree. C. under Ar. After stirring for
30 min at RT, a solution of
2-(3-(5-amino-3-(trifluoromethyl)-1H-pyrazol-1-yl)phenyl)acetamide
(0.07 g, 0.24 mmol) and Et.sub.3N (0.06 g, 0.66 mmol) was added and
the resulting mixture stirred at RT for 16 h. The mixture was
concentrated, purified via column chromatography, stirred in
HCl/EtOAc and the solid collected by filtration to yield
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-(trifluoromethyl)-1H-pyrazol-5-yl)--
3-(3-(pyridin-3-yloxy)phenyl)urea (0.041 g, 32% yield) as a white
solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.68 (s, 1H),
9.02 (s, 1H), 8.62 (s, 1H), 8.54 (d, J=4.8 Hz, 1H), 7.86-7.84 (m,
1H), 7.76 (dd, J=8.4 Hz, 4.8 Hz, 1H), 7.57-7.34 (m, 7H), 7.16 (dd,
J=8.4 Hz, 1.6 Hz, 1H), 6.96 (s, 1H), 6.85 (s, 1H), 6.78 (dd, J=8.4
Hz, 2.0 Hz, 1H), 3.50 (s, 2H); MS (ESI) m/z: 497.0 (M+H.sup.+).
##STR418##
[0531] A solution of 2-(3-iodophenyl)acetic acid (1.05 g, 4.0 mmol,
commercially available) in EtOH (12 mL) was treated with 2 drops of
concentrated sulfuric acid. The resultant solution was heated at
reflux for 90 min, cooled to RT and poured into hexanes (50 mL) and
EtOAc (50 mL). The organics were with saturated Na.sub.2CO.sub.3
(2.times.50 mL), H.sub.2O (50 mL), brine (50 mL), dried
(MgSO.sub.4) and concentrated to yield ethyl
2-(3-iodophenyl)acetate (1.11 g, 95% yield). MS (ESI) m/z: 291.0
(M+H.sup.+).
[0532] Ethyl 2-(3-iodophenyl)acetate (0.500 g, 1.72 mmol),
4-bromo-3-nitrobenzotrifluoride (1.86 g, 6.89 mmol commercially
available), tetrabutylammonium chloride (0.527 g, 1.90 mmol),
i-Pr.sub.2NEt (0.33 mL, 1.90 mmol) and Pd(OAc).sub.2 (0.039 g, 0.17
mmol) were combined neat in a sealed vial and heated at 130.degree.
C. for 65 h. The cooled reaction mixture was applied directly to
silica gel and eluted with 25% EtOAc/hexanes to provide
2'-nitro-4'-(trifluoromethyl)-[1,1'-biphenyl]-3-acetic acid ethyl
ester (0.107 g, 17% yield). MS (ESI) m/z: 354.0(M+H.sup.+).
[0533] 2'-Nitro-4'-(trifluoromethyl)-[1,1'-biphenyl]-3-acetic acid
ethyl ester (107 mg, 0.30 mmol) in THF (6 mL) was treated with
about 150 mg of Raney nickel (50 wt % in H.sub.2O). The reaction
was shaken on a Parr apparatus under 50 psi of H.sub.2. After 4.5
h, another 200 mg of Raney.RTM. nickel was added and the reaction
was shaken an additional 2 h under 50 psi H.sub.2. The reaction
mixture was filtered through Celite.RTM., concentrated in vacuo and
purified via column chromatography to afford
2'-amino-4'-(trifluoromethyl)-[1,1'-biphenyl]-3-acetic acid ethyl
ester (58 mg, 59% yield). MS (ESI) m/z: 324.2 (M+H.sup.+).
[0534] 2'-Amino-4'-(trifluoromethyl)-[1,1'-biphenyl]-3-acetic acid
ethyl ester (45 mg, 0.14 mmol), Example A37 (44 mg, 0.14 mmol) and
N-methylpyrrolidine (1 drop) were combined in THF (0.25 mL) in a
screw-cap vial. The vial was sealed and the reaction mixture was
heated at 55.degree. C. for 65 h. The crude reaction was purified
via column chromatography to yield
[1,1'-biphenyl]-2'-(3-(4-(1-oxoisoindolin-4-yl)phenyl)-ureido)-4'-(triflu-
oromethyl)-3-acetic acid ethyl ester (65 mg, 81% yield). MS (ESI)
m/z: 574.0 (M+H.sup.+).
[0535] A solution of
[1,1'-biphenyl]-2'-(3-(4-(1-oxoisoindolin-4-yl)phenyl)-ureido)-4'-(triflu-
oromethyl)-3-acetic acid ethyl ester (63 mg, 0.11 mmol) in THF (2
mL) and H.sub.2O (2 mL) was treated with LiOH.H.sub.2O (23 mg, 0.55
mmol). After 3 h, 1N HCl (0.6 mL, 0.6 mmol) was added and the
reaction mixture was diluted with EtOAc (30 mL). The organic layer
was washed with H.sub.2O (2.times.10 mL), brine (10 mL), dried
(Na.sub.2SO.sub.4) and concentrated to yield
[1,1'-biphenyl]-2'-(3-(4-(1-oxoisoindolin-4-yl)phenyl)ureido)-4'-
-(trifluoromethyl)-3-acetic acid (62 mg, 100% yield). MS (ESI) m/z:
546.0 (M+H.sup.+).
[0536]
[1,1'-Biphenyl]-2'-(3-(4-(1-oxoisoindolin-4-yl)phenyl)-ureido)-4'--
(trifluoromethyl)-3-acetic acid (62 mg, 0.11 mmol) was combined
with HOBT (20 mg, 0.15 mmol) and 0.5M in dioxane NH.sub.3 (1.0 mL,
0.5 mmol) in DMF (2 mL). EDC (64 mg, 0.23 mmol) was added and the
reaction mixture was stirred at RT for 7 h. The reaction was
partitioned between H.sub.2O (10 mL) and EtOAc (30 mL). The organic
was washed with 1N HCl (2.times.5 mL), saturated Na.sub.2CO.sub.3
(10 mL), brine (10 mL), concentrated and purified by reverse phase
chromatography to yield
[1,1'-biphenyl]-2'-(3-(4-(1-oxoisoindolin-4-yl)phenyl)ureido)-4'-(trifluo-
romethyl)-3-acetic acid amide (36 mg, 60% yield) as a white powder.
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.35 (s, 1H), 8.66 (s,
1H), 8.50 (s, 1H), 7.99 (s, 1H), 7.65 (m, 2H), 7.60-7.38 (m, 11H),
7.35 (dt, J=7.5, 1.3 Hz, 1H), 6.96 (brd, J=1.5 Hz, 1H), 4.50 (s,
2H), 3.49 (s, 2H); MS (ESI) m/z: 545.3 (M+H.sup.+). ##STR419##
[0537] Using General method E, Example 23 (80 mg, 0.17 mmol) was
saponified to afford
3-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]-1H-pyrazol-1-yl}benzoic
acid (60 mg, 79% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 9.46 (brs, 1H), 8.82 (brs, 1H), 8.05 (brs, 1H), 7.98 (t,
J=4.8 Hz, 1H), 7.92 (d, J=7.8 Hz, 1H), 7.80 (d, J=8.7 Hz, 1H), 7.63
(t, J=7.8 Hz, 1H), 7.27 (d, J=4.5 Hz, 2H), 6.37 (s, 1H), 1.26 (s,
9H). ##STR420##
[0538] To a stirred solution of Example 34 (0.150 g, 0.325 mmol,
1.0 eq), (3S)-(-)-3-(dimethylamino)pyrrolidine (0.0446 g, 0.390
mmol, 1.2 eq) and TBTU (0.125 g, 0.390 mmol, 1.2 eq) in DMF (3 mL)
was added I-PR2NET (0.173 ml, 0.975 mmol, 3.0 eq). The resulting
solution was stirred at RT. Upon completion, the reaction was
quenched with 3N HCl (pH 1-2) and extracted with EtOAc (1.times.).
This extract was set aside. The aqueous was basified (pH 9-10) with
satd. Na.sub.2CO.sub.3 and extracted with EtOAc (3.times.). The
combined organics were washed with brine (2.times.) and dried
(Na.sub.2SO.sub.4). Filtration and evaporation provided crude
product as a glass which was purified by reverse phase
chromatography to afford of pure
1-(3-t-butyl-1-(3-(2-((S)-3-(dimethylamino)pyrrolidin-1-yl)-2-oxoethyl)ph-
enyl)-1H-pyrazol-5-yl)-3-(2,3-dichloro-phenyl)urea (0.132 g, 73%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6; rotamers): .delta. 9.41
and 9.39 (s, 1H), 8.88 and 8.87 (s, 1H), 8.08-8.05 (m, 1H),
7.50-7.39 (m, 4H), 7.34-7.27 (m, 4H), 6.38 (s, 1H), 3.02-3.75 (m,
4H), 3.59-3.48 (m, 2H), 2.81-2.75 (m, 6H), 2.33-2.07 (m, 2H), 1.28
(s, 9H); MS (ESI) m/z: 557.3 (M+H.sup.+), 559.2 (M+2H.sup.+).
##STR421##
[0539] To a stirred solution of Example 34 (130 mg, 0.282 mmol), in
DMF (3 mL) was added HOBT (48 mg, 0.310 mmol) and EDC (68 mg, 0.352
mmol). The mixture was stirred for 15 min and then treated with
(S)-3-aminopropane-1,2-diol (32 mg, 0.352 mmol), stirred at RT
overnight, and then diluted with H.sub.2O (20 mL). The aqueous
layer was extracted with EtOAc (20 mL), and the combined organics
washed with 5% citric acid (20 mL), saturated NaHCO.sub.3 (20 mL),
brine (20 mL), dried (Na.sub.2SO.sub.4), concentrated, and purified
by column chromatography to yield
1-(3-t-butyl-1-(3-(2-((S)-2,3-dihydroxypropylamino)-2-oxoethyl)p-
henyl)-1H-pyrazol-5-yl)-3-(2,3-dichloro-phenyl)urea (90 mg, 60%
yield). .sup.1H-NMR (400 MHz, DMSO-d.sub.6): .delta. 1.28 (s, 9H),
2.93-2.96 (m, 1H), 3.19-3.47 (m, 4H), 3.53 (s, 2H), 4.51 (brs, 1H),
4.76 (brs, 1H), 6.39 (s, 1H), 7.29-7.45 (m, 6H), 8.07-8.10 (m, 2H),
8.79 (s, 1H), 9.26 (s, 1H); MS (ESI) m/z: 536.0 (M+H.sup.+).
##STR422##
[0540] Using the same procedure as for Example 36, Example 34 (100
mg, 0.20 mmol) and 2-aminoEtOH (2 mL) were combined to afford
1-(3-t-butyl-{1-[3-(2-hydroxyethylamino)-2-oxo-thyl]-phenyl}-1H-pyrazol-5-
-yl)-3-(2,3-dichlorophenyl)-urea (70 mg, 69% yield). .sup.1H NMR
(300 MHz, DMSO-d.sub.6): .delta. 9.22 (s, 1H), 8.74 (s, 1H),
8.08-8.03 (m, 2H), 7.38-7.24 (m, 6H), 6.34 (s, 1H), 3.45 (s, 2H),
3.30 (t, J=6.0 Hz, 2H), 3.04 (t, J=6.0 Hz, 2H), 1.22 (s, 9H); MS
(ESI) m/z: 504 (M+H.sup.+). ##STR423##
[0541] To a solution of N-(3-amino-4-methyl-phenyl)acetamide (5 g,
25 mmol) in DMF (5 mL) was added 2-chloropyrimidine (3.8 g, 33
mmol) and KI (0.5 g). The reaction was stirred at 100.degree. C.
overnight, cooled to 10.degree. C. and added to H.sub.2O (100 mL).
The resulting mixture was extracted with CH.sub.2Cl.sub.2
(2.times.100 mL). The combined organic layers were dried
(Na.sub.2SO.sub.4) and concentrated under vacuum. The residue was
dissolved in conc. HCl (10 mL), stirred at 80.degree. C. for 2 h
and concentrated under vacuum to yield
6-methyl-N.sup.1-(pyrimidin-2-yl)benzene-1,3-diamine hydrochloride
(3.75 g, 75% yield). .sup.1H NMR (400 MHz, CDCl.sub.3): 8.36 (dd,
J=15.2, 4.8 Hz, 2H), 7.46 (d, J=2.4 Hz, 1H), 6.97 (d, J=8.0 Hz,
1H), 7.26 (s, 1H), 6.67 (t, J=4.8 Hz, 1H), 6.39 (dd, J=8.0, 2.4,
Hz, 1H), 2.20 (s, 3H); MS (ESI) m/e: 201 (M+H.sup.+).
##STR424##
[0542] Using the same procedure as for Example 22, Example A6 (145
mg, 0.38 mmol) and Example A16 (80 mg, 0.40 mmol) were combined to
yield
1-(3-t-butyl-1-(3-(2-(2,3-dihydroxypropylamino)-2-oxoethyl)phenyl)-1H-pyr-
azol-5-yl)-3-(4-methyl-3-(pyrimidin-2-ylamino)phenyl)urea (52 mg,
60% yield, 3 steps). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
8.93 (s, 1H), 8.70 (s, 1H), 8.36-8.34 (m, 3H), 8.10 (t, J=5.7 Hz,
1H), 7.54 (d, J=2.2 Hz, 1H), 7.45 (t, J=7.8 Hz, 1H), 7.43 (s, 1H),
7.37-7.30 (m, 2H), 7.16 (dd, J=8.1, and 2.2 Hz, 1H), 7.08 (d, J=8.5
Hz, 1H), 6.74 (t, J=4.8 Hz, 1H), 6.37 (s, 1H), 4.76 (d, J=5.0 Hz,
1H), 4.52 (t, J=6.8 Hz, 1H), 3.54 (s, 2H), 3.49 (m, 1H), 3.31-3.18
(m, 3H), 2.96 (m, 1H), 2.13 (s, 3H), 1.27 (s, 9H); MS (ESI) m/z:
573.3 (M+H.sup.+). ##STR425##
[0543] To a stirring solution of 3-nitrophenylacetic acid (10.4 g,
57.3 mmol) in MeOH (250 ml) at RT was added HCl gas until
saturation was achieved. The resulting solution was stirred at
70.degree. C. for 1 h. The reaction was cooled and concentrated
under reduced pressure. The semisolid residue was dissolved in
Et.sub.2O, washed with H.sub.2O (2.times.), satd. NaHCO.sub.3
(2.times.), brine (1.times.) and dried (MgSO.sub.4). Filtration and
evaporation provided methyl 2-(3-nitrophenyl)acetate as a
low-melting solid (10.7 g, 96% yield), which was used without
further purification. .sup.1H NMR (300 MHz, CDCl.sub.3): .delta.
8.14-8.04 (m, 2H), 7.64-7.58 (m, 1H), 7.47 (brt, J=8.10 Hz, 1H),
3.72 (s, 2H), 3.68 (s, 3H); MS (ESI) m/z: 196.0 (M+H.sup.+).
[0544] Methyl 2-(3-nitrophenyl)acetate (9.6 g, 49 mmol) was treated
with conc. NH.sub.4OH (24 ml, 172 mmol). The suspension was stirred
briskly at RT until complete, then chilled thoroughly in an ice
bath. The solids were collected by filtration, rinsed sparingly
with ice H.sub.2O and dried to yield pure
2-(3-nitrophenyl)acetamide as an off-white solid (7.47 g, 84%
yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 8.18-8.02 (m,
2H), 7.75-7.70 (m, 1H), 7.61-7.57 (m, 3H), 7.00 (brs, 1H), 3.58 (s,
3H); MS (ESI) m/z: 181.0 (M+H.sup.+).
[0545] To a stirring solution of BH.sub.3-THF (3.5 ml, 3.5 mmol,
1.0M) was added a solution of 2-(3-nitrophenyl)acetamide (0.25 g,
1.4 mmol) in THF (7.0 mL) at RT. The resulting solution was stirred
at RT until the gas evolution had subsided and then heated at
70.degree. C. overnight. The cooled reaction was quenched carefully
with 3M HCl (2 ml) and heated again at 70.degree. C. to complete
the quench. The reaction was cooled to RT and concentrated to a
white solid, which was dissolved in 3M NaOH (pH 14) and extracted
with CH.sub.2Cl.sub.2 (4.times.). The organics were dried
(Na.sub.2SO.sub.4), filtered, and concentrated to provide 0.20 g
(87% yield) of crude product as an oil, which was purified by
precipitation from CH.sub.2Cl.sub.2 and 3M HCl/EtOAc (0.26 ml, 0.78
mmol) to yield 2-(3-nitrophenyl)ethanamine as the HCl salt as an
off-white solid (0.164 g). .sup.1H NMR (300 Mhz, DMSO-d.sub.6):
.delta. 8.18-8.15 (m, 1H), 8.13-8.04 (m, 1H), 8.02 (brs, 3H),
7.76-7.74 (m, 1H), 7.65 (brt, J=7.8 Hz), 3.17-3.08 (m, 2H),
3.06-3.00 (m, 2H); MS (ESI) m/z: 167.0 (M+H.sup.+).
[0546] To a stirring suspension of 2-(3-nitrophenyl)ethanamine
hydrochloride (0.164 g, 0.81 mmol) in dry CH.sub.2Cl.sub.2 (8 ml)
at RT was added i-Pr.sub.2NEt (0.42 ml, 2.43 mmol). The reaction
was stirred at RT until the solids were dissolved, cooled
thoroughly in an ice bath and TFAA (0.14 mL, 1.01 mmol) was added
dropwise. The resulting yellow solution was stirred overnight with
slow warming to RT. The reaction mixture was washed with ice
H.sub.2O (2.times.) and dried (MgSO.sub.4). Filtration and
evaporation provided N-(3-nitrophenethyl)-2,2,2-trifluoroacetamide
(0.215 g, 101% yield) as an oil that solidified on standing.
.sup.1H NMR (300 MHz, CDCl.sub.3): .delta. 8.17-8.14 (m, 1H),
8.11-8.10 (m, 1H), 7.58-7.52 (m, 2H), 6.4 (brs, 1H), 3.70 (q, J=6.0
Hz, 2H), 3.06 (t, J=6.0 Hz, 2H).
[0547] To a solution of
N-(3-nitrophenethyl)-2,2,2-trifluoroacetamide (9.05 g, 34.5 mmol)
in MeOH (125 ml) at RT was added 10% Pd/C (50% H.sub.2O wet) (3.67
g, 1.73 mmol). The resulting suspension was placed under H.sub.2 (3
atm) at RT overnight. The reaction was filtered through Celite.RTM.
and the cake rinsed with MeOH. The filtrate was concentrated to
provide N-(3-aminophenethyl)-2,2,2-trifluoroacetamide as an oil
(7.83 g, 98% yield). .sup.1H NMR (300 MHz, CDCl.sub.3): .delta.
7.16-7.12 (m, 1H), 6.62-6.58 (m, 2H), 6.54-6.53 (m, 1H), 6.34 (brs,
1H), 3.61 (q, J=6.40 Hz, 2H), 2.80 (t, J=6.40 Hz, 2H), 2.68 (brs,
2H); MS (ESI) m/z: 233.3 (M+H.sup.+).
[0548] To a stirring solution of
N-(3-aminophenethyl)-2,2,2-trifluoroacetamide (7.83 g, 33.7 mmol)
in EtOAc (80 ml) at RT was added 3N HCl/EtOAc (12.4 ml, 37.1 mmol).
Solids precipitated almost immediately. The resulting suspension
was cooled in ice 1 h. The solids were collected by filtration,
rinsed with EtOAc and dried on the filter. There was obtained pure
N-(3-aminophenethyl)-2,2,2-trifluoroacetamide hydrochloride free of
less polar impurities as a pale tan solid (7.94 g, 88% yield).
.sup.1H NMR 300 MHz, (DMSO-d.sub.6): .delta. 10.3 (brs, 3H), 9.61
(t, J=5.32 Hz, 1H), 7.43-7.39 (m, 1H), 7.25-7.23 (m, 2H), 3.42 (q,
J=6.6 Hz, 2H), 2.84 (t, J=6.6 Hz, 2H).
[0549] N-(3-aminophenethyl)-2,2,2-trifluoroacetamide hydrochloride
(0.27 g, 1.0 mmol) was suspended in 6M HCl (2.0 mL) and cooled
thoroughly in an ice bath. This was rapidly stirred while a
solution of NaNO.sub.2 (73 mg) in H.sub.2O (1.0 mL) was added
slowly. The mixture was stirred at 0-5.degree. C. for 45 min and
was then treated with SnCl.sub.2.2H.sub.2O (1.3 g, 5.8 mmol) in 6N
HCl (4.0 mL). The resulting suspension was stirred at 0-5.degree.
C. for 3 h and then carefully quenched with 3N NaOH (15 mL) to pH
7-8. The mixture was diluted with Et.sub.2O, filtered through
Celite.RTM. and the filter cake was washed with H.sub.2O and
Et.sub.2O. The layers of the biphasic filtrate were separated and
the aqueous extracted with Et.sub.2O (2.times.). The combined
organics extracts were washed with brine (1.times.), dried
(Na.sub.2SO.sub.4), filtered and evaporated to provided
N-(3-hydrazinophenethyl)-2,2,2-trifluoroacetamide as a pale yellow
oil (0.18 g, 72% yield), which was used without further
purification. MS (ESI) m/z: 248.0 (M+H.sup.+).
[0550] To a stirring solution of
N-(3-hydrazinophenethyl)-2,2,2-trifluoroacetamide (0.18 g, 0.73
mmol) in absolute EtOH (5 ml) at RT was added pivaloylacetonitrile
(0.11 g, 0.87 mmol) and saturated HCl/EtOH (3 drops from a pipet).
The resulting solution was stirred at 75-80.degree. C. overnight,
then cooled to RT and concentrated. The residue was dissolved in
Et.sub.2O and washed with saturated. NaHCO.sub.3. The aqueous was
extracted with Et.sub.2O (1.times.). The combined organics were
washed with brine (1.times.), dried (MgSO.sub.4), filtered,
concentrated and purified via flash chromatography to provide
N-[3-(5-amino-3-t-butyl-1H-pyrazol-1-yl)phenethyl]-2,2,2-trifluoroacetami-
de as an orange glass (0.18 g, 70% yield). .sup.1H NMR (300 MHz,
CDCl.sub.3): .delta. 7.47-7.46 (m, 2H), 7.43-7.39 (m, 1H),
7.14-7.12 (m, 1H), 5.51 (s, 1H), 3.67 (q, J=6.6 Hz, 2H), 2.95 (t,
J=6.6 Hz, 2H), 1.33 (s, 9H); MS (ESI) m/z: 355.2 (M+H.sup.+).
##STR426##
[0551] Using general method A, Example A17 (0.180 g, 0.51 mmol) and
2,3-dichlorophenyl isocyanate (82 mg, 0.53 mmol) were combined to
yield
1-(3-t-butyl-1-(3-(2-(2,2,2-trifluoro-acetamido)ethyl)phenyl)-1H-pyrazol--
5-yl)-3-(2,3-dichloro-phenyl)urea as an orange foam (0.134 g, 52%
yield). .sup.1H NMR (400 MHz, CDCl.sub.3): .delta. 8.14 (brs, 1H),
7.39-7.20 (m, 8H), 7.03 (brs, 1H), 6.57 (s, 1H), 3.77 (m, 2H), 2.88
(m, 2H), 1.35 (s, 9H); MS (ESI) m/z: 508.3 (M+H.sup.+).
[0552] To a stirring solution of
1-(3-t-butyl-1-(3-(2-(2,2,2-trifluoro-acetamido)ethyl)phenyl)-1H-pyrazol--
5-yl)-3-(2,3-dichloro-phenyl)urea (0.134 g, 0.264 mmol) in MeOH (10
mL) and H.sub.2O (0.6 mL) at RT was added K.sub.2CO.sub.3 (0.182 g,
1.32 mmol). The resulting suspension was stirred at 60-65.degree.
C. for 2 h, then cooled to RT and the volatiles evaporated. The
residue was carefully dissolved in 1N HCl to pH 1-2 and extracted
with Et.sub.2O (2.times.). The aqueous was then basified (pH 13-14)
with 3M NaOH and extracted with CH.sub.2Cl.sub.2 (4.times.). The
combined CH.sub.2Cl.sub.2 extracts were washed with brine
(1.times.), dried (Na.sub.2SO.sub.4), filtered, and concentrated to
provided
1-{1-[3-(2-aminoethyl)phenyl]-3-t-butyl-1H-pyrazol-5-yl}-3-(2,3-dichlorop-
henyl)urea as a foam (25.6 mg, 97% yield). .sup.1H NMR (400 MHz,
CDCl.sub.3): .delta. 8.17 (dd, J=1.2, and 8.0 Hz, 1H), 7.31-7.28
(m, 4H), 7.14-7.06 (m, 4H), 6.45 (s, 1H), 3.48 (brt, J=4.4 Hz, 2H),
3.46-3.39 (m, 2H), 2.86 (t, J=7.0 Hz, 2H), 1.3 (s, 9H); MS (ESI)
m/z: 446.3 (M+H.sup.+). ##STR427##
[0553] To a stirring solution of Example 39 (54.2 mg, 0.121 mmol)
in MeOH (1.2 mL) at RT was added aq. formaldehyde (37 wt %, 0.036
mL, 0.49 mmol) and conc. formic acid (0.037 mL, 0.97 mmol). The
reaction was stirred at 60-65.degree. C. overnight, then cooled to
RT, diluted with 1N HCl and filtered. The filtrate was made basic
(pH 13) with 3N NaOH and extracted with CH.sub.2Cl.sub.2
(2.times.). The combined organics were washed with brine
(1.times.), dried (Na.sub.2SO.sub.4), filtered, concentrated and
purified by column chromatography, to yield
1-(3-t-butyl-1-{3-[2-(dimethylamino)ethyl]phenyl}-1H-pyrazol-5-yl)-3-(2,3-
-di-chlorophenyl)urea (17.4 mg, 30% yield). .sup.1H NMR (400 MHz,
CDCl.sub.3): .delta. 8.37-8.34 (m, 1H), 7.51-7.45 (m, 3H),
7.21-7.10 (m, 5H), 6.57 (s, 1H), 3.30-3.27 (m, 2H), 3.23-3.19 (m,
2H), 2.71 (s, 6H), 1.39 (s, 9H); MS (EI) 474.2 (M+H.sup.+).
##STR428##
[0554] Using general method C, Example 5 (0.17 g, 0.39 mmol) was
reduced to yield
1-(1-[3-(aminomethyl)phenyl]-3-t-butyl-1H-pyrazol-5-yl)-3-(3-bro-
mophenyl)urea as the HCl salt (0.131 g, 70% yield). .sup.1H NMR
(300 MHz, DMSO-d.sub.6): .delta. 9.93 (s, 1H), 8.83 (s, 1H), 8.36
(brs, 3H), 7.82-7.81 (m, 1H), 7.71 (brs, 1H), 7.57-7.55 (m, 2H),
7.48-7.46 (m, 1H), 7.31-7.29 (m, 1H), 7.24-7.20 (m, 1H), 7.15-7.13
(m, 1H), 6.42 (s, 1H), 4.16-4.12 (m, 2H), 1.29 (s, 9H); MS (ESI)
m/z: 442.3 (M+H.sup.+), 444.2 (M+2H.sup.+). ##STR429##
[0555] Using general method C, Example 9 (50 mg, 0.12 mmol) was
reduced to afford
1-{1-[3-(aminomethyl)phenyl]-3-t-butyl-1H-pyrazol-5-yl}-3-(2,3--
dichloro-phenyl)urea as a white solid (20.6 mg, 41% yield). .sup.1H
NMR (300 MHz, DMSO-d.sub.6): .delta. 9.55 (s, 1H), 8.47 (br s, 3H),
7.97-7.96 (m, 1H), 7.70-7.32 (m, 4H), 7.15-7.11 (m, 3H), 6.81 (s,
1H), 4.10 (br s, 2H), 1.38 (s, 9H); MS (ESI) m/z: 432.2
(M+H.sup.+), 434.2 (M+2+H.sup.+). ##STR430##
[0556] To a stirring solution of Example 9 (80 mg, 0.19 mmol) and
hydroxylamine hydrochloride (26 mg, 0.37 mmol,) in absolute EtOH
(2.0 mL) was added triethylamine (0.052 mL, 0.37 mmol). The
resulting mixture was stirred at 80.degree. C. for 5 h. The
reaction was cooled to RT and the volatiles evaporated. The residue
was partitioned between EtOAc and H.sub.2O and the aqueous was
extracted with EtOAc (3.times.). The combined organic extracts were
washed with saturated NaHCO.sub.3 (2.times.), brine (1.times.),
dried (Na.sub.2SO.sub.4), filtered and concentrated to provide
1-{1-[3-(N-hydroxycarbamimidoyl)phenyl]-3-t-butyl-1H-pyrazol-5-yl}-3-(2,3-
-dichlorophenyl)-urea (92 mg), which was used without further
purification. MS (ESI) m/z: 461.2 (M+H.sup.+), 463.3 (M+2H.sup.+).
##STR431##
[0557] To a stirring suspension of Example 43 (92 mg, 0.20 mmol)
and 10% Pd/C (50% H.sub.2O wet, 21 mg, 0.0100 mmol) in absolute
EtOH (2 mL) was added Ac.sub.2O (0.019 ml, 0.20 mmol) and 99%
formic acid (0.038 mL, 1.00 mmol). The resulting mixture was
stirred at 40-45.degree. C. for 18 h. The reaction was cooled to
RT, filtered through Celite.RTM., concentrated to dryness and the
residue dissolved in EtOAc and H.sub.2O. The layers were separated
and the aqueous extracted with EtOAc (2.times.). The combined
organic extracts were washed with saturated NaHCO.sub.3 (1.times.),
brine (1.times.), then dried (Na.sub.2SO.sub.4), filtered,
concentrated and purified via reverse phase chromatography to
provide of
1-[3-t-butyl-1-(3-carbamimidoylphenyl)-1H-pyrazol-5-yl]-3-(2,3-dichloroph-
enyl)urea as the TFA salt (27.2 mg, 24% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta.9.40 (s, 2H), 9.32 (s, 1H), 9.04 (s,
2H), 8.74 (s, 1H), 8.03-8.00 (m, 2H), 7.94-7.92 (m, 1H), 7.81-7.78
(m, 2H), 7.32-7.31 (m, 2H), 6.45 (br s, 1H), 1.30 (s, 9H); MS (ESI)
m/z: 445.2 (M+H.sup.+), 447.3 (M+2H.sup.+). ##STR432##
[0558] Using general method M, (4-aminophenyl)acetic acid (20 g,
0.13 mol) was converted to ethyl
2-(4-(3-t-butyl-5-amino-1H-pyrazol-1-yl)phenyl)acetate (22.5 g,
57.5% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
7.55-7.45 (m, 4H), 5.61 (s, 1H), 4.08 (q, J=6.9 Hz, 2H), 3.77 (s,
2H), 1.27 (s, 9H), 1.19 (t, J=6.9 Hz, 3H); MS (ESI) m/z: 302
(M+H.sup.+). ##STR433##
[0559] Using general method A, Example A18 (5 g, 14.8 mmol) and
1,2-dichloro-3-isocyanatobenzene (2.8 g, 15.0 mmol) were combined
to afford
2-(4-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]-1H-pyrazol-1-yl}p-
henyl)acetic acid (2.1 g, 29% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.24 (s, 1H), 8.77 (s, 1H), 8.05 (m, 1H),
7.47-7.38 (m, 4H), 7.30-7.28 (m, 2H), 6.36 (s, 1H), 4.08 (q, J=7.2
Hz, 2H), 2.72 (s, 2H), 1.25 (s, 9H), 1.18 (t, J=7.2 Hz, 3H); MS
(ESI) m/z: 489 (M+H.sup.+).
[0560] Using general method C,
2-(4-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]-1H-pyrazol-1-yl}phenyl)a-
cetic acid (100 mg, 0.21 mmol) was reduced to afford
1-{3-t-butyl-1-[4-(2-hydroxyethyl)-phenyl]-1H-pyrazol-5-yl}-3-(2,3-dichlo-
rophenyl)urea (60 mg, 64% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.21 (s, 1H), 8.77 (s, 1H), 8.06 (m, 1H),
7.41-7.34 (m, 4H), 7.30-7.28 (m, 2H), 6.36 (s, 1H), 4.66 (t, J=5.1
Hz, 1H), 3.63 (q, J=7.2 Hz, 2H), 2.77 (t, J=6.9 Hz, 2H), 1.25 (s,
9H); MS (ESI) m/z: 447 (M+H.sup.+). ##STR434##
[0561] To a solution of 3-nitro-benzaldehyde (15.1 g, 0.1 mol) in
CH.sub.2Cl.sub.2 (200 mL) was added dropwise
(triphenyl-phosphanylidene)acetic acid ethyl ester (34.8 g, 0.1
mol) in CH.sub.2Cl.sub.2 (100 mL) at 0.degree. C. After the
addition was complete, the resulting mixture was stirred for 1 h.
After removal the solvent under reduced pressure, the residue was
purified by column chromatography to afford
3-(3-nitrophenyl)acrylic acid ethyl ester (16.5 g, 74.6% yield).
.sup.1H NMR (400 MHz, CDCl.sub.3): .delta. 8.42 (s, 1H), 8.23 (dd,
J=0.8, and 8.0 Hz, 1H), 7.82 (d, J=7.6 Hz, 1H), 7.72 (d, J=16.0 Hz,
1H), 7.58 (t, J=8.0 Hz, 1H), 6.56 (d, J=16.0 Hz, 1H), 4.29 (q,
J=7.2 Hz, 2H), 1.36 (t, J=6.8 Hz, 3H).
[0562] A mixture of 3-(3-nitrophenyl)acrylic acid ethyl ester (16.5
g, 74.6 mmol) and Pd/C (1.65 g) in MeOH (200 mL) was stirred under
40 psi of H.sub.2 at RT for 2 h, then filtered through Celite.RTM..
After removal the solvent, 14 g of 3-(3-aminophenyl)propionic acid
ethyl ester was obtained. .sup.1H NMR (400 MHz, CDCl.sub.3):
.delta. 7.11 (t, J=5.6 Hz, 1H), 6.67 (d, J=7.2 Hz, 1H), 6.63-6.61
(m, 2H), 4.13 (q, J=7.2 Hz, 2H), 2.87 (t, J=8.0 Hz, 2H), 2.59 (t,
J=7.6 Hz, 2H), 1.34 (t, J=6.8 Hz, 3H); MS (ESI): m/z: 194
(M+H.sup.+).
[0563] To a solution of 3-(3-aminophenyl)propionic acid ethyl ester
(14 g, 72.5 mmol) in conc. HCl (200 mL) was added aqueous (10 mL)
NaNO.sub.2 (5 g, 72.5 mmol) at 0.degree. C. and the resulting
mixture was stirred for 1 h. A solution of SnCl.sub.2.2H.sub.2O (33
g, 145 mmol) in conc. HCl (150 mL) was then added at 0.degree. C.
The reaction solution was stirred for an additional 2 h at RT. The
precipitate was filtered and washed with EtOH and ether to yield
3-(3-hydrazinophenyl)propionic acid ethyl ester as a white solid,
which was used for the next reaction without further purification.
MS (ESI): m/z: 209 (M+H.sup.+).
[0564] A mixture of 3-(3-hydrazinophenyl)propionic acid ethyl ester
(13 g, 53.3 mmol) and 4,4-dimethyl-3-oxopentanenitrile (6.9 g, 55
mol) in EtOH (150 mL) was heated at reflux overnight. The reaction
solution was evaporated under vacuum. The residue was purified by
column chromatography to yield ethyl
3-(3-(3-t-butyl-5-amino-1H-pyrazol-1-yl)phenyl)propanoate (14.3 g,
85% yield) as a white solid. .sup.1H NMR (300 MHz, DMSO-d.sub.6);
.delta. 7.50-7.42 (m, 4H), 5.63 (s, 1H), 5.14 (s, 2H), 4.04 (q,
J=6.9 Hz, 2H), 2.92 (t, J=7.5 Hz, 2H), 2.66 (t, J=7.5 Hz, 2H), 1.27
(s, 9H), 1.16 (t, J=7.5 Hz, 3H); MS (ESI) m/z: 316 (M+H.sup.+).
[0565] Using general method A, the previous compound (300 mg, 1.0
mmol) and 1,2-dichloro-3-isocyanato-benzene (187 mg, 1.0 mmol) were
combined to afford
3-(3-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]-1H-pyrazol-1-yl}p-
henyl)propionic acid ethyl ester (210 mg, 42% yield), which was
used without further purification. .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.20 (s, 1H), 8.76 (s, 1H), 8.05 (m, 1H),
7.47-7.26 (m, 6H), 6.38 (s, 1H), 4.04 (q, J=7.2 Hz, 2H), 2.93 (t,
J=7.5 Hz, 2H), 2.65 (t, J=7.5 Hz, 2H), 1.28 (s, 9H), 1.15 (t, J=7.2
Hz, 3H); MS (ESI) m/z: 503 (M+H.sup.+).
[0566] Using general method E, the previous compound (100 mg, 0.199
mmol) was saponified to afford
3-(3-{3-t-Butyl-5-[3-(2,3-dichloro-phenyl)ureido]-1H-pyrazol-1-yl}-phenyl-
)propionic acid (60 mg, 63% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.23 (s, 1H), 8.77 (s, 1H), 8.03 (m, 1H),
7.44-7.21 (m, 6H), 6.36 (s, 1H), 2.88 (t, J=7.5 Hz, 2H), 2.58 (t,
J=7.5 Hz, 2H), 1.26 (s, 9H); MS (ESI) m/z: 475 (M+H.sup.+).
##STR435##
[0567] To a solution of 4-nitrobenzaldehyde (15.1 g, 0.1 mol) in
CH.sub.2Cl.sub.2 (200 mL) was added dropwise
(triphenylphosphanylidene)acetic acid ethyl ester (34.8 g, 0.1 mol)
in CH.sub.2Cl.sub.2 (100 mL) at 0.degree. C. After the addition was
completed, the resulting mixture was stirred for 2 h. After removal
the solvent under reduced pressure, the residue was purified by
column chromatography to afford 3-(4-nitrophenyl)acrylic acid ethyl
ester (16.5 g, 74.6% yield). .sup.1H NMR (400 MHz, CDCl.sub.3):
.delta. 8.25 (d, J=8.8 Hz, 2H), 7.71 (d, J=16.0 Hz, 1H), 7.67 (d,
J=8.8 Hz, 2H), 6.55 (d, J=16.0 Hz, 2H), 4.29 (q, J=7.2 Hz, 2H),
1.34 (t, J=7.2 Hz, 3H).
[0568] A mixture of 3-(4-nitrophenyl)acrylic acid ethyl ester (16.5
g, 74.6 mmol) and Pd/C (1.65 g) in MeOH (200 mL) was stirred under
40 psi of H.sub.2 at RT for 2 h. After filtration over Celite.RTM.
and removal of the solvent, 14 g of 3-(4-aminophenyl)propionic acid
ethyl ester was obtained. .sup.1H NMR (400 MHz, CDCl.sub.3):
.delta. 6.98 (d, J=8.0 Hz, 2H), 6.61 (d, J=8.4 Hz, 1H), 4.12 (q,
J=7.2 Hz, 2H), 2.84 (t, J=8.0 Hz, 2H), 2.55 (t, J=7.6 Hz, 2H), 1.23
(t, J=7.2 Hz, 3H). MS (ESI): m/z: 194 (M+H.sup.+).
[0569] To a solution of 3-(4-aminophenyl)propionic acid ethyl ester
(14 g, 72.5 mmol) in conc. HCl (200 mL) was added aqueous (10 mL)
NaNO.sub.2 (5 g, 72.5 mmol) at 0.degree. C. and the resulting
mixture was stirred for 1 h. A solution of SnCl.sub.2.2H.sub.2O (33
g, 145 mmol) in conc. HCl (150 mL) was then added at 0.degree. C.
The reaction solution was stirred for an additional 2 h at RT. The
precipitate was filtered and washed with EtOH and Et.sub.2O to
yield 3-(4-hydrazinophenyl)propionic acid ethyl ester as a white
solid, which was used for the next reaction without further
purification. MS (ESI): m/z: 209 (M+H.sup.+).
[0570] A mixture of 3-(4-hydrazinophenyl)propionic acid ethyl ester
(13 g, 53.3 mmol) and 4,4-dimethyl-3-oxopentanenitrile (6.9 g, 55
mol) in EtOH (150 mL) was heated at reflux overnight. The reaction
solution was evaporated under vacuum. The residue was purified by
column chromatography to yield ethyl
3-(4-(3-t-butyl-5-amino-1H-pyrazol-1-yl)phenyl)propanoate (14.3 g,
85% yield) as a white solid. .sup.1H NMR (300 MHz, DMSO-d.sub.6);
.delta. 7.44 (d, J=8.4 Hz, 2H), 7.27 (d, J=8.7 Hz, 2H), 5.34 (s,
1H), 5.11 (s, 2H), 4.04 (q, J=7.2 Hz, 2H), 2.86 (t, J=7.5 Hz, 2H),
2.61 (t, J=7.5 Hz, 2H), 1.19 (s, 9H), 1.15 (t, J=7.2 Hz, 3H); MS
(ESI) m/z: 316 (M+H.sup.+). ##STR436##
[0571] Using general method A, Example A19 (300 mg, 1.0 mmol) and
1,2-dichloro-3-isocyanato-benzene (187 mg, 1.0 mmol) were combined
to afford
3-(4-{3-t-butyl-5-[3-(2,3-dichloro-phenyl)ureido]-1H-pyrazol-1-yl}-
phenyl)propionic acid ethyl ester (250 mg, 50% yield), which was
used without further purification. MS (ESI) m/z: 503 (M+H.sup.+).
##STR437##
[0572] Using general method E, Example 47 (100 mg, 0.199 mmol) was
saponified to afford of
3-(3-{3-t-butyl-5-[3-(2,3-dichloro-phenyl)ureido]pyrazol-1-yl}-phenyl)-pr-
opionic acid (60 mg, 64% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.29 (s, 1H), 8.80 (s, 1H), 8.04 (m, 1H),
7.44-7.33 (m, 4H), 7.29-7.27 (m, 2H), 6.36 (s, 1H), 2.87 (t, J=7.5
Hz, 2H), 2.57 (t, J=7.5 Hz, 2H), 1.25 (s, 9H); MS (ESI) m/z: 475
(M+H.sup.+). ##STR438##
[0573] POCl.sub.3 (26 g, 0.18 mol) was added over 1 h to anhydrous
DMF (66 g) while keeping the temperature at 15-20.degree. C. After
the solution had stirred at RT for 1 h, 3-nitrophenyl acetic acid
(10 g, 0.06 mol) was added. The solution was heated to 85.degree.
C. and stirred for 18 h. The solution was cooled to RT and poured
onto 160 g of ice with vigorous stirring. A solution of sodium
perchlorate (11 g, 0.09 mol) in H.sub.2O was added, and a
crystalline precipitate formed over 10 min. The precipitate was
filtered, washed with H.sub.2O, and dried in vacuo at 50.degree. C.
to yield a tan power
(E)-N-[3-(dimethylamino)-2-(3-nitrophenyl)-2-propenylidene]-N-methylmetha-
naminium monoperchlorate (12 g, 58% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): 8.23 (d, J=7.5 Hz, 1H), 8.12 (s, 1H), 7.75-7.64 (m,
4H), 3.22 (s, 3H), 2.39 (s, 6H); MS (ESI) m/z: 349 (M+H.sup.+).
[0574] A solution of the material from the previous reaction (12 g,
32 mmol) dissolved in DMF (600 mL) were added t-butyl cyanoacetate
(5 mL, 35 mmol) and Et.sub.3N (4.9 mL, 35 mmol). The solution was
stirred at RT for 18 h and then partitioned between H.sub.2O and.
The aqueous layer was extracted with CH.sub.2Cl.sub.2 (3.times.500
mL), the combined organic layers were dried (MgSO.sub.4),
concentrated and the yellow residue was purified by column to yield
2-cyano-5-dimethylamino-4-(3-nitrophenyl)penta-2,4-dienoic acid
t-butyl ester (9 g, 82% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): 8.9-8.23 (m, 1H), 8.05 (s, 1H), 7.72 (s, 1H),
7.50-7.55 (m, 2H), 7.05 (s, 1H), 2.81 (brs, 6H), 1.44 (s, 9H); MS
(ESI) m/z: 344 (M+H.sup.+).
[0575] To a solution of the material from the previous reaction (9
g, 26 mmol) in acetic acid (150 mL) was added gaseous HCl at a
moderate rate for 15 min at RT. The solution was stirred at RT for
18 h and then partitioned between H.sub.2O and CH.sub.2Cl.sub.2.
The aqueous layer was extracted with CH.sub.2Cl.sub.2 (3.times.250
mL), the combined organic layers were dried (MgSO.sub.4),
concentrated and the yellow residue was purified by column to yield
2-chloro-5-(3-nitrophenyl)pyridine (3.5 g, 55% yield). .sup.1H NMR
(300 MHz, DMSO-d.sub.6): .delta. 8.65 (s, 1H), 8.42 (s, 1H), 8.29
(d, J=7.8 Hz, 1H), 7.92-7.86 (m, 2H), 7.68 (t, J=7.8 Hz, 1H), 7.49
(d, J=7.8 Hz, 1H).
[0576] To a solution of the material from the previous reaction (5
g, 21 mmol) in MeOH (50 mL) was added Raney-Ni and the mixture
stirred at RT under a atmosphere of H.sub.2 for 5 h. After the
Raney-Ni was filtered, the filtrate was concentrated to yield
3-(6-chloro-pyridin-3-yl)phenylamine (3.8 g, 89% yield). .sup.1H
NMR (300 MHz, DMSO-d.sub.6): .quadrature. 8.55 (d, J=2.4 Hz, 1H),
7.97 (dd, J=8.4 Hz, and 2.4 Hz, 1H), 7.52 (d, J=8.4 Hz, 1H), 7.10
(t, J=7.8 Hz, 1H), 6.82-6.76 (m, 2H), 6.60 (d, J=7.8 Hz, 1H), 6.22
(d, 2H); MS (ESI) m/z: 205 (M+H.sup.+).
[0577] To a solution of the material from the previous reaction
(3.5 g, 17 mmol) in conc. HCl (6 mL) was added an aqueous solution
(2 mL) of NaNO.sub.2 (1.21 g, 17 mmol) at 0.degree. C. and the
resulting mixture was stirred for 1 h. A solution of
SnCl.sub.2.2H.sub.2O (8.0 g, 36 mmol) in conc. HCl (7.5 mL) was
then added at 0.degree. C. The reaction solution was stirred for an
additional 2 h at RT. The precipitate was filtered and washed with
EtOH and ether to give [3-(6-chloropyridin-3-yl)phenyl]hydrazine
hydrochloride as a white solid, which was used for the next
reaction without further purification. MS (ESI) m/z: 220
(M+H.sup.+).
[0578] A mixture of the material from the previous reaction and
4,4-dimethyl-3-oxo-pentanenitrile (2.18 g, 35 mol) in EtOH (25 mL)
was heated at reflux overnight. The reaction solution was
concentrated and the residue purified by column chromatography to
give
5-t-butyl-2-[3-(6-chloropyridin-3-yl)-phenyl]-2H-pyrrazol-3-ylamine
(3.7 g, 60% yield, two steps). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 8.71 (d, J=1.8 Hz, 1H), 8.17 (d, J=6.3 Hz, 1H), 7.94 (s,
1H), 7.92 (s, 1H), 7.78 (t, J=6.3 Hz, 1H), 7.65 (d, J=6.0 Hz, 1H),
7.57 (d, J=6.3 Hz, 1H), 5.80 (s, 1H), 1.39 (s, 9H); MS (ESI) m/z:
327 (M+H.sup.+). ##STR439##
[0579] To a solution of 3-bromoaniline (17 g, 0.1 mol) in conc. HCl
(200 mL) was added an aqueous solution (20 mL) of NaNO.sub.2 (7 g,
0.1 mol) at 0.degree. C. and the resulting mixture was stirred for
1 h. A solution of SnCl.sub.2.2H.sub.2O (45 g, 0.2 mmol) in conc.
HCl (500 mL) was then added at 0.degree. C. The reaction solution
was stirred for 2 h at RT. The precipitate was filtered and washed
with EtOH and ether to yield (3-bromophenyl)hydrazine hydrochloride
as a white solid, which was used for the next reaction without
further purification
[0580] A mixture of (3-bromophenyl)hydrazine hydrochloride (22.2 g,
0.1 mol) and 4,4-dimethyl-3-oxo-pentanenitrile (18.7 g, 0.15 mol)
in EtOH (250 mL) was heated at reflux overnight. The reaction was
concentrated and the residue purified via column chromatography to
yield 2-(3-bromophenyl)-5-t-butyl-2H-pyrazol-3-ylamine as a white
solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 7.85 (s, 1H),
7.68 (d, J=7.6 Hz, 1H), 7.62 (d, J=7.2 Hz, 1H), 7.50 (t, J=8.0 Hz,
1H), 5.62 (s, 1H), 1.27 (s, 9H).
[0581] Using general method D, the material from the previous
reaction (0.833 g, 2.51 mmol) and 2,3-dichloroaniline (0.377 g,
2.33 mmol) were combined to yield
1-(1-(3-bromophenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)ure-
a (0.389 g, 42% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.26 (s, 1H), 8.77 (s, 1H), 8.01 (m, 1H), 7.74 (t, J=2.0
Hz, 1H), 7.62-7.56 (m, 2H), 7.49 (t, J=8.0 Hz, 1H), 7.30 (m, 2H),
6.41 (s, 1H), 1.28 (s, 9H); MS (ESI) m/z: 483.0 (M+H.sup.+).
##STR440##
[0582] Example 49 (156 mg, 0.32 mmol), t-butyl
4-(4,4,5,5-tetramethyl-1,3,2-dioxaboran-2-yl)-1-pyrazole-carboxylate
(146 mg, 0.50 mmol) and Cs.sub.2CO.sub.3 (316 mg, 0.97 mmol) were
combined in DMF (8.0 mL) and H.sub.2O (2.5 mL). The reaction
mixture was purged of air under vacuum and the head-space was
back-filled with N.sub.2. Palladium tetrakis(triphenylphosphine)
(40 mg, 0.035 mmol) was added and the reaction mixture was heated
to 80.degree. C. under N.sub.2. After 5.5 h, the reaction mixture
was cooled to RT and partitioned between H.sub.2O and EtOAc. The
organic layer was washed with H.sub.2O and brine, dried
(Na.sub.2SO.sub.4), concentrated in vacuo and purified via column
chromatography to yield
1-(1-(3-(1H-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3-dichlo-
rophenyl)urea (39 mg, 26% yield) as a film. Further purification by
reverse phase chromatography provided a white powder. .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 9.26 (s, 1H), 8.80 (s, 1H), 8.29
(brs, 1H), 8.06 (m, 1H), 7.99 (brs, 1H), 7.73 (t, J=1.7 Hz, 1H), dt
(J=8.4, 1.7 Hz, 1H), 7.51 (t, J=7.9 Hz, 1H), 7.33-7.28 (m, 3H),
6.42 (s, 1H), 1.29 (s, 9H); MS (ESI) m/z: 469.0 (M+H.sup.+).
##STR441##
[0583] A solution of 1-(3-bromophenyl)-3-t-butyl-1H-pyrazol-5-amine
hydrochloride (0.253 g, 0.77 mmol, available from Example 54),
t-butyl
4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole-1-carboxylate
(0.28 g, 0.95 mmol, commercially available) and Cs.sub.2CO.sub.3
(1.0 g, 3.1 mmol) in DMF (5 mL) and H.sub.2O (2 mL) was placed
under Ar for 15 min. Palladium tetrakis(triphenylphosphine) was
added and the reaction mixture was heated at 80.degree. C.
overnight. The reaction mixture was poured into H.sub.2O (20 mL)
and extracted with EtOAc (2.times.30 mL). The extracts were washed
with H.sub.2O (10 mL) and brine (10 mL), dried (Na.sub.2SO.sub.4)
concentrated and purified via column chromatography to yield
1-(3-(1H-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-amine (163 mg,
76% yield). MS (ESI) m/z: 282.3 (M+H.sup.+).
[0584] 1-(3-(1H-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-amine
(160 mg, 0.57 mmol) in EtOAc (3 mL) was cooled to 0.degree. C. and
treated with 1M NaOH (0.85 mL, 0.85 mmol) and isopropenyl
chloroformate (0.080 mL, 0.74 mmol). The reaction was allowed to
warm to RT overnight. The organic layer was washed with saturated
NaHCO.sub.3, brine, dried (Na.sub.2SO.sub.4) and was concentrated
to a film, which was dissolved in Et.sub.2O (5 mL) and the solution
was lowed to stand overnight. The resultant crystals were
collected, washed with Et.sub.2O and dried in vacuo to provide
prop-1-en-2-yl
4-(3-(3-t-butyl-5-((prop-1-en-2-yloxy)carbonyl)-1H-pyrazol-1-yl)phenyl)-1-
H-pyrazole-1-carboxylate (193 mg, 75% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.73 (brs, 1H), 8.96 (d, J=0.7 Hz, 1H), 8.46
(d, J=0.7 Hz, 1H), 7.87 (t, J=1.7 Hz, 1H), 7.81 (dt, J=8.2, 1.3 Hz,
1H), 7.54 (t, J=7.9 Hz, 1H), 7.41 (brd, J=7.9 Hz, 1H), 6.34 (s,
1H), 5.02 (s, 2H), 4.66 (brs, 1H), 4.57 (brs, 1H), 2.06 (s, 3H),
1.76 (brs, 3H), 1.30 (s, 9H). MS (ESI) m/z: 450.2 (M+H.sup.+).
[0585] Using the procedure for Example 151, prop-1-en-2-yl
4-(3-(3-t-butyl-5-((prop-1-en-2-yloxy)carbonyl)-1H-pyrazol-1-yl)phenyl)-1-
H-pyrazole-1-carboxylate (63 mg, 0.14 mmol) and
4-(4-aminophenyl)isoindolin-1-one (31 mg, 0.14 mmol) were combined
to yield prop-1-en-2-yl
4-(3-(3-t-butyl-5-(3-(4-(1-oxoisoindolin-4-yl)phenyl)ureido)-1H-pyrazol-1-
-yl)phenyl)-1H-pyrazole-1-carboxylate (75 mg, 87% yield). MS (ESI)
m/z: 616.2 (M+H.sup.+).
[0586] Using general method E, prop-1-en-2-yl
4-(3-(3-t-butyl-5-(3-(4-(1-oxoisoindolin-4-yl)phenyl)ureido)-1H-pyrazol-1-
-yl)phenyl)-1H-pyrazole-1-carboxylate (75 mg, 0.12 mmol) was
saponified to yield
1-(1-(3-(1H-pyrazol-4-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(1-
-oxoisoindolin-4-yl)phenyl)urea as a white powder (9.5 mg, 15%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.24 (s, 1H),
8.66 (s, 1H), 8.50 (s, 1H), 8.30 (brs, 1H), 8.00 (brs, 1H), 7.74
(brs, 1H), 7.69-7.62 (m, 3H), 7.59-7.48 (m, 7H), 7.33 (brd, J=7.9
Hz, 1H), 6.43 (s, 1H), 4.50 (s, 2H), 1.30 (s, 9H). MS (ESI) m/z:
532.3 (M+H.sup.+). ##STR442##
[0587] To a solution of quinolin-6-ylamine (5 g, 35 mmol) in conc.
HCl (12 mL) was added dropwise an aqueous solution (4 mL) of
NaNO.sub.2 (2.42 g, 35 mmol) at 0.degree. C. The resulting mixture
was stirred for 1 h and then treated dropwise with a solution of
SnCl.sub.22H.sub.2O (15.8 g, 70 mmol) in conc. HCl (15 mL) at
0.degree. C. The reaction mixture was stirred for 2 h at RT. The
precipitate was collected and washed with EtOH and Et.sub.2O to
yield 1-(quinolin-6-yl)hydrazine hydrochloride as a yellow powder
(4.3 g, 77% yield), which was used for the next reaction without
further purification.
[0588] A mixture of 1-(quinolin-6-yl)hydrazine hydrochloride (4.0
g, 20.5 mmol) and 4,4-dimethyl-3-oxo-pentanenitrile (3.6 g, 30 mol)
in EtOH (50 mL) and conc. HCl (5 mL) was heated at reflux
overnight. After removal of the solvent, the residue was purified
by column chromatography to yield
3-t-butyl-1-(quinolin-6-yl)-1H-pyrazol-5-amine (2.8 g, 51% yield).
.sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 8.84 (d, J=4.2 Hz,
1H), 8.37 (d, J=7.5 Hz, 1H), 8.09 (s, 1H), 8.04 (s, 2H), 7.52(m,
1H), 5.46 (s, 1H), 5.40 (brs, 2H), 1.29 (s, 9H).
General Experimental for Examples 52-55:
[0589] A solution of Example A21 and the appropriate isocyanate or
aniline was converted to the target compound using the general
method indicated. TABLE-US-00004 MS (EI) .sup.1H NMR (300 MHz/400
MHz, Example Name (M +H.sup.+) DMSO-d.sub.6) ##STR443##
1-[3-t-butyl-1- (quinolin-6-yl)-1H- pyrazol-5-yl]-3-(2,3-
dichlorophenyl)urea 52 mg, 30% yield General method A 454.2 .delta.
9.39 (s, 1H), 8.97 (dd, J=1.6, and 4.0 Hz, 1H), 8.78 (s, 1H), 8.49
(bd, J=8.0 Hz, 1H), 8.18 (d, J=4.8 Hz, 1H), 8.16 (d, J=2.0 Hz, 1H),
8.06 (dd, J=4.0, and 6.0 Hz, 1H). 7.96 (dd, J=2.4, and 9.2 Hz, 1H),
7.63 (dd, J=4.4, and 8.4 Hz, 1H), 7.31 (d, # J=1.6 Hz, 1H), 7.30
(s, 1H), 6.48 (s, 1H), 1.31 (s, 9H) ##STR444## 1-(3-t-butyl-1-
(quinolin-6-yl)-1H- pyrazol-5-yl)-3- (2,4,5- trifluorophenyl)urea
25 mg, 28% yield General method D 440.2 .delta. 9.09 (s, 1H), 9.04
(s, 1H), 8.97 (dd, J=1.6, and 4.4 Hz, 1H), 8.49 (d, J=8.4 Hz, 1H),
8.16 (m, 3H), 7.93 (dd, J=2.0, and 8.8 Hz, 1H). 7.62 (m, 2H), 6.48
(s, 1H), 1.31 (s, 9H) ##STR445## 1-(3-t-butyl-1-
(quinolin-6-yl)-1H- pyrazol-5-yl)-3- (2,3,5- trifluorophenyl)urea 5
mg, 3% yield General method D 440.2 .delta. 9.33 (s, 1H), 9.13 (s,
1H), 8.97 (m, 1H), 8.49 (d, J=7.3 Hz, 1H), 8.18 (d, J=9.2 Hz, 1H),
8.17 (s, 1H), 7.94 (d, J=8.8 Hz, 1H). 7.87 (m, 1H), 7.63 (m, 1H),
7.12 (m, 1H), 6.50 (s, 1H), 1.25 (s, 9H) ##STR446## 1-(3-t-butyl-1-
(quinolin-6-yl)-1H- pyrazol-5-yl)-3-(3- (pyridin-3-
yloxy)phenyl)urea HCl salt 62 mg, 55% yield General method D 551.2
.delta. 9.43 (brs, 1H), 9.07 (brs, 1H), 8.81 (brs, 1H), 8.71 (brs,
1H), 8.48 (m, 1H), 8.44 (m, 1H), 8.30 (m, 1H), 8.23 (m, 1H), 8.08
(m, 1H), 7.78 (m, 1H), 7.58 (m, 2H), 7.30 (m, 1H), 7.10 (dd, J=1.6,
and 8.4 Hz, 1H), 6.70 (dd, J=2.4, and 8.4 Hz, 1H), 6.43 (s, 1H),
1.31 (s, 9H)
[0590] ##STR447##
[0591] To a solution of quinolin-3-ylamine (5 g, 35 mmol) in conc.
HCl (12 mL) was added dropwise an aqueous solution (4 mL) of
NaNO.sub.2 (2.42 g, 35 mmol) at 0.degree. C. The resulting mixture
was stirred for 1 h, and then treated with a solution of
SnCl.sub.2.2H.sub.2O (15.8 g, 70 mmol) in conc. HCl (15 mL). The
reaction solution was stirred for an additional 2 h at RT. The
Example A22 precipitate was filtered and washed with EtOH and ether
to yield 1-(quinolin-3-yl)hydrazine hydrochloride (4.5 g, 81%
yield), which was used in the next reaction without further
purification.
[0592] A mixture of 1-(quinolin-3-yl)hydrazine hydrochloride (4 g,
20.5 mmol) and 4,4-dimethyl-3-oxo-pentanenitrile (3.6 g, 30 mol) in
EtOH (50 mL) and conc. HCl (5 mL) was heated at reflux overnight.
After removal of the solvent, the residue was purified by column
chromatography to yield
3-t-butyl-1-(quinolin-3-yl)-1H-pyrazol-5-amine (3.0 g, 55% yield).
.sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 9.16 (d, J=2.4 Hz,
1H), 8.44 (d, J=2.4 Hz, 1H), 8.03 (s, 1H), 8.00 (s, 1H), 7.72 (t,
J=7.2 Hz, 1H), 7.64 (t, J=7.2 Hz, 1H), 5.72 (s, 1H), 5.45 (s, 3H),
1.23 (s, 9H). ##STR448##
[0593] Using general method A, Example A22 (134 mg, 0.5 mmoL) and
1-chloro-4-isocyanatobenzene (90 mg, 0.6 mmoL) were combined to
afford
1-(3-t-butyl-1-(quinolin-3-yl)-1H-pyrazol-5-yl)-3-(4-chlorophenyl)urea
(100 mg, 48% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
9.10 (s, 1H), 9.07 (d, J=2.4 Hz, 1H), 8.67 (s, 1H), 8.54 (d, J=2.4
Hz, 1H), 8.10 (s, 1H), 8.07 (s, 1H), 7.81 (t, J=8.4 Hz, 1H), 7.68
(t, J=8.4 Hz, 1H), 7.41 (d, J=8.7 Hz, 2H), 7.27 (t, J=8.7 Hz, 2H),
6.45 (s, 1H), 1.30 (s, 9H). ##STR449##
[0594] Using general method A, Example A22 (133 mg, 0.5 mmoL) and
2,3-dichlorophenyl isocyanate (0.6 mmol) were combined to afford
1-[3-t-butyl-1-(quinolin-3-yl)-1H-pyrazol-5-yl]-3-(2,3-dichlorophenyl)ure-
a. ##STR450##
[0595] To a solution of 1,8-naphthalic anhydride (25 g, 0.13 mol)
in conc. H.sub.2SO.sub.4 (100 mL) was added dropwise a solution of
conc. HNO.sub.3 (7.85 g, 0.13 mol) in conc. H.sub.2SO.sub.4 (25 mL)
at 0.degree. C. After the addition was complete, the resulting
mixture was allowed to warm to RT, stirred for 90 min and then
poured into ice-H.sub.2O. The solid was filtered by suction, washed
with H.sub.2O, and re-crystallized from glacial AcOH to yield
3-nitro-1,8-naphthalic anhydride (24.5 g). .sup.1H NMR (300 MHz,
CDCl.sub.3): .delta. 9.11 (s, 1H), 9.06 (s, 1H), 8.58 (d, J=7.5 Hz,
1H), 8.43 (d, J=7.8 Hz, 1H), 7.82 (t, J=7.8 Hz, 1H).
[0596] To a solution of 3-nitro-1,8-naphthalic anhydride (21.8 g,
89.7 mmol) in H.sub.2O (550 mL) containing 14.4 g of NaOH was added
a solution of yellow HgO (25.1 g) in a mixture of H.sub.2O (75 mL)
and glacial AcOH (25 mL). After reflux for 4 days, the reaction
mixture was cooled and filtered to afford the mercurated product,
which was then refluxed in 700 mL of 5N HCl for 3 h. The
cream-colored precipitate was filtered, washed with cold H.sub.2O,
dried, and recrystallized from hot glacial AcOH to yield
3-nitronaphthalene-1-carboxylic acid (12 g). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 13.7 (brs, 1H), 9.18 (s, 1H), 8.93 (d, J=8.4
Hz, 1H), 8.70 (s, 1H), 7.88 (t, J=7.8 Hz, 1H), 7.76 (t, J=6.9 Hz,
1H).
[0597] To a solution of 3-nitronaphthalene-1-carboxylic acid (4.34
g, 20 mmol) in EtOH (50 mL) was added SOCl.sub.2 (3.70 mL, 30 mmol)
at 0.degree. C. The mixture was heated at reflux for 2 h and then
concentrated. The residue was recrystallized from EtOH to yield
ethyl 3-nitronaphthalene-1-carboxylate (4.2 g). .sup.1H NMR (300
MHz, DMSO-d.sub.6): .delta. 9.16 (s, 1H), 8.77 (d, J=8.7 Hz, 1H),
8.62 (s, 1H), 8.34 (d, J=8.1 Hz, 1H), 7.87 (t, J=7.2 Hz, 1H), 7.75
(t, J=7.2 Hz, 1H), 4.43 (q, J=7.2 Hz, 2H), 1.38 (t, J=7.2 Hz,
3H).
[0598] A mixture of 3-nitronaphthalene-1-carboxylic acid ethyl
ester (2.45 g, 10 mmol) and Pd/C (0.3 g) in EtOH (20 mL) was
stirred overnight at RT under 35 psi of H.sub.2. After filtration,
the filtrate was concentrated to yield ethyl
3-aminonaphthalene-1-carboxylate (2.04 g). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 8.63 (m, 1H), 7.93-7.97 (m, 2H), 7.84 (s,
1H), 7.54-7.57 (m, 2H), 4.39 (q, J=7.2 Hz, 2H), 1.35 (t, J=7.2 Hz,
3H).
[0599] To a solution of 3-aminonaphthalene-1-carboxylic acid ethyl
ester (2 g, 9.3 mmol) in conc. HCl (2 mL) was added dropwise an
aqueous solution of NaNO.sub.2 (0.63 g, 9.3 mmol) at 0.degree. C.
The resulted mixture was stirred for 1 h and then treated dropwise
with a solution of SnCl.sub.2.2H.sub.2O (4.2 g, 18.6 mmol) in conc.
HCl (10 mL) at 0.degree. C. The reaction mixture was stirred for 2
h at RT. precipitate was collected and washed with EtOH and
Et.sub.2O to yield ethyl 3-hydrazinonaphthalene-1-carboxylate
hydrochloride as a white solid (1.5 g), which was used for the next
reaction without further purification.
[0600] A mixture of 3-hydrazinonaphthalene-1-carboxylic acid ethyl
ester hydrochloride (1.5 g, 5.6 mmol) and
4,4-dimethyl-3-oxopentanenitrile (875 mg, 7.0 mmol) in EtOH (50 mL)
and conc. HCl (5 mL) was heated at reflux overnight. After removal
of the solvent, the residue was purified by column chromatography
to yield ethyl 3-(5-amino-3-t-butyl-1H-pyrazol-1-yl)-1-naphthoate
(1.8 g, 95% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
8.74 (d, J=6.3 Hz, 1H), 8.47 (s, 1H), 8.24 (s, 1H), 8.15 (d, J=6.0
Hz, 1H), 7.76 (t, J=5.7 Hz, 1H), 7.71 (t, J=5.7 Hz, 1H), 5.68 (s,
1H), 4.44 (q, J=5.4 Hz, 2H), 1.37 (t, J=5.4 Hz, 3H), 1.30 (s, 9H).
##STR451##
[0601] In EtOAc (25 mL) at RT was stirred Example A23 (1.20 g, 3.21
mmol), to this was added saturated NaHCO.sub.3 (20 mL). The mixture
was stirred for 20 min and then treated dropwise with Troc-Cl (0.66
mL). The mixture was stirred vigorously overnight at RT, then
diluted with EtOAc (50 mL) and H.sub.2O (50 mL). The organic phase
was separated, washed with 5% citric acid (50 mL), brine (50 mL),
dried (Na.sub.2SO.sub.4) and concentrated yield an oil. This oil
was dissolved in hexane (15 mL), warmed to reflux and then cooled
to precipitate. The solids were collected by filtration and dried
at 65.degree. C. under reduced pressure to yield 885 mg of ethyl
3-(3-t-butyl-5-((2,2,2-trichloroethoxy)carbonylamino)-1H-pyrazol-1-yl)-1--
naphthoate. This material was used without further purification.
##STR452##
[0602] Using general method A, Example A23 (500 mg, 1.3 mmol) and
1,2-dichloro-3-isocyanatobenzene (243 mg, 1.3 mmol) were combined
afford
3-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]pyrazol-1-yl}naphthalene-1-c-
arboxylic acid ethyl ester (265 mg, 39%). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.32 (s, 1H), 8.72 (d, J=6.3 Hz, 2H), 8.33
(d, J=2.1 Hz, 1H), 8.22 (d, J=2.1 Hz, 1H), 8.10 (d, J=7.8 Hz, 1H),
7.98 (t, J=5.1 Hz, 1H), 7.71-7.62 (m, 2H), 7.26 (d, J=4.8 Hz, 2H),
6.42 (s, 1H), 4.36 (q, J=7.2 Hz, 2H), 1.29 (t, J=7.2 Hz, 3H), 1.27
(s, 9H); MS (ESI) m/z: 525 (M+H.sup.+). ##STR453##
[0603] Using general method D, Example A24 (180 mg, 0.351 mmol),
and 3,5-difluoroaniline (59 mg, 0.456 mmol) were combined to yield
ethyl
3-(3-t-butyl-5-(3-(3,5-difluorophenyl)ureido)-1H-pyrazol-1-yl)-1-naphthoa-
te (100 mg, 57% yield). MS (ESI) m/z: 493.0 (M+H.sup.+).
[0604] Using general method C, this ester (100 mg, 0.203 mmol) was
reduced to yield
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(3,5-
-difluorophenyl)urea (71 mg, 78% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 1.31 (s, 9H), 5.03 (s, 2H), 5.305.60 (brs,
1H), 6.44 (s, 1H), 6.76-6.81 (m, 1H), 7.11-7.12 (d, 2H), 7.59-7.61
(m, 2H), 7.72 (s, 1H), 7.95-8.10 (m, 3H), 8.65 (s, 1H), 9.38 (s,
1H). MS (ESI) m/z: 451.0 (M+H.sup.+). ##STR454##
[0605] Using general method C, Example 58 (150 mg 0.29 mmol) in
anhydrous THF (10 mL) was reduced to afford
1-[5-t-butyl-2-(4-hydroxymethylnaphthalen-2-yl)-2H-pyrazol-3-yl]-3-(2,3-d-
ichloro-[phenyl)urea (98 mg, 70% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta.9.33 (s, 1H), 8.81 (s, 1H), 8.08 (d, J=8.4
Hz, 3H), 7.98 (s, 1H), 7.75 (s, 1H), 7.65-7.60 (m, 2H), 7.32 (t,
J=9.9 Hz, 2H), 6.47 (s, 1H) 5.52 (t, J=6.3 Hz, 1H), 5.05 (d, J=6.3
Hz, 2H), 1.32 (s, 9H). MS (ESI) m/z: 483 (M+H.sup.+).
##STR455##
[0606] Using general method A, Example A23 (169 mg, 0.5 mmol) and
1-chloro-4-isocyanato-benzene (92 mg) were combined to afford ethyl
3-{3-t-butyl-5-[3-(4-chlorophenyl)ureido]-1H-pyrazol-1-yl}naphthoate
(180 mg, 73% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
9.18 (s, 1H), 8.72 (d, J=8.1 Hz, 1H), 8.64 (s, 1H), 8.33 (s, 1H),
8.23 (s, 1H), 8.09 (d, J=7.5 Hz, 1H), 7.62-7.71 (m, 2H), 7.39 (d,
J=8.7 Hz, 2H), 7.24-7.27 (d, J=8.7 Hz, 2H), 6.40 (s, 1H), 4.37 (q,
J=6.9 Hz, 2H), 1.29 (t, J=6.9 Hz, 3H), 1.28 (s, 9H).
[0607] Using general method C, ethyl
3-{3-t-butyl-5-[3-(4-chlorophenyl)ureido]-1H-pyrazol-1-yl}naphthoate
(100 mg, 0.20 mmol) was reduced to afford
1-[3-t-butyl-2-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl]-3-(4-c-
hlorophenyl)urea (50 mg, 56% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.20 (brs, 1H), 8.58 (brs, 1H), 8.06 (m,
1H), 7.97 (ms, 1H), 7.93 (s, 1H), 7.70 (s, 1H), 7.57 (m, 2H), 7.38
(d, J=9.0 Hz, 2H), 7.25 (d, J=9.0 Hz, 2H), 6.39 (s, 1H), 5.45 (t,
J=5.1 Hz, 1H), 5.00 (d, J=5.1 Hz, 2H), 1.28 (s, 9H). ##STR456##
[0608] Using general method D, Example A24 (120 mg, 0.234 mmol),
and 2,3,4-trifluoroaniline (35 mg, 0.234 mmol) were combined to
yield ethyl 3-(3-t-butyl-5-(3-(2,3,4-trifluoro
phenyl)ureido)-1H-pyrazol-1-yl)-1-naphthoate as an oil.
[0609] Using general method C, ethyl
3-(3-t-butyl-5-(3-(2,3,4-trifluoro
phenyl)ureido)-1H-pyrazol-1-yl)-1-naphthoate (120 mg, 0.240 mmol)
was reduced to yield
1-(3-t-butyl-1-(4-(hydroxylmethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,-
3,4-trifluorophenyl)urea (14 mg, 13% yield). .sup.1H-NMR (400 MHz,
DMSO-d.sub.6): .delta. 1.30 (s, 9H), 5.02-5.05 (m, 2H), 5.49 (m,
1H), 6.45 (s, 1H), 7.20-7.30 (m, 1H), 7.60-8.10 (m, 8H), 8.92 (s,
1H), 9.06 (s, 1H). MS (ESI) m/z: 469.2 (M+H.sup.+). ##STR457##
[0610] Using general method D, Example A24 (120 mg, 0.234 mmol) and
2,4-difluoroaniline (30 mg, 0.234 mmol) were combined to yield
ethyl
3-(3-t-butyl-5-(3-(2,4-difluorophenyl)ureido)-1H-<pyrazol-1-yl)-1-naph-
thoate (89 mg, 21% yield). .sup.1H-NMR (400 MHz, DMSO-d.sub.6):
.delta. 1.25-1.31 (m, 3H), 1.29 (s, 9H), 4.39-4.47 (m, 2H), 6.45
(s, 1H), 7.02-7.03 (m, 1H), 7.28-7.29 (m, 1H), 7.68-7.73 (m, 2H),
7.99-8.01 (m, 1H), 8.13-8.15 (m, 1H), 8.24 (brs, 1H), 8.36 (s, 1H),
8.76-8.78 (m, 1H), 8.84 (s, 1H), 8.91 (s, 1H); MS (ESI) m/z: 493.2
(M+H.sup.+).
[0611] Using general method C, ethyl
3-(3-t-butyl-5-(3-(2,4-difluorophenyl)ureido)-1H-pyrazol-1-yl)-1-naphthoa-
t (68 mg, 0.14 mmol) was reduced to yield
1-(3-t-butyl-1-(4-(hydroxylmethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,-
4-difluorophenyl)urea (13 mg, 22% yield). .sup.1H-NMR (400 MHz,
DMSO-d.sub.6): .delta. 1.30 (s, 9H), 5.04-5.05 (m, 2H), 5.45 (m,
1H), 6.44 (s, 1H), 7.03-7.10 (m, 1H), 7.25-7.30 (m, 1H), 7.59-7.62
(m, 2H), 7.71 (brs, 1H), 7.95 (s, 1H), 8.02-8.10 (m, 3H), 8.88 (s,
2H); MS (ESI) m/z: 451.2 (M+H.sup.+). ##STR458##
[0612] Using general method D, Example A24 (120 mg, 0.234 mmol) and
2,4,5-trifluoroaniline (35 mg, 0.234 mmol) were combined to yield
3-(3-t-butyl-5-(3-(2,4,5-trifluorophenyl)ureido)-1H-pyrazol-1-yl)-1-napht-
hoate (120 mg, 19% yield). .sup.1H-NMR (400 MHz, DMSO-d.sub.6):
.delta. 1.25-1.31 (m, 3H), 1.29 (s, 9H), 4.39-4.47 (m, 2H), 6.45
(s, 1H), 7.02-7.03 (m, 1H), 7.28-7.29 (m, 1H), 7.68-7.73 (m, 2H),
7.99-8.01 (m, 1H), 8.13-8.15 (m, 1H), 8.24 (brs, 1H), 8.36 (s, 1H),
8.76-8.78 (m, 1H), 8.84 (s, 1H), 8.91 (s, 1H); MS (ESI) m/z: 493.2
(M+H.sup.+).
[0613] Using general method C,
3-(3-t-butyl-5-(3-(2,4,5-trifluorophenyl)ureido)-1H-pyrazol-1-yl)-1-napht-
hoate (126 mg, 0.250 mmol) was reduced to yield
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,4-
,5-trifluorophenyl)urea (22 mg). .sup.1H-NMR (400 MHz,
DMSO-d.sub.6): .delta. 1.30 (s, 9H), 5.04-5.05 (m, 2H), 5.48-5.50
(m, 1H), 6.46 (s, 1H), 7.58-7.71 (m, 4H), 7.95-8.19 (m, 4H), 8.97
(s, 1H), 9.11 (s, 1H). MS (ESI) m/z: 469.2 (M+H.sup.+).
##STR459##
[0614] Using general method D, Example A24 (180 mg, 0.351 mmol) and
1,2,3,5-trifluoroaniline (68 mg, 0.456 mmol) were combined to yield
3-(3-t-butyl-5-(3-(2,3,5-trifluorophenyl)ureido)-1H-pyrazol-1-yl)-1-napht-
hoate (120 mg, 32% yield).
[0615] Using general method C,
3-(3-t-butyl-5-(3-(2,3,5-trifluorophenyl)ureido)-1H-pyrazol-1-yl)-1-napht-
hoate (52 mg, 0.20 mmol) was reduced to yield
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,3-
,5-trifluorophenyl)urea (24 mg, 50%). .sup.1H-NMR (400 MHz,
DMSO-d.sub.6): .delta. 1.31 (s, 9H), 5.04-5.05 (d, 2H), 5.49 (t,
1H), 6.48 (s, 1H), 7.10-7.12 (m, 1H), 7.59-7.71 (m, 3H), 7.86-7.90
(m, 1H), 7.96 (s, 1H), 8.03-8.11 (m, 2H), 9.07 (s, 1H), 9.35 (s,
1H); MS (ESI) m/z: 469.0 (M+H.sup.+). ##STR460##
[0616] Using general method D, Example A24 (120 mg, 0.234 mmol) and
3,4,5-trifluoroaniline (35 mg, 0.234 mmol) were combined to yield
3-(3-t-butyl-5-(3-(3,4,5-trifluorophenyl)ureido)-1H-pyrazol-1-yl)-1-napht-
hoate (147 mg, 123% yield). This material was used directly in the
next reaction without purification.
[0617] Using general method C,
3-(3-t-butyl-5-(3-(3,4,5-trifluorophenyl)ureido)-1H-pyrazol-1-yl)-1-napht-
hoate (52 mg, 0.203 mmol) was reduced to yield
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(3,4-
,5-trifluorophenyl)urea (46 mg, 35% yield). .sup.1H-NMR (400 MHz,
DMSO-d.sub.6): .delta. 1.31 (s, 9H), 5.02-5.04 (m, 2H), 5.48 (t,
J=5.5 Hz, 1H), 6.43 (s, 1H), 7.29-7.33 (m, 2H), 7.58-7.62 (m, 2H),
7.72 (s, 1H), 7.94 (s, 1H), 7.99-8.02 (m, 1H), 8.07-8.09 (m, 1H),
8.67 (s, 1H), 9.31 (s, 1H); MS (ESI) m/z: 469.2 (M+H.sup.+).
##STR461##
[0618] Using general method D, Example A24 (130 mg, 0.24 mmol) and
Example A9 (35 mg, 0.234 mmol) were combined to yield
3-(3-t-butyl-5-(3-(3-(pyridin-3-yloxy)phenyl)ureido)-1H-pyrazol-1-yl)-1-n-
aphthoate (122 mg, 91% yield).
[0619] Using general method C,
3-(3-t-butyl-5-(3-(3-(pyridin-3-yloxy)phenyl)ureido)-1H-pyrazol-1-yl)-1-n-
aphthoate (52 mg, 0.203 mmol) was reduced to yield
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(3-(-
pyridin-3-yloxy)phenyl)urea (24 mg, 21% yield). .sup.1H-NMR (400
MHz, DMSO-d.sub.6): .delta. 1.30 (s, 9H), 5.03 (s, 2H), 6.41 (s,
1H), 6.67 (d, 1H), 7.07 (d, 1H), 7.24-7.30 (m, 2H), 7.43-7.45 (m,
2H), 7.59-7.61 (m, 2H), 7.71 (s, 1H), 7.95 (s, 1H), 8.00-8.10 (m,
2H), 8.36-8.39 (m, 2H), 8.49 (s, 1H), 9.15 (s, 1H); MS (ESI) m/z:
508.3 (M+H.sup.+). ##STR462##
[0620] Using general method C, Example A24 (2.0 g, 6.0 mmol) was
reduced to yield
[3-(5-amino-3-t-butyl-pyrazol-1-yl)naphthalen-1-yl]methanol (1.6 g,
92% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 8.05 (m,
1H), 7.88-7.96 (m, 2H), 7.91 (s, 1H), 7.48-7.52 (m, 2H), 5.40 (s,
1H), 5.38 (t, J=5.4 Hz, 1H), 5.28 (brs, 2H), 4.97 (d, J=5.4 Hz,
2H), 1.24 (s, 9H); MS (ESI) m/z: 296 (M+H.sup.+).
[0621] To
[3-(5-amino-3-t-butyl-pyrazol-1-yl)naphthalen-1-yl]methanol (1.6 g,
5.4 mmol) in THF (20 mL) was added SOCl.sub.2 (3.0 g, 25 mmol). The
mixture was heated at reflux for 3 h and then concentrated under
pressure to yield crude
3-t-butyl-1-[4-(chloromethyl)naphthalen-2-yl]-1H-pyrazol-5-amine
(1.5 g), which was used for the next reaction without further
purification. MS (ESI) m/z: 314 (M+H.sup.+).
[0622] To a solution of
3-t-butyl-1-[4-(chloromethyl)naphthalen-2-yl]-1H-pyrazol-5-amine
(1.5 g, 4.8 mmol) in DMF (8 mL) was added NaN.sub.3 (325 mg, 5.0
mmol). The mixture was stirred at RT overnight, then poured into
ice-H.sub.2O and extracted with EtOAc (3.times.100 mL). The
combined organic extracts were washed with brine, dried
(Na.sub.2SO.sub.4), filtered, concentrated and purified via column
chromatography to afford
1-[4-(azidomethyl)naphthalen-2-yl]-3-t-butyl-1H-pyrazol-5-amine
(1.35 g, 88% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
8.06 (m, 2H), 8.04 (m, 1H), 7.85 (s, 1H), 7.54-7.57 (m, 2H), 5.41
(s, 1H), 5.35 (brs, 2H), 4.96 (s, 2H), 1.21 (s, 9H); MS (ESI) m/z:
321 (M+H.sup.+). ##STR463##
[0623] Using general method A, Example A25 (400 mg, 1.25 mmol) and
1-chloro-4-isocyanatobenzene (230 mg, 1.5 mmol) were combined to
afford
1-[1-(4-(azidomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl]-3-(4-chl-
orophenyl)urea (360 mg, 61% yield). MS (ESI) m/z: 474
(M+H.sup.+).
[0624] A mixture of
1-[1-(4-(azidomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl]-3-(4-chl-
orophenyl)urea (350 mg, 0.74 mmol) and 10% Pd/C (60 mg) in MeOH (20
mL) was stirred at RT under 20 psi of H.sub.2 for 3 h and then
filtered. The filtrate was concentrated to yield the crude product,
which was purified by reverse phase chromatography to afford the
product as the TFA salt. A solution of the TFA salt in
MeCN/H.sub.2O (50 mL) was basified to pH 10 with 1N
Na.sub.2CO.sub.3. After lyophylization, the residue was dissolved
in THF and filtered. The filtrate was adjusted to pH 6 with 1N
HCl/MeOH (2.0 mL) and then concentrated to afford
1-[1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl]-3-(4-chl-
orophenyl)urea (190 mg, 57% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.80 (s, 1H), 8.88 (s, 1H), 8.49 (brs, 3H),
8.17-8.18 (m, 2H), 8.08 (d, J=7.2 Hz, 1H), 7.85 (s, 1H), 7.64-7.65
(m, 2H), 7.41 (d, J=6.6 Hz, 2H), 7.21 (d, J=6.6 Hz, 2H), 6.44 (s,
1H), 4.61 (d, J=5.2 Hz, 2H), 1.29 (s, 9H); MS (ESI) m/z: 448
(M+H.sup.+). ##STR464##
[0625] Using the same procedure as for Example 68, Example A25 (400
mg, 1.25 mmol) and 1,2-dichloro-3-isocyanatobenzene (280 mg, 1.5
mmol) were combined to afford
1-[1-(4-(azidomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl]-3-(2,3-d-
ichlorophenyl)urea (330 mg, 52% yield). MS (ESI) m/z: 508
(M+H.sup.+). This material (320 mg, 0.63 mmol) was reduced to
afford
1-[1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl]-3-(2,3-d-
ichlorophenyl)urea (185 mg, 61% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.71 (s, 1H), 9.04 (s, 1H), 8.53 (brs, 3H),
8.18 (s, 2H), 8.08 (d, J=4.8 Hz, 1H), 7.94 (t, J=6.3 Hz, 1H), 7.89
(s, 1H), 7.62-7.68 (m, 2H), 7.25 (d, J=4.2 Hz, 1H), 6.44 (s, 1H),
4.61 (s, 2H), 1.30 (s, 9H); MS (ESI) m/z: 482 (M+H.sup.+).
##STR465##
[0626] Using general method C, Example A25 (2.0 g, 6.0 mmol) was
reduced to yield
1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-amine,
which was immediately protected as the Boc-amine under standard
conditions to yield crude t-butyl
(3-(5-amino-3-t-butyl-1H-pyrazol-1-yl)naphthalen-1-yl)methylcarbamate
(3.1 g) which was used without further purification. Using general
method D, this crude material (3.1 g, 7.9 mmol) was transformed to
yield the desired product as a tan-colored foam (5.1 g, 114%
yield). .sup.1H NMR (300 MHz, CDCl.sub.3): .delta. 8.11 (brd, J=7.6
Hz, 1H), 7.92 (dd, J=2.0, and 7.2 Hz, 1H), 7.85 (d, J=2.0 Hz, 1H),
7.93 (m, 3H), 6.89 (bs, 1H), 6.50 (brs, 1H), 4.94 (brs, 1H), 4.86
(d, J=4.0 Hz, 2H), 4.84 (s, 2H), 1.49 (s, 9H), 1.40 (s, 9H); MS
(EI) m/z: 569.0 (M+H.sup.+). ##STR466##
[0627] Using general method D, Example A26 (1.0 g, 1.75 mmol), and
2,3,5-trifluoroaniline (0.31 g, 2.11 mmol) were combined to yield
t-butyl
(3-(3-t-butyl-5-(3-(2,3,5-trifluorophenyl)ureido)-1H-pyrazol-1-yl)naphtha-
len-1-yl)methylcarbamate. LC-MS (EI) m/z: 568.2 (M+H.sup.+). To
this material, dissolved in EtOAc (5 mL) was added 3N HCl/EtOAc
(5.85 mL). The solution was stirred at room temperature for 3 h.
The solid was filtered and dried under vacuum to obtain
1-(1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3,5-
-trifluorophenyl)urea HCl salt as a white solid (0.31 g, 38%
yield). .sup.1H-NMR (400 MHz, DMSO-d.sub.6): .delta. 9.49 (brs,
1H), 9.29 (brs, 1H), 8.42 (brs, 2H), 8.22 (d, J=7.2 Hz, 1H), 8.18
(brs, 1H), 8.12 (dd, J=2.4, and 6.8 Hz, 1H), 7.83 (m, 2H), 7.69 (m,
2H), 7.12 (m, 1H), 6.50 (s, 1H), 4.64 (q, J=6.0 Hz, 2H), 1.32 (s,
9H); LC-MS (EI) m/z: 468.2 (M+H.sup.+). ##STR467##
[0628] Using the same procedure as for Example 70, Example A26 and
2,4,5-trifluoroaniline were combined to afford
1-(1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,4,5-
-trifluorophenyl)urea as a white solid (0.45 g, 56% yield).
.sup.1H-NMR (400 MHz, DMSO-d.sub.6): .delta. 9.24 (brs, 1H), 9.19
(brs, 1H), 8.42 (brs, 2H), 8.21 (d, J=7.2 Hz, 1H), 8.18 (brs, 1H),
8.12 (m, 2H), 7.85 (brs, 1H), 7.5-7.7 (m, 3H), 6.49 (s, 1H), 4.64
(q, J=6.0 Hz, 2H), 1.32 (s, 9H); LC-MS (EI) m/z: 468.2 (M+H.sup.+).
##STR468##
[0629] Using the same procedure as for Example 70, Example A26 and
Example A9 were combined to yield
1-(1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(py-
ridin-3-yloxy)phenyl)urea (87 mg, 86% yield). .sup.1H-NMR (400 MHz,
DMSO-d.sub.6): .delta. 8.45 (m, 4H), 8.19 (m, 2H), 8.11 (m, 1H),
7.88 (m, 1H), 7.68 (m, 1H), 7.0-7.6 (m,5H), 6.68 (m, 1H), 6.44 (s,
1H), 4.64 (q, J=6.0 Hz, 2H), 1.33 (s, 9H); LC-MS (EI) m/z: 507.2
(M+H.sup.+). ##STR469##
[0630] Using the same procedure as for Example 70, Example A26 was
combined with 3-aminobenzonitrile to afford
1-(1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-cya-
nophenyl)urea as a white solid. (67 mg, 66% yield). .sup.1H-NMR
(DMSO-d.sub.6): .delta. 8.45 (m, 4H), 8.19 (m, 2H), 8.11 (m, 1H),
7.88 (m, 1H), 7.68 (m, 1H), 7.0-7.6 (m,5H), 6.68 (m, 1H), 6.44 (s,
1H), 4.64 (q, J=6.0 Hz, 2H), 1.33 (s, 9H); LC-MS (EI) m/z: 507.2
(M+H.sup.+). ##STR470##
[0631] Using the same procedure as Example 122, Example 68 (140 mg,
0.31 mmol) was transformed to yield
1-{3-t-butyl-1-[1-(methanesulfonylureidoamidomethyl)naphthalen-3-yl]-1H-p-
yrazol-5-yl}-3-(4-chlorophenyl-1-yl)urea (45 mg, 26% yield).
.sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 9.27 (brs, 1H), 8.55
(brs, 1H), 8.11 (m, 1H), 8.00 (m, 1H), 7.92 (s, 1H), 7.55-7.58 (m,
3H), 7.38 (d, J=8.4 Hz, 2H), 7.19 (t, J=9.0 Hz, 2H), 6.39 (s, 1H),
4.69 (s, 2H), 2.95 (s, 3H), 1.28 (s, 9H); MS (ESI) m/z: 569
(M+H.sup.+). ##STR471##
[0632] Using the same procedure as Example 122, Example 69 (135 mg,
0.28 mmol) was transformed to yield
1-{3-t-butyl-1-[1-(methanesulfonylureidoamidomethyl)naphthalen-3-yl]-1H-p-
yrazol-5-yl}-3-(2,3-dichlorophenyl-1-yl)urea (50 mg, 30% yield).
.sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 9.29 (brs, 1H), 8.81
(s, 1H), 8.15 (m, 1H), 7.99-8.00 (m, 2H), 7.92 (s, 1H), 7.55-7.58
(m, 3H), 7.26 (d, J=4.5 Hz, 2H), 6.42 (s, 1H), 4.71 (s, 2H), 2.88
(s, 3H), 1.28 (s, 9H); MS (ESI) m/z: 603 (M+H.sup.+).
##STR472##
[0633] A solution of 3-nitronaphthalene-1-carboxylic acid (10 g, 46
mmol, available from Example A23) in SOCl.sub.2 (50 mL) was heated
at reflux for 3 h. After removal of the solvent, the resultant
3-nitro-napthalene-1-carbonyl chloride was used without further
purification (8.4 g, 78% yield).
[0634] A 2-necked round-bottomed flask, equipped with a dropping
funnel and distillation apparatus was cooled in acetone-dry ice
bath. A mixture of KOH (12 g, 0.2 mmol) in 20 mL of H.sub.2O and 60
mL of Carbitol.RTM. (2(2-ethoxyethoxy)ethanol) was heated at
70.degree. C. and a solution of
N-methyl-N-nitroso-p-toluenesulfonamide (42.5 g, 0.2 mmol) in 300
mL of Et.sub.2O was added dropwise. The ethereal diazomethane
solution (250 mL, 83%) was collected at -20.degree. C. and then
used directly in the next reaction.
[0635] To a solution of 3-nitro-napthalene-1-carbonyl chloride (8.4
g, 35.7 mmol) in anhydrous THF (70 mL) was added an ethereal
solution of diazomethane (250 mL) dropwise at 0.degree. C. The
reaction mixture was stirred for 5 h, and then warmed to RT
overnight. Excess diazomethane was decomposed by the dropwise
addition of AcOH (50 mL). The mixture was extracted with Et.sub.2O
(3.times.150 ml), washed with brine and saturated NaHCO.sub.3
aqueous solution, dried and filtered. The filtrate was concentrated
to give the crude product, which was purified by column
chromatography to yield 2-diazo-1-(3-nitronaphthalen-1-yl)ethanone
(7.0 g, 81% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
9.14 (s, 1H), 8.47 (d, J=7.2 Hz, 1H), 8.35 (d, J=7.2 Hz, 1H), 8.35
(s, 1H), 7.84 (t, J=7.2 Hz, 2H), 7.76 (t, J=7.8 Hz, 2H), 6.84 (s,
1H); MS (ESI) m/z: 242 (M+H.sup.+).
[0636] To a mixture of 2-diazo-1-(3-nitronaphthalen-1-yl)ethanone
(3 g, 12.4 mmol) in EtOH (40 mL) was heated at 70.degree. C. added
AgOAc (300 mg, 1.8 mmol). The resulting mixture was stirred for 2
h. After filtration, the residue was washed with THF (3.times.30
mL). The combined organic layers were concentrated to the crude
product, which was recrystallized from EtOH to give
(3-nitronaphthalen-1-yl)acetic acid ethyl ester (2.1 g, 66% yield).
.sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 8.92 (s, 1H), 8.29 (d,
J=8.1 Hz, 1H), 8.21 (s, 1H), 8.02 (d, J=8.1 Hz, 1H), 7.79 (t, J=7.2
Hz, 1H), 7.70 (t, J=7.2 Hz, 1H), 4.30 (s, 2H), 4.06 (d, J=7.2 Hz,
2H), 1.14 (t, J=7.2 Hz, 3H); MS (ESI) m/z: 260 (M+H.sup.+).
[0637] A mixture of (3-nitronaphthalen-1-yl)-acetic acid ethyl
ester (3 g, 11.58 mmol) and 10% Pd/C (300 mg) in EtOH (100 mL) was
stirred under H.sub.2 atmosphere (45 psi) at RT overnight. The
mixture was filtered over Celite.RTM. and washed with EtOH. The
filtrate was concentrated to afford (3-aminonaphthalen-1-yl)-acetic
acid ethyl ester, which was put to the next reaction without
further purification. .sup.1H NMR (300 MHz, DMSO-d.sub.6), .delta.
7.65 (d, J=8.1 Hz, 1H), 7.48 (d, J=8.1 Hz, 1H), 7.27 (t, J=8.1 Hz,
1H), 7.08 (t, J=8.1 Hz, 1H), 6.85 (s, 1H), 6.73 (s, 1H), 5.35 (s,
2H), 4.06 (d, J=7.2 Hz, 2H), 3.94 (s, 2H), 1.14 (t, J=7.2 Hz, 3H);
MS (ESI) m/z: 260 (M+H.sup.+).
[0638] To a mixture of (3-aminonaphthalen-1-yl)acetic acid ethyl
ester (2.7 g, 11.8 mmol) in conc. HCl (20 mL) was added an aqueous
solution of NaNO.sub.2 (0.9 g, 13 mmol) dropwise at 0-5.degree. C.
The resulting mixture was stirred at 0.degree. C. for 30 min and
then treated with a solution of SnCl.sub.2.2H.sub.2O (5.9 g, 26.2
mmol) in conc. HCl at such a rate that the reaction temperature
never rose above 5.degree. C. After the addition was completed, the
mixture was stirred for another 2 h at RT. The precipitate was
collected by filtration and washed with ethyl ether to afford
(3-hydrazinonaphthalen-1-yl)-acetic acid ethyl ester hydrochloride
as a brown solid (2.3 g, 80% yield).
[0639] A solution of
[3-(5-amino-3-t-butyl-pyrazol-1-yl)naphthalen-1-yl]acetic acid
ethyl ester hydrochloride (3 g, 12.3 mmol) and
4,4-dimethyl-3-oxopentanenitrile (2.3 g, 18.4 mol) in alcohol (30
mL) containing concentrated hydrochloric acid (10 mL) was heated at
reflux overnight. After removed of the solvent, the precipitate was
collected by suction and washed with ethyl ether to afford
[3-(5-amino-3-t-butyl-pyrazol-1-yl)naphthalen-1-yl]acetic acid
ethyl ester hydrochloride as a yellow solid (3.5 g, 80% yield).
.sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 8.11 (s, 1H), 8.05 (m,
1H), 8.01 (m, 1H), 7.72 (s, 1H), 7.64 (m, 1H), 5.58 (s, 1H), 4.27
(s, 2H), 4.13 (d, J=7.2 Hz, 2H), 1.31 (s, 3H), 1.22 (t, J=7.2 Hz,
3H); MS (ESI) m/z: 352 (M+H.sup.+). ##STR473##
[0640] Using general method A, Example A27 (400 mg, 1.1 mmol) and
1,2-dichloro-3-isocyanatobenzene (800 mg, 4.2 mmol) were combined
to yield
3-{3-t-butyl-5-[3-(2,3-dichloro-phenyl)ureido]pyrazol-1-yl}naphthal-
en-1-yl)-acetic acid ethyl ester as a white solid (184 mg, 12.3%
yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 9.28 (s, 1H),
8.75 (s, 1H), 8.04-7.92 (m, 4H), 7.61-7.54 (m, 3H), 7.28-7.24 (m,
2H), 6.40 (s, 1H), 4.20 (s, 1H), 4.03 (q, J=7.2 Hz, 2H), 1.25 (s,
9H), 1.11 (t, J=7.2 Hz, 3H); MS (ESI) m/z: 539 (M+H.sup.+).
##STR474##
[0641] Using general method E, Example 76 (130 mg, 0.24 mmol) was
saponified to afford
2-(3-(3-t-butyl-5-(3-(2,3-dichlorophenyl)-ureido)-1H-pyrazol-1-yl)naphtha-
len-1-yl)acetic acid as a white solid (106 mg, 87% yield). .sup.1H
NMR (300 MHz, DMSO-d.sub.6): .delta. 9.39 (s, 1H), 8.83 (s, 1H),
8.03-7.97 (m, 4H), 7.63-7.54 (m, 3H), 7.30-7.23 (m, 2H), 6.42 (s,
1H), 4.11 (s, 2H), 1.27 (s, 9H); MS (ESI) m/z: 511 (M+H.sup.+).
##STR475##
[0642] Example 77 (500 mg, 0.98 mmol) was dissolved in a mixed
solvent of SOCl.sub.2 (5 mL) and DMF (1 mL). The mixture was
refluxed for 2 h, after which dry toluene was added and the solvent
was removed under vacuum. The process was repeated twice and the
crude product of acid chloride was obtained, which was dissolved in
dry THF immediately and cooled to -20.degree. C. NH.sub.3 was
bubbled through the solution for 15 min. The solution was allowed
to warm to RT, and the solvent was removed under reduced pressure
to yield a residue, which was purified by preparative HPLC to
provide
2-(3-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]pyrazol-1-yl}naphthalen-1-
-yl)acetamide (47 mg, 10% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): 9.41 (s, 1H), 8.81 (s, 1H), 8.09 (m, 1H), 7.99-7.93
(m, 3H), 7.60-7.56 (t, 4H), 7.27-7.24 (m, 2H), 7.00 (s, 1H), 6.40
(s, 1H), 3.84 (s, 2H), 1.26 (s, 1H); MS (ESI) m/z: 510 (M+H.sup.+).
##STR476##
[0643] Using general method D, Example A27 (1.50 g, 4.40 mmol) was
transformed to ethyl
2-(3-(3-t-butyl-5-((2,2,2-trichloroethoxy)carbonylamino)-1H-pyrazol-1-yl)-
naphthalen-1-yl)acetate (1.46 g, 63% yield). .sup.1H NMR (400 Mhz,
DMSO-d.sub.6): .delta. 1.31 (s, 9H), 3.62 (s, 3H), 4.23 (s, 2H),
4.84 (s, 2H), 6.35 (s, 1H), 7.57-7.63 (m, 3H), 7.93-7.98 (m, 3H),
10.09 (s, 1H); MS (ESI) m/z: 514.0 (M+H.sup.+). ##STR477##
[0644] In DMSO (2 mL) was placed Example A28 (120 mg, 0.266 mmol),
4-aminobenzonitrile (31 mg, 0.266 mmol) and i-Pr.sub.2NEt base (34
mg, 0.266 mmol). The mixture was stirred overnight at 65.degree.
C., cooled to RT and diluted with H.sub.2O (20 mL). The mixture was
diluted with EtOAc (20 mL) and the organic phase separated, washed
with 5% citric acid (20 mL), brine (20 mL), dried
(Na.sub.2SO.sub.4) and concentrated to yield methyl
2-(3-(3-t-butyl-5-(3-(4-cyanophenyl)-ureido)-1H-pyrazol-1-yl)naphthalen-1-
-yl)acetate as an oil (115 mg, 102% yield). This material was used
directly in the next reaction without purification.
[0645] Using general method E, the above ester (115 mg, 0.239 mmol)
was saponified to yield
2-(3-(3-t-butyl-5-(3-(4-cyanophenyl)ureido)-1H-pyrazol-1-yl)naphthalen-1--
yl)-acetic acid as a foam (81 mg, 73% yield). This material was
used directly in the next reaction without purification.
[0646] In DMF (1 mL) was placed the above acid (81 mg, 0.20 mmol),
HOBT (31 mg, 0.2 mmol) and EDC (50 mg, 0.2 mmol). The mixture was
stirred for 15 min and treated with a solution of 0.5M N.sub.3 in
dioxane (1 mL, 0.5 mmol) and stirred overnight at RT. Additional
EDC (30 mg) and 0.5M N.sub.3 in dioxane (1 mL, 0.5 mmol) were added
and the reaction stirred until all starting material was consumed.
The reaction mixture was diluted with EtOAc (15 mL) and 1N HCl (10
mL). The organic phase was separated, washed with 5% citric acid
(10 mL), satd. NaHCO.sub.3 (10 mL), brine (10 mL), dried
(Na.sub.2SO.sub.4), concentrated, and purified to yield
1-(1-(4-(2-amino-2-oxoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-
-yl)-3-(4-cyanophenyl)urea (17 mg, 21% yield). .sup.1H-NMR (400
MHz, DMSO-d.sub.6): .delta. 1.31 (s, 9H), 3.95 (s, 2H), 6.46 (s,
1H), 7.05 (s, 1H), 7.53-7.71 (m, 8H), 7.95-8.02 (m, 2H), 8.13-8.16
(m, 1H), 8.70 (s, 1H), 9.50 (s, 1H); MS (ESI) m/z: 467.3
(M+H.sup.+).
General Experimental for Examples 80-99:
[0647] The following compounds were prepared using the appropriate
aniline and the same procedures as for Example 79. For Examples
94-98, 1-amino-2,3-dihydroxypropane was used in place of ammonia.
For Example 99, serinol was used in place of ammonia.
TABLE-US-00005 MS (EI) Example Name (M + H.sup.+) .sup.1H NMR (400
MHz, DMSO-d.sub.6) ##STR478## 1-(1-(4-(2-amino-2-
oxoethyl)naphthalen- 2-yl)-3-t-butyl-1H- pyrazol-5-yl)-3- (2,3,4-
trifluorophenyl)urea 33 mg, 37% yield 496.3 .delta. 1.31 (s, 9H),
3.95 (s, 2H), 6.45 (s, 1H), 7.05 (brs, 1H), 7.25-7.27 (m, 1H),
7.58-7.62 (m, 4H), 7.84-8.16 (m, 4H), 8.94 (brs, 1H), 9.06 (s, 1H)
##STR479## 1-(1-(4-(2-amino-2- oxoethyl)naphthalen-
2-yl)-3-t-butyl-1H- pyrazol-5-yl)-3- (2,4,5- trifluorophenyl)urea
36 mg, 32% yield 496.3 .delta. 1.31 (s, 9H), 3.96 (s, 2H), 6.47 (s,
1H), 7.05 (s, 1H), 7.57-7.64 (m, 5H), 7.95 (brs, 1H), 8.02-8.04 (m,
1H), 8.14-8.22 (m, 2H), 8.99 (s, 1H), 9.12 (s, 1H) ##STR480##
1-(1-(4-(2-amino-2- oxoethyl)naphthalen- 2-yl)-3-t-butyl-1H-
pyrazol-5-yl)-3-(2,4- difluorophenyl)urea 53 mg, 62% yield 478.3
.delta. 1.30 (s, 9H), 3.95 (s, 2H), 6.45 (s, 1H), 7.03-7.05 (m,
2H), 7.26-7.29 (m, 1H), 7.58-7.61 (m, 4H), 7.95-8.16 (m, 4H), 8.90
(brs, 2H) ##STR481## 1-(1-(4-(2-amino-2- oxoethyl)naphthalen-
2-yl)-3-t-butyl-1H- pyrazol-5-yl)-3-(3,5- difluorophenyl)urea 33
mg, 56% yield 478.3 .delta. 1.31 (s, 9H), 3.95 (s, 2H), 6.45 (s,
1H), 6.70-6.80 (m, 1H), 7.04-7.13 (m, 3H), 7.59-7.62 (m, 4H), 7.95
(s, 1H), 7.99-8.02 (m, 1H), 8.14-8.16 (m, 1H), 8.65 (s, 1H), 9.37
(s, 1H) ##STR482## 1-(1-(4-(2-amino-2- oxoethyl)naphthalen-
2-yl)-3-t-butyl-1H- pyrazol-5-yl)-3-(4- fluorophenyl)urea 48 mg,
65% yield 460.2 .delta. 1.31 (s, 9H), 3.95 (s, 2H), 6.43 (s, 1H),
7.04-7.11 (m, 3H), 7.38-7.41 (m, 2H), 7.58-7.62 (m, 4H), 7.95 (brs,
1H), 8.00-8.02 (m, 1H), 8.14-8.16 (m, 1H), 8.48 (s, 1H), 9.01 (s,
1H) ##STR483## 1-(1-(4-(2-amino-2- oxoethyl)naphthalen-
2-yl)-3-t-butyl-1H- pyrazol-5-yl)-3- (2,3,5- trifluorophenyl)urea
61 mg, 53% yield 496.3 1.31 (s, 9H), 3.96 (s, 2H), 6.48 (s, 1H),
7.04-7.12 (m, 2H), 7.58-7.63 (m, 4H), 7.87-7.90 (m, 1H), 7.96 (s,
1H), 8.02-8.05 (m, 1H), 8.15-8.17 (m, 1H), 9.08 (s, 1H), 9.35 (s,
1H) ##STR484## 1-(1-(4-(2-amino-2- oxoethyl)naphthalen-
2-yl)-3-t-butyl-1H- pyrazol-5-yl)-3-(3- (pyridin-3-
yloxy)phenyl)urea hydrochloride 69 mg, 46% yield 535.2 1.30 (s,
9H), 3.95 (s, 2H), 6.40 (s, 1H), 6.75 (d, 1H), 7.04 (brs, 1H),
7.10-7.12 (m, 1H), 7.31-7.40 (m, 2H), 7.57-7.64 (m, 4H), 7.76-7.79
(m, 1H), 7.86-7.89 (m, 1H), 7.99-8.02 (m, 2H), 8.12-8.15 (m, 1H),
8.53-8.55 (m, 1H), 8.62 (m, 1H), 8.83 (s, 1H), 9.57 (s, 1H)
##STR485## 1-(1-(4-(2-amino-2- oxoethyl)naphthalen-
2-yl)-3-t-butyl-1H- pyrazol-5-yl)-3-(2,5- difluorophenyl)urea, 32
mg, 29% yield 478.3 1.31 (s, 9H), 3.96 (s, 2H), 6.49 (s, 1H),
6.81-6.84 (m, 1H), 7.04 (br.s, 1H), 7.24-7.28 (m, 1H), 7.59-7.64
(m, 4H), 7.96 (brs, 1H), 8.00-8.05 (m, 2H), 8.15-8.17 (m, 1H), 9.05
(s, 1H), 9.15 (s, 1H). ##STR486## 1-(1-(4-(2-amino-2- oxoethyl)-
naphthalen-2-yl)-3-t- butyl-1H-pyrazol-5- yl)-3-phenylurea, 31 mg,
56% yield 442.3 1.31 (s, 9H), 3.95 (s, 2H), 6.45 (s, 1H), 6.96-6.98
(m, 1H), 7.03-7.04 (m, 1H), 7.23-7.27 (m, 2H), 7.37-7.39 (m, 2H),
7.58-7.62 (m, 4H), 7.95 (s, 1H), 8.01-8.14 (m, 2H), 8.50 (s, 1H),
8.98 (s, 1H) ##STR487## 1-(1-(4-(2-amino-2- oxoethyl)naphthalen-
2-yl)-3-t-butyl-1H- pyrazol-5-yl)-3-(2- fluorophenyl)urea, 42 mg,
54% yield 460.2 1.31 (s, 9H), 3.96 (s, 2H), 6.47 (s, 1H), 6.99-7.22
(m, 4H), 7.60-7.62 (m, 4H), 7.96 (brs, 1H), 8.02-8.04 (m, 1H),
8.11-8.16 (m, 2H), 8.94-8.96 (m, 2H) ##STR488## 1-(1-(4-(2-amino-2-
oxoethyl)naphthalen- 2-yl)-3-t-butyl-1H- pyrazol-5-yl)-3-(2,3-
difluorophenyl)urea, 23 mg, 27% yield 478.3 1.30 (s, 9H), 3.96
(brs, 2H), 6.47 (brs, 1H), 7.03-7.20 (m, 3H), 7.58-7.65 (m, 4H),
7.94-8.16 (m, 4H), 8.99 (brs, 1H), 9.12 (bsr, 1H) ##STR489##
1-(1-(4-(2-amino-2- oxoethyl)naphthalen- 2-yl)-3-t-butyl-1H-
pyrazol-5-yl)-3- cyclohexylurea, 41 mg, 73% yield 448.2 1.07-1.31
(m, SH), 1.31 (s, 9H), 145-1.76 (m, 5H), 3.32 (m, 1H), 3.93 (s,
2H), 6.33 (s, 1H), 6.45-6.46 (d, 1H), 7.03 (brs, 1H), 7.56-7.60 (m,
4H), 7.86 (s, 1H), 7.97 (m, 1H), 8.08 (s, 1H), 8.12 (m, 1H).
##STR490## 1-(1-(4-(2-amino-2- oxoethyl)naphthalen-
2-yl)-3-t-butyl-1H- pyrazol-5-yl)-3- (3,4,5- trifluorophenyl)urea,
18 mg, 23% yield 496.3 1.31 (s, 9H), 3.95 (brs, 2H), 6.43 (brs,
1H), 7.04-7.05 (m, 1H), 7.29-7.33 (m, 2H), 7.58-7.63 (m, 4H),
7.94-7.95 (m, 1H), 7.99-8.01 (m, 1H), 8.13-8.16 (m, 1H), 8.67 (s,
1H), 9.32 (s, 1H). ##STR491## 1-(1-(4-(2-amino-2-
oxoethyl)naphthalen- 2-yl)-3-t-butyl-1H- pyrazol-5-yl)-3-
cyclopentylurea, 16 mg, 25% yield 434.2 1.76-1.31 (m, 2H), 1.31 (s,
9H), 1.48-1.56 (m, 4H), 1.77-1.78 (m, 2H), 3.86-3.87 (m, 1H), 3.93
(s, 2H), 6.33 (s, 1H), 6.53-6.54 (m, 1H), 7.03 (m, 1H), 7.56-7.60
(m, 4H), 7.87 (s, 1H), 7.97-7.98 (m, 1H), 8.03 (s, 1H), 8.10-8.20
(m, 1H) ##STR492## 1-(3-t-butyl-1-(4-(2- (2,3-
dihydroxypropylamino)- 2- oxoethyl)naphthalen- 2-yl)-1H-pyrazol-5-
yl)-3-(2,4,5- trifluorophenyl)urea, 65 mg, 50% yield 570.2 1.31 (s,
9H), 2.95-3.05 (m, 1H), 3.21-3.38 (m, 3H), 3.45-3.55 (m, 1H), 4.02
(s, 2H), 4.48-4.51 (m, 1H), 4.76-4.77 (m, 1H), 6.47 (s, 1H),
7.59-7.62 (m, 4H), 7.95 (s, 1H), 8.01-8.03 (m, 1H), 8.17-8.23 (m,
3H), 9.00 (s, 1H), 9.12 (m, 1H) ##STR493## 1-(3-t-butyl-1-(4-(2-
(2,3- dihydroxypropylamino)- 2- oxoethyl)naphthalen-
2-yl)-1H-pyrazol-5- yl)-3-(2,3,5- trifluorophenyl)urea 56 mg, 44%
yield 570.2 1.31 (s, 9H), 2.90-3.05 (m, 1H), 3.25-3.32 (m, 3H),
3.45-3.55 (m, 1H), 4.02 (s, 2H), 4.49 (t, 1H), 4.75 (d, 1H), 6.48
(s, 1H), 7.10-7.15 (m, 1H), 7.59-7.63 (m, 3H), 7.80-8.10 (m, 3H),
8.15-8.25 (m, 2H), 9.09 (s, 1H), 9.36 (s, 1H) ##STR494##
1-(3-t-butyl-1-(4-(2- (2,3- dihydroxypropylamino)- 2-
oxoethyl)naphthalen- 2-yl)-1H-pyrazol-5- yl)-3-(2,3,4-
trifluorophenyl)urea 24 mg, 24% yield 570.2 1.27 (s, 9H), 2.97-3.02
(m, 1H), 3.19-3.52 (m, 4H), 4.02 (s, 2H), 4.49 (brs, 2H), 6.45 (s,
1H), 7.24-7.27 (m, 1H), 7.59-7.63 (m, 3H), 7.84-7.94 (m, 2H),
8.00-8.03 (m, 1H), 8.17-8.23 (m, 2H), 8.94 (s, 1H), 9.06 (s, 1H)
##STR495## 1-(3-t-butyl-1-(4-(2- (2,3- dihydroxypropylamino)- 2-
oxoethyl)naphthalen- 2-yl)-1H-pyrazol-5- yl)-3-(3-(pyridin-3-
yloxy)phenyl)urea 61 mg, 36% yield 609.2 1.30 (s, 9H), 2.97-3.02
(m, 1H), 3.19-3.29 (m, 3H), 3.48-3.50 (m, 1H), 4.02 (s, 2H), 6.40
(s, 1H), 6.72-6.75 (m, 1H), 7.09-7.12 (m, 1H), 7.30-7.38 (m, 2H),
7.57-7.64 (m, 3H), 7.70-7.73 (m, 1H), 7.78-7.80 (m, 1H), 7.97-8.02
(m, # 2H), 8.15-8.18 (m, 1H), 8.23-8.26 (m, 1H), 8.51-8.59 (m, 2H),
8.75 (s, 1H), 9.46 (s, 1H) ##STR496## 1-(3-t-butyl-1-(4-(2- (2,3-
dihydroxypropylamino)- 2- oxoethyl)naphthalen- 2-yl)-1H-pyrazol-5-
yl)-3-(3,4,5- trifluorophenyl)urea, 116 mg, 55% yield 570.2 1.30
(s, 9H), 2.95-3.05 (m, 1H), 3.21-3.31 (m, 3H), 3.47-3.50 (m, 1H),
4.01 (s, 2H), 4.51 (t, 1H), 4.77 (d, 1H), 6.44 (s, 1H), 6.29-7.34
(m, 2H), 7.58-7.60 (m, 2H), 7.63 (s, 1H), 7.94 (s, 1H), 7.95-8.01
(m, 1H), 8.16-8.23 (m, 2H), 8.70 (s, 1H), 9.34 (s, 1H) ##STR497##
1-(3-t-butyl-1-(4-(2- (1,3- dihydroxypropan-2- ylamino)-2-
oxoethyl)naphthalen- 2-yl)-1H-pyrazol-5- yl)-3-(2,5-
difluorophenyl)urea 72 mg, 27% yield 552.2 1.31 (s, 9H), 3.40-3.50
(m, 4H), 3.66-3.74 (m, 1H), 4.02 (s, 2H), 4.4-4.70 (br s, 2H), 6.48
(s, 1H), 6.79-6.84 (m, 1H), 7.22-7.28 (m, 1H), 7.58-7.61 (m, 3H),
7.95 (s, 1H), 7.99-8.05 (m, 3H), 8.17-8.20 (m, 1H), 9.07 (s, 1H),
9.17 (s, 1H).
[0648] ##STR498##
[0649] To a solution of Example 58 (240 mg, 0.457 mmol) in THF (10
mL), at 0.degree. C. was added dropwise MeMgCl (0.92 mL, 205 mg,
2.74 mmol). The mixture stirred at 0.degree. C. for 1 h and then
warmed to RT for 3 h. The reaction mixture was stirred at RT and
treated with two additional batches of MeMgCl (2.times.0.6 mL, 1.8
mmol), subsequently quenched with H2O (25 mL) and diluted with
EtOAc (25 mL) and 5% citric acid (10 mL). The organic phase was
separated, washed with brine, dried (Na.sub.2SO.sub.4),
concentrated and purified to yield
1-(1-(4-acetylnaphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3-dichloro-
phenyl)urea (42 mg, 18% yield). .sup.1H-NMR (300 MHz,
DMSO-d.sub.6): .delta. 1.33 (s, 9H), 2.75 (s, 3H), 6.49 (s, 1H),
7.29-7.33 (m, 2H), 7.64-7.71 (m, 2H), 8.03-8.06 (m, 1H), 8.12-8.14
(m, 1H), 8.26 (s, 1H), 8.31 (s, 1H), 8.58-8.61 (m, 1H), 8.77 (s,
1H), 9.36 (s, 1H); MS (ESI) m/z: 497.0 (M+H.sup.+). ##STR499##
[0650] Example 60 (310 mg, 0.641 mmol) and MnO.sub.2 (1.12 g, 12.8
mmol) were refluxed in CH.sub.2Cl.sub.2 (20 mL) for 23 h. The
mixture was filtered hot through Celite.RTM. and washed with
CH.sub.2Cl.sub.2 (2.times.20 mL). The combined organic solutions
were evaporated at reduced pressure to yield
1-(3-t-butyl-1-(4-formylnaphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,3-dichloro-
phenyl)urea a pale pink foam which was used without further
purification.
[0651] To this aldehyde (150 mg, 0.312 mmol) in THF (5 mL) at
0.degree. C. was added dropwise MeMgCl (0.37 mL, 82 mg, 1.09 mmol).
The mixture was stirred at 0.degree. C. for 1 h and then warmed to
RT and stirred for 7 h. The mixture was treated with an additional
batch of MeMgCl (0.2 mL, 0.6 mmol), stirred overnight at RT,
treated with additional MeMgCl (0.3 mL, 0.9 mmol) and then quenched
with H.sub.2O (25 mL) and diluted with EtOAc (25 mL) and 5% citric
acid (10 mL). The organic phase was separated, washed with brine
dried (Na.sub.2SO.sub.4), filtered, concentrated and purified to
yield
1-(3-t-butyl-1-(4-(1-hydroxyethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2,-
3-dichlorophenyl)urea (65 mg, 42% yield). .sup.1H-NMR (300 MHz,
DMSO-d.sub.6): .delta. 1.31 (s, 9H), 1.49 (d, J=6.2 Hz, 3H),
5.47-5.48 (m, 1H), 5.53-5.54 (m, 1H), 6.45 (s, 1H), 7.28-7.31 (m,
2H), 7.57-7.60 (m, 2H), 7.83 (s, 1H), 7.94 (s, 1H), 8.02-8.18 (m,
3H), 8.78 (s, 1H), 9.31 (s, 1H); MS (ESI) m/z: 499.0 (M+H.sup.+).
##STR500##
[0652] To a solution of 1-indanone (30 g, 0.23 mol) in conc.
H.sub.2SO.sub.4 (200 mL) was added a solution of KNO.sub.3 (34 g,
0.34 mol) in conc. H.sub.2SO.sub.4 (100 mL) at 0.degree. C. The
resulting mixture was stirred for 2 h, and then poured into ice-H2O
(3 L). The mixture was extracted with EtOAc (3.times.500 mL). The
combined organic layers were washed with brine (3.times.500 mL),
dried (Na.sub.2SO.sub.4), filtered, concentrated and purified via
column chromatography to afford 6-nitro-indan-1-one (25 g, 61%
yield). .sup.1H-NMR (300 MHz, DMSO-d.sub.6): .quadrature. 8.45 (d,
J=8.4 Hz, 1H), 8.22 (s, 1H), 7.82 (d, J=8.4 Hz, 1H), 3.20 (t, J=6.0
Hz, 2H), 2.74 (t, J=6.0 Hz, 2H).
[0653] A mixture of the 6-nitroindan-1-one (10 g, 56 mmol) and 10%
Pd/C (2.0 g) in MeOH (200 mL) was stirred under 30 psi of H.sub.2
at RT for 3 h. After filtration, the filtrate was concentrated to
afford 6-aminoindan-1-one (7.2 g, 87% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 7.17 (d, J=8.1 Hz, 1H), 6.87 (d, J=8.1 Hz,
1H), 6.71 (s, 1H), 5.24 (s, 2H), 2.85 (t, J=5.4 Hz, 2H), 2.49 (t,
J=5.7 Hz, 2H).
[0654] To a mixture of 6-aminoindan-1-one (7.2 g, 11.8 mmol) in
conc. HCl (20 mL) at 0.degree. C. was added dropwise an aqueous
solution of NaNO.sub.2 (0.9 g, 13 mmol). After 30 min, a solution
of SnCl.sub.2.2H.sub.2O (5.9 g, 26.2 mmol) in conc. HCl was added
dropwise at such a rate that the reaction temperature never rose
above 5.degree. C. After the addition was completed, the mixture
was stirred at RT for 2 h. The mixture was extracted with Et.sub.2O
to afford 6-hydrazinoindan-1-one. MS (ESI) m/z: 199
(M+H.sup.+).
[0655] To a solution of the 6-hydrazinoindan-1-one (2.1 g, 14.3
mmol) and 4,4-dimethyl-3-oxo-pentanenitrile (2.15 g, 1.2 eq) in
EtOH (50 mL) was added conc. HCl (5 mL). The resulting mixture was
heated at reflux overnight. After removal of the solvent, the
residue was washed with ether to afford
6-(5-amino-3-t-butylpyrazol-1-yl)indan-1-one (1.1 g, 38.5% yield),
which was put to the next reaction without further purification. MS
(ESI) m/z: 270 (M+H.sup.+).
[0656] To a solution of the
6-(5-amino-3-t-butyl-pyrazol-1-yl)indan-1-one (1.5 g, 5.6 mmol) in
THF (30 mL) was added a solution of
1,2-dichloro-3-isocyanato-benzene (1.2 g, 6.4 mmol) in THF (5.0 mL)
at 0.degree. C. under N.sub.2. The resulting mixture was stirred at
RT overnight then poured into H2O. The mixture was extracted with
CH.sub.2Cl.sub.2 (3.times.100 mL). The combined organic layers were
washed with brine, dried (Na.sub.2SO.sub.4), filtered, concentrated
and purified via column chromatography to afford
1-[5-t-butyl-2-(3-oxo-indan-5-yl)-2H-pyrazol-3-yl]-3-(2,3-dichlorophenyl)-
urea as a solid (1.1 g, 43% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.22 (s, 1H), 8.68 (s, 1H), 7.94 (t, J=5.1
Hz, 1H), 7.78 (d, J=7.8 Hz, 1H), 7.69-7.65 (m, 2H), 7.24 (d, J=4.8
Hz, 2H), 6.34 (s, 1H), 3.14-3.05 (m, 2H), 2.78-2.66 (m, 2H),
1.22(s, 9H); MS (ESI) m/z: 457 (M+H.sup.+). ##STR501##
[0657] A solution of Example 102 (120 mg, 0.26 mmol) in MeOH (20
ml) was treated with NaBH.sub.4 (19 mg, 0.5 mmol) and stirred at RT
for 2 h. After removal of the solvent, the residue was purified by
preparative HPLC to yield
1-[5-t-butyl-2-(3-hydroxy-indan-5-yl)-2H-pyrazol-3-yl]-3-(2,3-dichlorophe-
nyl)urea (67 mg, 56% yield). .sup.1H NMR (300 MHz, CD.sub.3OD):
.delta. 8.04 (m, 1H), 7.45-7.21 (m, 4H), 6.45 (s, 1H), 5.25 (t,
J=6.3 Hz, 1H), 3.10 (m, 1H), 2.85(m, 1H), 2.50 (m, 1H), 2.00 (m,
1H), 1.34 (s, 9H); MS (ESI) m/z: 459 (M+H.sup.+). ##STR502##
[0658] To a mixture of Example 102 (120 mg, 0.26 mmol) and
K.sub.2CO.sub.3 (0.1 g, 0.7 mmol) in EtOH (20 mL) was added
HONH.sub.2.HCl (500 mg). The resulting mixture was heated at reflux
for 3 h, then concentrated and the residue was purified by reverse
phase chromatography to yield
1-[5-t-butyl-2-(3-hydroxyimino-indan-5-yl)-2H-pyrazol-3-yl]-3-(2,3-dichlo-
rophenyl)urea (75 mg, 61% yield). .sup.1H NMR (300 MHz,
CD.sub.3OD): .delta. 8.04 (d, J=5.4 Hz, 1H), 7.73 (s, 1H),
7.52-7.43 (m, 2H), 7.22-7.20 (m, 2H), 6.48 (s, 1H), 3.20-3.12 (m,
2H), 2.97 (m, 2H), 1.33 (s, 9H); MS (ESI) m/z: 473 (M+H.sup.+).
##STR503##
[0659] A mixture of Example 104 (45 mg, 0.09 mmol) and Raney.RTM.
Ni (0.1 g) in EtOH (20 mL) was stirred under 30 psi of H.sub.2
atmosphere for 3 h. After filtration and removal of the solvent,
the residue was purified by reverse phase chromatography to give
1-[2-(3-amino-indan-5-yl)-5-t-butyl-2H-pyrazol-3-yl]-3-(2,3-dichloropheny-
l)urea (20 mg, 48% yield). .sup.1H NMR (300 MHz, CD.sub.3OD):
.delta. 7.98 (t, J=5.4 Hz, 1H), 7.62 (s, 1H), 7.50 (s, 2H), 7.22
(d, J=4.5 Hz, 2H), 6.42 (s, 1H), 3.20 (m, 1H), 3.10-3.02 (m, 2H),
2.20-2.12 (m, 2H), 1.30 (s, 9H); MS (ESI) m/z: 458 (M+H.sup.+).
##STR504##
[0660] To a solution of 5-nitroindoline (5.00 g, 30.5 mmol) in
CH.sub.2Cl.sub.2 (100 mL) at RT was added Et3N (4.25 mL, 3.08 g,
30.5 mmol) followed by the careful addition of TFAA (4.23 mL, 6.40
g, 30.5 mmol). The resulting solution was stirred at RT for 1 h,
followed by the addition of more Et.sub.3N (4.25 mL, 3.08 g, 30.5
mmol) and TFAA (4.23 mL, 6.40 g, 30.5 mmol). After 2 h of stirring
at RT, H.sub.2O (100 mL) was added and the mixture was extracted
with CH.sub.2Cl.sub.2 (3.times.100 mL). The combined organics were
dried (MgSO.sub.4), filtered, and concentrated and dried under
vacuum to give 8.9 g (crude yield>100%) of
2,2,2-trifluoro-1-(5-nitroindolin-1-yl)ethanone as a yellow-brown
solid. .sup.1H NMR (400 MHz, CDCl.sub.3): .delta. 8.33 (d, J=8.8
Hz, 1H), 8.20 (dd, J=8.4, and 2.0 Hz, 1H), 8.14 (d, J=0.8 Hz, 1H),
4.42 (t, J=8.4 Hz, 2H), 3.38 (t, J=8.6 Hz, 2H); MS (ESI) m/z: 261.0
(M+H.sup.+).
[0661] To a suspension of
2,2,2-trifluoro-1-(5-nitroindolin-1-yl)ethanone (7.92 g, 30.4 mmol)
in MeOH (100 mL) was added 10% Pd/C (0.648 g, 0.609 mmol) and the
slurry was stirred under H.sub.2 (1 atm) overnight. The mixture was
filtered through a pad of Celite.RTM. and the filtrate was
concentrated and dried under vacuum to give 7.7 g (crude
yield>100%) of 1-(5-aminoindolin-1-yl)-2,2,2-trifluoroethanone
as a yellow-brown solid. .sup.1HNMR (400 MHz, CDCl.sub.3): .delta.
8.00 (d, J=8.8 Hz, 1H), 6.59 (s, 1H), 6.57 (d, J=8.4 Hz, 1H), 4.23
(t, J=8.0 Hz, 2H), 3.69 (brs, 2H), 3.16 (t, J=8.2 Hz, 2H); MS (ESI)
m/z: 231.0 (M+H.sup.+).
[0662] To an ice-cold solution of
1-(5-aminoindolin-1-yl)-2,2,2-trifluoroethanone (7.00 g, 30.4 mmol)
in 6N HCl (50 mL) was dropwise added a solution of NaNO.sub.2 (2.10
g, 30.4 mmol) in H.sub.2O (5 mL). The resulting slurry was stirred
at 0.degree. C. for 30 min. A solution of SnCl2.2H.sub.2O (13.7 g,
60.8 mmol) in conc. HCl (60 mL) was added dropwise and after the
addition was complete the resulting slurry was stirred at RT for 2
h. The mixture was filtered and the resulting solid was collected.
The solid was redissolved in EtOH (200 mL), pivaloyl acetonitrile
was added (4.57 g, 36.5 mmol) and the solution was heated at reflux
temperature overnight. Water (100 mL) was added and the mixture was
extracted with CH.sub.2Cl.sub.2 (3.times.100 mL), dried
(MgSO.sub.4), concentrated and purified via column chromatography
to yield
1-(5-(5-amino-3-t-butyl-1H-pyrazol-1-yl)indolin-1-yl)-2,2,2-trifluo-
roethanone (492 mg, 4% yield). .sup.1H NMR (400 MHz, CD.sub.3OD):
.delta. 8.39 (d, J=8.4 Hz, 1H), 7.55 (s, 1H), 7.48 (dd, J=8.8, and
2.0 Hz, 1H), 4.44 (t, J=8.2 Hz, 2H), 3.40 (t, J=8.6 Hz, 2H), 1.39
(s, 9H), pyrazolamine protons not visible; MS (ESI) m/z: 353.0
(M+H.sup.+). ##STR505##
[0663] Using general method A, Example A29 (0.200 g, 0.514 mmol)
and 2,3-dichlorophenyl isocyanate (0.145 g, 0.772 mmol) were
combined and deprotected according to general method G to yield of
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea
(229 mg, 93% yield) as a white solid. .sup.1H NMR (400 MHz,
CD.sub.3OD): .delta. 8.04 (t, J=4.8 Hz, 1H), 7.67 (s, 1H), 7.59
(dd, J=8.4, and 2.0 Hz, 1H), 7.51 (d, J=8.4 Hz, 1H), 7.26 (d, J=4.8
Hz, 1H), 7.26 (d, J=4.8 Hz, 1H), 6.67 (s, 1H), 3.91 (t, J=7.8 Hz,
2H), 3.39 (t, J=7.8 Hz, 2H), 1.39 (s, 9H), amine and urea protons
not visible; MS (ESI) m/z: 444.0 (M+H.sup.+). ##STR506##
[0664] To a solution of Example 106 (0.100 g, 0.208 mmol) in
CH.sub.2Cl.sub.2 (5 mL) was added pyridine (0.049 g, 0.624 mmol)
and AcCl (0.033 g, 0.42 mmol) and the resulting solution was
stirred at room temperature for 30 min. Water was added (20 mL) and
the mixture was extracted with CH.sub.2Cl.sub.2 (3.times.20 mL),
dried (MgSO.sub.4), concentrated and purified via column
chromatography to yield
1-(1-(1-acetylindolin-5-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3-dichlorophe-
nyl)urea (68 mg, 67% yield) as a white foam. .sup.1H NMR (400 MHz,
acetone-d.sub.6): .delta. 8.53 (brs, 1H), 8.28 (dd, J=8.8, and 1.6
Hz, 1H), 8.20 (brs, 1H), 8.17 (d, J=8.4 Hz, 1H), 7.35 (brs, 1H),
7.32-7.28 (m, 2H), 7.23 (dd, J=8.0, and 1.6 Hz, 1H), 6.47 (s, 1H),
4.22 (t, J=8.4 Hz, 2H), 3.25 (t, J=8.6 Hz, 2H), 2.20 (s, 3H), 1.31
(s, 9H); MS (ESI) m/z: 486.2 (M+H.sup.+). ##STR507##
[0665] To a solution of Example 106 (0.077 g, 0.16 mmol) in
CH.sub.2Cl.sub.2 (5 mL) was added pyridine (0.038 g, 0.48 mmol) and
MsCl (0.037 g, 0.32 mmol) and the resulting pink solution was
stirred at RT for 2 h. Water (20 mL) was added and the mixture was
extracted with CH.sub.2Cl.sub.2 (3.times.20 mL), dried
(MgSO.sub.4), concentrated and purified via column chromatography
to yield
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3-d-
ichlorophenyl)urea (61 mg, 73% yield) as a white solid. .sup.1H-NMR
(300 MHz, acetone-d.sub.6): .delta. 8.52 (brs, 1H), 8.26 (dt,
J=8.4, and 2.0 Hz, 1H), 8.16 (brs, 1H), 7.42 (brs, 1H), 7.40-7.29
(m, 3H), 7.24 (dd, J=8.4, and 1.6 Hz, 1H), 6.47 (s, 1H), 4.07 (t,
J=8.6 Hz, 2H), 3.23 (t, J=8.6 Hz, 2H), 3.02 (s, 3H), 1.32 (s, 9H);
MS (ESI) m/z: 522.0 (M+H.sup.+). ##STR508##
[0666] Using general method D, Example A29 (0.150 g, 0.28 mmol) and
2,3,5-trifluoroaniline (0.125 g, 0.853 mmol) were combined and
subsequently deprotected according to general method G to afford
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3,5-trifluorophenyl)u-
rea, which was dissolved in CH.sub.2Cl.sub.2 (3 mL). Pyridine
(0.200 mL, 0.196 g, 8.70 mmol) and MsCl (0.296 g, 9.09 mmol) were
added sequentially at 0.degree. C. The mixture was allowed to reach
RT and stirred for 3 h. Water (20 mL) was added and the mixture was
extracted with EtOAc (3.times.30 mL), dried (MgSO.sub.4),
concentrated and purified via column chromatography to yield of
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3,5-
-trifluorophenyl)urea (25 mg, 17% yield) as a light brown solid.
.sup.1H-NMR (400 MHz, acetone-d.sub.6): .delta. 8.62 (brs, 1H),
8.34 (brs, 1H), 8.01-7.96 (m, 1H), 7.42 (s, 1H), 7.39 (d, J=8.4 Hz,
1H), 7.35 (dd, J=8.4, 2.0 Hz, 1H), 6.88-6.81 (m, 1H), 6.47 (s, 1H),
4.07 (t, J=8.4 Hz, 2H), 3.23 (t, J=8.6 Hz, 2H), 3.03 (s, 3H), 1.32
(s, 9H); MS (ESI) m/z: 508.3 (M+H.sup.+). ##STR509##
[0667] Using the same method as for Example 109, Example A29 (0.150
g, 0.28 mmol) and 2,4,5-trifluoroaniline (0.125 g, 0.853 mmol) were
combined to afford
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl-
)-3-(2,4,5-tri-fluorophenyl)urea (38 mg, 26% yield) as a light
brown solid. .sup.1H-NMR (400 MHz, acetone-d.sub.6): .delta. 8.47
(brs, 1H), 8.34 (brs, 1H), 8.31-8.23 (m, 1H), 7.42 (s, 1H), 7.39
(d, J=8.4 Hz, 1H), 7.36-7.25 (m, 2H), 6.46 (s, 1H), 4.06 (t, J=8.8
Hz, 2H), 3.22 (t, J=8.4 Hz, 2H), 3.02 (s, 3H), 1.31 (s, 9H); MS
(ESI) m/z: 508.3 (M+H.sup.+). ##STR510##
[0668] Using general method A, Example A29 (70 mg, 0.20 mmol) and
3-cyanophenyl isocyanate (30 mg, 0.20 mmol) were combined to yield
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(3-cyanophenyl)urea
HCl salt (53 mg, 67% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.82 (s, 1H), 8.87 (s, 1H), 7.94 (t, J=2.0 Hz, 1H), 7.62
(dt, J=1.2, and 10.4 Hz, 1H), 7.56 (s, 1H), 7.43 (m, 2H), 6.39 (s,
1H), 3.73 (t, J=8.0 Hz, 2H), 3.23 (t, J=8.0 Hz, 2H), 1.28 (s, 9H);
LC-MS (EI) m/z: 497.2 (M+H.sup.+). ##STR511##
[0669] To a solution of 6-nitroindoline (5.00 g, 30.5 mmol) in
CH.sub.2Cl.sub.2 (100 mL) was added Et.sub.3N (4.25 mL, 3.08 g,
30.5 mmol) and TFAA (4.23 mL, 6.40 g, 30.5 mmol) and the resulting
solution stirred at RT for 1 h. More Et.sub.3N (4.25 mL, 3.08 g,
30.5 mmol) and TFAA (4.23 mL, 6.40 g, 30.5 mmol) were added and the
solution was stirred at RT for another 2 h. Water (100 mL) was
added and the mixture was extracted with CH.sub.2Cl.sub.2
(3.times.100 mL), dried (MgSO.sub.4), and concentrated to yield
2,2,2-trifluoro-1-(6-nitroindolin-1-yl)ethanone (8.9 g, crude
yield>100%) as a yellow-brown solid. .sup.1H-NMR (300 MHz,
CDCl.sub.3): .delta. 9.01 (s, 1H), 8.05 (d, J=8.0 Hz, 1H), 7.40 (d,
J=8.0 Hz, 1H), 4.42 (t, J=8.2 Hz, 2H), 3.38 (t, J=8.4 Hz, 2H); MS
(ESI) m/z: 261.0 (M+H.sup.+).
[0670] To a suspension of
2,2,2-trifluoro-1-(6-nitroindolin-1-yl)ethanone (7.92 g, 30.4 mmol)
in MeOH (100 mL) was added 10% Pd/C (0.648 g, 0.609 mmol) and the
slurry was stirred under H.sub.2 (1 atm) overnight. The mixture was
filtered through a pad of Celite.RTM. and the filtrate was
concentrated and dried under vacuum to yield
1-(6-aminoindolin-1-yl)-2,2,2-trifluoroethanone (7.7 g, crude
yield>100%) as a yellow-brown solid. .sup.1H-NMR (400 MHz,
CDCl.sub.3): .delta. 7.64 (d, J=2.0 Hz, 1H), 7.01 (d, J=8.0 Hz,
1H), 6.49 (dd,, J=8.4, and 2.0 Hz, 1H), 4.24 (t, J=8.0 Hz, 2H),
3.85 (brs, 2H), 3,13 (t, J=8.2 Hz, 2H); MS (ESI) m/z: 231.0
(M+H.sup.+).
[0671] To an ice-cold solution of
1-(6-aminoindolin-1-yl)-2,2,2-trifluoroethanone (7.00 g, 30.4 mmol)
in 6N HCl (50 mL) was dropwise added a solution of NaNO.sub.2 (2.10
g, 30.4 mmol) in H.sub.2O (5 mL). The resulting slurry was stirred
at 0.degree. C. for 30 min. A solution of SnCl2.2H.sub.2O (11.5 g,
60.8 mmol) in conc. HCl (60 mL) was added dropwise and after the
addition was complete the resulting slurry was stirred at RT for 2
h. The mixture was filtered and the resulting solid was redissolved
in EtOH (200 mL). Pivaloyl acetonitrile (4.57 g, 36.5 mmol) was
added and the solution was heated at reflux overnight. Water (100
mL) was added and the mixture was extracted with CH.sub.2Cl.sub.2
(3.times.100 mL), dried (MgSO.sub.4), concentrated and purified by
recrystallization from ethyl acetate/hexanes to yield
1-(6-(5-amino-3-t-butyl-1H-pyrazol-1-yl)indolin-1-yl)-2,2,2-trifluoroetha-
none (3.2 g, 30% yield) as a light-brown solid. .sup.1H-NMR (400
MHz, acetone-d.sub.6): .delta. 8.49 (d, J=2.0 Hz, 1H), 7.51 (dd,
J=8.4, and 2.0 Hz, 1H), 4.41 (t, J=8.2 Hz, 2H), 3.32 (t, J=8.2 Hz,
2H), 1.32 (s, 9H), pyrazolamine protons not observed; MS (ESI) m/z:
353.2 (M+H.sup.+). ##STR512##
[0672] To a solution of 2,3-dichloroaniline (0.200 g, 1.23 mmol) in
EtOAc (5 mL) was added NaOH (1M, 2 mL, 2 mmol) and Troc-Cl (0.262
g, 1.23 mmol) and the resulting mixture was stirred overnight.
Water (50 mL) was added and the mixture was extracted with EtOAc
(3.times.100 mL), dried (MgSO.sub.4), concentrated and purified via
column chromatography to yield
2,2,2-trichloroethyl-2,3-dichlorophenylcarbamate (408 mg, 98%) as a
yellow foam. .sup.1H NMR (400 MHz, CDCl.sub.3): .delta. 8.11 (d,
J=6.4 Hz, 1H), 7.43 (brs, 1H), 7.25-7.22 (m, 2H), 4.86 (s, 2H); MS
(EI) m/z: 335.8 (M+H.sup.+).
[0673] A solution of
2,2,2-trichloroethyl-2,3-dichlorophenylcarbamate (0.400 g, 1.19
mmol) and 3-amino-5-t-butylpyrazole (0.165 g, 1.19 mmol) in DMF (1
mL) was stirred at 80.degree. C. overnight. Water (50 mL) was added
and the mixture was extracted with EtOAc (3.times.100 mL), dried
(MgSO.sub.4), concentrated and purified via column chromatography
to yield 1-(3-t-butyl-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea
(230 mg, 59% yield) as a pink foam. .sup.1H NMR (400 MHz,
CDCl.sub.3): .delta. 8.26 (d, J=6.8 Hz, 1H), 7.20-7.14 (m, 2H),
5.85 (brs, 1H), 1.34 (s, 9H), amine and urea protons not visible;
MS (EI) m/z: 327.0 (M+H.sup.+). ##STR513##
[0674] A mixture of Example A9 (0.100 g, 0.386 mmol), Troc-Cl
(0.164 g, 0.772 mmol), 2N NaOH (2.00 mL, 4.00 mmol) and EtOAc (2
mL) was stirred at RT overnight. Water (30 mL) was added and the
mixture was extracted with EtOAc (3.times.100 mL), dried
(MgSO.sub.4), concentrated and purified via column chromatography
to yield 2,2,2-trichloroethyl-3-(pyridin-3-yloxy)phenylcarbamate
(45 mg, 32% yield) as a yellow oil. .sup.1H NMR (CDCl.sub.3):
.delta. 8.42 (s, 1H), 8.38 (d, J=4.4 Hz, 1H), 7.36-7.24 (m, 5H),
7.17 (d, J=7.6 Hz, 1H), 6.76 (dd, J=8.2, and 1.8 Hz, 1H), 4.80 (s,
2H); MS (EI) m/z: 361.0 (M+H.sup.+).
[0675] A mixture of
2,2,2-trichloroethyl-3-(pyridin-3-yloxy)phenylcarbamate (0.040 g,
0.11 mmol), 5-amino-3-t-butylpyrazole (0.031 g, 0.22 mmol) and
i-Pr.sub.2NEt (0.029 g, 0.22 mmol) in DMF (2 mL) was stirred at
100.degree. C. overnight. Water (20 mL) was added and the mixture
was extracted with EtOAc (3.times.100 mL), dried (MgSO.sub.4),
concentrated and purified via column chromatography to yield
1-(3-t-butyl-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea (26
mg, 67% yield) of the desired product as a red-brown oil.
.sup.1H-NMR (400 MHz, CDCl.sub.3): .delta. 10.1 (brs, 1H), 8.40 (s,
1H), 8.35 (d, J=3.6 Hz, 1H), 8.02 (s, 1H), 7.35-7.28 (m, 4H), 6.71
(dt, J=6.4, and 2.2 Hz, 1H), 5.67 (brs, 1H), 1.32 (s, 9H), urea
protons not visible; MS (EI) m/z: 352.3 (M+H.sup.+). ##STR514##
[0676] Using general method A, Example A30 (0.400 g, 1.14 mmol) and
2,3-dichlorophenyl isocyanate (0.426 g, 2.28 mmol) were combined
and deprotected according to general method G to yield
1-(3-t-butyl-1-(indolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea
(230 mg, 42% yield) as an off-white solid. .sup.1H-NMR (400 MHz,
CD.sub.3OD): .delta. 8.01 (dd, J=7.2, and 4.4 Hz, 1H), 7.64-7.58
(m, 3H), 7.25-7.23 (m, 2H), 6.51 (s, 1H), 3.91 (t, J=7.8 Hz, 2H),
3.38 (t, J=8.0 Hz, 2H), 1.37 (s, 9H); MS (ESI) m/z: 444.0
(M+H.sup.+). ##STR515##
[0677] Using the same method as for Example 109, Example 112 (0.150
g, 0.312 mmol) was transformed to
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3-d-
ichlorophenyl)urea (100 mg, 61% yield) as a pink foam. .sup.1H-NMR
(400 MHz, acetone-d.sub.6): .delta. 8.58 (brs, 1H), 8.27 (dt,
J=8.4, 1.6 Hz, 1H), 8.17 (brs, 1H), 7.54 (d, J=2.0 Hz, 1H), 7.35
(d, J=7.6 Hz, 1H), 7.30 (t, J=8.0 Hz, 1H), 7.22-7.20 (m, 2H), 6.46
(s, 1H), 4.06 (t, J=8.4 Hz, 2H), 3.23 (t, J=8.6 Hz, 2H), 2.98 (s,
3H), 1.32 (s, 9H); MS (ESI) m/z: 522.0 (M+H.sup.+). ##STR516##
[0678] Using general method A, Example A30 (70 mg, 0.2 mmol) and
3-cyanophenylisocyanate (29 mg, 0.2 mmol) were combined and
deprotected according to general method G to yield
1-(3-t-butyl-1-(indolin-6-yl)-1H-pyrazol-5-yl)-3-(3-cyanophenyl)urea
HCl salt (67 mg, 77% yield). .sup.1H-NMR (400 MHz, CD.sub.3OD):
.delta. 7.94 (t, J=1.6 Hz, 1H), 7.79 (s, 1H), 7.72 (m, 2H), 7.63
(m, 1H), 7.61 (m, 1H), 7.46 (t, J=7.6 Hz, 1H), 7.40 (t, J=1.2 Hz,
1H), 7.38 (t, J=1.6 Hz, 1H), 3.99 (t, J=7.6 Hz, 2H), 3.45 (t, J=7.6
Hz, 2H), 1.41 (s, 9H); LC-MS (EI) m/z: 497.2 (M+H.sup.+).
##STR517##
[0679] A mixture of Example A31 (63 mg, 0.19 mmol),
1-N-Boc-indole-5-boronic acid (75 mg, 0.28 mmol, commercially
available from Anichem), Cu(OAc).sub.2 (53 mg, 0.28 mmol), pyridine
(0.05 mL) and molecular sieves (activated, 4A) in CH.sub.2Cl.sub.2
(12 mL) was stirred open to the air at RT for 3 days. The reaction
mixture was filtered through a pad of Celite.RTM., concentrated,
and purified via column chromatography to yield
1-(3-t-butyl-1-(1H-indol-5-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)ure-
a (50 mg, 48% yield). LC-MS (EI) m/z: 542.3 (M+H.sup.+). This
material was dissolved in CH.sub.2Cl.sub.2 (1 mL) and TFA (0.5 mL)
and stirred at RT overnight. Concentration and purification by
column chromatography yielded
1-(3-t-butyl-1-(1H-indol-5-yl)-1H-pyrazol-5-yl)-3-(2,3-dichloroph-
enyl)urea (19 mg, 47% yield). .sup.1H-NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.11 (s, 1H), 8.82 (s, 1H), 8.08 (dd, J=2.4, and 9.6 Hz,
1H), 7.62 (d, J=2.0 Hz, 1H), 7.53 (d, J=8.8 Hz, 1H), 7.48 (t, J=2.8
Hz, 1H), 7.29 (m, 2H), 7.16 (dd, J=1.6, and 8.4 Hz, 1H), 6.55 (brs,
1H), 6.38 (s, 1H), 3.86 (s, 3H), 1.28 (s, 9H); LC-MS (EI) m/z:
442.0 (M+H.sup.+). ##STR518##
[0680] Using the same procedure as for Example 115, Example A32
(0.07 g, 0.2 mmol) and 1-N-Boc-indole-5-boronic acid (0.05 g, 0.2
mmol, commercially available from Anichem), were combined to yield
1-(3-t-butyl-1-(1-indol-5-yl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phen-
yl)urea (7 mg, 7% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.18 (s, 1H), 8.42 (brs, 2H), 8.26 (s, 1H), 7.59 (d, J=2.0
Hz, 1H), 7.52 (d, J=8.4 Hz, 1H), 7.48 (t, J=2.8 Hz, 1H), 7.46 (s,
2H), 7.28 (t, J=8.4 Hz, 1H), 7.24 (t, J=1.6 Hz, 1H), 7.13 (dd,
J=2.0, and 8.4 Hz, 1H), 7.05 (dd, J=0.8, and 8.4 Hz, 1H), 6.67 (dd,
J=2.0, and 8.0 Hz, 1H), 6.53 (t, J=2.0 Hz, 1H), 6.33 (s, 1H), 1.27
(s, 9H); LC-MS (EI) m/z: 467.3 (M+H.sup.+). ##STR519##
[0681] Using the same procedure as for Example 115, Example A31 (63
mg, 0.19 mmol) and 1-N-methylindole-5-boronic acid (51 mg, 0.28
mmol, commercially available from Anachem) were combined to yield
1-(3-t-butyl-1-(1-methyl-1H-indol-5-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorop-
henyl)urea as a white solid (54 mg, 61% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 9.10 (s, 1H), 8.80 (s, 1H), 8.08 (dd,
J=2.8, and 7.6 Hz, 1H), 7.63 (d, J=2.0 Hz, 1H), 7.59 (d, J=8.8 Hz,
1H), 7.46 (d, J=2.8 Hz, 1H), 7.30 (m, 2H), 7.23 (dd, J=2.0, and 8.8
Hz, 1H), 6.54 (d, J=2.4 Hz, 1H), 6.38 (s, 1H), 3.86 (s, 3H), 1.26
(s, 9H); LC-MS (EI) m/z: 456.0 (M+H.sup.+). ##STR520##
[0682] Commercially available N-Boc-5-indoleboronic acid (0.30 g,
1.1 mmol) was dissolved in CH.sub.2Cl.sub.2 (20 mL) and pyridine (1
mL) with molecular sieves (activated 4A) and stirred overnight at
RT. Commercially available ethyl
3-t-butyl-1H-pyrazole-5-carboxylate, Cu(OAc).sub.2 and molecular
sieves (4A activated, powder) were added to the boronic acid
solution and the whole stirred at RT open to the atmosphere for 2
d. The reaction mixture was filtered through a pad of Celite.RTM.,
concentrated and purified by column chromatography to yield ethyl
5-(3-t-butyl-5-(ethoxycarbonyl)-1H-pyrazol-1-yl)-1H-indole-1-carboxylate
(0.18 g, 38% yield). LC-MS (EI) m/z: 412.3 (M+H.sup.+).
[0683] Using general method E, the material from the previous
reaction was saponfied to yield
1-(1-(t-butoxycarbonyl)-1H-indol-5-yl)-3-t-butyl-1H-pyrazole-5-carboxylic
acid which was used directly in the next step.
[0684] To a solution of
1-(1-(t-butoxycarbonyl)-1H-indol-5-yl)-3-t-butyl-1H-pyrazole-5-carboxylic
acid (0.09 g, 0.23 mmol) in toluene (2 mL) was added triethyl amine
(0.026 mL, 0.26 mmol) and Example A11 (0.065 g, 0.26 mmol). The
reaction mixture was stirred at RT and DPPA (71 mg, 0.26 mmol) was
added. The reaction mixture was heated at 100.degree. C. for 2 h,
cooled, concentrated and the residue purified via column
chromatography to yield t-butyl
5-(3-t-butyl-5-(3-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyri-
midin-6-yl)phenyl)ureido)-1H-pyrazol-1-yl)-1H-indole-1-carboxylate.
[0685] Using general method F, t-Butyl
5-(3-t-butyl-5-(3-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6--
yl)phenyl)ureido)-1H-pyrazol-1-yl)-1H-indole-1-carboxylate was
transformed to
1-(3-t-butyl-1-(1H-indol-5-yl)-1H-pyrazol-5-yl)-3-(3-(8-methyl-7-oxo-7-
,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea as a pale yellow
solid (17 mg, 13% yield). .sup.1H-NMR (DMSO-d.sub.6): .delta. 9.20
(bs, 1H), 9.15 (s, 1H), 9.11 (s, 1H), 8.31 (s, 1H), 8.16 (s, 1H),
7.81 (t, J=2.0 Hz, 1H), 7.63 (d, J=2.0 Hz, 1H), 7.54 (d, J=8.4 Hz,
1H), 7.49 (t, J=2.8 Hz, 1H), 7.42 (m, 1H), 7.36 (t, J=8.0 Hz, 1H),
7.29 (dt, J=1.2, and 8.0 Hz, 1H), 7.17 (dd, J=2.4, and 8.8 Hz, 1H),
6.56 (m, 1H), 6.39 (s, 1H), 3.71 (s, 3H), 1.29 (s, 9H); LC-MS (EI)
m/z: 594.2 (M+H.sup.+). ##STR521##
[0686] To a solution of 5-bromoindoline (1.00 g, 5.05 mmol) in
CH.sub.2Cl.sub.2 (20 mL) was added Et.sub.3N (0.7 mL, 0.51 g, 5.05
mmol). Trifluoroacetic anhydride (0.7 mL, 1.06 g, 5.05 mmol) was
added dropwise into the reaction mixture and the resulting solution
was stirred at RT for 4 h. Water (20 mL) was added and the mixture
was extracted with CH.sub.2Cl.sub.2 (3.times.100 mL). The organic
layer was dried (Na.sub.2SO.sub.4), concentrated and dried under
vacuum to yield (1.42 g, 96% yield) as a yellow solid. .sup.1H NMR
(400 MHz, CDCl.sub.3): .delta. 8.11 (d, J=9.6 Hz, 1H), 7.41 (m,
2H), 4.32 (t, J=8.4 Hz, 2H), 3.28 (t, J=8.4 Hz, 2H); LC-MS (EI)
m/z: 294.0 (M+H.sup.+), 296 (M+3H.sup.+).
[0687] To a solution of
1-(5-bromoindolin-1-yl)-2,2,2-trifluoroethanone (0.70 g, 2.4 mmol)
in DMF (10 mL) were added sequentially KOAc (0.70 g, 7.1 mmol),
pinacoldiboron (0.91 g, 3.6 mmol) and PdCl.sub.2(dppf) (98 mg, 0.12
mmol). After flushing the reaction vessle with N.sub.2, the
reaction mixture was sealed and heated at 80.degree. C. for 3 h.
The reaction mixture was partitioned between H.sub.2O and EtOAc.
The combined organic extracts were washed with brine, dried
(Na.sub.2SO.sub.4), concentrated and purified via column
chromatography to yield
2,2,2-trifluoro-1-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)indolin-
-1-yl)ethanone (0.84 g, 100%) as a yellow solid. .sup.1H NMR (400
MHz, CDCl.sub.3): .delta. 8.20 (d, J=7.6 Hz, 1H), 7.75 (d, J=7.6
Hz, 1H), 7.72 (s, 1H), 4.30 (t, J=8.4 Hz, 2H), 3.27 (t, J=8.4 Hz,
2H), 1.37 (s, 12H); LC-MS (EI) m/z: 342.3 (M+H.sup.+).
[0688] To a solution of
2,2,2-trifluoro-1-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)indolin-
-1-yl)ethanone (0.7 g, 2.1 mmol) in THF/H.sub.2O (4/1, 15 mL) was
added NaIO.sub.4 (1.4 g, 6.4 mmol). The reaction mixture was
stirred at RT for 30 min and then treated with 2N HCl (18 mL).
After stirring at RT for 3 h, the reaction mixture was filtered and
washed with THF. The filtrate was concentrated and the residue
triturated with EtOAc (1 mL) to yield
1-(2,2,2-trifluoroacetyl)indolin-6-ylboronic acid (0.45 g, 81%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.04 (s, 2H),
8.01 (d, J=8.0 Hz, 1H), 7.75 (brs, 1H), 7.72 (d, J=8.4 Hz, 1H),
4.29 (t, J=8.0 Hz, 2H), 3.27 (t, J=8.0 Hz, 2H); LC-MS (EI) m/z:
260.0 (M+H.sup.+). ##STR522##
[0689] Using the same procedure as for Example 115, Example A33 and
Example A32 were combined to yield
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phen-
yl)urea (20 mg, 11% yield) as the HCl salt. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .quadrature. 9.62 (s, 1H), 8.74 (s, 1H), 8.56 (brm,
2H), 7.70 (m, 2H), 7.53 (brs, 1H), 7.42 (brd, J=8.0 Hz, 1H), 7.34
(m, 2H), 7.13 (brd, J=7.6 Hz, 1H), 7.12 (brm, 1H), 6.72 (dd, J=6.8
Hz, 1H), 6.34 (s, 1H), 3.72 (brt, J=7.2 Hz, 2H), 3.22 (brt, J=7.2
Hz, 2H), 1.26 (s, 9H); LC-MS (EI) m/z: 469.2 (M+H.sup.+).
##STR523##
[0690] A mixture of 6-nitro-1H-indazole (25 g, 0.153 mmol,
commercially available) and 10% Pd/C (2.0 g) in MeOH was stirred
under H.sub.2 (1 atm) overnight. After filtration, the filtrate was
concentrated to yield 1H-indazol-6-ylamine (18.5 g, 94% yield) as a
yellow solid. .sup.1H NMR (300 MHz, DMSO-d.sub.6): 12.20 (br s,
1H), 7.70 (s, 1H), 7.35 (d, J=5.4 Hz, 1H), 6.49-6.44 (m, 2H), 5.17
(brs, 2H). MS (ESI) m/z: 134 (M+H.sup.+).
[0691] To a solution of 1H-indazol-6-ylamine (20 g, 153 mmol) in
conc. HCl (50 mL) was added an aqueous solution (50 mL) of
NaNO.sub.2 (19 g, 158 mmol) at 0.degree. C. and the resulting
mixture was stirred for 1 h. A solution of SnCl.sub.2.2H.sub.2O (90
g, 306 mmol) in conc. HCl (70 mL) pre-cooled to 0.degree. C. was
then added, and the mixture stirred for 2 h at RT. The precipitate
was filtered and washed with Et.sub.2O to yield
(1H-indazol-6-yl)-hydrazine hydrochloride as a yellow solid, which
was used without further purification.
[0692] A mixture of (1H-indazol-6-yl)-hydrazine hydrochloride and
4,4-dimethyl-3-oxo-pentanenitrile (17 g, 1.05 eq) in EtOH (200 mL)
was heated at reflux overnight. The reaction was concentrated and
the residue purified by column chromatography to yield
3-t-butyl-1-(1H-indazol-6-yl)-1H-pyrazol-5-amine (21 g, 58% yield,
for two steps). .sup.1H NMR (300 MHz, DMSO-d.sub.6): 8.21 (s, 1H),
7.96 (d, J=8.1 Hz, 1H), 7.81 (s, 1H), 7.25 (d, J=8.1 Hz, 1H), 5.71
(s, 1H), 1.31 (s, 9H); MS (ESI) m/z: 256 (M+H.sup.+).
[0693] To a solution of
3-t-butyl-1-(1H-indazol-6-yl)-1H-pyrazol-5-amine (15 g, 49 mmol)
dissolved in dioxane (100 mL) at RT was added 10% NaOH (50 mL) and
the mixture stirred for 0.5 h. Boc anhydride (12 g, 1.2 eq) was
then added to the mixture and the solution stirred for 3 h. The
mixture was extracted with CH.sub.2Cl.sub.2 (3.times.100 mL). The
combined organic extracts were concentrated and purified by column
chromatography to yield
6-(5-amino-3-t-butyl-pyrazol-1-yl)-indazole-1-carboxylic acid
t-butyl ester (13.1 g, 75% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 8.41 (s, 1H), 8.35 (s, 1H), 7.90 (d, J=8.1
Hz, 1H), 7.68 (d, J=8.1 Hz, 1H), 5.42 (s, 1H), 5.38 (brs, 2H), 1.65
(s, 9H), 1.22 (s, 9H); MS (ESI) m/z: 356 (M+H.sup.+).
[0694] Using general method A, the material from the previous
reaction (0.150 g, 0.422 mmol, 1.00) and 2,3-dichlorophenyl
isocyanate (0.0557 ml, 0.422 mmol, 1.00 eq) were combined to yield
of t-butyl
6-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-1H-indazol-
e-1-carboxylate (0.130 g, 57% yield). .sup.1H NMR (DMSO-d.sub.6):
.delta. 9.42 (s, 1H), 8.79 (s, 1H), 8.51-8.50 (m, 1H), 8.23-8.22
(m, 1H), 8.10-8.02 (m, 2H), 7.65-7.62 (m, 1H), 7.34-7.29 (m, 2H),
6.46 (s, 1H), 1.60 (s, 9H), 1.31 (s, 9H); MS (ESI) m/z: 543.0
(M+H.sup.+), 545.0 (M+2+H.sup.+).
[0695] A solution of yield of t-butyl
6-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-1H-indazol-
e-1-carboxylate (0.13 g, 0.239 mmol, 1.00 eq) in satd. HCl/EtOH
(5.00 ml) and stirred at 65.degree. C. for 2 h until the reaction
was clear and homogeneous. It was cooled to RT and evaporated. The
syrupy residue was dissolved in MeCN/H.sub.2O, frozen and
lyopholized to yield
1-(3-t-butyl-1-(1H-indazol-6-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)u-
rea (97.1 mg, 85% yield) as the HCl salt. .sup.1H NMR
(DMSO-d.sub.6): .delta. 9.32 (s, 1H), 8.81 (s, 1H), 8.17-8.16 (m,
1H), 8.13-8.12 (m, 1H), 8.10-8.07 (m, 1H), 7.92-7.82 (m, 1H),
7.65-7.59 (m, 1H), 7.24-7.25 (m, 2H), 6.44 (s, 1H), 1.30 (s, 9H);
MS (ESI) m/z: 443.0 (M+H.sup.+), 445.0 (M+2+H.sup.+).
##STR524##
[0696] A mixture of 5-nitro-1H-indazole (25 g, 0.153 mmol,
commercially available) and 10% Pd/C (2.0 g) in MeOH was stirred
under H.sub.2 (1 atm) overnight. After filtration, the filtrate was
concentrated to yield 20 g (97%) of 1H-indazol-5-amine as a yellow
solid. .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 12.50 (brs,
1H), 7.70 (s, 1H), 7.21 (d, J=8.7 Hz, 1H), 6.77 (d, J=8.7 Hz, 1H),
6.74 (s, 1H), 4.71 (brs, 1H), 3.15 (d, J=4.8 Hz, 2H); MS (ESI) m/z:
134 (M+H.sup.+).
[0697] To a solution of 1H-indazol-5-ylamine (20 g, 153 mmol) in
conc. HCl (50 mL) was added an aqueous solution (50 mL) of
NaNO.sub.2 (19 g, 158 mmol) at 0.degree. C. and the resulting
mixture was stirred for 1 h. A solution of SnCl.sub.2.2H.sub.2O (90
g, 306 mmol) in conc. HCl (70 mL), pre-cooled to 0.degree. C., was
then added. The reaction solution was stirred for 2 h at RT. The
precipitate was filtered and washed with ether to yield
(1H-indazol-5-yl)-hydrazine hydrochloride as a yellow solid, which
was used for the next reaction without further purification.
[0698] A mixture of (1H-indazol-5-yl)-hydrazine hydrochloride and
4,4-dimethyl-3-oxo-pentanenitrile (19 g, 1.05 eq) in EtOH (200 mL)
was heated at reflux overnight. The reaction was concentrated and
the residue purified by column chromatography to yield
3-t-butyl-1-(1H-indazol-5-yl)-1H-pyrazol-5-amine (23 g, 60% of two
steps). .sup.1H NMR (300 MHz, DMSO-d.sub.6): 8.24 (s, 1H), 8.06 (s,
1H), 7.75 (d, J=9.0 Hz, 1H), 7.45 (dd, J=9.0 Hz, 1.8 Hz, 1H), 5.7
(s, 1H), 1.31 (s, 9H). MS (ESI) m/z: 256 (M+H.sup.+).
[0699] To a solution of
3-t-butyl-1-(1H-indazol-5-yl)-1H-pyrazol-5-amine (14 g, 48 mmol) in
dioxane (100 mL) was added 10% NaOH (50 mL) at RT and the mixture
stirred for 0.5 h. Boc anhydride (12 g, 1.2 eq) was added to the
mixture and the solution stirred for 3 h. The mixture was extracted
with CH.sub.2Cl.sub.2 (3.times.100 mL). The combined organic
extracts were concentrated and purified by column chromatography to
yield t-butyl
5-(5-amino-3-t-butyl-1H-pyrazol-1-yl)-1H-indazole-1-carboxylate
(7.8 g, 46%). .sup.1H NMR (300 MHz, DMSO-d.sub.6): 8.44 (s, 1H),
8.10 (d, J=9.0 Hz, 1H), 8.00 (s, 1H), 7.82 (d, J=9.0 Hz, 1H), 5.39
(s, 1H), 5.24 (br s, 2H), 1.65 (s, 9H), 1.21 (s, 9H). MS (ESI) m/z:
356 (M+H.sup.+).
[0700] Using general method A, t-butyl
5-(5-amino-3-t-butyl-1H-pyrazol-1-yl)-1H-indazole-1-carboxylate
(0.150 g, 0.422 mmol, 1.00 eq) and 2,3-dichlorophenyl isocyanate
(0.0557 ml, 0.422 mmol, 1.00 eq). were combined to yield t-butyl
5-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-1H-indazol-
e-1-carboxylate (115.5 mg, 50% yield). .sup.1H NMR (DMSO-d.sub.6):
.delta. 9.25 (s, 1H), 8.73 (s, 1H), 8.53 (brs, 1H), 8.22-8.19 (m,
1H), 8.06-8.01 (m, 2H), 7.79-7.76 (m, 1H), 7.33-7.29 (m, 2H), 6.43
(s, 1H), 1.67 (s, 9H), 1.30 (s, 9H); MS (ESI) m/z: 543.0
(M+H.sup.+), 545.0 (M+2+H.sup.+).
[0701] t-Butyl
5-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-1H-indazol-
e-1-carboxylate (0.1155 g, 0.213 mmol, 1.00 eq) was dissolved in
satd. HCl/EtOH. The solution was heated at 80.degree. C. for 1 h.
After cooling to RT, the reaction was concentrated to dryness and
treated with 80:20 MeCN/H.sub.2O. The resulting suspension was
thoroughly chilled. The solids were collected by filtration, rinsed
with 80:20 MeCN/H.sub.2O, MeCN and dried on the filter to yield
1-(3-t-butyl-1-(1H-indazol-5-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)u-
rea (55.5 mg, 54.4% yield) as the HCl salt. .sup.1H NMR
(DMSO-d.sub.6): 9.18 (s, 1H), 8.76 (s, 1H), 8.19 (s, 1H), 8.08-8.06
(m, 1H), 7.89-7.88 (m, 1H), 7.70-7.67 (m, 1H), 7.47-7.44 (m, 1H),
7.33-7.28 (m, 2H), 6.40 (s, 1H), 1.29 (s, 9H); MS (ESI) m/z: 502.0
(M+H.sup.+), 504.0 (M+2+H.sup.+). ##STR525##
[0702] To a solution of phenethylamine (60.5 g, 0.5 mol) and
Na.sub.2CO.sub.3 (63.6 g, 0.6 mol) in EtOAc/HO (800 mL, 4:1) was
added ethyl chloroformate dropwise (65.1 g, 0.6 mol) at 0.degree.
C. during a period of 1 h. The mixture was warmed to RT and stirred
for an additional 1 h. The organic phase was separated and the
aqueous layer was extracted with EtOAc. The combined organic phases
were washed with H.sub.2O and brine, dried (Na.sub.2SO.sub.4),
filtered and concentrated to a crude solid, which was purified by
flash chromatography to afford ethyl phenethyl carbamate (90.2 g).
.sup.1H NMR (400 MHz, CDCl.sub.3): .delta. 7.32-7.18 (m, 5H), 4.73
(brs, 1H), 4.14-4.08 (q, J=6.8 Hz, 2H), 3.44-3.43 (m, 2H),
2.83-2.79 (t, J=6.8 Hz, 2H), 1.26-1.21 (t, J=6.8 Hz, 3H).
[0703] A suspension of ethyl phenethyl carbamate (77.2 g, 40 mmol)
in polyphosphoric acid (300 mL) was heated to 140-160.degree. C.
and stirred for 2.5 h. The reaction mixture was cooled to RT,
carefully poured into ice-H.sub.2O and stirred for 1 h. The aqueous
solution was extracted with EtOAc (3.times.300 mL). The combined
organic phases were washed with H.sub.2O, 5% K.sub.2CO.sub.3 and
brine, dried (Na.sub.2SO.sub.4), filtered and concentrated to a
crude solid which was purified by flash chromatography to afford
3,4-dihydro-2H-isoquinolin-1-one (24 g). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 7.91 (brs, 1H), 7.83 (d, J=7.5 Hz, 1H,),
7.43 (t, J=7.5 Hz, 1H), 7.33-7.25 (m, 2H), 3.37-3.32 (m, 2H), 2.87
(t, J=6.6 Hz, 2H).
[0704] To an ice-salt bath cooled mixture of conc. HNO.sub.3 and
conc. H.sub.2SO.sub.4 (200 mL, 1:1) was added
4-dihydro-2H-isoquinolin-1-one (15 g, 0.102 mol) dropwise over 15
min. After stirring for 2 h, the resulting mixture was poured into
ice-H.sub.2O and stirred for 30 min. The precipitate was filtered,
washed with H.sub.2O, and dried in air to afford
7-nitro-3,4-dihydro-2H-isoquinolin-1-one (13 g). .sup.1H NMR (300
MHz, DMSO-d.sub.6): .delta. 8.53 (d, J=2.4 Hz, 1H,), 8.31 (d, J=2.4
Hz, 1H), 8.29 (d, J=2.4 Hz, 1H), 7.62 (d, J=8.4 Hz, 1H), 3.44-3.39
(m, 2H), 3.04 (t, J=6.6 Hz, 2H).
[0705] A suspension of 7-nitro-3,4-dihydro-2H-isoquinolin-1-one
(11.6 g, 60 mmol) and 10% Pd/C (1.2 g,) in MeOH was stirred
overnight at RT under H.sub.2 (40 psi). The mixture was filtered
through Celite.RTM. and washed with MeOH. The filtrate was
evaporated under vacuum to afford 8.2 g of
7-amino-3,4-dihydro-2H-isoquinolin-1-one, which was used without
further purification.
[0706] To a suspension of 7-amino-3,4-dihydro-2H-isoquinolin-1-one
(8.1 g, 50 mmol) in conc. HCl (100 mL) cooled in an ice-H.sub.2O
bath was added a solution of NaNO.sub.2 (3.45 g, 50 mmol) in
H.sub.2O dropwise at such a rate that the reaction mixture never
rose above 5.degree. C. After stirring for 30 min, to the resulting
mixture was added a solution of SnCl.sub.2.2H.sub.2O (22.5 g, 0.1
mol) in conc. HCl (150 mL) dropwise at 0.degree. C. in an
ice-H.sub.2O bath. The resulting mixture was stirred for another 2
h at 0.degree. C. The precipitate was collected by suction, washed
with ether to afford 7-hydrazino-3,4-dihydro-2H-isoquinolin-1-one
(8.3 g), which was used for the next reaction without further
purification.
[0707] A mixture of 7-amino-3,4-dihydro-2H-isoquinolin-1-one (8.0
g, 37.6 mmol) and 4,4-dimethyl-3-oxo-pentanenitrile (5.64 g, 45
mmol) in EtOH (100 mL) and conc. HCl (10 mL) was heated at reflux
overnight. After removal of the solvent, the residue was washed
with ether to afford
7-(5-Amino-3-t-butyl-pyrazol-1-yl)-3,4-dihydro-2H-isoquinolin-1-one
hydrochloride as a yellow solid (11.5 g, 96% yield), which was used
without further purification. ##STR526##
[0708] Using general method A, Example A34 (2.0 g, 6.2 mmol) and
1,2-dichloro-3-isocyanato-benzene (1.42 g, 7.5 mmol) were combined
to afford 1.2 g
1-[3-t-butyl-1-(1-oxo-1,2,3,4-tetrahydroisoquinolin-7-yl)-1H-pyrazol-5-yl-
]-3-(2,3-di-chlorophenyl)urea (1.2 g, 41% yield). .sup.1H NMR (300
MHz, CDCl.sub.3): .delta. 9.08 (brs, 1H), 8.34 (brs, 1H), 8.15
(brs, 1H), 8.02 (m, 1H), 7.60 (brs, 1H), 7.53 (d, J=8.1 Hz, 1H),
7.29 (d, J=8.7 Hz, 1H), 7.15-7.09 (m, 2H), 6.62 (s, 1H), 3.5 (brm,
2H), 3.94 (brm, 2H), 1.34 (s, 9H). ##STR527##
[0709] Using general method C, Example 122 (120 mg, 0.25 mmol) was
reduced to yield
1-[3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-7-yl)-1H-pyrazol-5-yl]-3-(2-
,3-dichloro-phenyl)urea (80 mg, 70% yield). .sup.1H NMR (300 MHz,
CD.sub.3OD): .delta. 7.98 (t, J=4.8 Hz, 1H), 7.45-7.39 (m, 3H),
7.23 (d, J=5.1 Hz, 2H), 6.41 (s, 1H), 4.41 (s, 2H), 3.52 (t, J=6.3
Hz, 2H), 3.19 (t, J=6.3 Hz, 2H), 1.33 (s, 9H). ##STR528##
[0710] Using general method A, Example A34 (2.0 g, 6.2 mmol) and
1-chloro-4-isocyanatobenzene (1.15 g, 7.5 mmol) were combined to
afford
1-[3-t-butyl-1-(1-oxo-1,2,3,4-tetrahydroisoquinolin-7-yl)-1H-pyrazol-5-yl-
]-3-(4-chlorophenyl)urea (1.5 g, 55% yield). .sup.1H NMR (300 MHz,
CDCl.sub.3): .delta. 9.03 (s, 1H), 8.77 (s, 1H), 7.90 (s, 1H), 7.54
(d, J=7.5 Hz, 1H), 7.30 (d, J=9 Hz, 3H), 7.19 (d, J=9 Hz, 2H), 6.88
(brs, 1H), 6.74 (s, 1H), 3.45 (brs, 2H), 2.88 (t, J=6 Hz, 2H), 1.37
(s, 9H).
[0711] Using general method C,
1-[3-t-butyl-1-(1-oxo-1,2,3,4-tetrahydroisoquinolin-7-yl)-1H-pyrazol-5-yl-
]-3-(4-chlorophenyl)urea (1.0 g, 2.3 mmol) was reduced to afford
1-[3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-7-yl)-1H-pyrazol-5-yl]-3-(4-
-chloro-phenyl)urea (0.8 g, 82% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.13 (brs, 1H), 8.34 (brs, 1H), 7.41-7.12
(m, 7H), 6.31 (s, 1H), 3.88 (s, 2H), 2.95 (t, J=6.0 Hz, 2H), 2.70
(t, J=6.0 Hz, 2H), 1.24 (s, 9H). ##STR529##
[0712] To a solution of Example A34 (20 g, 0.070 mol) in THF (400
mL) was added LAH (15 g, 0.395 mol) in portions at 0-5.degree. C.
The resulting mixture was heated at reflux overnight, followed by
the addition of 10% NaOH solution. After stirring for 1 h at RT,
Boc.sub.2O (23 g, 0.106 mol) was added and the solution stirred
overnight. After filtration, the filtrate was concentrated to
afford the crude product, which was purified by reverse phase
chromatography to give
7-(5-amino-3-t-butyl-pyrazol-1-yl)-3,4-dihydro-1H-isoquinoline-2-carboxyl-
ic acid t-butyl ester (12 g, 75% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): 7.32 (s, 1H), 7.29 (d, J=2.7 Hz, 1H), 7.18 (d, J=8.4
Hz, 1H), 5.32 (s, 1H), 5.15 (s, 1H), 4.51 (s, 2H), 3.52 (t, J=5.6
Hz, 2H), 2.75 (t, J=5.6 Hz, 2H), 1.40 (s, 9H), 1.17 (s, 9H); MS
(ESI) m/z: 371(M+H.sup.+).
[0713] Using general method D,
7-(5-amino-3-t-butyl-pyrazol-1-yl)-3,4-dihydro-1H-isoquinoline-2-carboxyl-
ic acid t-butyl ester (0.250 g, 0.675 mmol) and 3-aminobenzonitrile
(0.0796 g, 0.674 mmol, 1.00 eq) were combined to yield 0.34 g (98%)
of t-butyl
7-(3-t-butyl-5-(3-(3-cyanophenyl)ureido)-1H-pyrazol-1-yl)-3,4-dih-
ydroisoquinoline-2(1H)-carboxylate as an oil. MS (ESI) m/z: 515.2
(M+H.sup.+).
[0714] To t-butyl
7-(3-t-butyl-5-(3-(3-cyanophenyl)ureido)-1H-pyrazol-1-yl)-3,4-dihydroisoq-
uinoline-2(1H)-carboxylate (0.34 g, 0.66 mmol) in EtOAc (5.0 ml)
was added 3M HCl/EtOAc (1.1 mL, 3.3 mmol). The resulting mixture
was stirred at 20-25.degree. C. for 6.5 h. The suspension was
diluted with Et.sub.2O to fully precipitate the solids. These were
collected by filtration, rinsed with Et.sub.2O and dried to yield
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-7-yl)-1H-pyrazol-5-yl)-3-(3-
-cyanophenyl)urea (0.1377 g, 46% yield) of as an off-white solid.
.sup.1H NMR (400 MHz, DMSO-d.sub.6): 10.1 (s, 1H), 9.47 (brs, 2H),
8.97 (s, 1H), 7.94-7.93 (m, 1H), 7.63-7.60 (m, 1H), 7.49-7.33 (m,
5H), 6.37 (s, 1H), 4.36 (brs, 2H), 3.37 (brs, 2H), 3.06-3.03 (m,
2H), 1.28 (s, 9H); MS (ESI) m/z: 415.3 (M+H.sup.+). ##STR530##
[0715] Using the same method as for Example 107, Example 123 (100
mg, 0.22 mmol) was converted to
1-[1-(2-acetyl-1,2,3,4-tetrahydroisoquinolin-7-yl)-3-t-butyl-1H-pyrazol-5-
-yl]-3-(2,3-dichlorophenyl)urea (55 mg, 50% yield). .sup.1H NMR
(300 MHz, DMSO-d.sub.6): .quadrature. 9.16 (m, 1H), 8.74 (s, 1H),
8.00 (s, 1H), 7.20-7.36 (m, 5H), 6.33 (s, 1H), 4.66 (s, 2H), 4.61
(s, 2H), 2.76-2.86 (m, 2H), 2.04 (s, H), 1.22 (s, 9H); MS (ESI)
m/z: 500 (M+H.sup.+). ##STR531##
[0716] Using the same method as for Example 108, Example 123 (100
mg, 0.22 mmol) was converted to
1-{3-t-butyl-1-[2-(methanesulfonyl)-1,2,3,4-tetrahydroisoquinolin-7-yl]-1-
H-pyrazol-5-yl}-3-(2,3-dichlorophenyl)urea (45 mg, 38% yield).
.sup.1H NMR (300 MHz, DMSO-d.sub.6): 9.18 (s, 1H), 8.75 (s, 1H),
8.03 (m, 1H), 7.26-7.33 (m, 5H), 6.35 (s, 1H), 4.40 (s, 2H), 3.42
(s, 2H), 2.94 (s, 2H), 2.93 (s, 3H), 1.23 (s, 9H); MS (ESI) m/z:
536 (M+H.sup.+).
[0717] A mixture of CDI (810 mg, 5.0 mmol) and methanesulfonamide
(500 mg, 5.0 mmol) in DMF (10 mL) was stirred at 60.degree. C. for
5 h. To 1 mL of the reaction mixture was added Example 123 (100 mg,
0.23 mmol). The resulting mixture was stirred overnight at RT.
After ##STR532## removal of the solvent, the residue was purified
by reverse phase chromatography to afford
N-(7-{3-t-butyl-5-[3-(4-chloro-phenyl)ureido]pyrazol-1-yl}-3,4-dihydro-1H-
-isoquinoline-2-carbonyl)methane-sulfonamide (55 mg, 44% yield).
.sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 10.6 (s, 1H), 9.09 (s,
1H), 8.37 (s, 1H), 7.41-7.26 (m, 7H), 6.33 (s, 1H), 4.60 (s, 2H),
3.62 (brm, 2H), 3.24 (s, 3H), 2.88-2.85 (m, 2H), 1.24 (s, 9H).
##STR533##
[0718] A suspension of Example A34 (1.00 g, 3.12 mmol), Et.sub.3N
(0.43 mL, 0.315 g, 3.12 mmol) and Lawesson's reagent (1.26 g, 3.12
mmol) in dioxane (30 mL) was heated at reflux. After 1 h, the
mixture was cooled to RT. Water (50 mL) was added and the mixture
was extracted with EtOAc (3.times.100 mL), dried (MgSO.sub.4) and
filtered. The filtrate was filtered through a pad of silica gel and
the silica gel was thoroughly rinsed with MeOH. The solvents were
evaporated under reduced pressure and the residue purified by
column chromatography to yield of
7-(3-t-butyl-5-amino-1H-pyrazol-1-yl)-3,4-dihydroisoquinoline-1(2H)-thion-
e as a yellow solid (310 mg, 33% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 10.6 (brs, 1H), 8.49 (d, J=2.4 Hz, 1H), 7.66
(dd, J=8.0, and 2.4 Hz, 1H), 7.35 (d, J=8.4 Hz, 1H), 5.38 (s, 1H),
5.16 (brs, 2H), 3.42-3.38 (m, 2H), 2.93 (t, J=6.8 Hz, 2H), 2.21 (s,
9H); MS (ESI) m/z: 301.2 (M+H.sup.+).
[0719] A suspension of
7-(3-t-butyl-5-amino-1H-pyrazol-1-yl)-3,4-dihydroisoquinoline-1(2H)-thion-
e (0.150 g, 0.499 mmol) in THF (3 mL) was added to a solution of
2,3-dichlorophenyl isocyante (0.141 g, 0.749 mmol), pyridine (0.061
mL, 0.059 g, 0.749 mmol) and THF (3 mL). The flask which contained
the starting material was again rinsed with THF (4 mL) and the
solution was added to the reaction flask. The resulting yellow
suspension was briefly heated with a heat gun, causing the reaction
mixture to become clear. After 18 h, the solution was concentrated
and the residue was purified by column chromatography to yield
1-[3-t-butyl-1-(1-thioxo-1,2,3,4-tetrahydroisoquinolin-7-yl)-1H-pyrazol-5-
-yl]-3-(2,3-dichlorophenyl)urea as a yellow solid (203 mg, 83%
yield). .sup.1H NMR (400 MHz, acetone-d.sub.6): .delta. 9.60 (brs,
1H), 8.66 (d, J=2.0 Hz, 1H), 8.61 (brs, 1H), 8.26 (dd, J=8.4, and
2.0 Hz, 1H), 8.17 (brs, 1H), 7.68 (dd, J=8.0, and 2.0 Hz, 1H), 7.40
(d, J=8.4 Hz, 1H), 7.30 (t, J=8.2 Hz, 1H), 7.23 (dd, J=7.6, and 1.2
Hz, 1H), 6.48 (s, 1H), 3.62-3.58 (m, 2H), 3.07 (t, J=6.6 Hz, 2H),
1.33 (s, 9H); MS (ESI) m/z: 488.0 (M+H.sup.+).
[0720]
1-[3-t-Butyl-1-(1-thioxo-1,2,3,4-tetrahydroisoquinolin-7-yl)-1H-py-
razol-5-yl]-3-(2,3-dichlorophenyl)urea (0.170 g, 0.348 mmol) was
dissolved in 0.5M N.sub.3/dioxane (30 mL). Mercuric chloride (0.142
g, 0.522 mmol) was added and the mixture was stirred at 80.degree.
C. After 18 h, H.sub.2O (2 mL) was added. The mixture was stirred
for 30 min and filtered through a pad of Celite.RTM.. The solvent
was removed under vacuum and the residue was purified by
reverse-phase chromatography to yield
1-[1-(1-amino-3,4-dihydroisoquinolin-7-yl)-3-t-butyl-1H-pyrazol-5-y-
l]-3-(2,3-dichlorophenyl)urea (25 mg, 15% yield). .sup.1H NMR (400
MHz, CD.sub.3OD): .quadrature. 8.14 (d, J=2.0 Hz, 1H), 7.99-7.96
(m, 1H), 7.84 (dd, J=8.0, and 2.0 Hz, 1H), 7.63 (d, J=8.0 Hz, 1H),
7.23-7.21 (m, 2H), 6.46 (s, 1H), 3.62 (t, J=6.8 Hz, 2H), 3.14 (t,
J=6.8 Hz, 2H), 1.35 (s, 9H); MS (ESI) m/z: 471.3 (M+H.sup.+).
##STR534##
[0721] Example 123 (crude, 0.241 mmol) was suspended in DMF (1 mL).
Triethylamine (0.1 mL, 0.073 g, 0.072 mmol),
di-t->butoxycarbonylthiourea (67 mg, 0.241 mmol) and mercuric
chloride (72 mg, 0.265 mmol) were added and the mixture was stirred
for 20 min. The mixture was filtered through a pad of Celite.RTM.
and concentrated to afford a crude solid which was purified by
column chromatography to yield
1-[3-t-butyl-1-(N,N'-(t-butyloxycarbonyl)-2-amidino-1,2,3,4-tetrahydroiso-
quinolin-7-yl)-1H-pyrazol-5-yl]-3-(2,3-dichlorophenyl)-urea (76 mg,
45% yield). .sup.1H NMR (400 MHz, CDCl.sub.3): .delta. 10.1 (brs,
1H), 8.07 (dd, J=6.4, and 3.2 Hz, 1H), 8.03 (brs, 1H), 7.97 (brs,
1H), 7.22 (dd, J=8.4, and 1.6 Hz, 1H), 7.12-7.10 (m, 3H), 7.06 (d,
J=8.0 Hz, 1H), 6.36 (s, 1H), 4.57 (brs, 2H), 3.63 (brs, 2H), 2.79
(brs, 2H), 1.48 (s, 18H), 1.30 (s, 9H); MS (ESI) m/z: 700.3
(M+H.sup.+).
[0722]
1-[3-t-Butyl-1-(N,N'-(t-butyloxycarbonyl)-2-amidino-1,2,3,4-tetrah-
ydroisoquinolin-7-yl)-1H-pyrazol-5-yl]-3-(2,3-dichlorophenyl)-urea
(0.076 g, 1.1 mmol) and TFA (0.7 mL, 8.7 mmol) were dissolved in
CH.sub.2Cl.sub.2 (4 mL), stirred overnight, concentrated under
reduced pressure and the resulting solid purified by reverse-phase
chromatography to yield
1-[3-t-butyl-1-(2-carbamimidoyl-1,2,3,4-tetrahydroisoquinolin-7--
yl)-1H-pyrazol-5-yl]-3-(2,3-dichlorophenyl)urea (51 mg, 77% yield).
.sup.1H NMR (400 MHz, CD.sub.3OD): .delta. 8.02 (dd, 1H, J=6.4, 3.2
Hz), 7.44-7.43 (m, 2H), 7.37 (br s, 1H), 7.25 (d, 1H, J=2.8 Hz),
7.24 (s, 1H), 6.45 (s, 1H), 4.67 (s, 2H), 3.70 (t, 2H, J=6.0 Hz),
3.09 (t, 2H, J=5.8 Hz), 1.35 (s, 9H); MS (ESI) m/z: 500.3
(M+H.sup.+). ##STR535##
[0723] To a solution of hydrocarbostyril (9.00 g, 61.2 mmol) in
conc. H.sub.2SO.sub.4 (180 mL) cooled to -10.degree. C. was slowly
added H.sub.2O (45 mL), followed by HNO.sub.3 (65%, 4.5 mL). The
yellow solution was stirred at -10.degree. C. for 10 min and then
carefully quenched at -10.degree. C. with H.sub.2O (500 mL). The
precipitated yellow solid was filtered off, washed with H.sub.2O
and dried in vacuo to yield
1,2-dihydro-6-nitroisoquinolin-3(4H)-one (10.3 g, 88% yield).
.sup.1H NMR (400 MHz, CDCl.sub.3): .delta. 9.35 (brs, 1H),
8.12-8.09 (m, 2H), 6.95-6.92 (m, 1H), 3.10 (t, J=7.6 Hz, 2H), 2.73
(t, J=7.8 Hz, 2H); MS (ESI) m/z: 193.0 (M+H.sup.+).
[0724] To a suspension of 1,2-dihydro-6-nitroisoquinolin-3(4H)-one
(10.3 g, 53.6 mmol) in MeOH (150 mL) was added 10% Pd/C (1.14 g,
1.07 mmol) and the mixture was stirred overnight under H.sub.2 (1
atm). After filtration, the filtrate was concentrated and the
residue was suspended in acetone, filtered and precipitated with
conc. HCl (10 mL). The resulting precipitate was collected, washed
with H.sub.2O and acetone and recrystallized from MeOH/H.sub.2O to
yield 6-amino-1,2-dihydroisoquinolin-3(4H)-one as a grey solid (6.7
g, 63% yield). .sup.1H NMR (400 MHz, CD.sub.3OD): .delta. 7.22 (d,
J=2.0 Hz, 1H), 7.20 (dd, J=8.4, and 2.4 Hz, 1H), 6.98 (d, J=8.4 Hz,
1H), 3.01 (t, J=7.6 Hz, 2H), 2.59 (t, J=7.6 Hz, 2H); MS (ESI) m/z:
163.0 (M+H.sup.+).
[0725] To a suspension of 6-amino-1,2-dihydroisoquinolin-3(4H)-one
(4.00 g, 20.1 mmol) in 2M HCl (40 mL) at -10.degree. C. was added
solid NaNO.sub.2 (1.39 g, 20.1 mmol) causing all solids to
dissolve. The mixture was stirred at -10.degree. C. for 30 min and
then solid SnCl.sub.2.2H.sub.2O (9.09 g, 40.3 mmol) was added at
-10.degree. C. The mixture was allowed to warm to RT over a period
of 30 min and then stirred for 2 h. Ethanol (160 mL) and
pivaloylacetonitrile (2.52 g, 20.1 mmol) were added and the
solution was heated at reflux overnight under Ar atm. The EtOH was
removed under reduced pressure, H.sub.2O (200 mL) was added, and
the mixture was extracted with CH.sub.2Cl.sub.2 (3.times.200 mL),
dried (MgSO.sub.4), concentrated and purified via column
chromatography to yield
6-(3-t-butyl-5-amino-1H-pyrazol-1-yl)-1,2-dihydroisoquinolin-3(4H)-one
(1.98 g, 35% yield). .sup.1H NMR (400 MHz, CDCl.sub.3): .delta.
7.82 (brs, 1H), 7.40 (brs, 1H), 7.35 (dd, J=8.4, and 2.4 Hz, 1H),
6.80 (d, J=8.8 Hz, 1H), 5.52 (s, 1H), 3.67 (brs, 2H), 3.01 (t,
J=7.8 Hz, 2H), 2.65 (t, J=7.4 Hz, 2H), 1.30 (s, 9H); MS (ESI) m/z:
285.2 (M+H.sup.+). ##STR536##
[0726] Using general method A, Example A35 and 2,3-dichlorophenyl
isocyanate (0.145 g, 0.774 mmol) were combined to yield
1-[3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-yl]-3-
-(2,3-dichlorophenyl)urea (307 mg, 92% yield). .sup.1H NMR (400
MHz, acetone-d.sub.6): .delta. 9.26 (brs, 1H), 8.55 (brs, 1H), 8.28
(dd, J=8.4, and 1.6 Hz, 1H), 8.21 (brs, 1H), 7.36 (s, 1H), 7.32 (d,
J=8.4 Hz, 1H), 7.31 (t, J=8.2 Hz, 1H), 7.24 (dd, J=8.4, and 1.6 Hz,
1H), 7.03 (d, J=8.4 Hz, 1H), 6.47 (s, 1H), 3.01 (t, J=7.4 Hz, 2H),
2.53 (t, J=7.6 Hz, 2H), 1.31 (s, 9H); MS (ESI) m/z: 472.2
(M+H.sup.+). ##STR537##
[0727] Using general method D, Example A35 (0.075 g, 0.16 mmol) and
Example A11 (0.04 g, 0.16 mmol) were combined to yield
1-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-
-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.065 g, 63%) as a solid, .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 10.29 (s, 1H), 9.32 (s, 1H), 9.16 (s, 1H), 9.12 (s, 1H),
8.48 (s, 1H), 8.17 (s, 2H), 7.82 (s, 1H), 7.46-7.27 (m, 5H), 6.98
(d, J=8.4 Hz, 1H), 6.36 (s, 1H), 3.71 (s, 3H), 2.96 (t, J=7.2 Hz,
2H), 1.27 (s, 9H); MS (ESI) m/z: 563.3 (M+H.sup.+). ##STR538##
[0728] 6-Hydrazinyl-3,4-dihydroquinolin-2(1H)-one (1.00 g, 4.68
mmol, available from Example A35) was dissolved in EtOH (10 mL) and
3-cyclopentyl-3-oxopropanenitrile (0.706 g, 5.15 mmol) was added.
The reaction mixture was heated at 80.degree. C. for 22 h. The
reaction mixture was concentrated and the residue was suspended in
EtOAc (30 mL) and treated slowly with satd. Na.sub.2CO.sub.3 (30
mL). The solution was extracted with EtOAc (3.times.), and the
combined organics were washed H.sub.2O and dried
(Na.sub.2SO.sub.4), filtered, concentrated and dried to yield
6-(5-amino-3-cyclopentyl-1H-pyrazol-1-yl)-3,4-dihydroquinolin-2(-
1H)-one (1.2 g, 87% yield) which was used without further
purification. LC-MS (EI) m/z: 297.2 (M+H.sup.+). ##STR539##
[0729] Using general method D, Example A36 (0.15 g, 0.32 mmol) and
Example A9 (70 mg, 0.38 mmol) were combined to yield
1-(3-cyclopentyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-y-
l)-3-(3-(pyridin-3-yloxy)phenyl)urea (60 mg, 28% yield, 2 steps) as
an off-white solid HCl salt. .sup.1H-NMR (DMSO-d.sub.6): .delta.
10.3 (s, 1H), 9.41 (s, 1H), 8.56 (bs, 1H), 8.52 (s, 1H), 8.51 (bs,
1H), 7.71 (m, 2H), 7.33 (m, 2H), 7.25 (dd, J=2.4, and 8.8 Hz, 1H),
7.12 (dd, J=1.6, and 8.0 Hz, 1H), 6.95 (d, J=8.0 Hz, 1H), 6.73 (dd,
J=2.0, and 8.0 Hz, 1H), 6.26 (s, 1H), 2.98 (m, 1H), 2.93 (t, J=7.6
Hz, 2H), 2.47 (t, J=7.6 Hz, 2H), 1.95 (m, 2H), 1.64 (m, 6H); LC-MS
(EI) m/z: 509.2 (M+H.sup.+). ##STR540##
[0730] Using general method D, Example A36 and Example A11 were
combined to yield
1-(3-cyclopentyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-py-
razol-5-yl)-3-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)ph-
enyl)urea (11 mg, 6% yield, 2 steps). .sup.1H-NMR (DMSO-d.sub.6):
.delta. 10.3 (s, 1H), 9.18 (s, 1H), 9.15 (s, 1H), 9.12 (s, 1H),
8.38 (s, 1H), 8.17 (s, 1H), 7.82 (bt, 1H), 7.46 (m, 1H), 7.37 (t,
J=8.0 Hz, 1H), 7.31 (m, 1H), 7.26 (m, 1H), 6.98 (d, J=8.4 Hz, 1H),
6.30 (s, 1H), 3.71 (s, 3H), 2.96 (m, 3H), 1.96 (m, 2H), 1.68 (m,
6H); LC-MS (EI) m/z: 575.2 (M+H.sup.+). ##STR541##
[0731] Using general method C, Example 131 was reduced to yield
1-[3-t-butyl-1-(1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-yl]-3-(2,3--
dichlorophenyl)urea hydrochloride (204 mg, 70% yield). .sup.1H NMR
(400 MHz, CD.sub.3OD): .delta. 8.11 (dd, J=6.0, and 4.0 Hz, 1H),
7.40-7.36 (m, 2H), 7.28 (d, J=2.0 Hz, 1H), 7.27 (s, 1H), 7.11 (d,
J=8.0 Hz, 1H), 6.85 (s, 1H), 3.48 (t, J=5.8 Hz, 2H), 2.95 (t, J=6.2
Hz, 2H), 2.08 (quintet, J=5.8 Hz, 2H), 1.42 (s, 9H); MS (ESI) m/z:
458.3 (M+H.sup.+). ##STR542##
[0732] To a suspension of Example 135 (0.151 g, 0.305 mmol),
Et.sub.3N (0.124 g, 1.22 mmol) and di-t-butoxycarbonyl-thiourea
(0.084 g, 0.305 mmol) in DMF (2 mL) at RT was added HgCl.sub.2
(0.091 g, 0.336 mmol) and the resulting mixture was stirred
overnight. Water (20 mL) was added and the mixture extracted with
Et.sub.2O (3.times.20 mL), dried (MgSO.sub.4), concentrated, and
purified via column chromatography to yield
1-(3-t-butyl-1-(N,N'-(t-butyloxycarbonyl)-1-amidino-1,2,3,4-tetrahydroqui-
nolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea as a
colorless solid (92 mg, 43% yield). .sup.1H NMR (400 MHz,
acetone-d.sub.6): .delta. 9.64 (brs, 1H), 8.56 (brs, 1H), 8.27 (dd,
J=8.0, and 1.6 Hz, 1H), 8.16 (brs, 1H), 7.37-7.33 (m, 3H), 7.30 (d,
J=8.4 Hz, 1H), 7.24 (dd, J=8.0, and 1.2 Hz, 1H), 6.46 (s, 1H), 3.78
(t, J=6.4 Hz, 2H), 2.83 (t, J=6.8 Hz, 2H), 2.01 (quintet, J=6.4 Hz,
2H), 1.37 (brs, 18H), 1.32 (s, 9H); MS (ESI) m/z: 700.3
(M+H.sup.+).
[0733] A solution of
1-(3-t-butyl-1-(N,N'-(t-butyloxycarbonyl)-1-amidino-1,2,3,4-tetrahydroqui-
nolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea (0.088 g,
0.13 mmol) in 3 N HCl/EtOAc (10 mL) was stirred overnight at RT.
The solvent was evaporated and the residue was redissolved in
H2O/MeCN 2:1 (5 mL) and lyopholized to yield
1-[3-t-butyl-1-(1-amidino-1,2,3,4-tetrahydroquinolin-6-yl]-1H-pyrazol-5-y-
l)-3-(2,3-dichlorophenyl)urea as the hydrochloride salt (65 mg, 96%
yield). .sup.1H NMR (400 MHz, CD.sub.3OD): .delta. 7.99 (t, J=4.8
Hz, 1H), 7.58 (d, J=8.4 Hz, 1H), 7.52-748 (m, 2H), 7.26-7.25 (m,
2H), 6.68 (s, 1H), 3.81 (t, J=6.4 Hz, 2H), 2.90 (t, J=6.6 Hz, 2H),
2.09 (quintet, J=6.4 Hz, 2H), 1.40 (s, 9H); MS (ESI) m/z: 501.2
(M+H.sup.+). ##STR543##
[0734] To an ice-cold solution of 2-(3-methoxyphenyl)-1-ethanamine
(5.00 g, 33.1 mmol) and Et.sub.3N (5.10 mL, 3.70 g, 36.6 mmol) in
CH.sub.2Cl.sub.2 (100 mL) was added ethyl chloroformate (3.50 mL,
3.62 g, 33.4 mmol). The resulting solution was allowed to warm to
RT and was stirred for 2 h. Water (100 mL) was added and the
mixture was extracted with CH.sub.2Cl.sub.2 (3.times.50 mL), dried
(MgSO.sub.4) and concentrated to yield ethyl
3-methoxyphenethylcarbamate (7.32 g, 99% yield) as a pale yellow
oil. .sup.1H NMR (400 MHz, CDCl.sub.3): .delta. 7.22 (t, J=7.8 Hz,
1H), 6.78 (d, J=8.0 Hz, 1H), 6.77 (d, J=8.0 Hz; 1H), 6.74 (s, 1H),
4.65 (brs, 1H), 4.11 (q, J=7.2 Hz, 2H), 3.80 (s, 3H), 3.44 (q,
J=6.4 Hz, 2H), 2.79 (t, J=7.0 Hz, 2H), 1.23 (t, J=7.0 Hz, 3H); MS
(ESI) m/z: 224.2 (M+H.sup.+).
[0735] A mixture of ethyl 3-methoxyphenethylcarbamate (7.32 g, 32.8
mmol) and polyphosphoric acid (30 g) was heated at 120.degree. C.
for 2 h after which H.sub.2O (100 mL) was added and the mixture was
cooled to RT. The mixture was extracted with EtOAc (6.times.100
mL), dried (MgSO.sub.4) and concentrated to yield crude
6-methoxy-3,4-dihydroisoquinolin-1(2H)-one (8.0 g, 138%) as a
sticky gum. .sup.1H NMR (400 MHz, acetone-d.sub.6): .delta. 7.88
(d, J=8.4 Hz. 1H), 7.04 (brS, 1H), 6.87 (dd, J=8.4, and 2.4 Hz,
1H), 6.82 (d, J=2.4 Hz, 1H), 3.84 (s, 3H), 3.49 (t, J=6.4 Hz, 2H),
2.94 (t, J=6.2 Hz, 2H); MS (ESI) m/z: 178.0 (M+H.sup.+).
[0736] A mixture of 6-methoxy-3,4-dihydroisoquinolin-1(2H)-one
(6.40 g, 35.6 mmol) and pyridinium hydrochloride (41.1 g, 356 mmol)
was heated at 200.degree. C. for 3 h. Water was added (200 mL) and
the mixture was extracted with CH.sub.2Cl.sub.2 (3.times.200 mL),
dried (MgSO.sub.4) and concentrated to yield
6-hydroxy-3,4-dihydroisoquinolin-1(2H)-one (1.60 g, 39%, 2 steps)
as a yellow solid. .sup.1H NMR (400 Mhz, acetone-d.sub.6): .delta.
8.91 (brs, 1H), 7.81 (d, J=8.4 Hz, 1H), 7.40 (brs, 1H), 6.77 (d,
J=8.4 Hz, 1H), 6.70 (s, 1H), 3.47 (dt, J=6.8, and 3.2 Hz, 2H), 2.88
(t, J=6.6 Hz, 2H); MS (ESI) m/z: 164.0 (M+H.sup.+).
[0737] To a suspension of
6-hydroxy-3,4-dihydroisoquinolin-1(2H)-one (1.60 g, 9.81 mmol) and
Et.sub.3N (1.37 mL, 0.992 g, 9.81 mmol) in CH.sub.2Cl.sub.2 (100
mL) was added triflic chloride (1.65 g, 9.81 mmol). After 2 h of
stirring, H.sub.2O (100 mL) was added and the mixture was extracted
with CH.sub.2Cl.sub.2 (3.times.100 mL), dried (MgSO.sub.4),
concentrated and purified via column chromatography to yield
1-oxo-1,2,3,4-tetrahydroisoquinolin-6-yl trifluoromethanesulfonate
(1.70 mg, 59% yield) as a colorless solid. .sup.1H NMR (400 MHz,
CDCl.sub.3): .delta. 8.19 (d, J=8.4 Hz, 1H), 7.27 (dd, J=8.4, and
2.4 Hz, 1H), 7.19 (d, J=2.4 Hz, 1H), 6.58 (brs, 1H), 3.64 (dt,
J=6.8, and 2.4 Hz, 2H), 3.08 (t, J=6.6 Hz, 2H); MS (ESI) m/z: 296.0
(M+H.sup.+).
[0738] To a suspension of 1-oxo-1,2,3,4-tetrahydroisoquinolin-6-yl
trifluoromethanesulfonate (1.70 g, 5.76 mmol), benzophenone
hydrazone (1.36 g, 6.91 mmol), Cs.sub.2CO.sub.3 (2.81 g, 8.64 mmol)
and DPPF (0.048 g, 0.086 mmol) in degassed PhMe (40 mL) was added
Pd(OAc).sub.2 (0.013 g, 0.058 mmol) and the resulting mixture was
stirred at RT for 30 min and then heated at 90.degree. C. After 16
h, the mixture was cooled to RT, H.sub.2O (50 mL) was added and the
mixture was extracted with EtOAc (3.times.50 mL), dried
(MgSO.sub.4), concentrated and purified via column chromatography
to yield
6-(2-(diphenylmethylene)hydrazinyl)-3,4-dihydroisoquinolin-1(2H)-one
(980 mg, 50% yield). .sup.1H NMR (400 MHz, acetone-d.sub.6):
.delta. 8.69 (brs, 1H), 7.79 (d, J=9.2 Hz, 1H), 7.63-7.54 (m, 5H),
7.37-7.31 (m, 5H), 7.11-7.08 (m, 2H), 6.67 (brS, 1H), 3.47 (dt,
J=7.2, and 3.2 Hz, 2H), 2.90 (t, J=6.6 Hz, 2H); MS (ESI) m/z: 342.0
(M+H.sup.+).
[0739] A solution of
6-(2-(diphenylmethylene)hydrazinyl)-3,4-dihydroisoquinolin-1(2H)-one
(0.980 g, 2.87 mmol), pivaloylacetonitrile (0.539 g, 4.31 mmol) and
p-TsOH (4.04 g, 28.8 mmol) in EtOH (20 mL) was heated at reflux
overnight. The reaction was cooled and H.sub.2O was added (20 mL).
The mixture was extracted with CH.sub.2Cl.sub.2 (3.times.50 mL),
dried (MgSO.sub.4), concentrated and recrystallized to yield
6-(5-amino-3-t-butyl-1H-pyrazol-1-yl)-3,4-dihydroisoquinolin-1(2H)-one
(387 mg, 48% yield). Purification of the mother liquors via column
chromatography yielded an additional 330 mg (40%) of
6-(5-amino-3-t-butyl-1H-pyrazol-1-yl)-3,4-dihydroisoquinolin-1(2H)-one.
.sup.1H NMR (400 MHz, acetone-d.sub.6): .delta. 7.99 (d, J=8.4 Hz,
1H), 7.65 (dd, J=8.4, and 2.0 Hz, 1), 7.60 (s, 1H), 6.99 (brs, 1H),
5.53 (s, 1H), 4.92 (brs, 2H), 3.55 (dt, J=6.8, and 2.8 Hz, 2H),
3.02 (t, J=6.4 Hz, 2H), 1.25 (s, 9H); MS (ESI) m/z: 285.2
(M+H.sup.+). ##STR544##
[0740] Using general method A, Example A37 (0.070 g, 0.069 mmol)
and 2,3-dichlorophenyl isocyanate (0.069 g, 0.37 mmol) were
combined to yield
1-(3-t-butyl-1-(1-oxo-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl-
)-3-(2,3-dichloro-phenyl)urea (90 mg, 77% yield) as a pale yellow
solid. .sup.1H NMR (400 Mhz, acetone-d.sub.6): .delta. 9.01 (brs,
1H), 8.54 (brs, 1H), 8.30 (d, J=8.4 Hz, 1H), 7.93 (d, J=8.0 Hz,
1H), 7.55 (d, J=8.4 Hz, 1H), 7.50 (s, 1H), 7.33-7.29 (m, 2H), 7.23
(d, J=8.0 Hz, 1H), 6.55 (s, 1H), 3.55 (dt, J=6.4, and 1.6 Hz, 2H),
3.05 (t, J=6.2 Hz, 2H), 1.33 (s, 9H); MS (ESI) m/z: 472.0
(M+H.sup.+). ##STR545##
[0741] Using general method C, Example A37 (0.200 g, 0.703 mmol)
was reduced to
3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-amine
which was used without further purification. MS (ESI) m/z: 446.3
(4; (M+H.sup.+), 271.3 (M+2H.sup.+).
[0742] To a solution of
3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-amine
in CH.sub.2Cl.sub.2 (20 mL) was added Boc anhydride (0.154 g, 0.703
mmol) and the solution was stirred at RT for 30 min. Evaporation
and column chromatography yielded t-butyl
6-(5-amino-3-t-butyl-1H-pyrazol-1-yl)-3,4-dihydroisoquinoline-2(1H)-carbo-
xylate (154 mg, 59% yield, 2 steps) as a yellow oil. .sup.1H NMR
(400 MHz, acetone-d.sub.6): .delta. 7.44-7.39 (m, 2H), 7.21 (d,
J=7.6 Hz, 1H), 5.47 (s, 1H), 4.76 (brs, 2H), 4.56 (brs, 2H), 3.64
(t, J=5.8 Hz, 2H), 2.85 (t, J=6.0 Hz, 2H), 1.46 (s, 9H), 1.24 (s,
9H); MS (ESI) m/z: 371.2 (M+H.sup.+). ##STR546##
[0743] Using general method A, Example A38 (0.150 g, 0.405 mmol)
and 2,3-dichlorophenyl isocyanate (0.100 g, 0.532) were combined,
and the product deprotected using general method F to yield
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(2-
,3-dichlorophenyl)urea (125 mg, 88% yield). .sup.1H NMR (400 MHz,
CD.sub.3OD): .delta. 8.07-8.05 (m, 1H), 7.55-7.50 (m, 3H),
7.28-7.27 yield (m, 2H), 6.69 (brs, 1H), 4.50 (s, 2H), 3.58 (t,
J=6.2 Hz, 2H), 3.27-3.23 (m, 2H), 1.41 (s, 9H); MS (ESI) m/z: 460.0
(M+H.sup.+).
[0744] Starting with Example A38, the following compounds were made
using either general method A or D and deprotection using general
method F. Yields are reported over two (general method A) or three
(general method D) steps starting from Example A38. TABLE-US-00006
MS (EI) Example Name (M + H.sup.+) .sup.1H NMR (400 MHz,
CD.sub.3OD) ##STR547## 1-(3-t-butyl-1- (1,2,3,4-tetrahydro-
isoquinolin-6-yl)-1H- pyrazol-5-yl)-3-(3- cyanophenyl)urea 19 mg,
24% yield 415.3 .delta. 7.90-7.89 (m, 1H), 7.61 (d, 1H, J=8.4 Hz),
7.54 (s, 1H), 7.52 (d, J=2.0 Hz, 1H), 7.46 (d, J=8.0 Hz, 1H), 7.43
(d, J=3.6 Hz, 1H), 7.38 (dt, J=7.2, and 1.2 Hz, 1H), 7.00 (s, 1H),
4.47 (s, 2H), 3.56 (t, J=6.2 Hz, 2H), 3.24 (t,J=6.4 Hz, 2H), 1.40
(s, 9H), ##STR548## 1-(3-t-butyl-1- (1,2,3,4-tetrahydro-
isoquinolin-6-yl)-1H- pyrazol-5-yl)-3-(3- phenoxyphenyl)urea 54 mg,
84% yield 482.3 .delta. 7.54-7.52 (m, 2H), 7.47 (d, J =8.8 Hz, 1H),
7.37-7.33 (m, 2H), 7.24 (t, J=8.2 Hz, 1H), 7.19 (t, J=2.0 Hz, 1H),
7.12 (t, J=7.4 Hz, 1H), 7.06 (dd, J=8.0, and 1.2 Hz, 1H), 7.00-6.97
(m, 2H), 6.67 (s, 1H), 6.65 (dd, J=8.4, and 2.4 Hz, 1H), 4.47 (s,
2H), # 3.56 (t, J=6.4 Hz, 2H), 3.23 (t, J=6.2 Hz, 2H), 1.39 (s, 9H)
##STR549## 1-(3-t-butyl-1- (1,2,3,4-tetrahydro-
isoquinolin-6-yl)-1H- pyrazol-5-yl)-3-(3- (pyridin-3-
yloxy)phenyl)urea 38 mg, 36% yield 483.3 .delta. 8.68 (d, J=2.8 Hz,
1H), 8.61 (d, J=6.0 Hz, 1H), 8.24 (ddd, J=8.8, 2.4, and 0.8 Hz,
1H), 8.07 (dd, J=9.0, and 5.8 Hz, 1H), 7.60-7.59 (m, 2H), 7.56--.54
(m, 2H), 7.44 (t, J=8.2 Hz, 1H), 7.31 (dd, J=8.4, and 1.2 Hz, 1H),
6.92 (dd, J=8.0, and 1.6 # Hz, 1H), 4.52 (s, 2H), 3.59 (t, J=6.2
Hz, 2H), 3.28 (t, J=6.4 Hz, 2H), 1.43 (s, 9H), pyrazolamine, urea
and amine protons not visible ##STR550## 1-(3-t-butyl-1-
(1,2,3,4-tetrahydro- isoquinolin-6-yl)-1H- pyrazol-5-yl)-3-(4-
methyl-3-(pyrimidin- 2-ylamino)phenyl)- urea 53 mg, 84% yield 497.2
.delta. 8.59 (d, J=4.8 Hz, 2H), 7.66 (d, J=2.4 Hz, 1H), 7.51-7.44
(m, 3H), 7.35 (d, J=8.4 Hz, 1H), 7.30 (dd, J=8.0, and 2.0 Hz, 1H),
7.10 (t, J=5.6 Hz, 1H), 6.60 (s, 1H), 4.47 (s, 2H), 3.56 (t, J=6.4
Hz, 2H), 3.24 (t, J=6.4 Hz, 2H), 2.25 (s, 3H), 1.37 (s, 9H)
##STR551## 1-(3-t-butyl-1- (1,2,3,4- tetrahydroisoquinolin-
6-yl)-1H-pyrazol-5- yl)-3-(4- phenoxyphenyl)-urea 45 mg, 70% yield
482.2 .delta. 7.57-7.50 (m, 3H), 7.40 (d, J=9.2 Hz, 2H), 7.33 (t,
J=8.8 Hz, 2H), 7.08 (t, J=7.6 Hz, 1H), 6.95-6.93 (m, 4H), 6.76 (s,
1H), 4.50 (s, 2H), 3.58 (t, J=6.4 Hz, 2H), 3.26 (t, J=6.2 Hz, 2H),
1.41 (s, 9H) ##STR552## 1-(3-t-butyl-1- (1,2,3,4-
tetrahydroisoquinolin- 6-yl)-1H-pyrazol-5- yl)-3-(2,3-
difluorophenyl)-urea 110 mg, 47% yield 426.2 (DMSO-d.sub.6):
.delta. 9.37 (m, 1H), 9.24 (m, 1H), 9.11 (m, 1H), 7.88 (m, 1H),
7.42 (m, 2H), 7.36 (m, 2H), 7.12 (m, 1H), 7.04 (m, 1H), 6.38 (s,
1H), 4.32 (brt, 2H), 3.39 (brm, 2H), 3.08 (brt, 2H), 1.28 (s, 9H)
##STR553## 1-(3-t-butyl-1- (1,2,3,4- tetrahydroisoquinolin-6
-yl)-1H-pyrazol-5- yl)-3-(2,4- difluorophenyl)-urea 180 mg, 77%
yield 426.2 (DMSO-d.sub.6): .delta. 9.23 (brs, 2H), 8.93 (m, 1H),
8.89 (m, 1H), 8.00 (m, 1H), 7.2-7.5 (m, 4H), 7.01 (m, 1H), 6.36 (s,
1H), 4.32 (bt, 2H), 3.40 (m, 2H), 3.07 (t, J=6.4 Hz, 2H), 1.27 (s,
9H) ##STR554## 1-(3-t-butyl-1- tetrahydroisoquinolin-
6-yl)-1H-pyrazol-5- yl)-3-(2,4,5- trifluorophenyl)-urea 120 mg, 53%
yield 444.0 (DMSO-d.sub.6): .delta. 9.27 (brm, 1H), 9.19 (brs, 1H),
9.03 (brm, 1H), 8.13 (m, 1H), 7.63 (m, 1H), 7.38 (m, 3H), 6.38 (s,
1H), 4.36 (brm, 2H), 3.39 (brm, 2H), 3.07 (brt, J=6.4 Hz, 2H), 1.25
(s, 9H) ##STR555## 1-(3-t-butyl-1- (1,2,3,4- tetrahydroisoquinolin-
6-yl)-1H-pyrazol-5- yl)-3-(2,3,4- trifluorophenyl)-urea 45 mg, 18%
yield 444.0 (DMSO-d.sub.6): .delta. 9.32 (brm, 1H), 9.17 (s, 1H),
9.01 (s, 1H), 7.78 (m, 1H), 7.37 (m, 3H), 6.35 (s, 1H), 4.32 (brm,
2H), 3.39 (brm, 2H), 3.07 (brt, J=6.4 Hz, 2H), 1.25 (s, 9H)
[0745] ##STR556##
[0746] Using general method D, Example A38 (0.08 g, 0.15 mmol) and
Example A12 (0.04 g, 0.16 mmol) were combined and the product
deprotected using general method F to yield
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea (54 mg, 52% yield,
3 steps) as the HCl salt. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.78 (s, 1H), 9.55 (brs, 2H), 8.87 (brs, 2H), 8.52 (d,
J=5.6 Hz, 1H), 7.55-7.43 (m, 5H), 7.39-7.34 (m, 2H), 7.16-7.14 (m,
2H), 6.35 (s, 1H), 4.30 (brs, 2H), 3.39-3.37 (m, 2H), 3.12-3.09 (m,
2H), 2.78 (d, J=5.6 Hz, 3H), 1.28 (s, 9H); MS (ESI) m/z: 540.3
(M+H.sup.+). ##STR557##
[0747] Using general method D, Example A38 (0.08 g, 0.15 mmol) and
Example A11 (0.037 g, 0.15 mmol) were combined and the product
deprotected using general method F to yield
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(32 mg, 29% yield, 3 steps) as the HCl salt. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.46 (s, 1H), 9.29 (brs, 2H), 9.16 (s, 1H),
9.11 (s, 1H), 8.65 (s, 1H), 8.15 (s, 1H), 7.82 (s, 1H), 7.46-7.44
(m, 2H), 7.38-7.34 (m, 2H), 7.29-7.23 (m, 2H), 7.18-7.16 (m, 1H),
6.36 (s, 1H), 4.31 (brs, 2H), 3.71 (s, 3H), 3.41-3.37 (m, 2H), 3.09
(t, J=6.0 Hz, 2H), 1.28 (s, 9H); MS (ESI) m/z: 549.3 (M+H.sup.+).
##STR558##
[0748] Using general method D, Example A38 (0.1 g, 0.22 mmol) and
Example A13 (0.037 g, 0.15 mmol) were combined and the product
deprotected using general method F to yield
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(2-(m-
ethylcarbamoyl)pyridin-4-yloxy)phenyl)urea
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(5-chloropyridin-3-yloxy)phenyl)urea (27 mg, 51%, 2 steps) as the
HCl salt. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.77 (s,
1H), 9.49 (brs, 2H), 8.83 (s, 1H), 8.43 (d, J=1.6 Hz, 1H), 8.33 (d,
J=2.0 Hz, 1H), 7.63-7.62 (m, 1H), 7.43-7.41 (m, 2H), 7.34-7.29 (m,
3H), 7.15-7.13 (m, 1H), 6.72 (dd, J=8.0 Hz, 2.0 Hz, 1H), 6.32 (s,
1H), 4.29 (brs, 2H), 3.38-3.35 (m, 2H), 3.08 (t, J=6.0 Hz, 2H),
1.26 (s, 9H); MS (ESI) m/z: 517.3 (M+H.sup.+). ##STR559##
[0749] Using general method H, 4-(4-aminophenyl)isoindolin-1-one
(150 mg, 0.67 mmol, made according to literature procedures) was
transformed to yield prop-1-en-2-yl
4-(1-oxoisoindolin-4-yl)phenylcarbamate (176 mg, 85% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.1 (s, 1H), 8.67 (s,
1H), 7.65 (apparent td, J=7.6, 1.2 Hz, 2H), 7.61-7.55 (m, 5H), 4.77
(brt, J=1.0 Hz, 1H), 4.76 (s, 1H), 4.50 (s, 2H), 1.96 (s, 3H); MS
(ESI) m/z: 309.0 (M+H.sup.+). ##STR560##
[0750] A solution of Example A39 (58.5 mg, 0.19 mmol), Example A38
(70 mg, 0.019 mmol) and N-methyl pyrrolidine (8.9 mg, 0.10 mmol) in
THF (0.4 mL) was heated at 55.degree. C. for 24 h. The crude
reaction mixture was chromatographed on silica gel to provide
t-butyl
6-(3-t-butyl-5-(3-(4-(1-oxoisoindolin-4-yl)phenyl)ureido)-1H-pyrazol-1-yl-
)-3,4-dihydroiso-quinoline-2(1H)-carboxylate (76 mg). MS (ESI) m/z:
621.3 (M+H.sup.+).
[0751] Using general method F, t-butyl
6-(3-t-butyl-5-(3-(4-(1-oxoisoindolin-4-yl)phenyl)ureido)-1H-pyrazol-1-yl-
)-3,4-dihydroiso-quinoline-2(1H)-carboxylate (74 mg, 0.12 mmol) was
deprotected to yield
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-(1-oxoisoindolin-4-yl)phenyl)urea hydrochloride (45 mg, 43% yield,
2 steps). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.59 (s,
1H), 9.36 (brs, 2H), 8.75 (s, 1H), 8.67 (s, 1H), 7.64 (m, 2H),
7.59-7.51 (m, 5H), 7.45 (m, 2H), 7.36 (d, J=9.2 Hz, 1H), 6.37 (s,
1H), 4.50 (s, 2H), 4.31 (brs, 2H), 3.39 (m, 2H), 3.10 (t, J=6.1 Hz,
2H), 1.29 (s, 9H); MS (ESI) m/z: 519.2 (M+H.sup.+). ##STR561##
[0752] Using general method H, Example A39 (665 mg, 1.79 mmol) was
transformed to yield t-butyl
6-(3-t-butyl-5-((prop-1-en-2-yloxy)carbonyl)-1H-pyrazol-1-yl)-3,4-dihydro-
isoquinoline-2(1H)-carboxylate (843 mg, 100% yield). .sup.1H NMR
(400 MHz, CDCl.sub.3): .delta. 7.30-7.22 (m, 3H), 6.71 and 6.45
(brs, 1H total), 4.77 (brs, 1H), 4.74 (m, 1H), 4.63 (s, 2H), 3.68
(m, 2H), 2.91 (t, J=5.6 Hz, 2H), 1.98 (s, 3H), 1.52 (s, 9H), 1.36
(s, 9H); MS (ESI) m/z: 455.3 (M+H.sup.+). ##STR562##
[0753] Using the same procedure as for Example 151, Example A40
(145 mg, 0.32 mmol) and 3-amino-5-fluorobenzonitrile (50 mg, 0.37
mmol) were combined to yield
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-cyano-5-fluorophenyl)urea hydrochloride (55 mg, 38% yield, 2
steps). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.2 (s, 1H),
9.36 (brs, H), 8.96 (s, 1H), 7.65 (dt, J=11.2, and 2.0 Hz, 1H),
7.62 (t, J=1.9 Hz, 1H), 7.44-7.40 (m, 3H), 7.34 (d, J=9.1 Hz, 1H),
6.37 (s, 1H), 4.30 (s, 2H), 3.39 (m, 2H), 3.09 (t, J=6.0 Hz, 2H),
1.28 (s, 9H); MS (ESI) m/z: 433.3 (M+H.sup.+). ##STR563##
[0754] Using the same procedure as for Example 151, Example A40
(136 mg, 0.30 mmol) and
6-methyl-N1-(4-(pyridin-3-yl)pyrimidin-2-yl)ben-zene-1,3-diamine
(80 mg, 0.29 mmol, made according to literature procedures) were
combined to afford
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-y-
l)-3-(4-methyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea
dihydrochloride (109 mg, 56% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.56 (s, 1H), 9.50 (brs, 2H), 9.43 (d, J=1.7
Hz, 1H), 9.10 (s, 1H), 8.99 (brd, J=8.3 Hz, 1H), 8.92 (dd, J=5.4,
1.3 Hz, 1H), 8.83 (s, 1H), 8.60 (d, J=5.3 Hz, 1H), 7.94 (dd, J=8.0,
5.4 Hz, 1H), 7.98 (s, 1H), 7.57 (d, J=5.3 Hz, 1H), 7.46-7.42 (m,
2H), 7.34 (d, J=8.4 Hz, 1H), 7.14-7.08 (m, 2H), 6.35 (s, 1H), 4.29
(m, 2H), 3.37 (m, 2H), 3.09 (t, J=6.0 Hz, 2H), 2.18 (s, 3H), 1.28
(s, 9H); MS (ESI) m/z: 574.2 (M+H.sup.+). ##STR564##
[0755] Using the same procedure as for Example 108, Example 138
(0.070 g, 0.14 mmol) and MsCl (0.032 g, 0.28 mmol) were combined to
yield
1-(3-t-butyl-1-(2-(methylsulfonyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-
-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea (57 mg, 75%) as a
colorless solid. .sup.1H NMR (400 Mhz, acetone-d.sub.6): .delta.
8.56 (brs, 1H), 8.26 (dd, J=8.4, and 1.6 Hz, 1H), 8.17 (brs, 1H),
7.42-7.40 (m, 2H), 7.33-7.29 (m, 2H), 7.24 (dd, J=8.4, and 2.0 Hz,
1H), 6.48 (s, 1H), 4.49 (s, 2H), 3.56 (t, J=6.0 Hz, 2H), 3.03 (t,
J=5.8 Hz, 2H), 2.93 (s, 3H), 1.32 (s, 9H); MS (ESI) m/z: 536.0
(M+H.sup.+). ##STR565##
[0756] To a solution of hydrocarbostyril (7.8 g, 0.53 mol) in conc.
H.sub.2SO.sub.4 (200 mL) was slowly added H.sub.2O (50 mL) at
-10.degree. C. Conc. HNO.sub.3 (70%, 4.0 mL) was added dropwise at
-10.degree. C. The yellow solution was stirred at -10.degree. C.
for 10 min and then carefully quenched with ice H.sub.2O (500 mL).
The precipitated yellow solid was filtered, washed with H.sub.2O
and dried under vacuum to obtain
6-nitro-3,4-dihydroquinolin-2(1H)-one (7.9 g, 78% yield). .sup.1H
NMR (400 Mhz, CDCl.sub.3): .delta. 9.28 (s, 1H), 8.12 (m, 2H), 6.95
(d, J=9.2 Hz, 1H), 3.12 (t, J=7.2 Hz, 2H), 2.75 (d, J=7.2 Hz,
2H).
[0757] To a solution of 6-nitro-3,4-dihydroquinolin-2(1H)-one (0.46
g, 2.4 mmol) and NBS (0.53 g, 3.0 mmol) in CHCl.sub.3 (20 mL) was
added benzoyl peroxide (cat. amount) at RT. The mixture was
refluxed at 80.degree. C. for 3 h. More NBS (0.25 g) was added and
the reaction mixture was refluxed at 80.degree. C. for 1 h. The
solvent was evaporated and the residue was dissolved in EtOH. The
solid was filtered, washed with EtOH and dried under vacuum to
obtain 6-nitroquinolin-2-ol as a pale yellow solid (0.36 g, 79%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.71 (d, J=2.0
Hz, 1H), 8.34 (dd, J=2.8, and 9.2 Hz, 1H), 8.14 (d, J=9.6 Hz, 1H),
7.44 (d, J=9.2 Hz, 1H), 6.68 (dd, J=1.6, and 9.6 Hz, 1H). LC-MS
(EI) m/z: 191.0 (M+H.sup.+).
[0758] A mixture of 6-nitroquinolin-2-ol and PtO.sub.2 (20 mg) in
EtOH (30 mL) was stirred under H.sub.2 (1 atm) for 20 h. More
PtO.sub.2 (10 mg) was added and was stirred under H.sub.2 (1 atm)
for 2 days. The solution was filtered and washed with MeOH and
CHCl.sub.3. The solvent was evaporated and the residue was dried
under vacuum to obtain 6-aminoquinolin-2(1H)-one as a yellow solid
(0.28 g, 92% yield). LC-MS (EI) m/z: 161.0 (M+H.sup.+).
[0759] To a solution of 6-aminoquinolin-2(1H)-one in conc. HCl (1.5
mL) was added an aqueous solution (0.75 mL) of NaNO.sub.2 dropwise
at 0.degree. C. The reaction mixture was stirred at 0.degree. C.
for 1 h, and then added a solution of SnCl.sub.2.2H.sub.2O in conc.
HCl (0.75 mL) dropwise at 0.degree. C. The reaction mixture was
allowed to reach RT over a period of 30 min and then stirred for
additional 2 h. The reaction mixture was diluted with EtOH. The
mixture was filtered to remove some solids and then
pivaloylacetonitrile was added into the solution. The reaction
mixture was heated at 80.degree. C. for 16 h. The reaction mixture
was evaporated and the residue was suspended in ethyl acetate (30
mL) and treated slowly with satd. Na.sub.2CO.sub.3 (30 mL). The
solution was extracted with EtOAc (3.times.). The combined organics
were washed H.sub.2O and dried (Na.sub.2SO.sub.4). Filtration,
evaporation, and drying under vacuum provided crude
6-(5-amino-3-t-butyl-1H-pyrazol-1-yl)quinolin-2(1H)-one which was
used as is in the next reaction. LC-MS (EI) m/z: 283.0 (M+H.sup.+).
##STR566##
[0760] Using general method A, Example A41 (90 mg, 0.32 mmol) in
THF (3 mL) and 2,3-dichlorophenyl isocyanate (72 mg, 0.38 mmol)
were combined to yield
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3--
(2,3-dichlorophenyl)-urea as a yellow solid (52 mg, 35% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.22 (s, 1H), 8.74 (s,
1H), 8.07 (dd, J=3.2, and 6.4 Hz, 1H), 8.01 (d, J=10.0 Hz, 1H),
7.85 (d, J=2.4 Hz, 1H), 7.64 (dd, J=2.4, and 8.4 Hz, 1H), 7.43 (d,
J=8.8 Hz, 1H), 7.31 (d, J=3.24 Hz, 1H), 7.30 (s, 1H), 6.59 (dd,
J=1.6, and 9.2 Hz, 1H), 6.41 (s, 1H), 1.28 (s, 9H); MS (EI) m/z:
470.0 (M+H.sup.+). ##STR567##
[0761] To a solution of
(S)-1,2,3,4-tetrahydroisoquinolone-3-carboxylic acid (5.00 g, 28.2
mmol) in conc. H.sub.2SO.sub.4 (20 mL) at RT was added dropwise a
solution of KNO.sub.3 (2.95 g, 29.2 mmol) in conc. H.sub.2SO.sub.4
(10 mL) without cooling. When the addition was complete, the
mixture was stirred for 5 min and then carefully diluted with
H.sub.2O and neutralized with conc. NH.sub.4OH (about 100 mL). The
precipitate was filtered, washed with H.sub.2O and acetone and
dried in vacuo to give 6.60 g (crude yield>100%) of a mixture of
nitrated compounds which was used as is in the next reaction. MS
(EI) m/z: 223.0 (M+H.sup.+).
[0762] To a solution of the mixture from the previous reaction
(4.40 g, 18.6 mmol) in CH.sub.2Cl.sub.2 (100 mL) was added TFAA
(3.89 mL, 5.87 g, 27.9 mmol) and the resulting solution was stirred
at RT for 30 min. Water (100 mL) was added and the mixture was
extracted with CH.sub.2Cl.sub.2 (3.times.100 mL). The organic layer
was dried (MgSO.sub.4), concentrated, and dried to yield 6.2 g
(100%) of (S)-methyl
7-nitro-2-(2,2,2-trifluoroacetyl)-1,2,3,4-tetrahydroisoquinoline-3-carbox-
ylate and the 6-nitro isomer as a mixture. MS (EI) m/z: 333.0
(M+H.sup.+).
[0763] To a solution of the two regioisomers (6.20 g, 18.7 mmol) in
MeOH (100 mL) was added 10% Pd/C (0.397 g, 0.161 mmol) and the
mixture was stirred under H.sub.2 (1 atm). The mixture was filtered
through Celite.RTM. and concentrated to yield a yellow syrup of
(S)-methyl
7-amino-2-(2,2,2-trifluoroacetyl)-1,2,3,4-tetrahydroisoquinoline-3-carbox-
ylate and the 6-amino isomer as a mixture (6.1 g, crude
yield>100%) which was used without further purification. MS (EI)
m/z: 303.0 (M+H.sup.+).
[0764] To a solution of the mixture from the previous reaction
(5.60 g, 16.5 mmol) in 2N HCl (30 mL) at 0.degree. C. was added in
portions solid NaNO.sub.2 (1.14 g, 16.5 mmol) and the resulting
solution was stirred for 45 min at 0.degree. C.
SnCl.sub.2.2H.sub.2O (7.46 g, 33.1 mmol) was then added and the
mixture was allowed to reach RT and was stirred for 90 min. Ethanol
(270 mL) and pivaloylacetonitrile (3.10 g, 24.8 mmol) were added
and the resulting solution was heated at reflux overnight. Ethanol
was removed under reduced pressure and 2N HCl (500 mL) was added to
the residue. The mixture was extracted with CH.sub.2Cl.sub.2
(3.times.500 ml), the organic layer was dried (MgSO.sub.4),
concentrated, and purified via column chromatography to yield
(3S)-methyl
7-(5-amino-3-t-butyl-1H-pyrazol-1-yl)-2-(2,2,2-trifluoroacetyl)-1,2,3,4-t-
etrahydroisoquinoline-3-carboxylate and (3S)-methyl
6-(5-amino-3-t-butyl-1H-pyrazol-1-yl)-2-(2,2,2-trifluoroacetyl)-1,2,3,4-t-
etrahydroisoquinoline-3-carboxylate as a mixture (3.10 mg, 44%)
heavily contaminated with pivaloylacetonitrile (around 70 mol %).
This material was used directly for the next step. MS (EI) m/z:
425.2 (M+H.sup.+).
[0765] Using general method A, the previous mixture (1.60 g, 3.77
mmol) and 2,3-dichlorophenyl isocyanate (4.50 g, 23.9 mmol) were
combined and the mixture of two compounds separated by column
chromatography to yield (3S)-methyl
7-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-2-(2,2,2-t-
rifluoroacetyl)-1,2,3,4-tetrahydroisoquinoline-3-carboxylate (275
mg, 12% yield), MS (EI) m/z: 612.1 (M+H.sup.+) and (3S)-methyl
6-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-2-(2,2,2-t-
rifluoroacetyl)-1,2,3,4-tetrahydroisoquinoline-3-carboxylate (80
mg, 4% yield), MS (EI) m/z: 612.0 (M+H.sup.+). ##STR568##
[0766] Using general method D, Example A41 (50 mg, 0.18 mmol) and
Example A9 (34 mg, 0.18 mmol) were combined to yield
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(py-
ridin-3-yloxy)phenyl)urea as an off-white solid (34 mg, 45% yield).
.sup.1H NMR (DMSO-d.sub.6): .delta. 9.01 (s, 1H), 8.40 (s, 1H),
8.37 (m, 2H), 7.98 (d, J=9.6 Hz, 1H), 7.82 (d, J=2.4 Hz, 1H), 7.61
(dd, J=2.4, and 8.8 Hz, 1H), 7.43 (m, 3H), 7.29 (t, J=8.0 Hz, 1H),
7.24 (t, J=2.4 Hz, 1H), 7.08 (dd, J=1.6, and 8.4 Hz, 1H), 6.70 (dd,
J=2.4, and 8.4 Hz, 1H), 6.58 (dd, J=2.0, and 10.0 Hz, 1H), 6.36 (s,
1H), 1.27 (s, 9H); LC-MS (EI) m/z: 495.2 (M+H.sup.+).
##STR569##
[0767] Using general method D, Example A41 (0.090 g, 0.20 mmol, 1.0
eq) and Example A12 (0.053 g, 0.22 mmol, 1.10 eq) and i-Pr.sub.2NEt
(0.044 ml, 0.25 mmol, 1.25 eq) were combined to yield
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea (11.2 mg. 10% yield, 2
steps. .sup.1H NMR (acetone-d.sub.6): 9.04 (s, 1H), 8.49-8.48 (m,
1H), 8.44 (s, 1H), 8.35 (brs, 1H), 7.96-7.94 (m, 1H), 7.87-7.86 (m,
1H), 7.76-7.73 (m, 1H), 7.65-7.64 (m, 1H), 7.59-7.58 (m, 1H),
7.47-7.39 (m, 2H), 7.31-7.29 (m, 1H), 7.31-7.29 (m, 1H), 7.14-7.12
(m, 1H), 6.85-6.82 (m, 1H), 6.55 (s, 1H), 6/52 (s, 1H), 2.94 (s,
3H), 1.33 (s, 9H); MS (ESI) m/z: 552.2 (M+H.sup.+). ##STR570##
[0768] Using general method D, Example A41 (0.075 g, 0.16 mmol) and
Example A11 (0.04 g, 0.16 mmol) were combined to afford
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(8--
methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.062 g, 60%) as the HCl salt. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .quadrature. 9.37 (brs, 1H), 9.17 (s, 1H), 9.12 (s,
1H), 8.65 (brs, 1H), 8.16 (s, 1H), 8.01 (d, J=9.6 Hz, 1H), 7.87 (d,
J=2.4 Hz, 1H), 7.81 (brs, 1H), 7.66 (dd, J=8.8 Hz, 2.0 Hz, 1H),
7.45-7.41 (m, 2H), 7.36 (t, J=8.0 Hz, 1H), 7.30-7.28 (m, 1H), 6.58
(d, J=9.6 Hz, 1H), 6.40 (s, 1H), 3.70 (s, 3H), 1.28 (s, 9H); MS
(ESI) m/z: 561.3 (M+H.sup.+). ##STR571##
[0769] Using general method D, Example A41 (0.081 g, 0.19 mmol) and
Example A12 (0.05 g, 0.21 mmol) were combined to afford
1-(3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea (0.04 g, 60%, 2 steps)
as a white solid HCl salt. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.48 (s, 1H), 8.89 (s, 1H), 8.72 (s, 1H), 8.52 (d, J=5.6
Hz, 1H), 8.01 (d, J=9.6 Hz, 1H), 7.88 (s, 1H), 7.66 (dd, J=8.8 Hz,
2.0 Hz, 1H), 7.53 (d, J=8.8 Hz, 2H), 7.47-7.43 (m, 3H), 7.18-7.13
(m, 3H), 6.59 (d, J=9.6 Hz, 1H), 6.37 (s, 1H), 2.79 (d, J=4.8 Hz,
3H), 1.29 (s, 9H); MS (ESI) m/z:552.2 (M+H.sup.+). ##STR572##
[0770] To a degassed solution of 1-iodo-3-nitrobenzene (0.35 g, 1.4
mmol) in DME (5 mL) was added Pd(PPh.sub.3).sub.4 (0.08 g, 10%
mol). After stirring for 5 min, 3-pyridylboronicacid (0.2 g, 1.65
mmol) and 2M Na.sub.2CO.sub.3 (1 mL) solution were added. After
refluxing for 16 h under an Ar atmosphere, the reaction mixture was
poured into H.sub.2O (15 mL) and extracted with EtOAc (2.times.30
mL). The combined organic extracts were washed with brine, dried
(Na.sub.2SO.sub.4), concentrated and purified via column
chromatography to yield 3-(3-nitrophenyl)pyridine (0.22 g, 78%) as
a white solid. .sup.1H NMR (CDCl.sub.3): .delta. 8.94 (brs, 1H),
8.73 (brs, 1H), 8.48 (t, J=1.6 Hz, 1H), 8.32-8.29 (m, 1H),
7.98-7.93 (m, 2H), 7.72-7.68 (m, 1H), 7.48 (brs, 1H); Exact mass:
200.0, Found: 201.0 (M+1).sup.+.
[0771] To a solution of 3-(3-nitrophenyl)pyridine (0.22 g, 1.1
mmol) in EtOAc (10 mL) was added PtO.sub.2 (0.025 g, 10% mol) and
the mixture was stirred for 4 h under H.sub.2 (1 atm). It was
filtered through Celite.RTM. and the combined filtrates were
concentrated to yield 3-(pyridin-3-yl)benzenamine (0.175 g, 94%) as
a semi solid which was used without further purification. .sup.1H
NMR (DMSO-d.sub.6): .delta. 8.77 (d, J=2.0 Hz, 1H), 8.53 (dd, J=8.8
Hz, 1.6 Hz, 1H), 7.57-7.52 (m, 1H), 7.46-7.43 (m, 1H), 7.13 (t,
J=8.0 Hz, 1H), 6.86-6.80 (m, 2H), 6.63-6.60 (m, 1H), 5.23 (s, 2H);
Exact mass: 170.0, Found: 171.0 (M+1).sup.+. ##STR573##
[0772] Using the same procedure as for Example A43,
5-iodo-2-aminopyridine (0.31 g, 1.4 mmol) and 3-nitrophenylboronic
acid (0.28 g, 1.7 mmol) were combined to yield
5-(3-nitrophenyl)pyridin-2-amine (0.18 g, 60%) as a white solid.
.sup.1H NMR (DMSO-d.sub.6): .delta. 8.37 (d, J=2.4 Hz, 1H), 8.34
(t, J=2.0 Hz, 1H), 8.11-8.04 (m, 2H), 7.83 (dd, J=8.0 Hz, 2.4 Hz,
1H), 7.68 (t, J=8.0 Hz, 1H), 6.55 (dd, J=8.4 Hz, 0.8 Hz, 1H), 6.26
(s, 2H); Exact mass: 215.0, Found: 216.0 (M+1).sup.+.
[0773] To a solution of 5-(3-nitrophenyl)pyridin-2-amine (0.17 g,
0.8 mmol) in CH.sub.2Cl.sub.2 (10 mL) was added pyridine (0.12 g,
1.6 mmol) and TFAA (0.2 g, 0.9 mmol). After stirring for 1 h at RT,
3M HCl (20 mL) was added to the reaction and the product was
extracted with CH.sub.2Cl.sub.2 (2.times.20 mL). The combined
organic extracts were washed with satd. NaHCO.sub.3 solution
(1.times.25 mL) and brine, then dried (Na.sub.2SO.sub.4) and
concentrated to yield a solid. This solid was dissolved in EtOAc,
and PtO.sub.2 was added to this mixture which was stirred under
H.sub.2 (1 atm) for 4 h. The mixture was filtered through
Celite.RTM., and the combined filtrates were concentrated to yield
N-(5-(3-aminophenyl)pyridin-2-yl)-2,2,2-trifluoroacetamide (0.21 g,
95%) as a solid which was used without further purification.
.sup.1H NMR (DMSO-d.sub.6): .delta. 8.65 (d, J=2.4 Hz, 1H),
8.11-8.09 (m, 1H), 8.03-8.01 (m, 1H), 7.16 (t, J=8.0 Hz, 1H),
6.92-6.88 (m, 2H), 6.66-6.64 (m, 1H); Exact mass: 281.1, Found:
282.3 (M+1).sup.+. ##STR574##
[0774] Using general procedure 1), Example A35 (0.09 g, 0.2 and
Example A44 (0.05 g, 0.20 mmol) were combined and deprotected using
general method G to yield
1-(3-(6-aminopyridin-3-yl)phenyl)-3-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydr-
oquinolin-6-yl)-1H-pyrazol-5-yl)urea (47 mg, 45% yield) as a solid.
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.27 (s, 1H), 9.40
(s, 1H), 8.58 (s, 1H), 8.23-8.21 (m, 2H), 8.11 (brs, 1H), 7.77 (s,
1H), 7.38-7.33 (m, 2H), 7.28-7.24 (m, 2H), 7.10 (d, J=0.8 Hz, 1H),
6.97 (d, J=0.8 Hz, 1H), 6.35 (s, 1H), 2.95 (t, J=6.4 Hz, 2H), 1.27
(s, 9H); MS (ESI) m/z: 496.3 (M+H.sup.+). ##STR575##
[0775] Using general method D, Example A35 (0.09 g, 0.2 mmol) and
Example A43 (0.034 g, 0.2 mmol) were combined to yield
1-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-
-(3-(pyridin-3-yl)phenyl)urea (76 mg, 74%) as a white solid as the
HCl salt. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.27 (s,
1H), 9.70-9.67 (m, 1H), 9.16 (s, 1H), 8.89 (s, 1H), 8.77 (brs, 2H),
8.11-8.08 (m, 1H), 7.95 (s, 1H), 7.47 (s, 2H), 7.35 (s, 1H), 7.29
(d, J=8.4 Hz, 1H), 6.97 (d, J=8.4 Hz, 1H), 6.36 (s, 1H), 2.95 (t,
J=7.6 Hz, 2H), 1.27 (s, 9H); MS (ESI) m/z: 481.2 (M+H.sup.+).
##STR576##
[0776] To a suspension of 6-aminoquinolin-2(1H)-one (0.72 g, 4.5
mmol, see Example A41) in conc. HCl (5 mL) was slowly added
NaNO.sub.2 (0.43 g, 6.3 mmol) solution in H.sub.2O (5 mL) at
0.degree. C. After stirring for 1 h, SnCl.sub.2.2H.sub.2O (2.0 g,
9.0 mmol), dissolved in conc. HCl (7 mL), was slowly added at such
a rate that the temperature of the mixture did not rise above
5.degree. C., After stirring for 2 h, the resultant solid was
filtered, dried, and suspended in EtOH. To this were added
3-cyclopentyl-3-oxopropanenitrile (0.68 g, 4.9 mmol) and a few
drops of HCl and the mixture was heated at 80.degree. C. for 16 h.
The solution was concentrated, dissolved in satd. NaHCO.sub.3
solution and the product was extracted with EtOAc (2.times.30 mL).
The combined organic extracts were washed with brine, dried
(Na.sub.2SO.sub.4), concentrated and the resultant solid triturated
with toluene (10 mL) and filtered to yield
6-(5-amino-3-cyclopentyl-1H-pyrazol-1-yl)quinolin-2(1H)-one (0.75
g, 57% yield) as a solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 7.95 (d, J=10.0 Hz, 1H), 7.81 (d, J=2.4 Hz, 1H), 7.68 (dd,
J=8.8 Hz, 2.0 Hz, 1H), 7.35 (d, J=8.8 Hz, 1H), 6.54 (d, J=8.8 Hz,
1H), 5.32 (s, 1H), 5.24 (brs, 2H), 2.92-2.84 (m, 1H), 1.94-1.86 (m,
2H), 1.73-1.57 (m, 6H); MS (ESI) m/z: 295.2 (M+H.sup.+).
##STR577##
[0777] Using general method D, Example A45 (0.075 g, 0.16 mmol))
and Example A11 (0.04 g, 0.16 mmol) were combined to yield
1-(3-cyclopentyl-1-(2-oxo-1,2-<dihydroquinolin-6-yl)-1H-pyrazol-5-yl)--
3-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(0.075 g, 47% yield, 2 steps) as a solid HCl salt. .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 9.71 (brs, 1H), 9.17 (s, 1H), 9.12 (s,
1H), 8.56 (brs, 1H), 8.15 (s, 1H), 8.11 (d, J=9.6 Hz, 1H), 7.90 (d,
J=2.4 Hz, 1H), 7.79 (brs, 1H), 7.67 (dd, J=8.8 Hz, 2.0 Hz, 1H),
7.46-7.41 (m, 2H), 7.35 (t, J=8.0 Hz, 1H), 7.28-7.26 (m, 1H), 6.57
(d, J=9.6 Hz, 1H), 6.33 (s, 1H), 3.70 (s, 3H), 3.06-2.98 (m, 1H),
1.99-1.94 (m, 2H), 1.72-1.59 (m, 6H); MS (ESI) m/z: 573.3
(M+H.sup.+). ##STR578##
[0778] Using general method D, Example A45 (0.075 g, 0.16 mmol) and
Example A12 (0.04 g, 0.16 mmol) were combined to yield
1-(3-cyclopentyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea (0.038 g, 31%
yield, 2 steps) as a solid HCl salt. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.59 (brs, 1H), 8.88 (brs, 1H), 8.81 (s,
1H), 8.51 (d, J=6.0 Hz, 1H), 8.01 (d, J=9.6 Hz, 1H), 7.89 (d, J=2.4
Hz, 1H), 7.67 (dd, J=8.8 Hz, 2.0 Hz, 1H), 7.54-7.42 (m, 4H),
7.17-7.13 (m, 3H), 7.58 (d, J=9.6 Hz, 1H), 6.33 (s, 1H), 3.06-2.98
(m, 1H), 2.78 (d, J=6.0 Hz, 3H), 1.99-1.94 (m, 2H), 1.72-1.59 (m,
6H); MS (ESI) m/z: 564.3 (M+H.sup.+). ##STR579##
[0779] Using general method D, Example A45 (0.075 g, 0.16 mmol) and
Example A9 (0.03 g, 0.16 mmol) were combined to yield
1-(3-cyclopentyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-
-(pyridin-3-yloxy)phenyl)urea (0.07 g, 52%, 2 steps) as a solid.
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.63-9.61 (m, 1H),
8.80-8.79 (m, 1H), 8.65-8.64 (m, 1H), 8.57-8.56 (m, 1H), 7.98 (d,
J=10.0 Hz, 1H), 7.93-7.90 (m, 1H), 7.86 (d, J=4.4 Hz, 1H),
7.83-7.79 (m, 1H), 7.64 (dd, J=8.8 Hz, 2.0 Hz, 1H), 7.42-7.38 (m,
2H), 7.34 (t, J=8.0 Hz, 1H), 7.15-7.13 (m, 1H), 6.76 (dd, J=8.0 Hz,
2.0 Hz, 1H), 6.57 (d, J=10.0 Hz, 1H), 6.29 (s, 1H), 3.04-2.97 (m,
1H), 1.98-1.93 (m, 2H), 1.72-1.60 (m, 6H); MS (ESI) m/z: 507.2
(M+H.sup.+). ##STR580##
[0780] To a solution of
8-amino-1,2,4,5-tetrahydrobenzo[c]azepin-3-one (0.5 g, 2.8 mmol) in
conc. HCl (3 mL) was added an aqueous solution (2 mL) of NaNO.sub.2
dropwise at 0.degree. C. The reaction mixture was stirred at
0.degree. C. for 1 h, and then treated dropwise with a solution of
SnCl.sub.2.2H.sub.2O in conc. HCl (2 mL) at 0.degree. C. The
reaction mixture was allowed to reach room temperature Example A46
over a period of 30 min and then stirred for an additional 2 h at
RT. This solution was concentrated and used directly for the next
step.
[0781] The material from the previous reaction (0.65 g, 2.8 mmol)
was dissolved in EtOH (10 mL) and some solid was filtered off.
Pivaloylacetonitrile (0.36 g, 2.8 mmol) was added to the solution.
The reaction mixture was heated at 80.degree. C. overnight, then
evaporated and the residue was suspended in EtOAc (30 mL) and
treated slowly with satd. Na.sub.2CO.sub.3 (30 mL). The solution
was extracted with EtOAc (3.times.), and the combined organics were
washed with H.sub.2O, dried (Na.sub.2SO.sub.4), filtered,
concentrated and dried under vacuum to provide crude product in 65%
yield. This was dissolved in toluene (10 mL) with molecular sieves
(4 .ANG.). The reaction mixture was refluxed overnight,
concentrated and the residue dried under vacuum. This was used for
the next reaction without further purification. MS (EI) m/z: 299.0
(M+H.sup.+). ##STR581##
[0782] Using general method A, Example A46 (23 mg, 0.077 mmol) and
2,3-dichlorophenylisocyanate (17 mg, 0.092 mmol) were combined to
yield
1-(3-t-butyl-1-(2-oxo-2,3,4,5-tetrahydro-1H-benzo[d]azepin-7-yl)-1H-pyraz-
ol-5-yl)-3-(2,3-dichlorophenyl)urea (23 mg, 61% yield) as a pale
yellow powder. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.20
(s, 0.84H), 9.04 (s, 0.26H), 8.76 (s, 0.84H), 8.75 (s, 0.26H), 8.06
(m, 1H), 7.66 (t, J=5.6 Hz, 0.84H), 7.51 (t, J=5.6 Hz, 0.26H), 7.31
(m, 4H), 6.38 (s, 0.26H), 6.37 (s, 0.84H), 3.88 (s, 0.48H), 3.82
(s, 1.72H), 3.48 (dd, J=5.6, and 11.6 Hz, 1.72H), 3.41 (m, 0.48H),
3.07 (t, J=6.0 Hz, 2H), 1.27 (s, 7.56H), 1.26 (s, 2.16H); MS (EI)
m/z: 487.0 (M+H.sup.+). ##STR582##
[0783] beta-Tetralone (34 mmol) was suspended in 300 mL of 85%
H.sub.3PO.sub.4 and treated portion wise with NaN.sub.3 (68 mmol)
with vigorous stirring over a period of 1 h. During this time the
reaction mixture was brought slowly to about 70.degree. C. After
stirring for a further 2 h at 70.degree. C., no more N.sub.2
evolution was observed. The reaction mixture was cooled to RT, then
poured into cold H.sub.2O (400 mL) and extracted with CHCl.sub.3
(3.times.). The organic layer was dried (MgSO.sub.4), concentrated
and the residue was dissolved in EtOAc and the solid was filtered
and washed with EtOAc to yield
4,5-dihydro-1H-benzo[d]azepin-2(3H)-one as a white solid (20%
yield) along with a varying amount of the other region isomer
1,2,4,5-tetrahydrobenzo[c]azepin-3-one.
[0784] To a solution of regioisomers from the previous reaction
(16.6 mmol) in CH.sub.2Cl.sub.2 were added Et.sub.3N (16.6 mmol),
di-t-butyl dicarbonate (33.1 mmol) and DMAP (16.6 mmol), and the
mixture stirred at RT for 24 h. The reaction mixture was purified
by column chromatography to yield Boc-protected
4,5-dihydro-1H-benzo[d]azepin-2(3H)-one as white solid in 20%
yield. A solution of this material (2.7 mmol) in 3N HCl/EtOAc (4
mL) was stirred at 0.degree. C. for 3 h. The solvent was
neutralized by 20% NaOH. The solution was extracted with CHCl.sub.3
(3.times.) and washed with H.sub.2O. The organic layer was dried
(MgSO.sub.4), and concentrated to afford
4,5-dihydro-1H-benzo[d]azepin-2(3H)-one (0.64 g, 91% yield) as a
white solid. LC-MS (EI) m/z: 162.2 (M+H.sup.+).
[0785] A solution of 4,5-dihydro-1H-benzo[d]azepin-2(3H)-one (3.5
mmol) was in THF (25 mL) was stirred at 0.degree. C. for 5 min. A
solution of 1M B.sub.3.THF (4 mL) was added dropwise to the
reaction mixture at 0.degree. C. over a period of 30 min. The ice
bath was removed and the reaction stirred at RT for 30 min. The
reaction mixture was heated at 60.degree. C. overnight, then cooled
to 0.degree. C. and additional 1M B.sub.3.THF (2.5 mL) was added
dropwise into the reaction mixture at 0.degree. C. over a period of
15 min. The ice bath was removed and it was stirred at RT for 30
min then heated at 60.degree. C. for 7 h. The reaction mixture was
cooled to RT, then further cooled with an ice-bath. The reaction
was quenched by the addition of 2M HCl (15 mL). The mixture was
heated for 30 min and then 20% NaOH (7.5 mL) was added with ice
cooling. The solution was extracted with chloroform (3.times.) and
the organic layer was washed with H.sub.2O. The organic layer was
dried (Na.sub.2SO.sub.4), concentrated and redissolved in 2 mL of
EtOAc and acidified with 3M HCl/EtOAc. The solid was filtered and
dried under vacuum to obtain 2,3,4,5-tetrahydro-1H-benzo[d]azepine
as a shiny powder (0.36 g, 69% yield). LC-MS (EI) m/z: 148.2
(M+H.sup.+).
[0786] A solution of 2,3,4,5-tetrahydro-1H-benzo[d]azepine
dissolved in conc. H.sub.2SO.sub.4 (1.5 mL) was cooled to 0.degree.
C. and a mixture of concentrated H.sub.2SO.sub.4 (0.12 mL) and
fuming HNO3 (0.06 mL) (also cooled to 0.degree. C.) was added
dropwise. After the addition was complete, the mixture was stirred
for 15-30 min. The reaction mixture was poured onto 10 g of crushed
ice, followed by the dropwise addition of 20% NaOH solution. The
mixture was extracted with EtOAc (3.times.). The organic layer was
washed with H.sub.2O, dried (Na.sub.2SO.sub.4), concentrated and
under vacuum to afford
7-nitro-2,3,4,5-tetrahydro-1H-benzo[d]azepine as a brown liquid
(0.12 g, 46% yield). LC-MS (EI) m/z: 193.0 (M+H.sup.+).
[0787] To a solution of
7-nitro-2,3,4,5-tetrahydro-1H-benzo[d]azepine (1.1 mmol) in
CH.sub.2Cl.sub.2 (5 mL) was added TFAA (1.7 mmol) and the resulting
solution was stirred at RT for 30 min. Water (10 mL) was added and
the mixture was extracted with CH.sub.2Cl.sub.2 (3.times.10 mL),
dried (MgSO.sub.4), and concentrated under vacuum to yield
2,2,2-trifluoro-1-(7-nitro-1,2,4,5-tetrahydrobenzo[d]azepin-3-yl)ethanone
as a yellow syrup (0.32 g, 96% yield). LC-MS (EI) m/z: 299.3
(M+H.sup.+).
[0788] To a suspension of
2,2,2-trifluoro-1-(7-nitro-1,2,4,5-tetrahydrobenzo[d]azepin-3-yl)ethanone
(1.1 mmol) in MeOH (5 mL) was added 10% Pd/C and the mixture was
stirred at RT under H.sub.2 (1 atm) for 24 h. After filtration, the
filtrate was concentrated to afford
1-(7-amino-1,2,4,5-tetrahydrobenzo[d]azepin-3-yl)-2,2,2-trifluoroethanone
(0.27 g, 95% yield). LC-MS (EI) m/z: 259.0 (M+H.sup.+).
[0789] To a solution of
1-(7-amino-1,2,4,5-tetrahydrobenzo[d]azepin-3-yl)-2,2,2-trifluoroethanone
(1.6 mmol) in conc. HCl (2 mL) was added an aqueous solution (1 mL)
of NaNO.sub.2 (2.4 mmol) dropwise at 0.degree. C. The reaction
mixture was stirred at 0.degree. C. for 1 h, and was followed by
the addition of a solution of SnCl.sub.2.2H.sub.2O (5.0 mmol) in
conc. HCl (1 mL) dropwise at 0.degree. C. The reaction mixture was
allowed to reach RT over a period of 30 min and then stirred for
additional 2 h. The solution was concentrated and redissolved in
EtOH, and pivaloylacetonitrile (3.7 mmol) was added. The reaction
mixture was heated at reflux for 16 h. The reaction mixture was
evaporated and the residue suspended in EtOAc (30 mL) and treated
slowly with satd. NaHCO.sub.3 (30 mL). The biphasic mixture was
stirred at RT for 2 h. The aqueous layer was treated with 6M NaOH
to pH 8 and filtered to remove the tin salts. The filtrate was
extracted with EtOAc (3.times.). The combined organics were washed
with satd. NaHCO.sub.3 (1.times.), brine (1.times.) and dried
(Na.sub.2SO.sub.4). Filtration, evaporation and drying under vacuum
provided crude product (0.21 g, 71% yield). LC-MS (EI) m/z: 285.2
(M+H.sup.+).
[0790] This material (0.74 mmol) was dissolved in CH.sub.2Cl.sub.2
and Boc anhydride (0.74 mmol) was added. The resultant solution was
stirred at RT for 30 min and evaporated to yield t-butyl
7-(5-amino-3-t-butyl-1H-pyrazol-1-yl)-1,2,4,5-tetrahydrobenzo[d]azepine-3-
-carboxylate (0.26 g, 98% yield). LC-MS (EI) m/z: 385.2
(M+H.sup.+). ##STR583##
[0791] Using general method A, Example A47 (65 mg, 0.17 mmol) and
2,3-dichlorophenyl isocyanate (32 mg, 0.17 mmol) were combined and
the product deprotected using general method F to yield
1-(3-t-butyl-1-(2,3,4,5-tetrahydro-1H-benzo[d]azepin-7-yl)-1H-pyrazol-5-y-
l)-3-(2,3-dichlorophenyl)urea (50 mg, 58% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 9.28 (s, 1H), 8.89 (m, 1H), 8.81 (s,
1H), 8.03 (dd, J=4.0, and 5.6 Hz, 1H), 7.42 (brs, 1H), 7.31 (m,4H),
6.37 (s, 1H), 3.20 (m, 4H), 3.14 (m, 4H), 1.26 (s, 9H); LC-MS (EI)
m/z: 472.0 (M+H.sup.+). ##STR584##
[0792] Using general method A, Example A47 (70 mg, 0.18 mmole) and
3-cyanophenylisocynate (26 mg, 0.18 mmol) were combined and the
product deprotected using general method F to yield
1-(3-t-butyl-1-(2,3,4,5-tetrahydro-1H-benzo[d]azepin-7-yl)-1H-pyrazol-5-y-
l)-3-(3-cyanophenyl)urea HCl salt (24 mg, 29% yield). .sup.1H NMR
(DMSO-d.sub.6): .delta. 9.78 (s, 1H), 9.04 (m, 1H), 8.73 (s, 1H),
7.93 (t, J=1.6 Hz, 1H), 7.61 (dt, J=1.2, and 9.2 Hz, 1H), 7.48 (t,
J=7.6 Hz, 1H), 7.42 (m, 2H), 7.34 (s, 1H), 6.37 (s, 1H), 3.19 (m,
4H), 3.14 (m, 4H), 1.27 (s, 9H); LC-MS (EI) m/z: 429.2 (M+H.sup.+).
##STR585##
[0793] To a solution of commercially available
6-bromo-1,2,3,4-tetrahydro-2-quinolinone (5.0 g, 22 mmol) and NBS
(4.9 g, 27 mmol) in CHCl.sub.3 (80 mL) was added a catalytic
portion of benzoyl peroxide at RT. The mixture was refluxed at
80.degree. C. for 3 h, after which additional NBS (2.0 g) was added
and the reaction refluxed overnight at 80.degree. C. Additional NBS
(0.9 g) was added into the reaction mixture which was refluxed at
80.degree. C. for 5 h. The solid was filtered, washed with EtOH and
dried to yield 6-bromoquinolin-2(1H)-one (4.35 g, 88% yield) as a
pale yellow solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
7.93 (d, J=2.8 Hz, 1H), 7.88 (d, J=9.6 Hz, 1H), 7.64 (dd, J=2.0,
and 8.8 Hz, 1H), 7.25 (d, J=8.8 Hz, 1H), 6.55 (dd, J=2.0, and 9.6
Hz, 1H); LC-MS (EI) m/z: 224.0 (M+H.sup.+).
[0794] 6-Bromoquinolin-2(1H)-one (4.0 g, 18 mmol), 4-methoxybenzyl
chloride (3.6 g, 23 mmol), and tetrabutylammonium bromide (1.2 g,
3.6 mmol) were dissolved in PhMe (200 mL) and then KOH (powder, 1.8
g, 32 mmol) was added into the reaction mixture. The reaction
mixture was stirred at RT for 4 h, then poured into H.sub.2O and
extracted with EtOAc (3.times.50 mL). The organic layer was washed
with H.sub.2O, dried (Na.sub.2SO.sub.4), and concentrated.
Trituration with hexane, followed by collection of the solids
yielded 1-(4-methoxybenzyl)-6-bromoquinolin-2(1H)-one (5.4 g, 87%
yield) as a yellow solid. .sup.1H NMR (400 MHz, CDCl.sub.3):
.delta. 7.70 (d, J=2.4 Hz, 1H), 7.66 (d, J=9.6 Hz, 1H), 7.52 (dd,
J=2.0, and 8.8 Hz, 1H), 7.19 (d, J=9.2 Hz, 1H), 7.16 (d, J=8.8 Hz,
2H), 6.85(d, J=8.8 Hz, 2H), 6.83 (d, J=9.4 Hz, 1H), 5.48 (brs, 2H),
3.78 (s, 3H), 1.36 (s, 12H); LC-MS (EI) m/z: 344.0 (M+H.sup.+).
[0795] Potassium acetate (54.3 g, 44 mmol), pinacol diboron (5.5 g,
22 mmol) and PdCl.sub.2(dppf) (0.60 mg, 0.73 mmol) were added
sequentially to a solution
1-(4-methoxybenzyl)-6-bromoquinolin-2(1H)-one (5.0 g, 15 mmol) in
DMF (70 mL). After flushing with N.sub.2, the reaction vessel was
sealed and heated at 80.degree. C. for 14 h and then partitioned
between H.sub.2O and EtOAc. The combined organic extracts were
washed with brine, dried (MgSO.sub.4) concentrated and purified via
column chromatography to yield
1-(4-methoxybenzyl)-6-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)quinol-
in-2(1H)-one (38 g, 67% yield) as a yellow solid. .sup.1H NMR (400
MHz, CDCl.sub.3): .delta. 8.04 (brs, 1H), 7.86 (dd, J=1.2, and 8.4
Hz, 1H), 7.76 (d, J=9.6 Hz, 1H), 7.32 (d, J=9.2 Hz, 1H), 7.17 (d,
J=8.4 Hz, 2H), 6.83 (d, J=8.8 Hz, 2H), 6.80 (d, J=9.6 Hz, 1H), 5.52
(brs, 2H), 3.77 (s, 3H), 1.36 (s, 12H); LC-MS (EI) m/z: 392.3
(M+H.sup.+).
[0796] Sodium periodate (5.9 g, 28 mmol) was added to a solution of
1-(4-methoxybenzyl)-6-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)quinol-
in-2(1H)-one (3.6 g, 9.2 mmol) in THF/H.sub.2O (4/1, 40 mL). The
reaction mixture was stirred at RT for 30 min, after which 2N HCl
(9.2 mL) was added and the solution was then stirred at RT for 3 h.
The solution was extracted with EtOAc (3.times.50 mL) and the
organic layer was dried (MgSO.sub.4), and concentrated to yield
crude 1-(4-methoxybenzyl)-2-oxo-1,2-dihydroquinolin-6-ylboronic
acid (2.6 g, 90% yield) which was used without further
purification. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.10
(brs, 1H), 7.96 (d, J=9.2 Hz, 1H), 7.88 (dd, J=1.6, and 8.8 Hz,
1H), 7.39 (d, J=9.2 Hz, 1H), 7.16 (d, J=8.4 Hz, 2H), 6.86 (d, J=8.4
Hz, 2H), 6.69 (d, J=9.6 Hz, 1H), 5.45 (brs, 2H), 3.69 (s, 3H);
LC-MS (EI) m/z: 310.0 (M+H.sup.+).
[0797] 1-(4-Methoxybenzyl)-2-oxo-1,2-dihydroquinolin-6-ylboronic
acid (1.8 g, 5.8 mmol) was dissolved in CH.sub.2Cl.sub.2 (120 mL)
and pyridine (10 mL) with molecular sieves (activated, 4A) and the
solution was kept overnight at RT. Commercially available ethyl
3-t-butyl-1H-pyrazole-5-carboxylate (1.2 g, 5.8 mmol),
Cu(OAc).sub.2 (1.1 g, 5.8 mmol) and molecular sieves (4A activated,
powder) were added to the boronic acid solution and the reaction
mixture was stirred open to the air at RT for 3 days. The reaction
mixture was filtered through a pad of Celite.RTM., and the filtrate
was evaporated under reduced pressure and purified by silica gel
column chromatography to yield ethyl
1-(1-(4-methoxybenzyl)-2-oxo-1,2-dihydroquinolin-6-yl)-3-t-butyl-1H-pyraz-
ole-5-carboxylate (2.5 g, 94% yield). LC-MS (EI) m/z: 460.3
(M+H.sup.+).
[0798] A solution of ethyl
1-(1-(4-methoxybenzyl)-2-oxo-1,2-dihydroquinolin-6-yl)-3-t-butyl-1H-pyraz-
ole-5-carboxylate (1.5 g, 3.3 mmol) in TFA (25 mL) was heated in a
sealed tube at 100.degree. C. for 7 h. The mixture was cooled,
concentrated and purified by silica gel column chromatography to
yield ethyl
3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazole-5-carboxylate
(1.0 g, 90% yield). .sup.1H NMR (400 MHz, CDCl.sub.3): .delta. 7.95
(d, J=9.6 Hz, 1H), 7.77 (d, J=2.0 Hz, 1H), 7.66 (dd, J=2.4, and 8.4
Hz, 1H), 7.46 (d, J=8.8 Hz, 1H), 6.94 (s, 1H), 6.82 (d, J=9.2 Hz,
1H). LC-MS (EI) m/z: 340.3 (M+H.sup.+).
[0799] To a stirred suspension of ethyl
3-t-butyl-1-(2-oxo-1,2-dihydroquinolin-6-yl)-1H-pyrazole-5-carboxylate
(1.0 g, 2.95 mmol) and Et.sub.3N (0.45 g, 4.45 mmol) in
CH.sub.2Cl.sub.2 (30 ml) was added triflic anhydride (1.66 g, 5.9
mmol) at -78.degree. C. and then maintained at this temperature for
30 min. The reaction was allowed to warm to RT over a period 1.5 h,
then quenched by pouring onto ice. The organic layer was washed
with 10% NaOH, extracted with CH.sub.2Cl.sub.2 (3.times.50 mL).
washed with brine, dried (Na.sub.2SO.sub.4), concentrated and
purified by column chromatography to yield ethyl
3-t-butyl-1-(2-(trifluoromethylsulfonyloxy)quinolin-6-yl)-1H-pyrazole-5-c-
arboxylate (1.3 g, 94% yield). .sup.1H NMR (400 MHz, CDCl.sub.3):
.delta. 8.40 (d, J=8.8 Hz, 1H), 8.12 (d, J=9.2 Hz, 1H), 8.04 (d,
J=2.0 Hz, 1H), 7.90 (dd, J=2.4 and, 9.2 Hz, 1H), 7.31 (d, J=8.8 Hz,
1H), 6.99 (s, 1H), 4.28 (q, J=7.2 Hz, 2H), 1.41 (s, 9H), 1.30 (t,
J=7.2 Hz, 3H); LC-MS (EI) m/z: 472.0 (M+H.sup.+). ##STR586##
[0800] To a solution of Example A48 (0.10 g, 0.21 mmol) in DMSO (1
mL) was added (R)--N,N-dimethylpyrrolidin-3-amine (0.055 g, 0.47
mmol). The reaction mixture was heated at 40.degree. C. for 1 h.
Ethyl acetate was added and the resulting solution was washed with
brine, dried (Na.sub.2SO.sub.4) and concentrated under reduced
pressure to yield ethyl
3-t-butyl-1-(2-((R)-3-(dimethylamino)pyrrolidin-1-yl)quinolin-6-yl)-1H-py-
razole-5-carboxylate (88 mg, 95% yield). .sup.1H NMR (400 MHz,
CDCl.sub.3): .delta. 7.89 (d, J=8.8 Hz, 1H), 7.75 (d, J=8.8 Hz,
1H), 7.69 (d, J=2.0 Hz, 1H), 7.56 (dd, J=2.0 and, 8.4 Hz, 1H), 6.92
(s, 1H), 6.76 (d, J=9.2 Hz, 1H), 4.21 (q, J=7.6 Hz, 2H), 4.03 (m,
1H), 3.88 (m. 1H), 3.60 (m, 1H), 3.49 (m, 1H), 2.98 (m, 1H), 2.63
(s, 6H), 2.33 (m, 1H), 2.04 (m, 1H), 1.40 (s, 9H), 1.21 (t, J=7.6
Hz, 3H); LC-MS (EI) m/z: 436.2 (M+H.sup.+). ##STR587##
[0801] Using the same procedure as for Example A49, Example A48
(0.2 g, 0.42 mmol) and t-butyl piperazine-1-carboxylate (0.17 g,
0.93 mmol) were combined to yield t-butyl
4-(6-(5-amino-3-t-butyl-1H-pyrazol-1-yl)quinolin-2-yl)piperazine-1-carbox-
ylate (210 mg, 98% yield). .sup.1H NMR (400 MHz, CDCl.sub.3):
.delta. 7.94 (d, J=8.8 Hz, 1H), 7.74 (d, J=8.8 Hz, 1H), 7.71 (d,
J=2.4 Hz, 1H), 7.58 (dd, J=2.4 and, 8.8 Hz, 1H), 7.01 (d, J=9.2 Hz,
1H), 6.92 (s, 1H), 4.22 (q, J=7.2 Hz, 2H), 3.77 (m, 4H), 3.61 (m.
4H), 2.64 (s, 6H), 1.52 (s, 9H), 2.33 (m, 1H), 1.40 (s, 9H), 1.22
(t, J=7.6 Hz, 3H); LC-MS (EI) m/z: 508.3 (M+H.sup.+).
##STR588##
[0802] Using the same procedure as for Example A49, Example A48
(0.20 g, 0.42 mmol) and t-butyl 2-aminoethylcarbamate (0.15 g, 0.93
mmol) were combined to yield ethyl
1-(2-(2-(t-butoxycarbonyl)ethylamino)quinolin-6-yl)-3-t-butyl-1H-pyrazole-
-5-carboxylate (0.20 mg, 98% yield). .sup.1H NMR (400 MHz,
CDCl.sub.3): .delta. 7.85 (d, J=9.2 Hz, 1H), 7.75 (d, J=8.8 Hz,
1H), 7.70 (d, J=2.4 Hz, 1H), 7.59 (dd, J=2.4 and, 8.8 Hz, 1H), 6.93
(s, 1H), 6.73 (m, 1H), 5.57 (brs, 1H), 4.23 (q, J=7.2 Hz, 2H), 3.70
(brq, J=5.2 Hz, 2H), 3.45 (brq, J=5.2 Hz, 2H), 1.45 (s, 9H), 1.40
(s, 9H), 1.24 (t, J=7.2 Hz, 3H); LC-MS (EI) m/z: 482.2 (M+H.sup.+).
##STR589##
[0803] Using the same procedure as for Example A49, Example A48
(0.20 g, 0.42 mmol) and MeNH.sub.2.HCl (0.043 g, 0.64 mmol) were
combined to yield ethyl
3-t-butyl-1-(2-(dimethylamino)quinolin-6-yl)-1H-pyrazole-5-carboxyl-
ate (82 mg, 55% yield). .sup.1H NMR (400 MHz, CDCl.sub.3): .delta.
7.90 (d, J=9.2 Hz, 1H), 7.68 (d, J=2.8 Hz, 1H), 7.53 (d, J=9.2 Hz,
1H), 7.46 (dd, J=2.0, and 8.8 Hz, 1H), 7.17 (q, J=4.8 Hz, 1H), 6.98
(s, 1H), 6.80 (d, J=8.8 Hz, 1H), 2.92 (d, J=4.8 Hz, 1H), 1.32 (s,
9H); LC-MS (EI) m/z: 353.2 (M+H.sup.+). ##STR590##
[0804] Using the same procedure as for Example A49, Example A48
(0.20 g, 0.42 mmol) and Me.sub.2NH.HCl (0.026 g, 0.32 mmol) were
combined to yield ethyl
3-t-butyl-1-(2-(dimethylamino)quinolin-6-yl)-1H-pyrazole-5-carboxyl-
ate (82 mg, 55% yield). .sup.1H NMR (400 MHz, CDCl.sub.3): .delta.
8.04 (s, 1H), 7.88 (m, 1H), 7.73 (m, 1H), 7.68 (brs, 1H), 7.57 (m,
1H), 6.94 (d, J=8.8 Hz, 1H), 6.92 (s, 1H), 4.21 (q, J=7.2 Hz, 2H),
2.98 (s, 3H), 2.90 (s, 3H), 1.40 (s, 9H), 1.21 (t, J=7.2 Hz, 3H);
LC-MS (EI) m/z: 367.3 (M+H.sup.+). ##STR591##
[0805] Using the same procedure as for Example A49, Example A48
(0.15 g, 0.42 mmol) and 4-methoxybenzylamine (0.13 g, 0.93 mmol)
were combined to yield ethyl
1-(2-(4-methoxybenzylamino)quinolin-6-yl)-3-t-butyl-1H-pyrazole-5-carboxy-
late (150 mg, 77%). LC-MS (EI) m/z: 459.2 (M+H.sup.+). Using
general method E, this material was saponified to yield
1-(2-(4-methoxybenzylamino)quinolin-6-yl)-3-t-butyl-1H-pyrazole-5-carboxy-
lic acid in quantitative yield. A solution of this material in TFA
(25 mL) was heated in sealed tube at 100.degree. C. for 7 h. The
mixture was cooled, concentrated and purified by silica gel column
chromatography to yield
1-(2-aminoquinolin-6-yl)-3-t-butyl-1H-pyrazole-5-carboxylic acid
(0.1 g, 99% yield). LC-MS (EI) m/z: 311.2 (M+H.sup.+).
##STR592##
[0806] To a solution of Example A50 (0.21 g, 0.41 mmol) in a mix of
EtOH:dioxane:H.sub.2O (1:1:1) (1 mL) was added LiOH (40 mg, 1.7
mmol). The mixture was stirred overnight at RT then diluted with
EtOAc (50 mL) and 5% citric acid (50 mL). The organic phase was
separated, washed with brine (20 mL), dried (Na.sub.2SO.sub.4),
concentrated and dried to yield
1-(2-(4-(t-butoxycarbonyl)piperazin-1-yl)quinolin-6-yl)-3-t-butyl-1H-pyra-
zole-5-carboxylic acid as a yellow solid in quantitative yield.
LC-MS (EI) m/z: 480.2 (M+H.sup.+).
[0807] To a solution of
1-(2-(4-(t-butoxycarbonyl)piperazin-1-yl)quinolin-6-yl)-3-t-butyl-1H-pyra-
zole-5-carboxylic acid (0.1 g, 0.21 mmol) in toluene (2 mL) was
added Et.sub.3N (0.032 mL, 0.23 mmol) and 2,3-dichloroaniline (84
mg, 0.52 mmol). The reaction mixture was stirred at RT and DPPA (63
mg, 0.23 mmol) was added. The reaction mixture was heated at
100.degree. C. for 2 h, cooled, quenched with H.sub.2O, and
extracted with EtOAc (3.times.50 mL). The organic extracts were
washed with brine, dried (Na.sub.2SO.sub.4), concentrated and
purified by column chromatography to yield t-butyl
4-(6-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)quinolin-
-2-yl)piperazine-1-carboxylate (0.11 g, 83% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 9.26 (s, 1H), 8.77 (s, 1H), 8.17
(d, J=9.6 Hz, 1H), 8.07 (dd, J=3.2, and 6.8 Hz, 1H), 7.87 (d, J=2.0
Hz, 1H), 7.68 (m, 2H), 7.31 (m, 3H), 6.42 (s, 1H), 3.74 (m, 4H),
3.47 (m, 4H), 1.44 (s, 9H), 1.30 (s, 9H); LC-MS (EI) m/z: 638.3
(M+H.sup.+).
[0808] The material from the previous reaction (0.11 g, 0.17 mmol)
was dissolved in EtOAc, 3M HCl/EtOAc (2 mL) was added and the
solution was stirred at RT for 5 h. The solution was concentrated
and the residue was dissolved in H.sub.2O/CH.sub.3CN (1:1, 4 mL)
and lyopholized to obtain
1-(3-t-butyl-1-(2-(piperazin-1-yl)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3--
dichlorophenyl)urea (65 mg, 66% yield) as a white solid HCl salt.
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.55 (brs, 1H), 9.37
(brs, 2H), 8.89 (s, 1H), 8.40 (brd, J=7.6 Hz, 1H), 8.07 (brs, 1H),
8.00 (m, 2H), 7.87 (m, 1H), 7.53 (brd, J=8.4 Hz, 1H), 7.29 (d,
J=4.8 Hz, 2H), 6.42 (s, 1H), 4.10 (m, 4H), 3.29 (m, 4H), 1.30 (s,
9H); LC-MS (EI) m/z: 538.3 (M+H.sup.+). ##STR593##
[0809] Using the same procedure as for Example 168 Example A50 (100
mg, 0.21 mmol), and Example A11 (58 mg, 0.23 mmol) were combined to
yield
1-(3-t-butyl-1-(2-(piperazin-1-yl)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(3-(8-
-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(69 mg, 42% yield, 3 steps) as the HCl salt. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.30 (brm, 1H), 9.15 (s, 1H), 9.11 (s, 1H),
8.96 (brm, 2H), 8.60 (brm, 2H), 8.27 (brm, 1H), 8.15 (s, 1H), 7.97
(brm, 1H), 7.81 (brs, 1H), 7.78 (brm, 1H), 7.43 (m, 1H), 7.35 (brt,
J=7.6 Hz, 1H), 7.28 (m, 1H), 6.41 (s, 1H), 4.01 (m, 4H), 3.97 (m,
4H), 3.71 (s, 3H), 3.26 (m, 4H), 1.30 (s, 9H); LC-MS (EI) m/z:
629.2 (M+H.sup.+). ##STR594##
[0810] Using the same procedure as for Example 168, Example A50
(0.10 g, 0.21 mmol) and Example A12 (0.13 g, 0.52 mmol) were
combined to yield
1-(3-t-butyl-1-(2-(piperazin-1-yl)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2-
-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea (90 mg, 59% yield, 3
steps) as an off-white solid HCl salt. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.33 (brs, 1H), 9.02 (brs, 2H), 8.78 (m,
2H), 8.63 (brs, 1H), 8.50 (d, J=5.6 Hz, 1H), 8.30 (m, 1H), 7.94 (m,
1H), 7.80 (m, 1H), 7.52 (m, 2H), 7.45 (m, 1H), 7.36 (d, J=2.4 Hz,
1H), 7.13 (m, 2H), 6.41 (s, 1H), 4.01 (m, 4H), 3.27 (m, 4H), 2.78
(d, J=4.8 Hz, 3H), 1.31 (s, 9H); LC-MS (EI) m/z: 620.2 (M+H.sup.+).
##STR595##
[0811] Using the same procedure as for Example 168, Example A50
(0.10 g, 0.21 mmol), and Example A7 (0.14 g, 0.52 mmol) were
combined to yield
1-(3-t-butyl-1-(2-(piperazin-1-yl)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-me-
thyl-3-(4-(pyridin-3-yl)pyrimidin-2-ylamino)phenyl)urea (94 mg, 57%
yield, 3 steps) as the HCl salt. .sup.1H NMR (400 MHz, 400 MHz,
DMSO-d.sub.6): .delta. 9.36 (brm, 1H), 9.27 (brm, 1H), 8.99 (brs,
1H), 8.82 (brd, J=4.8 Hz, 1H), 8.78 (brm, 1H), 8.56 (d, J=5.2 Hz,
1H), 8.37 (brd, J=9.2 Hz, 1H), 8.04 (brs, 1H), 7.95 (brm, 1H), 7.83
(m, 1H), 7.76 (brm, 1H), 7.49 (m, 2H), 7.11 (d, J=8.8 Hz, 1H), 7.06
(dd, J=2.0, and 8.4 Hz, 2H), 6.41 (s, 1H), 4.14 (brm, 4H), 3.28
(brm, 4H), 3.15 (brd, J=4.8 Hz, 3H), 2.18 (s, 3H), 1.32 (s, 9H);
LC-MS (EI) m/z: 654.3 (M+H.sup.+). ##STR596##
[0812] Using the same procedure as for Example 168, Example A51
(0.10 g, 0.21 mmol) and Example A12 (0.11 g, 0.44 mmol) were
combined to yield
1-(1-(2-(2-aminoethylamino)quinolin-6-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-
-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea ((100 mg, 75%
yield, 3 steps) as a pale yellow solid HCl salt. .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 9.51 (brs, 1H), 8.80 (brs, 1H), 8.78
(m, 1H), 8.50 (d, J=6.0 Hz, 1H), 8.39 (m, 1H), 8.15 (m, 3H), 7.98
(m, 1H), 7.52 (m, 2H), 7.36 (d, J=2.8 Hz, 1H), 7.21 (m, 1H), 7.14
(m, 3H), 6.42 (s, 1H), 3.92 (m, 2H), 3.18 (m, 2H), 2.78 (d, J=4.8
Hz, 3H), 1.31 (s, 9H); LC-MS (EI) m/z: 594.2 (M+H.sup.+).
##STR597##
[0813] Using the same procedure as for Example 168, Example A49
(0.08 g, 0.21 mmol) and Example A12 (0.13 g, 0.52 mmol) were
combined to yield
1-(3-t-butyl-1-(2-((R)-3-(dimethylamino)pyrrolidin-1-yl)quinolin-6-yl)-1H-
-pyrazol-5-yl)-3-(4-(2-(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea
(30 mg, 20% yield) as a yellow solid HCl salt. .sup.1H NMR (400
MHz, CDCl.sub.3): .delta. 9.38 (s, 1H), 8.77 (m, 2H), 7.35 (d,
J=2.8 Hz, 1H), 7.14 (m, 3H), 6.41 (s, 1H), 4.15 (brs, 1H), 4.06
(brs, 1H), 3.95 (brs, 1H), 3.64 (brs, 1H), 2.87 (brt, J=5.6 Hz,
6H), 2.78 (d, J=4.8 Hz, 3H), 1.31 (s, 9H); LC-MS (EI) m/z: 648.2
(M+H.sup.+). ##STR598##
[0814] Using the same procedure as for Example 168, Example A52
(0.04 g, 0.11 mmol) and Example A12 (0.07 g, 0.27 mmol) were
combined to yield
1-(3-t-butyl-1-(2-(methylamino)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2-(m-
ethylcarbamoyl)pyridin-4-yloxy)phenyl)urea (53 mg, 74% yield) as
the HCl salt. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.87
(brm, 1H), 9.38 (brs, 1H), 8.78 (brm, 1H), 8.74 (s, 1H), 8.50 (d,
J=5.6 Hz, 1H), 8.35 (brd, J=9.2 Hz, 1H), 8.13 (brs, 1H), 8.11 (brm,
1H), 7.97 (dd, J=2.0, and 9.2 Hz, 1H), 7.52 (d, J=8.8 Hz, 2H), 7.34
(d, J=2.8 Hz, 1H), 7.14 (m, 3H), 6.42 (s, 1H), 3.15 (brd, J=4.8 Hz,
3H), 2.78 (d, J=5.2 Hz, 3H), 1.31 (s, 9H); LC-MS (EI) m/z: 565.3
(M+H.sup.+). ##STR599##
[0815] Using the same procedure as for Example 168, Example A53
(0.08, 0.21 mmol) and Example A12 (0.13 g, 0.52 mmol) were combined
to yield
1-(3-t-butyl-1-(2-(dimethylamino)quinolin-6-yl)-1H-pyrazol-5-yl)-3-(4-(2--
(methylcarbamoyl)pyridin-4-yloxy)phenyl)urea (61 mg, 51% yield) as
a pale yellow solid HCl salt. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.30 (brs, 1H), 8.78 (q, J=4.4 Hz, 1H), 8.69 (brs, 1H),
8.50 (d, J=5.6 Hz, 1H), 8.15 (m, 2H), 7.98 (m, 1H), 7.52 (m, 2H),
7.34 (d, J=2.4 Hz, 1H), 7.14 (m, 3H), 6.42 (s, 1H), 3.38 (brs, 6H),
2.78 (d, J=4.8 Hz, 3H), 1.31 (s, 9H); LC-MS (EI) m/z: 579.2
(M+H.sup.+). ##STR600##
[0816] Using the same procedure as for Example 168, Example A54
(0.085 g, 0.27 mmol) and Example A12 (0.10 g, 0.41 mmol) were
combined to yield
1-(1-(2-aminoquinolin-6-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(4-(2-(methylcar-
bamoyl)pyridin-4-yloxy)phenyl)urea (48 mg, 33% yield) as the HCl
salt. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.59 (brs, 1H),
9.20 (brs, 1H), 8.90 (brs, 1H), 8.79 (q, J=4.4 Hz, 1H), 8.50 (d,
J=5.6 Hz, 1H), 8.48 (d, J=9.2 Hz, 1H), 8.17 (d, J=2.4 Hz, 1H), 7.97
(dd, J=2.0, and 8.8 Hz, 1H), 7.84 (d, J=8.8 Hz, 1H), 7.52 (m, 2H),
7.37 (m, 3H), 7.17 (m, 4H), 6.41 (s, 1H), 2.78 (d, J=4.4 Hz, 3H),
1.31 (s, 9H); LC-MS (EI) m/z: 551.2 (M+H.sup.+). ##STR601##
[0817] To a solution of
(S)-1,2,3,4-tetrahydroisoquinolone-3-carboxylic acid (5.00 g, 28.2
mmol) in conc. H.sub.2SO4 (20 mL) at RT was added dropwise a
solution of KNO.sub.3 (2.95 g, 29.2 mmol) in conc. H.sub.2SO.sub.4
(10 mL). The mixture was stirred for 5 min, then carefully diluted
with H.sub.2O and neutralized with conc. NH.sub.4OH (100 mL). The
precipitate was filtered, washed with HO and acetone and dried in
vacuo to yield 6.60 g (crude yield>100%) of nitrated compounds.
The crude mixture was used directly without further purification.
MS (ESI) m/z: 223.0 (M+H.sup.+).
[0818] To a suspension of the mixture from the previous reaction
(6.60 g, 29.7 mmol) in MeOH (50 mL) was added dropwise conc.
H.sub.2SO.sub.4 (5.0 mL, 9.2 g, 3.16 mmol). The mixture was heated
at 60.degree. C. for 5 h, neutralized and basified with 2N NaOH and
extracted with EtOAc (3.times.100 mL). The combined organic layers
were dried (MgSO.sub.4), filtered and evaporated to yield 2.85 g
(43%, 2 steps) of a mixture as a yellow solid. MS (ESI) m/z: 237.0
(M+H.sup.+).
[0819] To a stirring solution of the mixture from the previous
reaction (2.80 g, 1.9 mmol) in CH.sub.2Cl.sub.2 was added Boc
anhydride (3.10 g, 14.2 mmol) and the resulting mixture was stirred
for 3 h. The mixture was concentrated and the residue was purified
by column chromatography to yield 1.15 g (29%) of
(S)-2-t-butyl-3-methyl-3,4-dihydro-7-nitroisoquinoline-2,3(1H)-dicarboxyl-
ate. MS (ESI) m/z: 359.2 (M+Na.sup.+).
[0820] To a suspension of
(S)-2-t-butyl-3-methyl-3,4-dihydro-7-nitroisoquinoline-2,3(1H)-dicarboxyl-
ate (1.15 g, 3.42 mmol) in MeOH (15 mL) was added 10% Pd/C (0.073
g, 0.068 mmol) and the mixture was stirred under H.sub.2 (1 atm).
After 18 h, the mixture was filtered through a pad of Celite.RTM.,
acidified with conc. HCl (0.060 mL, 0.072 mmol) and concentrated to
yield 970 mg (83%) of
(S)-2-t-butyl-3-methyl-7-amino-3,4-dihydroisoquinoline-2,3(1H)-dicarboxyl-
ate as the hydrochloride salt. MS (ESI) m/z: 329.2
(M+Na.sup.+).
[0821] To a solution of
(S)-2-t-butyl-3-methyl-7-amino-3,4-dihydroisoquinoline-2,3-(1H)-dicarboxy-
late (0.960 g, 2.80 mmol) in 2M HCl (10 mL) was at -10.degree. C.
added solid NaNO.sub.2 (0.190 g, 2.80 mmol) and the resulting
solution was stirred for 45 min at a temperature below 0.degree. C.
Solid SnCl.sub.2.2H.sub.2O (1.26 g, 5.60 mmol) was added and the
mixture was allowed to warm to RT and stirred for 2 h. Ethanol (80
mL) and pivaloylacetonitrile (0.350 g, 2.80 mmol) were added and
the resulting solution was heated at reflux overnight. Ethanol was
removed under reduced pressure and H.sub.2O (100 mL) was added to
the residue. The mixture was extracted with CH.sub.2Cl.sub.2
(3.times.100 ml), dried (MgSO.sub.4), and concentrated. The residue
was dissolved in MeOH (200 mL) and conc. H2SO.sub.4 (15 mL) was
added and the mixture was heated at reflux for 4 h. After cooling,
the mixture was neutralized with 3N NaOH (approx. 150 mL) and MeOH
was removed under reduced pressure. The mixture was extracted with
CH.sub.2Cl.sub.2 (3.times.100 mL), dried (MgSO.sub.4), and
concentrated. The residue was dried in vacuo overnight and
resuspended in CH.sub.2Cl.sub.2 (30 mL). A solution of Boc
anhydride (0.611 g, 2.80 mmol) in CH.sub.2Cl.sub.2 (5 mL) was added
dropwise at 0.degree. C. and the resulting mixture was allowed to
reach RT and stirred for 3 h. Water (100 mL) was added and the
mixture was extracted with EtOAc (3.times.100 mL), dried
(MgSO.sub.4), concentrated and purified by column chromatography to
yield 118 mg (10%) of (3S)-2-t-butyl
3-methyl-7-(3-t-butyl-5-amino-1H-pyrazol-1-yl)-3,4-dihydroisoquinoline-2,-
3(1H)-dicarboxylate as a yellow foam. MS (ESI) m/z: 429.2
(M+H.sup.+). ##STR602##
[0822] Using general method A, Example A55 (0.215 g, 0.501 mmol)
and 2,3-dichlorophenyl isocyanate (0.104 g, 0.552 mmol) were
combined, and the product deprotected using general methods F and E
to yield
(3S)-7-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-1,2,3-
,4-tetra-hydroisoquinoline-3-carboxylic acid (128 mg, 60% yield) as
a colorless solid. .sup.1H-NMR (400 MHz, acetone-d.sub.6): .delta.
8.60 (brs, 1H), 8.27 (d, J=8.4 Hz, 1H), 8.19 (brS, 1H), 7.40 (d,
J=8.0 Hz, 1H), 7.38-7.34 (m, 2H), 7.31 (d, J=8.0 Hz, 1H), 7.24 (d,
J=8.0 Hz, 1H), 6.49 (s, 1H), 4.12 (d, J=14.4 Hz, 1H), 3.89 (d,
J=14.8 Hz, 1H), 3.63 (d, J=10.4 Hz, 1H), 3.17 (d, J=15.6 Hz, 1H),
2.90 (dd, J=16.0, and 10.8 Hz, 1H), 1.32 (s, 9H); MS (ESI) m/z:
502.0 (M+H.sup.+). ##STR603##
[0823] A solution of (3S)-2-t-butyl 3-methyl
7-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-3,4-dihydr-
oiso-quinoline-2,3(1H)-dicarboxylate (from Example 177, 0.100 g,
0.163 mmol) in 7N N.sub.3/MeOH (3 mL) was stirred at RT overnight.
The solvent was removed under reduced pressure and the residue was
dissolved in CH.sub.2Cl.sub.2 (2 mL). Boc anhydride (0.036 g, 0.163
mmol) was added and the solution was stirred at room temperature
for 30 min. The solvent was evaporated and the residue was purified
by column chromatography to yield (3S)-t-butyl
7-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-3-carbamoy-
l-3,4-dihydroisoquinoline-2(1H)-- carboxylate (85 mg, 87% yield) as
a white solid. .sup.1H-NMR (400 MHz, acetone-d.sub.6): .delta. 8.66
(brs, 1H), 8.27 (dd, J=8.4, and 2.0 Hz, 1H), 8.21 (brs, 1H),
7.42-7.37 (m, 2H), 7.35-7.29 (m, 2H), 7.24 (dd, J=8.0, and 1.6 Hz,
1H), 6.88 (brs, 1H), 6.49 (s, 1H), 6.33 (brs, 1H), 4.97-4.45 (m,
3H), 3.36-3.09 (m, 2H), 1.47-1.45 (m, 9H), 1.32 (s, 9H); MS (ESI)
m/z: 601.2 (M+H.sup.+).
[0824] (3S)-t-butyl
7-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-3-carbamoy-
l-3,4-dihydroisoquinoline-2(1H)-carboxylate (0.085 g, 0.14 mmol)
was dissolved in 4N HCl in dioxane (5 mL) and the solution was
stirred at RT for 30 min. The solvent was removed under reduced
pressure and the residue was dissolved in H.sub.2O/MeCN (1:1) and
lyopholized to yield
1-(3-t-butyl-1-((3S)-3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-7-yl)-1H-p-
yrazol-5-yl)-3-(2,3-dichlorophenyl)urea (65 mg, 85% yield) as a
white solid. .sup.1H-NMR (CD.sub.3OD) shows rotameric mixture. MS
(ESI) m/z: 501.2 (M+H.sup.+). ##STR604##
[0825] To a suspension of DL-m-tyrosine (5.00 g, 11.0 mmol) in 0.05
N HCl (50 mL) was added 37% aq. formaldehyde (5.00 mL, 5.2 g, 64.0
mmol) and the resulting slurry was heated at 90.degree. C. for 1 h
and then cooled to RT. The mixture was filtered and the resulting
solid was washed with H.sub.2O and acetone and dried in vacuo to
yield 6-hydroxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid
(3.31 g, 52% yield) as an off-white solid. MS (EI) m/z: 194.0
(M+H.sup.+). .sup.1H NMR (400 MHz, CD.sub.3OD): .delta. 7.03 (d,
J=8.0 Hz, 1H), 6.69 (dd, J=8.8, and 2.4 Hz, 1H), 7.00 (s, 1H),
4.28-4.19 (m, 2H), 3.80 (dd, J=11.6, and 5.2 Hz, 1H), 3.31-3.27 (m,
1H), 3.05 (dd, J=16.8, and 11.2 Hz, 1H), acid, hydroxy and amine
protons not visible.
[0826] Acetyl chloride (30 mL, 33 g, 422 mmol) was added carefully
to ice-cold anhydrous EtOH and the resulting solution was stirred
at RT for 10 min.
6-Hydroxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid (3.30 g,
14 mmol) was added and the mixture was stirred at 50.degree. C. for
5 h. The solvent was evaporated and the residue was dried under
vacuum to yield ethyl
6-hydroxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylate (4.35 g,
crude yield>100%) as a yellow solid. MS expected 222.1 found
222.0. .sup.1H NMR (400 MHz, CD.sub.3OD): .delta. 7.06 (d, J=8.4
Hz, 1H), 6.74 (dd, J=8.0, and 2.4 Hz, 1H), 6.69 (d, J=2.4 Hz, 1H),
4.44-4.29 (m, 5H), 3.35 (dd, J=17.2, and 5.2 Hz, 1H), 3.15 (dd,
J=17.2, and 11.6 Hz, 1H), 1.35 (t, J=7.2 Hz, 3H).
[0827] To a solution of the material from the previous reaction
(3.70 g, 14.4 mmol) and Et.sub.3N (6.00 mL, 4.36 g, 43.1 mmol) in
CH.sub.2Cl.sub.2 (100 mL) was added Boc anhydride (3.76 g, 17.2
mmol) at RT and the resulting mixture was stirred for 1 h. Water
(100 mL) was added and the mixture was extracted with
CH.sub.2Cl.sub.2 (3.times.100 mL), dried (MgSO.sub.4), and
concentrated under vacuum to yield 2-t-butyl 3-ethyl
6-hydroxy-3,4-dihydroisoquinoline-2,3(1H)-dicarboxylate (5.80 g,
crude yield>100%) as a light brown foam. MS (EI) m/z: 344.3
(M+Na.sup.+). .sup.1H NMR (400 Mhz, CDCl.sub.3) shows rotameric
mixture.
[0828] To a solution of material from the previous reaction (4.61
g, 14.3 mmol) in CH.sub.2Cl.sub.2 (100 mL) at RT was added
Et.sub.3N (3.00 mL, 2.18 g, 21.5 mmol) and triflic chloride (2.29
mL, 3.63 g, 21.5 mmol) and the resulting solution was stirred at RT
for 1 h. Water (100 mL) was added and the mixture was extracted
with CH.sub.2Cl.sub.2 (3.times.100 mL), dried (MgSO.sub.4),
concentrated and purified by column chromatography to yield
2-t-butyl 3-ethyl
6-(trifluoromethylsulfonyloxy)-3,4-dihydroisoquinoline-2,3(1H)-dicarboxyl-
ate (6.30 g, 97% yield, 3 steps) as a white wax-like solid. MS (EI)
m/z: 476.0 (M+Na.sup.+). .sup.1H NMR (400 MHz, CDCl.sub.3) shows
rotameric mixture.
[0829] To a degassed solution of the material from the previous
reaction (3.270 g, 7.21 mmol), bis(pinacolato)diboron (2.75 g,
0.662 mmol), and KOAc (2.12 g, 21.6 mmol) in DMF (10 mL) was added
PdCl.sub.2(dppf).sub.2 (0.2945 g, 0.361 mmol) and the resulting
mixture was stirred at 80.degree. C. overnight. Water (100 mL) was
added and the mixture was extracted with EtOAc (3.times.100 mL),
dried (MgSO.sub.4), concentrated and purified by column
chromatography to yield 2-t-butyl 3-ethyl
6-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-3,4-dihydroisoquinoline-2-
,3(1H)-dicarboxylate (2.77 g, 89%) as a colorless oil. MS (EI) m/z:
454.2 (M+Na.sup.+).
[0830] To a solution of the material from the previous reaction
(0.105 g, 0.243 mmol) in THF/H2O (4:1) (2 mL) was added NaIO.sub.4
(0.160 g, 0.730 mmol) and the thick mixture was stirred for 30 min.
Hydrochloric acid (2N, 0.24 mL, 0.48 mmol) was added and the
resulting solution was stirred at RT overnight. Water (30 mL) was
added and the mixture was extracted with EtOAc (3.times.100 mL),
dried (MgSO.sub.4), concentrated and dried under vacuum to yield
2-(t-butoxycarbonyl)-3-(ethoxycarbonyl)-1,2,3,4-tetrahydroisoquinolin-6-y-
lboronic acid (66 mg, 78%) of the crude boronic acid as an
orange-yellow solid. MS (EI) m/z: 372.3 (M+Na.sup.+). This material
was used without further purification. ##STR605##
[0831] To a solution of Example A32 (0.025 g, 0.071 mmol), Example
A56 (0.064 g, 0.180 mmol) and pyridine (0.011 g, 0.14 mmol) in
CH.sub.2Cl.sub.2 (2 mL) was added Cu(OAc).sub.2 (0.019 g, 0.11
mmol) and the resulting green solution was stirred at RT open to
air for 72 h, replacing evaporated solvent as needed. Water (20 mL)
was added and the mixture was extracted with CH.sub.2Cl.sub.2
(3.times.20 mL), dried (MgSO.sub.4), concentrated and purified by
column chromatography to yield 2-t-butyl 3-ethyl
6-(3-t-butyl-5-(3-(3-(pyridin-3-yloxy)phenyl)ureido)-1H-pyrazol-1-yl)-3,4-
-dihydroisoquinoline-2,3(1H)-dicarboxylate (13 mg, 28% yield) as a
yellow oil. MS (EI) m/z: 655.2 (M+H.sup.+).
[0832] A solution of the material from the previous reaction (0.013
g, 0.020 mmol) in 2N HCl in EtOH (5 mL) was stirred overnight. The
solvent was evaporated and the residue was dissolved in 7N
N.sub.3/MeOH and the solution was stirred in a sealed vessel at
60.degree. C. overnight. The solvent was evaporated and the residue
was purified by reverse phase chromatography. Basic reextraction
and acidification with HCl yielded
1-(3-t-butyl-1-(3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazo-
l-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea (7 mg, 59% yield) as an
off-white solid. .sup.1H NMR (400 MHz, CD.sub.3OD): .delta. 8.66
(d, J=2.8 Hz, 1H), 8.59 (d, J=5.6 Hz, 1H), 8.21 (ddd, J=8.8, 2.4,
and 1.2 Hz, 1H), 8.04 (dd, J=8.4, and 5.4 Hz, 1H), 7.58 (t, J=2.2
Hz, 1H), 7.52 (s, 1H), 7.50 (d, J=1.6 Hz, 1H), 7.45 (d, J=10.0 Hz,
1H), 7.41 (d, J=7.6 Hz, 1H), 7.19 (ddd, J=8.0, 1.8, and 0.8 Hz,
1H), 6.89 (ddd, J=8.0, 2.4, and 1.2 Hz, 1H), 6.50 (s, 1H), 4.54 (d,
J=16.0 Hz, 1H), 4.49 (d, J=16.0 Hz, 1H), 4.29 (dd, J=12.0, and 5.0
Hz, 1H), 3.54 (dd, J=17.2, and 4.8 Hz, 1H), 1.36 (s, 9H), one
proton is buried under the MeOH peak; MS (EI) m/z: 526.2
(M+H.sup.+). ##STR606##
[0833] Using the same procedure as for Example 179, 2-t-butyl
3-ethyl
6-(3-t-butyl-5-(3-(3-(pyridin-3-yloxy)phenyl)ureido)-1H-pyrazol-1-yl)-3,4-
-dihydroisoquinoline-2,3(1H)-dicarboxylate (0.053 g, 0.081 mmol),
available from Example 188) in 3N hydrochloric acid in MeOH (10.0
mL) was stirred at RT for 1 h. The solvent was evaporated and the
residue was dissolved in 8N MeNH.sub.2/MeOH (3 mL) and the solution
was stirred in a sealed vessel at 50.degree. C. overnight. The
solvent was evaporated and the residue was purified by reverse
phase chromatography and coevaporated with THF/4N HCl to yield
1-(3-t-butyl-1-(1-(methylcarbamoyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1-
H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea (43 mg, 87%
yield) as a yellow solid. .sup.1H-NMR (MeOH-d.sub.4): .delta. 8.66
(d, 1H, J=2.4 Hz), 8.59 (d, 1H, J=5.6 Hz), 8.22 (ddd, 1H, J=9.2,
2.4, 1.2 Hz), 8.05 (dd, 1H, J=8.0, 6.0 Hz), 7.60-7.54 (m, 4H), 7.42
(t, 1H, J=8.0 Hz), 7.20 (dd, 1H, J=7.6, 1.2 Hz), 6.90 (dd, 1H,
J=8.4, 2.0 Hz), 6.53 (s, 1H), 5.23 (s, 1H), 3.80-3.74 (m, 1H),
3.56-3.49 (m, 1H), 3.26-3.14 (m, 2H), 2.88 (s, 3H). 1.36 (s, 9H).
MS expected 540.3 found 540.3 ##STR607##
[0834] To a solution of 4-(4-aminophenyl)isoindolin-1-one (0.327 g,
1.46 mmol, made according to literature procedures) in EtOAc (5 mL)
was added NaOH (2N, 2 mL, 4 mmol) and Troc-Cl (0.618 g, 2.92 mmol)
and the resulting mixture was stirred at RT for 6 h. Water (20 mL)
was added and the mixture was extracted with EtOAc (3.times.20 mL),
dried (MgSO.sub.4) and concentrated. The residue was dissolved in
DMF (2 mL) to which was added 5-amino-3-t-butylpyrazole (0.831 g,
5.97 mmol, made according to literature procedures) and
i-Pr.sub.2NEt (0.406 g, 2.92 mmol) and the solution was stirred at
90.degree. C. overnight. Water (100 mL) was added and the mixture
was extracted with EtOAc (3.times.100 mL), dried (MgSO.sub.4) and
concentrated. Addition of CH.sub.2Cl.sub.2 to the residue resulted
in precipitation of the product. The product was collected and
dried to yield
1-(3-t-butyl-1H-pyrazol-5-yl)-3-(4-(1-oxoisoindolin-4-yl)phenyl)urea
(270 mg, 48% yield) as a light brown powder. .sup.1H-NMR
(DMSO-d.sub.6): .delta. 9.31 (s, br, 1H), 8.95 (s, br, 1H), 8.65
(s, br, 1H), 7.65-7.63 (m, 2H), 7.58-7.52 (m, 5H), 6.00 (s, br,
1H), 4.51 (s, 2H), 1.25 (s, 9H), one NH is not visible. MS expected
390.2 found 390.2.
[0835] To a solution of the material from the previous reaction
(0.200 g, 0.514 mmol) and Example A54 (0.179 g, 0.514 mmol) in DMF
(2 mL) was added pyridine (0.122 g, 1.54 mmol) and Cu(OAc).sub.2
(0.140 g, 0.770 mmol) and the resulting solution was stirred under
a balloon of air at RT for 96 h. Water (20 mL) was added and the
mixture was extracted with EtOAc (3.times.20 mL), dried
(MgSO.sub.4), concentrated and purified by column chromatography to
yield 2-t-butyl 3-ethyl
6-(3-t-butyl-5-(3-(4-(1-oxoisoindolin-4-yl)phenyl)ureido)-1H-pyrazol-1-yl-
)-3,4-dihydroisoquinoline-2,3(1H)-dicarboxylate (50 mg, 14%) as a
yellow powder. MS expected 693.3 found 693.2.
[0836] A solution of the material from the previous reaction (0.025
g, 0.036 mmol) in 3N HCl/MeOH was stirred at RT for 1 h. The
solvent was evaporated and the residue was dried in vacuo. The
residue was dissolved in THF (3 mL) and 2N NaOH (2 mL) was added.
MeOH was added until the mixture became homogenous. After 1 h, the
mixture was acidified with conc. HCl, concentrated and purified by
reverse phase chromatography to yield
6-(3-t-butyl-5-(3-(4-(1-oxoisoindolin-4-yl)phenyl)ureido)-1H-pyrazo-
l-1-yl)-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid (16 mg,
74%) as a white solid. .sup.1H-NMR (MeOH-d.sub.4): .delta. 7.79 (d,
1H, J=7.2 Hz), 7.66-7.48 (m, 9H), 6.63 (s, 1H), 4.62-4.47 (m, 5H),
3.61 (dd, 1H, J=17.6, 4.8 Hz), 3.38-3.31 (m, 1H), 1.40 (s, 9H). MS
expected 565.3 found 565.3. ##STR608##
[0837] Using the same method as for Example 184, a solution of
methyl
6-(3-t-butyl-5-(3-(3-(pyridin-3-yloxy)phenyl)ureido)-1H-pyrazol-1-yl)-1,2-
,3,4-tetrahydroisoquinoline-3-carboxylate (0.017 g, 0.026 mmol,
available in Example 179) in 3N HCl in MeOH (2 mL) was stirred at
RT overnight. The solvent was evaporated and the residue was
dissolved in MeOH (0.5 mL). 3-Amino-1,2-dihydroxypropane (0.200 g,
2.20 mmol) was added and the solution was kept at RT overnight. The
mixture was directly loaded on to a reverse phase column and
purified to yield
1-(1-(3-((2,3-dihydroxypropyl)carbamoyl)-1,2,3,4-tetrahydroisoquinolin-6--
yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea
(16 mg, 97% yield) as a yellow solid. .sup.1H-NMR (MeOH-d.sub.4):
.delta. 8.66 (s, 1H), 8.60 (d, 1H, J=5.6 Hz), 8.23-8.20 (m, 1H),
8.05 (dd, 1H, J=8.8, 5.6 Hz), 7.57 (t, 1H, J=2.0 Hz), 7.52-7.40 (m,
4H), 7.23 (d, 1H, J=8.4 Hz), 6.89 (dd, 1H, J=7.6, 1.6 Hz), 6.54 (s,
1H), 4.56 (d, 1H, J=16.8 Hz), 4.51 (d, 1H, J=16.8 Hz), 4.29 (dd,
1H, J=12.0, 4.4 Hz), 3.78-3.72 (m, 1H), 3.54-3.45 (m, 5H), 1.36 (s,
9H), one proton is buried under the MeOH peak, urea, amide, amine
and hydroxy protons not visible. MS expected 600.3 found 600.2
##STR609##
[0838] A solution of Example 181 (0.025 g, 0.036 mmol) was
dissolved in 7N ammonia in MeOH (3 mL) and the solution was kept at
RT overnight, then purified via reverse phase column chromatography
to yield
1-(3-t-butyl-1-(3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazo-
l-5-yl)-3-(4-(1-oxoisoindolin-4-yl)phenyl)urea (8 mg, 37%) as a
white solid. .sup.1H-NMR (MeOH-d.sub.4): .delta. 7.78 (dd, 1H,
J=7.4, 1.4 Hz), 7.65 (dd, 1H, J=8.0, 1.0 Hz), 7.61 (d, 1H, J=7.6
Hz), 7.58-7.45 (m, 7H), 6.51 (s, 1H), 4.55 (s, 2H), 4.54 (d, 2H,
J=16.0 Hz), 4.49 (d, 2H, J=16.0 Hz), 4.28 (dd, 1H, J=11.6, 5.2 Hz),
3.53 (dd, 1H, J=17.2, 5.2 Hz), 1.38 (s, 9H), one proton is buried
under the MeOH peak, urea, amine and amide protons not visible. MS
expected 564.3 found 564.3 ##STR610##
[0839] Using the same procedure as for Example 179, 2-t-butyl
3-ethyl
6-(3-t-butyl-5-(3-(3-(pyridin-3-yloxy)phenyl)ureido)-1H-pyrazol-1-yl)-3,4-
-dihydroisoquinoline-2,3(1H)-dicarboxylate (0.029 g, 0.044 mmol),
available from experimental 184) in 3N hydrochloric acid in MeOH
(10.0 mL) was stirred at RT for 1 h. The solvent was evaporated and
the residue was dissolved in 3-amino-1,2-dihydroxypropane (0.200 g,
2.2 mmol) in MeOH (0.5 mL) and the solution was stirred at RT for 2
d. The solvent was evaporated and the residue was purified by
reverse phase chromatography and coevaporated with THF/4N HCl to
yield
1-(1-(1-((2,3-dihydroxypropyl)carbamoyl)-1,2,3,4-tetrahydroisoquinolin-6--
yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea
(24 mg, 81% yield) as a pale yellow solid. .sup.1H-NMR
(MeOH-d.sub.4): .delta. 8.68 (d, 1H, J=3.2 Hz), 8.60 (d, 1H, J=7.6
Hz), 8.23 (ddd, 1H, J=8.8, 2.6, 1.0 Hz), 8.06 (dd, 1H, J=8.4, 1.4
Hz), 7.70 (dd, 1H, J=9.0, 1.8 Hz), 7.58-7.54 (m, 3H), 7.42 (t, 1H,
J=8.0 Hz), 7.22 (dt, 1H, J=8.4, 1.0 Hz), 6.90 (dd, 1H, J=6.8, 1.6
Hz), 6.58 (d, 1H, J=1.2 Hz), 5.29 (s, 1H), 3.84-3.63 (m, 2H),
3.63-3.51 (m, 5H), 3.30-2.87 (m, 2H), 1.37 (s, 9H), urea, amine,
hydroxy and amide protons not visible. MS expected 600.3 found
600.2. ##STR611##
[0840] To a solution of benzyl 3-t-butyl-1H-pyrazole-5-carboxylate
(0.100 g, 0.387 mmol, synthesized by trans-esterification of
commercially available ethyl 3-t-butyl-1H-pyrazole-5-carboxylate),
2-(t-butoxycarbonyl)-3-(methoxycarbonyl)-1,2,3,4-tetrahydroisoquinolin-6--
ylboronic acid (0.195 g, 0.581 mmol, made analogously to Example
A56) and pyridine (0.092 g, 1.16 mmol) in methylene chloride (4 mL)
was added copper(II)-acetate (0.105 g, 0.581 mmol) and the
resulting mixture was stirred at Rt for 1 d. The mixture was
directly loaded on a silica gel column, chromatographed and
concentrated to yield 2-t-butyl 3-methyl
6-(5-(benzyloxycarbonyl)-3-t-butyl-1H-pyrazol-1-yl)-3,4-dihydroisoquinoli-
ne-2,3(1H)-dicarboxylate (171 mg, 81% yield) as a colorless foam.
MS expected 548.3 found 548.3. To this material (0.136 g, 0.248
mmol) in EtOAc (5 mL) was added palladium on charcoal (10%, 0.013
g, 0.012 mmol) and the mixture was stirred under an atmosphere of
H.sub.2 overnight. The mixture was filtered and the filtrate was
concentrated to yield
1-(2-(t-butoxycarbonyl)-3-(methoxycarbonyl)-1,2,3,4-tetrahydroisoquinolin-
-6-yl)-3-t-butyl-1H-pyrazole-5-carboxylic acid (114 mg, 100%) as a
colorless foam. MS expected 458.2 found 458.3.
[0841] To a solution of the material from the previous reaction
(0.070 g, 0.153 mmol) and Example A11 (0.062 g, 0.245 mmol) in
toluene (2 mL) was added triethylamine (0.031 g, 0.306 mmol) and
diphenylphosphonic azide (0.063 g, 0.229 mmol) and the resulting
solution was stirred at 100.degree. C. for 1 h. The mixture was
directly loaded on a column and purified via column chromarography
to yield 2-t-butyl 3-methyl
6-(3-t-butyl-5-(3-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6--
yl)phenyl)ureido)-1H-pyrazol-1-yl)-3,4-dihydroisoquinoline-2,3(1H)-dicarbo-
xylate (89 mg, 82%) as a yellow oil. MS expected 707.3 found
707.2
[0842] A solution of material from the previous reaction (0.088 g,
0.120 mmol) in 3N HCl in MeOH was stirred at RT for 1 h. The
solvent was evaporated and the residue was dried in vacuo. The
residue was dissolved in 7N ammonia in MeOH and the mixture was
kept at RT overnight. The mixture purified via reverse phase column
chromatography to yield
1-(3-t-butyl-1-(3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazo-
l-5-yl)-3-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl-
)urea dihydrochloride (63 mg, 76%) as a yellow crystalline solid.
.sup.1H-NMR (MeOH-d.sub.4): .delta. 9.27 (s, br, 2H), 8.17 (s, 1H),
7.89 (s, 1H), 7.60-7.49 (m, 4H), 7.42-7.38 (m, 2H), 6.71 (s, 1H),
4.58 (d, 1H, J=16.4 Hz), 4.53 (d, 1H, J=16.4 Hz), 4.33 (dd, 1H,
J=11.6, 4.4 Hz), 3.89 (s, 3H), 3.57 (dd, 1H, J=17.6, 5.2 Hz), 1.40
(s, 9H), one proton is buried under the MeOH peak, urea, amide and
amine protons not visible. MS expected 592.3 found 592.3.
##STR612##
[0843] Using general method G, followed by general method E,
(3S)-methyl
6-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-2-(2,2,2-t-
rifluoroacetyl)-1,2,3,4-tetrahydro-isoquinoline-3-carboxylate from
Example A42 (0.080 g, 0.13 mmol) was deprotected and lyophilized to
yield
(3S)-6-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-1,2,3-
,4-tetrahydroisoquinoline-3-carboxylic acid (42 mg, 60% yield) as
an off-white solid. .sup.1H NMR (400 MHz, CD.sub.3OD): .delta. 7.98
(t, J=4.8 Hz, 1H), 7.49 (s, 1H), 7.48 (d, J=7.6 Hz, 1H), 7.42 (d,
J=8.4 Hz, 1H), 7.24 (d, J=4.8 Hz, 1H), 7.24 (d, J=4.8 Hz, 1H), 6.42
(s, 1H), 4.55 (d, J=16.4 Hz, 1H), 4.48 (d. J=16.4 Hz, 1H), 4.41
(dd, J=10.8, and 4.8 Hz, 1H), 3.56 (dd, J=17.6, and 4.4 Hz, 1H),
1.35 (s, 9H), one aliphatic proton is buried under the MeOH peak;
MS (EI) m/z: 504.0 (M+H.sup.+). ##STR613##
[0844] A solution of (3S)-methyl
7-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-2-(2,2,2-t-
rifluoro-acetyl)-1,2,3,4-tetrahydroiso-quinoline-3-carboxylate from
Example A42 (0.153 g, 0.250 mmol), methylamine hydrochloride (1.000
g, 14.8 mmol) and triethylamine (2.05 mL, 1.49 g, 14.7 mmol) in
MeOH (5 mL) was stirred at 60.degree. C. for 24 h. H2O was added
(50 mL) and the mixture was extracted with CH.sub.2Cl.sub.2
(3.times.50 mL), dried (MgSO.sub.4) and concentrated. The residue
was redisolved in CH.sub.2Cl.sub.2 (5 mL). Boc anhydride (0.055 g,
0.250 mmol) was added and the solution was stirred at RT for 30
min. The solvent was evaporated and the residue was purified by
column chromatography to yield (3S)-t-butyl
7-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-3-(methyl--
carbamoyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (52 mg, 34%
yield) as a white solid. .sup.1H NMR (400 MHz, acetone-d.sub.6)
shows rotameric mixture. MS (EI) m/z: 615.2 (M+H.sup.+).
[0845] Using general method F, the material from the previous
reaction (0.050 g, 0.14 mmol) was deprotected and lyophilized to
yield
1-(3-t-butyl-1-((3S)-3-(methylcarbamoyl)-1,2,3,4-tetrahydroisoquinolin-7--
yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea (42 mg, 94% yield)
as a white solid. .sup.1H NMR (400 MHz, CD.sub.3OD) shows rotameric
mixture. MS (EI) m/z: 515.0 (M+H.sup.+). ##STR614##
[0846] To a solution of Example A31 (0.066 g, 0.200 mmol), Example
A56 (0.070 g, 0.200 mmol) and pyridine (0.032 g, 0.401 mmol) in
CH.sub.2Cl.sub.2 (2 mL) was added copper(II)-acetate (0.055 g,
0.301 mmol) and the resulting green solution was stirred at RT open
to air for 96 h, replacing evaporated solvent as needed. H.sub.2O
was added (20 mL) and the mixture was extracted with
CH.sub.2Cl.sub.2 (3.times.20 mL), EtOAc (3.times.100 mL), dried
(MgSO.sub.4), concentrated and purified via reverse phase column
chromatography to yield 2-t-butyl
3-ethyl-6-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-3,-
4-dihydroisoquinol-ine-2,3(1H)-dicarboxylate (50 mg, 40%) as an
off-white solid. MS (EI) m/z: 630.2 (M+H.sup.+).
[0847] A solution of the material from the previous reaction (0.040
g, 0.063 mmol) in 7N ammonia in MeOH (3 mL, 21 mmol) was heated at
70.degree. C. for 8 h. The solvent was evaporated and the residue
was purified by reverse phase chromatography to yield
1-(3-t-butyl-1-(3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazo-
l-5-yl)-3-(2,3-dichloro-phenyl)urea (17 mg, 50% yield) as an
off-white solid. .sup.1H NMR (400 Mhz, CD.sub.3OD): .delta. 8.03
(t, J=4.8 Hz, 1H), 7.56-7.54 (m, 2H), 7.49 (d, J=8.8 Hz, 1H),
7.26-7.25 (m, 2H), 6.61 (s, 1H), 4.57 (d, J=16.8 Hz, 1H), 4.51 (d,
J=16.4 Hz, 1H), 4.30 (dd, J=12.0, and 4.6 Hz, 1H), 3.54 (dd,
J=17.6, and 4.8 Hz, 1H), 1.38 (s, 9H), one proton is buried under
the MeOH peak, urea, amide and amine protons not visible; MS (EI)
m/z: 501.2 (M+H.sup.+). ##STR615##
[0848] A solution of 2-t-butyl 3-ethyl
6-(3-t-butyl-5-(3-(3-(pyridin-3-yloxy)phenyl)ureido)-1H-pyrazol-1-yl)-3,4-
-dihydroisoquinoline-2,3(1H)-dicarboxylate (available from Example
179, 0.102 g, 0.160 mmol) in 3N HCl in MeOH (5 mL) was stirred for
11 h. The solvent was evaporated. The residue was dissolved in THF
(2 mL). 2N NaOH was added (2 mL) and then MeOH until homogenous.
The solution was stirred at RT for 1 h. The solvents were
evaporated, the residue was purified by reverse phase
chromatography followed by coevaporation with THF/HCl to yield
6-(3-t-butyl-5-(3-(3-(pyridin-3-yloxy)phenyl)ureido)-1H-pyrazol-1-y-
l)-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid (20 mg, 100%)
as a white solid. .sup.1H NMR (400 MHz, CD.sub.3OD): .delta. 8.66
(d, J=2.8 Hz, 1H), 8.59 (d, J=5.2 Hz, 1H), 8.22 (ddd, J=9.2, 2.8,
and 0.8 Hz, 1H), 8.05 (dd, J=8.8, 5.6 Hz, 1H), 7.58 (t, J=2.0 Hz,
1H), 7.54-7.46 (m, 3H), 7.42 (t, J=8.2 Hz, 1H), 7.21 (d, J=8.0 Hz,
1H), 6.89 (dd, J=8.4, and 2.4 Hz, 1H), 6.57 (s, 1H), 6.59 (d,
J=16.0 Hz, 1H), 4.51 (d, J=16.0 Hz, 1H), 4.49 (dd, J=11.2, and 5.2
Hz, 1H), 3.60 (dd, J=18.0, and 4.8 Hz, 1H), 1.37 (s, 9H), acid,
amine and urea protons not visible, one proton is buried under the
MeOH peak; MS (EI) m/z: 527.2 (M+H.sup.+). ##STR616##
[0849] A solution of 2-t-butyl 3-ethyl
6-(3-t-butyl-5-(3-(3-(pyridin-3-yloxy)phenyl)ureido)-1H-pyrazol-1-yl)-3,4-
-dihydroisoquinoline-2,3(1H)-dicarboxylate (available from Example
179, 0.102 g, 0.160 mmol) in 3N HCl in MeOH (5 mL) was stirred for
1 h. The solvent was evaporated and the residue was redissolved in
8N methylamine in EtOH and stirred at RT overnight. The solvent was
evaporated, the residue was purified by reverse phase
chromatography and coevaporation with THF/HCl to yield
1-(3-t-butyl-1-(3-(methylcarbamoyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1-
H-pyrazol-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)urea (20 mg, 92%
yield) as a white solid. .sup.1H NMR (400 MHz, CD.sub.3OD): .delta.
8.67 (d, J=2.8 Hz, 1H), 8.60 (d, J=5.6 Hz, 1H), 8.23 (ddd, J=8.8,
2.8, and 1.0 Hz, 1H), 8.06 (dd, J=8.8, and 5.6 Hz, 1H), 7.58 (t,
J=2.2 Hz, 1H), 7.54 (d, J=8.0 Hz, 1H), 7.50 (t, J=7.6 Hz, 2H), 7.43
(t, J=8.2 Hz, 1H), 7.26 (dd, J=8.0, and 1.6 Hz, 1H), 6.90 (ddd,
J=8.4, 2.0, and 0.8 Hz, 1H), 6.64 (s, 1H), 4.56 (d, J=16.4 Hz, 1H),
4.52 (d, J=16.4 Hz, 1H), 4.28 (dd, J=11.6, and 4.8 Hz, 1H), 3.50
(dd, J=17.2, and 4.8 Hz, 1H), 2.86 (s, 3H), 1.38 (s, 9H), amide,
urea and amine protons not visible, one proton is buried under the
MeOH peak, methylamide protons split due to rotation barrier; MS
(EI) m/z: 540.3 (M+H.sup.+). ##STR617##
[0850] Using general method H, Example A29 (116 mg, 0.30 mmol) was
transformed to prop-1-en-2-yl
3-t-butyl-1-(1-(2,2,2-trifluoroacetyl)indolin-5-yl)-1H-pyrazol-5-ylcarbam-
ate (119 mg, 91% yield). MS (ESI) m/z: 437.3 (M+H.sup.+). Using the
same procedure as for Example 151, this material (117 mg, 0.27
mmol) and 4-(4-aminophenyl)isoindolin-1-one (61 mg, 0.27 mmol) were
combined to yield
1-(3-t-butyl-1-(1-(2,2,2-trifluoroacetyl)indolin-5-yl)-1H-pyrazol-5-
-yl)-3-(4-(1-oxoisoindolin-4-yl)phenyl)urea (152 mg, 94% yield). MS
(ESI) m/z: 603.3 (M+H.sup.+). To this material (149 mg, 0.25 mmol)
was added NH.sub.3/MeOH (7.0 M, 3.0 mL, 21 mmol) and the resultant
mixture was stirred at RT overnight. Ether (9 mL) was added, the
reaction was filtered and the precipitate was washed with 3:1
Et.sub.2O-MeOH (10 mL) and Et.sub.2O (10 mL). The tan-colored solid
was dried in vacuo to provide
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(4-(1-oxoisoindo-
lin-4-yl)phenyl)urea (100 mg, 79% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.21 (s, 1H), 8.57 (s, 1H), 8.26 (s, 1H),
7.66-7.62 (m, 2H), 7.56 (m, 1H), 7.54-7.50 (m, 4H), 7.08 (brs, 1H),
6.97 (dd, J=8.2, and 2.1 Hz, 1H), 6.58 (d, J=8.2 Hz, 1H), 6.32 (s,
1H), 5.81 (s, 1H), 4.51 (s, 2H), 3.50 (td, J=8.5, and 1.5 Hz, 2H),
2.99 (t, J=8.5 Hz, 2H), 1.26 (s, 9H); MS (ESI) m/z: 507.2
(M+H.sup.+). ##STR618##
[0851] Using the same procedure as for Example 108, Example 191 (55
mg, 0.11 mmol) was transformed to yield
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-(4-(1--
oxoisoindolin-4-yl)phenyl)urea (5 mg, 8% yield) as an off-white
solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.15 (s, 1H),
8.57 (s, 1H), 8.44 (s, 1H), 7.66-7.62 (m, 2H), 7.56 (m, 1H),
7.54-7.52 (m, 4H), 7.43 (m, 1H), 7.36-7.32 (m, 2H), 6.38 (s, 1H),
4.50 (s, 2H), 4.02 (t, J=8.5, 2H), 3.20 (t, J=8.5 Hz, 2H), 3.07 (s,
3H), 1.286 (s, 9H); MS (ESI) m/z: 585.3 (M+H.sup.+). ##STR619##
[0852] To a solution of Example A27 (500 mg, 1.5 mmol) in absolute
THF was added powder LiAlH.sub.4 (300 mg, 7.5 mmol) in portions at
0.degree. C. under N.sub.2 atmosphere. After stirring for 3 h, the
reaction was quenched by addition of H.sub.2O and 2N NaOH. The
suspension was filtered and the filtrate was concentrated to the
crude product, which was purified by reverse phase chromatography
to yield 2-(3-(5-amino-3-t-butyl-1H-pyrazol-1-yl)naphthalen-1-yl)
(400 mg, 86% yield) as a white solid. .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta.8.02-8.05 (m, 1H), 7.90-7.93 (m, 1H), 7.86
(s, 1H), 7.61 (s, 1H), 7.50-7.47 (m, 2H), 5.38 (s, 1H), 5.27 (s,
2H), 4.73 (t, J=5.4 Hz, 1H), 3.69 (t, J=6.9 Hz, 2H), 3.20 (t, J=6.9
Hz, 2H), 1.20 (s, 9H); MS (ESI) m/z: 310 (M+H.sup.+).
[0853] To a stirred solution of the material from the previous
reaction (400 mg, 1.3 mmol) and DPPA (0.419 mL, 2 mmol) in dry THF
(10 mL) at 0.degree. C. was added DBU (0.293 mL, 2 mmol). The
resulting mixture was allowed to warm to 25.degree. C. and stirred
under N.sub.2 for 18 h. The mixture was concentrated and purified
by column chromatography to yield
1-(4-(2-azidoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-amine
(150 mg, 30% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
8.75-8.78 (m, 1H), 7.90-7.95 (m, 1H), 7.92 (s, 1H), 7.69 (s, 1H),
7.55-7.50 (m, 2H), 5.39 (s, 1H), 5.30 (s, 2H), 3.68 (t, J=7.2 Hz,
2H), 3.35 (t, J=7.2 Hz, 2H), 1.21 (s, 1H); MS (ESI) m/z: 335
(M+H.sup.+).
[0854] To a mixture of the material from the previous reaction (150
mg, 0.45 mmol) and Et.sub.3N (0.186 mL, 1.3 mmol) in
CH.sub.2Cl.sub.2 (10 mL) was added a solution of
1,2-dichloro-3-isocyanatobenzene (84 mg, 1.5 mmol) in
CH.sub.2Cl.sub.2 dropwise at 0.degree. C. under N.sub.2 atmosphere.
The mixture was allowed to come to room temperature and stirred
overnight before being poured into ice cold 1.0N HCl. The mixture
was extracted with CH.sub.2Cl.sub.2 (3.times.100 mL), and the
combined organic layers were washed with brine, dried
(Na.sub.2SO.sub.4), filtered and concentrated to give a dark oil,
which was purified by column chromatography to yield
1-(1-(4-(2-azidoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3--
dichlorophenyl)urea (200 mg, 30% yield) as a white solid. .sup.1H
NMR (300 MHz, DMSO-d.sub.6): .delta. 9.29 (s, 1H), 8.74 (s, 1H),
8.12-8.15 (m, 1H), 8.12-8.00 (m, 2H), 7.93-7.96 (m, 1H), 7.62-7.53
(m, 3H), 7.30-7.24 (m, 2H), 6.42 (s, 1H), 3.69 (t, J=7.2 Hz, 2H),
3.37 (t, J=7.2 Hz, 2H), 1.23 (s, 1H); MS (ESI) m/z: 522
(M+H.sup.+).
[0855] To a solution of the material from the previous reaction
(200 mg, 0.38 mmol) in absolute THF was added LiAlH.sub.4 powder
(77 mg, 1.9 mmol) in portions at 0.degree. C. under N.sub.2. After
stirring for 3 h, the reaction was quenched by addition of H.sub.2O
and 2N NaOH. The suspension was filtered and the filtrate was
concentrated to give the crude product, which was purified by
reverse phase chromatography to yield
1-(1-(4-(2-aminoethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3--
dichlorophenyl)urea (20 mg, 10% yield) as a white solid. .sup.1H
NMR (300 MHz, DMSO-d.sub.6): .delta. 9.30 (s, 1H), 8.71 (s, 1H),
8.12 (d, J=7.8 Hz, 1H), 8.03-7.98 (m, 3H), 7.84 (s, 2H), 7.60-7.56
(m, 3H), 7.25-7.24 (m, 2H), 6.40 (s, 1H), 3.43-3.46 (m, 2H),
3.10-3.15 (m, 2H), 1.25(s, 9H); MS (ESI) m/z: 496 (M+H.sup.+).
##STR620##
[0856] A mixture of formamide (7.91 g, 176 mmol) and
4-nitroanthranilic acid (4.00 g, 22.0 mmol) was warmed to
160.degree. C. and stirred for 7 h then cooled to RT and stirred
overnight. The mixture was diluted with H.sub.2O (30 mL) and
stirred overnight. The brown solid was collected by filtration and
dried to yield 7-nitroquinazolin-4-ol (3.62 g, 86% yield). .sup.1H
NMR (300 MHz, DMSO-d.sub.6): 8.38-8.33 (m, 2H), 8.27-8.23 (m,
2H).
[0857] A solution of 7-nitroquinazolin-4-ol (3.62 g, 18.9 mmol)
with 10% Pd/C (0.25 g) in DMF (15 mL) was stirred under H.sub.2 (1
atm) for 18 h, then partially concentrated at elevated temperature,
filtered warm through Celite.RTM. to remove catalyst and then
concentrated to a brown solid. The solid was triturated with EtOAc
(50 mL), filtered, dried, redissolved in DMF (25 mL), treated with
10% Pd/C (0.25 g) and stirred overnight under an H.sub.2
atmosphere. The mixture was filtered free of catalyst and the
filtrate evaporated at reduced pressure to yield a brown solid
which was triturated with EtOAc (50 mL) and filtered to yield
7-aminoquinazolin-4-ol (2.27 g, 74% yield). MS (ESI) m/e
(M+H.sup.+) 162.3.
[0858] To a stirred suspension of 7-aminoquinazolin-4-ol (2.00 g,
12.4 mmol) in conc. HCl (20.0 ml) at 0.degree. C. was added
dropwise NaNO.sub.2 (0.98 g, 14.3 mmol, 1.15 eq) as a solution in
H.sub.2O (15.0 ml). The resulting mixture was stirred at 0.degree.
C. for 1 h, and then treated with a solution of
SnCl.sub.2.2H.sub.2O (12.0 g, 53.4 mmol, 4.30 eq) in conc. HCl
(15.0 ml). The reaction was stirred at 0.degree. C. for 1 h and
then at RT for 2 h. The reaction was diluted with EtOH (130 ml) and
4,4-dimethyl-3-oxopentanenitrile (2.02 g, 16.1 mmol, 1.30 eq)
added, heated at reflux overnight, then cooled to RT and
concentrated. The residue was diluted with EtOAc (100 mL), placed
in an ice/H2O bath and the stirred solution made basic (pH 8) with
solid NaOH. The mixture was filtered through Celite.RTM., washed
with H.sub.2O (50 mL) and then EtOAc (100 mL). The organic phase
washed with brine, dried (Na.sub.2SO.sub.4) and concentrated to
yield a tan solid, which was dried then stirred in ether (100 mL)
and allowed to stand. The solid was collected by filtration and
dried to yield
7-(5-amino-3-t-butyl-1H-pyrazol-1-yl)quinazolin-4(3H)-one (1.69 g,
48% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): 8.17-8.11 (m, 2H),
7.90-7.83 (m, 2H), 5.47 (m, 3H), 1.23 (s, 9H). MS (ESI) m/e
(M+H.sup.+) 284.2.
[0859] Using general method A,
7-(5-amino-3-t-butyl-1H-pyrazol-1-yl)quinazolin-4(3H)-one (120 mg,
0.424 mmol) and 2,3-dichlorophenylisocyanate (79 mg, 0.487 mmol)
were combined to yield
1-(3-t-butyl-1-(4-oxo-3,4-dihydroquinazolin-7-yl)-1H-pyrazol-5-y-
l)-3-(2,3-dichlorophenyl)urea (102 mg, 51% yield) as a white solid.
.sup.1H NMR (300 MHz, DMSO-d.sub.6): 9.41 (s, 1H), 8.79 (s, 1H),
8.25-8.23 (s, 1H), 8.16 (s, 1H), 8.08-8.02 (m, 1H), 7.82-7.75 (m,
2H), 7.32-7.30 (m, 2H), 6.46 (s, 1H), 1.30 (s, 9H). MS (ESI) m/e
(M+H.sup.+) 471.0. ##STR621##
[0860] A mixture of formamide (14 g, 0.3 mol) and
2-amino-5-nitrobenzoic acid (9.1 g, 0.05 mol) was heated at
155.degree. C. for 7 h, cooled to RT and stirred overnight. The
mixture was diluted with H.sub.2O (30 mL) and filtered. The
resultant brown solid was dissolved in i-PrOH (300 mL), warmed to
reflux, cooled to RT and filtered and dried to yield
6-nitroquinazolin-4(3H)-one, (5.85 g, 61% yield). MS (ESI) m/e
(M+H.sup.+) 192.0
[0861] A mixture of 6-nitroquinazolin-4(3H)-one (4.15 g, 21.7 mmol)
and 10% Pd/C (0.3 g) in MeOH (25 mL) and THF (50 mL) was stirred
under H.sub.2 (1 atm) at 40.degree. C. for 18 h. The mixture was
diluted with DMF (50 mL), stirred overnight under H.sub.2, then
placed under an Ar atmosphere. After the addition of Pd/C (0.4 g),
the mixture was placed under an H.sub.2 atmosphere and warmed to
50.degree. C. and stirred for 4 h. The reaction mixture was
filtered through Celite.RTM., washed with warm DMF (75 mL) and the
combined filtrates evaporated to yield 6-aminoquinazolin-4(3H)-one
(3.10 g, 88% yield) as a yellow solid. MS (ESI) m/e (M+H.sup.+)
162.3
[0862] To a suspension of 6-aminoquinazolin-4(3H)-one (3.07 g, 19.0
mmol, 1.0 eq) in conc. HCl (30.0 ml) at 0.degree. C. was added
dropwise NaNO.sub.2 (1.51 g, 21.9 mmol, 1.15 eq) as a solution in
H.sub.2O (20.0 ml). The resulting mixture was stirred at 0.degree.
C. for 1 h, and then treated with a solution of
SnCl.sub.2.2H.sub.2O (18.5 g, 81.9 mmol, 4.30 eq) in conc. HCl
(20.0 ml). The reaction was stirred at 0.degree. C. for 1 h and
then at RT for 2 h. The reaction was diluted with EtOH (200 ml),
treated with 4,4-dimethyl-3-oxopentanenitrile (3.10 g, 24.8 mmol,
1.30 eq), heated at reflux overnight, then cooled to RT and
concentrated. The residue was diluted with EtOAc (100 mL), then
stirred in an ice/H2O bath and made basic (pH 8) with solid NaOH.
The mixture was filtered through Celite.RTM., washed with H.sub.2O
(50 mL) and then EtOAc (100 mL). The organic phase was washed with
brine, dried (Na.sub.2SO.sub.4) and concentrated to yield a yellow
solid, which was triturated from Et.sub.2O (100 ml) to yield
6-(5-amino-3-t-butyl-1H-pyrazol-1-yl)quinazolin-4(3H)-one (1.2 g,
22% yield). MS (ESI) m/e (M+H.sup.+) 284.2
[0863] Using general method A, the material from the previous
reaction (120 mg, 0.424 mmol) and 2,3-dichlorophenyl isocyanate (96
mg, 0.508 mmol) were combined to yield
1-(3-t-butyl-1-(4-oxo-3,4-dihydroquinazolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3-
-dichlorophenyl)urea as a tan solid (107 mg, 53% yield).
.sup.1H-NMR (DMSO-d.sub.6): .delta. 1.30 (s, 9H), 6.42 (s, 1H),
7.27-7.32 (m, 2H), 7.80-7.83 (m, 1H), 7.98-8.03 (m, 2H), 8.15 (s,
1H), 8.20-8.21 (m, 1H), 8.72 (s, 1H), 9.40 (br s, 1H). MS (ESI) m/e
(M+H.sup.+) 471.0 ##STR622##
[0864] Using general method D, Example A29 (0.25 g, 0.47 mmol) in
DMSO (2 mL) and Example A11 (0.13 g, 0.52 mmol) were combined to
yield
1-(3-t-butyl-1-(1-(2,2,2-trifluoroacetyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-
-(3-(8-methyl-7-oxo-6,7,8,8a-tetrahydropyrido[2,3-d]pyrimidin-6-yl)phenyl)-
urea, which was deprotected with 7N N.sub.3/MeOH (2 mL) at room
temperature for 2 h. Water (10 mL) was added and the mixture was
extracted with CH.sub.2Cl.sub.2 (3.times.20 mL). The organic
extracts were dried (MgSO.sub.4), concentrated and purified by
column chromatography to yield
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(3-(8-methyl-7-oxo-7,8-d-
ihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (0.20 g, 79% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.22 (s, 1H), 9.16 (s,
1H), 9.11 (s, 1H), 8.23 (s, 1H), 8.17 (s, 1H), 7.83 (t, J=1.6 Hz,
1H), 7.44 (m, 1H), 7.37 (t, J=8.0 Hz, 1H), 7.30 (m, 1H), 7.08 (brs,
1H), 6.96 (dd, J=2.0, and 8.0 Hz, 1H), 6.58 (d, J=8.4 Hz, 1H), 6.32
(s, 1H), 5.81 (brs, 1H), 3.71 (s, 3H), 3.49 (brt, J=8.4 Hz, 2H),
2.98 (t, J=8.4 Hz, 2H), 1.25 (s, 9H); LC-MS (EI) m/z: 535.2
(M+H.sup.+). To a solution of this material (30 mg, 0.06 mmol) in
EtOAc (1 mL) was added 3M HCl/EtOAc (21 .quadrature.L). The solid
was filtered and dried under vacuum to obtain
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(3-(8-methyl-7-oxo-7,8-d-
ihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea (31 mg, 97% yield) as
the HCl salt. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.32
(brs, 1H), 9.16 (s, 1H), 9.12 (s, 1H), 8.47 (brs, 1H), 8.17 (s,
1H), 7.83 (t, J=1.6 Hz, 1H), 7.45 (m, 1H), 7.37 (brs, 1H), 7.36 (t,
J=8.0 Hz, 1H), 7.29 (m, 1H), 7.28 (brs, 1H), 7.08 (brs, 1H), 6.37
(s, 1H), 3.71 (s, 3H), 3.65 (m, 2H), 3.14 (m, 2H), 1.27 (s, 9H);
LC-MS (EI) m/z: 535.2 (M+H.sup.+). ##STR623##
[0865] Using the same procedure as for Example 108, Example 196
(170 mg, 0.32 mmol) and methanesulfonyl chloride (73 mg, 0.64 mmol)
were combined to yield
11-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl-
)-3-(3-(8-methyl-7-oxo-7,8-dihydropyrido[2,3-d]pyrimidin-6-yl)phenyl)urea
(60 mg, 31% yield) as a pale yellow solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.18 (brs, 1H), 9.16 (s, 1H), 9.12 (s, 1H),
8.41 (brs, 1H), 8.17 (s, 1H), 7.84 (t, J=2.0 Hz, 1H), 7.46 (m, 1H),
7.42 (d, J=1.2 Hz, 1H), 7.36 (m, 4H), 7.30 (dt, J=1.6, and 7.6 Hz,
1H), 6.38 (s, 1H), 4.02 (t, J=8.4 Hz, 2H), 3.71 (s, 3H), 3.20 (t,
J=8.4 Hz, 2H), 1.27 (s, 9H); LC-MS (EI) m/z: 613.3 (M+H.sup.+).
##STR624##
[0866] Using general method D, Example A35 (0.12 g, 0.4 mmol) and
1-Aminonaphthalene (0.034 g, 0.23 mmol) were combined to yield
1-(3-t-butyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyrazol-5-yl)-3-
-(naphthalen-1-yl)urea (36 mg, 19% yield, 2 steps). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 10.3 (s, 1H), 9.04 (s, 1H), 8.76
(s, 1H), 8.00 (d, J=7.6 Hz, 1H), 7.92 (m, 2H), 7.65 (d, J=8.4 Hz,
1H), 7.54 (m, 2H), 7.46 (t, J=8.0 Hz, 1H), 7.35 (d, J=2.4 Hz, 1H),
7.32 (dd, J=2.4, and 8.0 Hz, 1H), 7.01 (d, J=8.4 Hz, 1H), 6.39 (s,
1H), 2.98 (t, J=6.8 Hz, 1H), 1.28 (s, 9H); MS (EI) m/z: 454.2
(M+H.sup.+). ##STR625##
[0867] Using general method D, Example A38 (0.20 g, 0.54 mmol) and
(S)-aminoindane (0.035 g, 0.26 mmol) were combined to yield
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-((-
S)-2,3-dihydro-1H-inden-1-yl)urea HCl salt (82 mg, 53% yield, 2
steps). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.51 (brs,
2H), 8.32 (m, 1H), 7.23 (m, 5H), 7.07 (m, 1H), 6.47 (brs, 1H), 6.23
(s, 1H), 5.09 (m, 1H), 4.30 (m, 2H), 3.37 (m, 2H), 3.07 (brt, J=4.8
Hz, 2H), 2.90 (m, 1H), 2.76 (m, 1H), 2.38 (m, 1H), 1.71 (m, 1H),
1.27 (s, 9H); MS (EI) m/z: 430.2 (M+H.sup.+). ##STR626##
[0868] Using the same procedure as for Example 108, Example 145
(0.14 g, 0.3 mmol) was transformed
1-(3-t-butyl-1-(2-(methylsulfonyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-
-pyrazol-5-yl)-3-(2,4-difluorophenyl)urea (60 mg, 40% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 8.88 (brs, 1H), 8.77
(s, 1H), 8.04 (m, 1H), 7.31 (m, 4H), 7.02 (m, 1H), 6.38 (s, 1H),
4.43 (s, 2H), 3.46 (t, J=6.0 Hz, 2H), 3.00 (t, J=6.0 Hz, 2H), 2.98
(s, 3H), 1.25 (s, 9H); LC-MS (EI) m/z: 504.2 (M+H.sup.+).
##STR627##
[0869] To a stirred suspension of Example 106 (20 mg, 0.045 mmol)
and Et.sub.3N (6.8 mg, 0.068 mmol) in CH.sub.2Cl.sub.2 (2.0 ml) was
added triflic anhydride (14 mg, 0.051 mmol) at -78.degree. C. which
was stirred for 30 min. The reaction was quenched with saturated
NaHCO.sub.3 and allowed to warm to RT. The mixture was diluted with
EtOAc and the organic layer was washed with NH.sub.4Cl,
NaHCO.sub.3, brine, and dried (MgSO.sub.4), and concentrated under
reduced pressure to obtain
1-(3-t-butyl-1-(1-(trifluoromethylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-
-3-(2,3-dichlorophenyl)urea as a pale yellow solid (20 mg, 100%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.22 (s, 1H),
8.74 (brs, 1H), 8.04 (dd, J=4.4, and 5.6 Hz, 1H), 7.54 (brs, 1H),
7.43 (d, J=2.4 Hz, 1H), 7.42 (s, 1H), 7.32 (d, J=1.6 Hz, 1H), 6.39
(s, 1H), 4.30 (t, J=8.4 Hz, 2H), 3.33 (s, 2H), 3.32 (t, J=8.4 Hz,
2H), 1.27 (s, 9H); LC-MS (EI) m/z: 576.2 (M+H.sup.+).
##STR628##
[0870] A solution of Example A57 (415 mg, 1.23 mmol) in THF (4 mL)
of THF was cooled to -78.degree. C. and treated with sodium
bis(trimethylsilylamide) (11.0M in THF, 2.6 mL, 2.6 mmol). The
reaction mixture was stirred for 30 min at -78.degree. C. Methyl
iodide (0.090 mL, 1.47 mmol) was added and the reaction mixture was
allowed to slowly warm to 0.degree. C. over 90 min. The reaction
was partitioned between saturated aqueous NH.sub.4Cl (10 mL) and
EtOAc (30 mL). The organic layer was washed with H.sub.2O (10 mL)
and brine (10 mL). The combined aqueous washes were extracted with
ether (10 mL). All organics were combined, dried (Na.sub.2SO.sub.4)
and purified via column chromatography to yield ethyl
2-(4-(5-amino-3-t-butyl-1H-pyrazol-1-yl)phenyl)propanoate (99 mg,
26% yield). MS (ESI) m/z: 316.3 (M+H.sup.+).
[0871] Using general method A, the material from the previous step
(97 mg, 0.31 mmol) and 2,3-dichlorophenyl isocyanate (0.061 mL,
0.46 mmol) were combined to yield ethyl
2-(4-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)phenyl)p-
ropanoate (89 mg, 57% yield) as a foam. MS (ESI) m/z: 503.3
(M+H.sup.+).
[0872] Using general method E, the material from the previous step
(84 mg, 0.17 mmol) was saponified to yield
2-(4-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)phenyl)p-
ropanoic acid (67 mg, 84% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 12.42 (brs, 1H), 9.32 (s, 1H), 8.81 (s, 1H),
8.09 (m, 1H), 7.49-7.43 (m, 4H), 7.35-7.29 (m, 2H), 6.39 (s, 1H),
3.77 (q, J=7.2 Hz, 1H), 1.41 (d, J=7.2 Hz, 3H), 1.27 (s, 9H); MS
(ESI) m/z: 475.2 (M+H.sup.+). ##STR629##
[0873] A solution of Example 202 (51 mg, 0.11 mmol) in DMF (1.5 mL)
was treated with ammonia (0.5M in dioxane, 1.5 mL, 0.75 mmol).
PyBOP (80 mg, 0.15 mmol) was added and the resultant solution was
stirred overnight at RT. Water (10 mL) was added and the
precipitate was filtered and further purified via column
chromatography to yield
1-(1-(4-(1-amino-1-oxopropan-2-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2-
,3-dichlorophenyl)urea (42 mg, 83% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.31 (s, 1H), 8.82 (s, 1H), 8.10 (m, 1H),
7.50-7.43 (m, 5H), 7.35-7.29 (m, 2H), 6.88 (s, 1H), 6.39 (s, 1H),
3.66 (q, J=7.2 Hz, 1H), 1.36 (d, J=7.2 Hz, 3H), 1.27 (s, 9H); MS
(ESI) m/z: 474.0 (M+H.sup.+). ##STR630##
[0874] To a solution of 3-hydroxy phenethylamine hydrochloride
(0.500 g, 2.88 mmol) in ethanol (10 mL) was added ethyl glyoxylate
(50% in toluene, 1.18 g, 5.76 mmol) and the mixture was heated at
80.degree. C. for 2 h. The solution was cooled to RT and
triethylamine (0.874 g, 4.32 mmol) and Boc anhydride (0.943 g, 4.32
mmol) were added and the resulting solution was stirred at RT for 1
h. Evaporation of the solvent and column chromatography yielded
2-t-butyl 1-ethyl
6-hydroxy-3,4-dihydroisoquinoline-1,2(1H)-dicarboxylate (720 mg,
78% yield) as a colorless foam. .sup.1H NMR (400 MHz, CDCl.sub.3):
.delta. 7.35 (t, J=8.0 Hz, 1H), 6.69 (d, J=8.4 Hz, 1H), 6.63 (s,
1H), 5.49 (s, 0.4H), 5.33 (s, 0.6H), 4.95 (brs, 0.6H), 4.93 (brs,
0.4H), 4.17-4.10 (m, 2H), 3.77-3.69 (m, 2H), 2.93-2.75 (m, 2H),
1.49 (s, 4H), 1.47 (s, 5H), 1.28-1.21 (m, 3H); MS (ESI) m/z:
[0875] 344.3 (M+Na.sup.+).
[0876] To a solution of the material from the previous step (0.770
g, 2.240 mmol) in CH.sub.2Cl.sub.2 (10 mL) was added triethylamine
(0.401 mL, 0.291 g, 2.88 mmol) and triflic chloride (0.306 mL,
0.485 g, 2.88 mmol) and the resulting solution was stirred at RT
for 3 h. Water was added (50 mL) and the mixture was extracted with
CH.sub.2Cl.sub.2 (3.times.50 mL), dried (MgSO.sub.4) and
concentrated to yield 2-t-butyl 1-ethyl
6-(trifluoromethylsulfonyloxy)-3,4-dihydroisoquinoline-1,2(1H)-di-
carboxylate (1.05 g, 97% yield) of the crude product as a colorless
oil which was used without further purification. .sup.1H NMR (400
MHz, CDCl.sub.3): .delta. 7.61 (d, J=8.8 Hz, 0.4H), 7.60 (d, J=8.8
Hz, 0.6H), 7.13 (d, J=8.4 Hz, 1H), 5.62 (s, 0.4H), 5.44 (s, 0.6H),
4.18 (q, J=7.0 Hz, 2H), 3.96-3.83 (m, 1H), 3.73-3.64 (m, 1H),
3.15-3.09 (m, 1H), 2.96-2.89 (m, 2H), 1.53 (s, 4H), 1.47 (s, 5H),
1.29-1.23 (m, 3H); MS (ESI) m/z: 476.0 (M+Na.sup.+).
[0877] To a degassed solution of the material from the previous
step (1.05 g, 2.32 mmol), bis(pinacolato)diboron (0.882 g, 3.47
mmol), and potassium acetate (0.682 g, 6.95 mmol) in DMF (10 mL)
was added PdCl.sub.2(dppf) (0.095 g, 0.116 mmol) and the resulting
mixture was stirred at 80.degree. C. for 3 h. Water was added (100
mL) and the mixture was extracted with EtOAc (3.times.100 mL),
dried (MgSO.sub.4), concentrated and purified via column
chromatography to yield 2-t-butyl 1-ethyl
6-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-3,4-dihydroisoqui-
noline-1,2(1H)-dicarboxylate (935 mg, 94% yield) as a colorless
oil. .sup.1H NMR (400 MHz, CDCl.sub.3): .delta. 7.65 (d, 1H, J=7.6
Hz), 7.61 (s, 0.6H), 7.60 (s, 0.4H), 7.50 (t, J=8.8 Hz, 1H), 5.58
(s, 0.4H), 5.42 (s, 0.6H), 4.14 (q, J=7.2 Hz, 2H), 3.79-3.73 (m,
2H), 2.98-2.84 (m, 2H), 1.49 (s, 4H), 1.47 (s, 5H), 1.34 (s, 12H),
1.20 (t, J=7.6 Hz, 3H); MS (ESI) m/z: 454.2 (M+Na.sup.+).
[0878] To a solution of the material from the previous step (0.900
g, 2.09 mmol) in acetone/water 4:1 was added sodium periodate (1.34
g, 6.26 mmol) and the resulting slurry was stirred at RT for 30
min. 2N HCl was added (2.09 mL, 4.17 mmol) and the resulting
mixture was stirred at RT overnight. Water was added (100 mL) and
the mixture was extracted with EtOAc (3.times.100 mL), dried
(MgSO.sub.4) and concentrated to yield
2-(t-butoxycarbonyl)-1-(ethoxycarbonyl)-1,2,3,4-tetrahydroisoquinolin-6-y-
lboronic acid (670 mg, 92% yield) as a brown solid which was used
without further purification. MS (ESI) m/z: 372.3 (M+Na.sup.+).
##STR631##
[0879] To a solution of Example A31 (0.075 g, 0.229 mmol), Example
A57 (0.100 g, 0.286 mmol) and pyridine (0.054 g, 0.688 mmol) in
CH.sub.2Cl.sub.2 (5 mL) was added copper(II)-acetate (0.062 g,
0.688 mmol) and the resulting green solution was stirred at RT
until all starting material was consumed. Water was added (100 mL)
and the mixture was extracted with CH.sub.2Cl.sub.2 (3.times.50
mL), dried (MgSO.sub.4), concentrated and purified via column
chromatography to yield 2-t-butyl 1-ethyl
6-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-3,-
4-dihydroisoquinoline-1,2(1H)-dicarboxylate (85 mg, 59% yield) as a
colorless foam. .sup.1H NMR (400 MHz, CDCl.sub.3): .delta. 8.62
(brs, 1H), 8.25 (d, J=8.0 Hz, 1H), 8.19 (brs, 1H), 7.65 (d, J=8.4
Hz, 0.5H), 7.61 (d, J=8.4 Hz, 0.5H), 7.49-7.44 (m, 2H), 7.31 (t,
J=8.2 Hz, 1H), 7.24 (dd, J=7.6, and 1.6 Hz, 1H), 6.49 (s, 1H), 5.58
(s, 0.5H), 5.51 (s, 0.5H), 4.21-4.14 (m, 2H), 3.88-3.78 (m, 1H),
3.75-3.63 (m, 1H), 2.99-2.90 (m, 2H), 1.48 (s, 4H), 1.46 (s, 5H),
1.32 (s, 9H), 1.26-1.21 (m, 3H); MS (ESI) m/z: 630.2 (M+H.sup.+).
##STR632##
[0880] A solution of Example A58 (0.080 g, 0.130 mmol) in 3N
hydrochloric acid in methanol (10.0 mL) was stirred at RT for 1 h.
The solvent was evaporated and the residue was dissolved in 8N
methylamine in ethanol (3 mL) and the solution was stirred at
50.degree. C. overnight. The solvent was evaporated and the residue
was purified by reverse phase chromatography and coevaporated with
THF/4N HCl to yield
1-(3-t-butyl-1-(1-(methylcarbamoyl)-1,2,3,4-tetrahydroisoquinolin-6-yl)-1-
H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea (43 mg, 59% yield) of as
a colorless solid. .sup.1H NMR (400 MHz, CD.sub.3OD): .delta. 8.03
(t, J=5.0 Hz, 1H), 7.64-7.58 (m, 3H), 7.28-7.27 (m, 2H), 6.60 (s,
1H), 5.23 (s, 1H), 3.88-3.81 (m, 1H), 3.56-3.50 (m, 1H), 3.30-3.15
(m, 2H), 2.90 (s, 3H), 1.39 (s, 9H); MS (ESI) m/z: 515.0
(M+H.sup.+). ##STR633##
[0881] Using general method E, Example A58 (0.280 g, 0.444 mmol)
was saponified to yield
2-(t-butoxycarbonyl)-6-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyr-
azol-1-yl)-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid (234
mg, 88% yield) as an off-white foam. MS (ESI) m/z: 602.2
(M+H.sup.+). A solution of this material (0.065 g, 0.11 mmol) was
stirred in 4N hydrogen chloride in dioxane (5 mL) for 1 h.
Evaporation of the solvent and purification via reverse phase
chromatography and co-evaporation with HCl/ethanol (2.times.100 mL)
yielded (25 mg, 43% yield) of the desired product as its
hydrochloride. .sup.1H NMR (400 MHz, CD.sub.3OD): .delta. 8.05 (t,
J=5.0 Hz, 1H), 7.59-7.56 (m, 2H), 7.52 (d, J=8.4 Hz, 1H), 7.27-7.26
(m, 2H), 6.69 (s, 1H), 4.62 (d, J=16.4 Hz, 1H), 4.54 (d, J=14.4 Hz,
1H), 4.50 (dd, J=11.2, and 4.8 Hz, 1H), 3.59-3.56 (m, 1H),
3.38-3.30 (m, 1H), 1.40 (s, 9H), urea, acid and amine protons not
visible; MS (ESI) m/z: 502.0 (M+H.sup.+).
General Experimental for Examples: 206-213
[0882] Example A3 and the appropriate aniline were combined as
indicated. TABLE-US-00007 MS (EI) .sup.1H NMR (400 MHz), (acetone-
Example Name (M + H.sup.+) d.sub.6) ##STR634## 1-(3-t-butyl-1-(3-
cyanophenyl)-1H- pyrazol-5-yl)-3-(3,4- difluorophenyl)urea 168 mg,
88%, yield General method D 369.3 .delta. 8.63 (brs, 1H), 8.04-8.02
(m, 1H), 8.03 (brs, 1H), 7.98 (dt, J=7.6, and 1.8 Hz, 1H), 7.75
(dt, J=7.6, and 1.4 Hz, 1H), 7.71 (t, J=7.6 Hz, 1H), 7.68-7.63 (m,
1H), 7.23-7.17 (m, 1H), 7.13-7.09 (m, 1H), 6.44 (s, 1H), 1.32 (s,
9H) ##STR635## 1-(3-t-butyl-1-(3- cyanophenyl)-1H- pyrazol-5-yl)-3-
(2,4,5- trifluorophenyl)urea 138 mg, 69% yield General method D
413.7 .delta. 8.45 (brs, 1H), 8.38 (brs 1H), 8.25-8.18 (m, 1H),
8.04 (t, J =1.8 Hz, 1H), 7.98 (dt, J 8.0, and 1.8 Hz, 1H), 7.77
(dt, J=8.8, and 1.4 Hz, 1H), 7.72 (t, J=8.0 Hz, 1H), 7.34-7.27 (m,
1H), 6.49 (s, 1H), 1.32 (s, 9H) ##STR636## 1-(3-t-butyl-1-(3-
cyanophenyl)-1H- pyrazol-5-yl)-3-(3,5- difluorophenyl)urea 165 mg,
87% yield General method D 396.3 .delta. 8.82 (brs, 1H), 8.09 (brs,
1H), 8.03 (t, J=7.2 Hz, 1H), 7.97 (dt,J=7.6, and 1.6 Hz, 1H), 7.76
(dt, J=7.6, and 1.6 Hz, 1H), 7.71 (t, J=7.6 Hz, 1H), 7.19-7.13 (m,
2H), 6.62 (dt, J=9.4, and 2.2 Hz, 1H), 6.45 (s, 1H), 1.32 (s, 9H)
##STR637## 1-(3-t-butyl-1-(3- cyanophenyl)-1H- pyrazol-5-yl)-3-
(2,3,5- trifluorophenyl)urea 66 mg, 51% yield General method D
414.0 .delta. 8.69 (brs, 1H), 8.48 (brs, 1H), 8.05 (t, J=1.6 Hz,
1H), 7.99 (dt, J=8.0, and 2.0 Hz, 1H), 7.96-7.90 (m, 1H), 7.77 (dt,
J=7.6, and 1.4 Hz, 1H), 7.72 (t, J=7.6 Hz, 1H), 6.89-6.82 (m, 1H),
6.50 (s, 1H), 1.33 (s, 9H) ##STR638## 1-(3-t-butyl-1-(3-
cyanophenyl)-1H- pyrazol-5-yl)-3- (2,3,4- trifluorophenyl)urea 141
mg, 71% yield General method D 414.0 .delta. 8.41 (brs, 1H), 8.34
(brs, 1H), 8.04 (t, J=1.6 Hz, 1H), 7.98 (dt, J=8.0, and 2.0 Hz,
1H), 7.97-7.87 (m, 1H), 7.77 (dt, J=7.6, and 1.4 Hz, 1H), 7.72 (t,
J=7.2 Hz, 1H), 7.17-7.10 (m, 1H), 6.47 (s, 1H), 1.32 (s, 9H)
##STR639## 1-[3-t-butyl-1-(3- cyanophenyl)-1H-
pyrazol-5-yl]-3-((S)- 1-phenylethyl)urea 55 mg, 28% yield General
method B 388.1 .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 8.17
(s, 1H), 7.92 (s, 1H), 7.85-7.78 (m, 2H), 7.65 (m, 1H), 7.31-7.18
(m, 5H), 7.00 (d, J=8.1 Hz, 1H), 6.24 (s, 1H), 4.69 (m, 1H), 1.31
(d, J=6.9 Hz, 3H), 1.21 (s, 9H) ##STR640## 1-(3-t-butyl-1-(3-
cyanophenyl)-1H- pyrazol-5-yl)-3-(2,4- difluorophenyl)urea 165 mg,
87% yield General method D 396.3 .delta. 8.30 (brs, 1H), 8.25 (brs,
1H), 8.18-8.10 (m, 1H), 8.04 (t, J=1.8 Hz, 1H), 7.99 (dt, J=8.0,
and 2.0 Hz, 1H), 7.76 (dt, J=8.0, and 1.4 Hz, 1H), 7.72 (t, J=7.6
Hz, 1H), 7.06 (ddd, J=11.6, 8.8, and 2.8 Hz, 1H), 6.99-6.94 (m,
1H), 6.47 (s, 1H), 1.32 (s, 9H) ##STR641## 1-(3-t-butyl-1-(3-
cyanophenyl)-1H- pyrazol-5-yl)-3-(2,5- difluorophenyl)urea 91 mg,
48% yield General method D 396.3 .delta. 8.48 (brs, 1H), 8.44 (brs,
1H), 8.12-8.07 (m, 1H), 8.05 (t, J=1.6 Hz, 1H), 7.99 (dt, J=8.0,
and 2.0 Hz, 1H0, 7.77 (dt, J=8.0, and 1.6 Hz, 1H), 7.72 (t, J=8.0
Hz, 1H), 7.20-7.14 (m, 1H), 6.79-6.73 (m, JH), 6.51 (s, 1H), 1.33
(s, 9H)
[0883] ##STR642##
[0884] To a solution of Example 207 (0.092 g, 0.22 mmol) in dry
ethanol (2 mL) was at -78.degree. C. added acetyl chloride (1.1 g,
14 mmol) and the resulting solution was kept at RT overnight. The
solvent was evaporated and to the residue was added 7N ammonia in
methanol (2 mL) and the mixture was stirred at RT overnight. The
solvent was evaporated and the residue was purified by
reverse-phase chromatography, which was followed by an additional
basic extraction and reacidification with HCl to yield
1-(3-t-butyl-1-(3-carbamimidoylphenyl)-1H-pyrazol-5-yl)-3-(2,4,5-
-trifluorophenyl)urea (45 mg, 43% yield) as a white solid. .sup.1H
NMR (400 MHz, CD.sub.3OD): .delta. 8.05 (t, J=1.6 Hz, 1H),
8.02-7.92 (m, 3H), 7.83 (t, J=8.0 Hz, 1H), 7.23 (dt, J=10.8, and
7.2 Hz, 1H), 6.60 (s, 1H), 1.39 (s, 9H), amidine and urea protons
not visible; MS (ESI) m/z: 431.0 (M+H.sup.+). ##STR643##
[0885] Dry urea (3.0 g) was added to a solution of NaOMe (0.1 mol,
in 50 mL of MeOH) at RT, stirred for 30 min, after which diethyl
oxalate (7.0 g) was slowly added. The mixture was stirred for 1 h,
conc. HCl (10 mL) was added and the solution stirred for 10 min.
After filtration, the residue was washed twice with a small
quantity of MeOH, and the combined filtrates were concentrated to
yield imidazolidine-2,4,5-trione as a white solid which was used
without further purification. .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta.11.8 (s, 2H). ##STR644##
[0886] To a solution of NaOMe (0.15 mol, in 60 mL of MeOH) was
added 7.2 g of sulfamide at RT. The resulting mixture was stirred
for 30 min, after which dimethyl oxalate (11.0 g) was added. The
suspension was heated at reflux for 16 h, cooled, filtered, the
precipitate washed with MeOH, and dried under vacuum to yield
1,2,5-thiadiazolidine-3,4-dione 1,1-dioxide as the disodium salt
(12.2 g). .sup.13C-NMR (300 MHz, D.sub.2O): .delta. 173 (s, 2C).
##STR645##
[0887] Using general method A, Example A1 (143 mg, 0.5 mmol) and
1-fluoro-2-isocyanato-benzene (67 mg, 0.5 mmol) were combined to
afford ethyl
3-{3-t-butyl-5-[3-(2-fluorophenyl)ureido]-1H-pyrazol-1-}benzoate
(40 mg, 19% yield). ##STR646##
[0888] Using general method B, Example A1 (143 mg, 0.5 mmol) and
2,3-difluorophenylamine (67 mg, 0.5 mmol) were combined to afford
ethyl
3-{3-t-butyl-5-[3-(2,3-difluorophenyl)ureido]-1H-pyrazol-1-yl}benzoate
(50 mg, 23% yield). ##STR647##
[0889] Using general method A, Example A1 (500 mg, 1.74 mmol) and
5-isocyanato-benzo[1,3]dioxole (290 mg, 1.8 mmol) were combined to
afford ethyl
3-{5-[3-(benzo[d][1,3]dioxo-5-yl)ureido]-3-t-butyl-1H-pyrazol-1-yl}-
benzoate (320 mg, 41% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 8.73 (s, 1H), 8.34 (s, 1H), 8.03 (s, 1H), 7.92 (d, J=8.4
Hz, 1H), 7.78 (d, J=7.8 Hz, 1H), 7.63 (t, J=7.8 Hz, 1H), 7.09 (s,
1H), 6.76 (d, J=8.1 Hz, 2H), 6.68 (d, J=8.4 Hz, 1H), 6.32 (s, 1H),
5.92 (s, 2H), 4.29 (q, J=6.9 Hz, 2H), 1.28 (s, 9H), 1.26 (t, J=6.9
Hz, 3H); MS (ESI) m/z: 451 (M+H.sup.+). ##STR648##
[0890] Using general method A, Example A1 (10.7 g, 70.0 mmol) and
4-nitrophenyl 4-chlorophenylcarbamate (10 g, 34.8 mmol) were
combined to yield ethyl
3-{3-t-butyl-5-[3-(4-chlorophenyl)ureido]-1H-pyrazol-1-yl}benzoate
(8.0 g, 52% yield). .sup.1H NMR (DMSO-d.sub.6): .delta. 9.11 (s,
1H), 8.47 (s, 1H), 8.06 (m, 1H), 7.93 (d, J=7.6 Hz, 1H), 7.81 (d,
J=8.0 Hz, 1H), 7.65 (dd, J=8.0, 7.6 Hz, 1H), 7.43 (d, J=8.8 Hz,
2H), 7.30 (d, J=8.8 Hz, 2H), 6.34 (s, 1H), 4.30 (q, J=6.8 Hz, 2H),
1.27 (s, 9H), 1.25 (t, J=6.8 Hz, 3H); MS (ESI) m/z: 441
(M.sup.++H). ##STR649##
[0891] Using General method C, Example 215 (35 mg, 0.083 mmol) was
reduced to afford
1-{3-t-butyl-1-[3-(hydroxymethyl)phenyl]-1H-pyrazol-5-yl}-3-(2-fluorophen-
yl)urea (20 mg, 63% yield). .sup.1H-NMR (300 MHz, DMSO-d.sub.6):
.delta. 8.90 (br s, 1H), 8.81 (s, 1H), 8.08 (t, J=6.3 Hz, 1H),
7.48-6.98 (m, 7H), 6.36 (s, 1H), 5.30 (t, J=5.7 Hz, 1H), 4.55 (d,
J=5.7 Hz, 1H), 1.22 (s, 9H); MS (ESI) m/z: 383 (M+H.sup.+).
##STR650##
[0892] Using General method C, Example 216 (45 mg, 0.10 mmol) was
reduced to afford
1-{3-t-butyl-1-[3-(hydroxymethyl)phenyl]-1H-pyrazol-5-yl}-3-(2,-
3-difluorophenyl)urea (30 mg, 75% yield). .sup.1H-NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.08 (s, 1H), 8.85 (s, 1H), 7.88 (t, J=7.5
Hz, 1H), 7.48-7.42 (m, 2H), 7.33 (d, J=7.5 Hz, 2H), 7.13-6.95 (m,
2H), 6.36 (s, 1H), 4.55 (s, 1H), 1.24 (s, 9H); MS (ESI) m/z: 401
(M+H.sup.+). ##STR651##
[0893] Using General method C, Example 217 (100 mg, 0.22 mmol) was
reduced to afford
1-(benzo[d][1,3]dioxol-5-yl)-3-(3-t-butyl-1-(3-(hydroxymethyl)phenyl)-1H--
pyrazol-5-yl)urea (50 mg, 56% yield). .sup.1H NMR (300 MHz,
CD.sub.3OD): .delta. 7.52-7.47 (m, 4H), 7.02 (s, 1H), 6.65-6.69 (m,
2H), 6.41 (s, 1H), 5.89 (s, 2H), 4.69 (s, 2H), 1.33 (s, 9H); MS
(ESI) m/z: 409 (M+H.sup.+). ##STR652##
[0894] To a solution of CuI (1 mol %), 1,10-phenanthroline (10 mol
%), Cs.sub.2CO.sub.3 (9.8 g, 30 mmol) and DMF (20 mL) was added
t-butyl carbazate (3.4 g, 25 mmol), 3-iodobenzyl alcohol (5.0 g, 21
mmol). The reaction mixture was heated at 80.degree. C. for 2 h.
The reaction mixture was filtered through a pad of silica gel and
the filtrate was evaporated under reduced pressure to obtain crude
product, 1-Boc-1-(3-carbinol)phenylhydrazine as yellow oil. The
product was used for the next reaction without further
purification.
[0895] To a solution of 1-Boc-1-(3-carbinol)phenylhydrazine (2.0 g,
8.4 mmol) in absolute ethanol (30 mL) at RT was added conc. HCl
(3.5 mL, 42 mmol). The reaction mixture was stirred at 60.degree.
C. for 30 min. Pivaloylacetonitrile (1.3 g, 10 mmol) was added into
the reaction mixture, which was heated at 90.degree. C. for 3 h.
The solvent was evaporated under reduced pressure and the residue
was dissolved in water and lyophilized to obtain the crude product
[3-(5-amino-3-t-butyl-1H-pyrazol-1-yl)phenyl]methanol as the HCl
salt. The product was used for the next step without further
purification. .sup.1H-NMR (DMSO-d.sub.6): .delta. 7.4-7.6 (m, 4H),
5.62 (br s, 1H), 4.59 (s, 2H), 1.29 (s, 9H).
[0896] To a solution of
[3-(5-amino-3-t-butyl-1H-pyrazol-1-yl)phenyl]methanol hydrochloride
salt (2.0 g, 7.1 mmol) in DMF (20 mL) was added imidazole (2.7 g,
39 mmol) and TBSCl (2.1 g, 14 mmol), which was stirred at RT for 8
h. The reaction mixture was quenched with water and extracted with
EtOAc (3.times.). Organic extracts were washed with NaHCO.sub.3,
H.sub.2O and 10% LiCl solution. The combined organic extracts were
washed with brine, dried (Na.sub.2SO.sub.4), filtered, concentrated
and purified via column chromatography to yield
3-t-butyl-1-(3-[(t-butylmethylsilyloxy)methyl]phenyl}-1H-pyrazol-5-amine
in 36% yield (for three steps): .sup.1H-NMR (CDCl.sub.3): .delta.
7.3-7.6 (m, 4H), 5.54 (s, 1H), 4.80 (s, 2H), 1.34 (s, 9H), 0.97 (s,
9H), 0.13 (s, 6H); MS (EI) m/z: 360 (M+1H.sup.+). ##STR653##
[0897] To a solution of Example A61 (100 mg, 0.18 mmol) in THF (2
mL) was added pyridine (45 mL, 0.56 mmol) and 3-chlorophenyl
isocyanate (43 mg, 0.18 mmol). The reaction mixture was stirred at
RT for 20 min, heated until all solids were dissolved, and stirred
at RT for 4 h. The reaction mixture was concentrated under reduced
pressure to yield
1-(3-t-butyl-1-{3-[(t-butyldimethylsilyloxy)methyl]phenyl}-1H-pyrazol-5-y-
l)-3-(3-chlorophenyl)urea (62 mg, 43% yield).
[0898] To a solution of
1-(3-t-butyl-1-{3-[(t-butyldimethylsilyloxy)methyl]phenyl}-1H-pyrazol-5-y-
l)-3-(3-chlorophenyl)urea (120 mg, 0.12 mmol) in THF (2 mL) was
added TBAF (1.0 M, 0.13 mL, 0.13 mmol). The reaction mixture was
stirred at RT for 2.5 h. The solvent was removed under reduced
pressure. EtOAc was added into the residue followed by 1N--HCl (5
drops). The combined organic extracts were washed with brine, dried
(Na.sub.2SO.sub.4), filtered, concentrated and purified via column
chromatography to yield
1-(3-t-butyl-1-(3-hydroxymethyl)phenyl)-1H-pyrazol-5-yl)-3-(3-chloropheny-
l)urea as a white powder (34 mg, 71% yield). .sup.1H-NMR
(CDCl.sub.3): .delta. 8.11 (s, 1H), 7.34 (t, J=2.0 Hz, 1H),
7.05-7.25 (m, 7H), 6.99 (dt, J=1.3, and 7.8 Hz, 1H), 6.39 (s, 1H),
4.39 (s, 2H), 1.33 (s, 9H); MS (EI) m/z: 399 (M+H.sup.+).
##STR654##
[0899] Using the same procedure as for Example 222, Example A61
(100 mg, 0.28 mmol) and 3-bromophenyl isocyanate (55 mg, 0.28 mmol)
were combined to yield
1-{3-t-butyl-1-[3-(hydroxymethyl)phenyl]-1H-pyrazol-5-yl}-3-(3-b-
romophenyl)urea as a white powder (19 mg, 15% yield). .sup.1H-NMR
(CDCl.sub.3): .delta. 8.17 (s, 1H), 7.47 (t, J=1.8 Hz, 1H), 7.34
(s, 1H), 7.00-7.25 (m, 7H), 6.39 (s, 1H), 4.37 (s, 2H), 1.32 (s,
9H); MS (EI) m/z: 443 and 445 (M+ and M.sup.++2H.sup.+).
##STR655##
[0900] To a stirred solution of Example 218 (1.60 g, 3.63 mmol) in
THF (200 mL) was added LiAlH.sub.4 powder (413 mg, 10.9 mmol) at
-10.degree. C. under N.sub.2. The mixture was stirred for 2 h and
excess LiAlH.sub.4 was quenched by adding ice. The solution was
acidified to pH=7 with dilute HCl. Solvents were slowly removed and
the solid was filtered and washed with EtOAc (200+100 mL). The
filtrate was concentrated to yield
1-{3-t-butyl-1-[3-hydroxymethyl)phenyl]-1H-pyrazol-5-yl}-3-(4-chloropheny-
l)urea (1.40 g, 97% yield). .sup.1H NMR (DMSO-d.sub.6): .delta.
9.11 (s, 1H), 8.47 (s, 1H), 7.47-7.27 (m, 8H), 6.35 (s, 1H), 5.30
(t, J=5.6 Hz, 1H), 4.55 (d, J=5.6 Hz, 2H), 1.26 (s, 9H); MS (ESI)
m/z: 399 (M+H.sup.+). ##STR656##
[0901] A solution of Example 224 (800 mg, 2.0 mmol) and SOCl.sub.2
(0.30 mL, 4 mmol) in CHCl.sub.3 (30 mL) was refluxed gently for 3
h. The solvent was evaporated in vacuo and the residue was taken up
to in CH.sub.2Cl.sub.2 (2.times.20 mL). After removal of the
solvent,
1-{3-t-butyl-1-[3-(chloromethyl)phenyl]-1H-pyrazol-5-yl}-3-(4-chloropheny-
l)urea (812 mg, 97% yield) was obtained as white powder. .sup.1H
NMR (DMSO-d.sub.6): .delta. 9.57 (s, 1H), 8.75 (s, 1H), 7.63 (s,
1H), 7.50-7.26 (m, 7H), 6.35 (s, 1H), 4.83 (s, 2H), 1.27 (s, 9H);
MS (ESI) m/z: 417 ##STR657##
[0902] To a mixture of Example A62 (100 mg, 0.24 mmol) in DMF (2
mL) was added Example A60 (91.0 mg, 0.48 mmol) at RT, which was
stirred overnight at RT. The reaction solution was concentrated and
the residue purified via column chromatography to yield
0-{5-t-butyl-2-[3-(1,1,3,4-tetraoxo-1.lamda..sup.6-1,2,5]thiadiazolidin-2-
-ylmethyl)phenyl]-2H-pyrazol-3-yl}-3-(4-chlorophenyl)urea (40 mg,
31% yield). .sup.1H-NMR (300 MHz, DMSO-d.sub.6): .delta. 8.96 (s,
1H), 8.45 (s, 1H), 7.53 (s, 1H), 7.25-7.46 (m, 7H), 6.35 (s, 1H),
4.69 (s, 2H), 1.25 (s, 9H). ##STR658##
[0903] Using General method E, Example A2 (80 mg, 0.17 mmol) was
saponified to afford
3-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]-1H-pyrazol-1-yl}benzoic
acid (60 mg, 79% yield). .sup.1H-NMR (300 MHz, DMSO-d.sub.6):
.delta. 9.46 (br s, 1H), 8.82 (br s, 1H), 8.05 (br s, 1H), 7.98 (t,
J=4:8 Hz, 1H), 7.92 (d, J=7.8 Hz, 1H), 7.80 (d, J=8.7 Hz, 1H), 7.63
(t, J=7.8 Hz, 1H), 7.27 (d, J=4.5 Hz, 2H), 6.37 (s, 1H), 1.26 (s,
9H) ##STR659##
[0904] Using the same procedure as for Example 41, Example 116
(0.11 g, 0.28 mmol) was reduced to afford
1-{1-[3-(aminomethyl)phenyl]-3-t-butyl-1H-pyrazol-5-yl}-3-(3-chloro-pheny-
l)urea as an off-white HCl salt (77.2 mg, 64% yield). .sup.1H NMR
(DMSO-d.sub.6): .delta. 10.11 (s, 1H), 8.91 (s, 1H), 8.43 (br s,
3H), 7.72 (s, 1H), 7.68 (s, 1H), 7.56-7.55 (m, 2H), 7.48-7.46 (m,
1H), 7.31-7.25 (m, 2H), 7.02-6.99 (m, 1H), 6.42 (s, 1H), 4.16-4.12
(m, 2H), 1.30 (s, 9H); MS (ESI) m/z: 398.3 (M+H.sup.+), 400.2
(M+2+H.sup.+). ##STR660##
[0905] To a solution of Example 1 (150 mg, 0.34 mmoL), Example A59
(43 mg, 3.7 mmol) and PPh.sub.3 (98 mg, 3.7 mmoL) in anhydrous THF
(1 mL) was slowly added a solution of DEAD (74 .mu.L, 3.7 mmoL) in
THF (1 mL). The reaction mixture was allowed to stir for 3 h and
then quenched with H.sub.2O, extracted with CH.sub.2Cl.sub.2
(3.times.25 mL), dried (MgSO.sub.4), filtered, concentrated and
purified by column chromatography to yield
1-(3-t-butyl-1-(3-((2,4,5-trioxoimidazolidin-1-yl)methyl)phenyl)-1H-pyraz-
ol-5-yl)-3-(2,3-dichlorophenyl)urea (60 mg, 33.4%). .sup.1H NMR
(300 MHz, DMSO-d.sub.6): 12.05 (s, 1H), 9.24 (s, 1H), 8.70 (s, 1H),
8.04 (m, 1H), 7.35-7.46 (m, 4H), 7.25-7.27 (m, 2H), 6.37 (s, 1H),
4.68 (s, 2H), 1.28 (s, 9H); MS (ESI) m/z: 529 (M+H.sup.+)
##STR661##
[0906] To a solution of Example 1 (300 mg, 0.7 mmol) in anhydrous
DMF (6 mL) was added SOCl.sub.2 (165 mg, 0.1 mL, 1.4 mmol) at 0
.quadrature.C. The solution was heated at reflux for 4 h and
concentrated to W) yield
1-(3-t-butyl-1-(3-(chloromethyl)phenyl)-1H-pyrazol-5-yl)-3-(2,3-dichlorop-
henyl)urea (150 mg, 43% yield), which was used without further
purification. MS (ESI) m/z: 451 (M+H.sup.+).
[0907] To a solution of the material from the previous reaction
(150 mg, 0.33 mmol) in anhydrous DMF (10 mL) was added
1,2,5-thiadiazolidine-3,4-dione 1,1-dioxide disodium salt (136 mg,
0.70 mmol) and KI (17 mg, 0.1 mmol). The mixture was stirred at
40.degree. C. overnight. After filtration, the solution was
concentrated to give the crude product, which was purified by
reverse phase chromatography to afford
1-{5-t-butyl-2-[3-(4-methylene-1,1,3-trioxo-[1,2,5]thiadiazolidin--
2-ylmethyl)-phenyl]-2H-pyrazol-3-yl}-3-(2,3-dichlorophenyl)-urea
(18 mg, 5%). .sup.1H NMR (DMSO-d.sub.6): 9.28 (s, 1H), 8.73 (s,
1H), 8.04 (t, J=3.3 Hz, 1H), 7.52 (s, 1H), 7.45 (d, J=7.8 Hz, 1H),
7.35 (q, J=7.8 Hz, 2H), 7.27 (t, J=3.3 Hz, 2H), 6.36 (s, 1H), 4.70
(s, 2H), 4.65 (s, 1H), 1.24 (s, 9H). MS (ESI) m/z: 565 (M+H.sup.+).
##STR662##
[0908] Using General method A, Example A4 (70 mg, 0.29 mmol) and
4-fluorophenylisocyanate (39 mg, 0.29 mmol) were combined to afford
1-(3-t-butyl-1-(3-methoxyphenyl)-1H-pyrazol-5-yl)-3-(4-fluorophenyl)urea
as a white powder (38 mg, 35% Yield). .sup.1H NMR (300 MHz,
CDCl.sub.3): .delta. 7.59 (brs, 1H), 7.16 (t, J=8.4 Hz 1H), 6.8-7.1
(m-, 8H), 6.77 (dd, J=1.8 and 8.7 Hz, 1H), 6.30 (s, 1H), 3.66 (s,
3H), 1.27 (s, 9H); MS (EI) m/z: 383 (M+H.sup.+). ##STR663##
[0909] Using General method A, Example A4 (70 mg, 0.29 mmol) and
3-chlorophenylisocyanate (44 mg, 0.29 mmol) were combined to afford
1-(3-t-butyl-1-(3-methoxyphenyl)-1H-pyrazol-5-yl)-3-(3-chlorophenyl)urea
(83 mg, 73% yield). .sup.1H NMR (300 MHz, CDCl.sub.3): .delta. 8.30
(s, 1H), 7.38 (s, 1H), 7.20 (t, J=1.8 Hz, 1H), 7.07 (m, 2H), 6.95
(dt, J=1.2, and 7.8 Hz, 2H), 6.82 (t, J=2.1 Hz, 1H), 6.78 (s, 1H),
7.72 (dd, J=2.1, and 8.7 Hz, 1H), 6.28 (s, 1H), 3.56 (s, 3H), 1.21
(s, 9H); MS (EI) m/z: 399 (M+H.sup.+). ##STR664##
[0910] Using General method A, Example A4 (70 mg, 0.29 mmol) and
3-bromophenylisocyanate (57 mg, 0.29 mmol) were combined to afford
1-(3-t-butyl-1-(3-methoxyphenyl)-1H-pyrazol-5-yl)-3-(3-bromophenyl)urea
as a white solid (107 mg, 85% yield). .sup.1H NMR (300 MHz,
CDCl.sub.3): .delta. 8.08 (brs, 1H), 7.38 (s, 1H), 7.23 (s 1H).
7.0-7.2 (m, 4H), 7.8-7.9 (m, 2H), 6.75 (dd, J=2.4 and 8.4 Hz, 1H),
6.32 (s, 1H), 3.59 (s, 3H), 1.24 (s, 9H); MS (EI) m/z: 443 and 445
(M+ and M+2H.sup.+). ##STR665##
[0911] Using General method A, Example A4 (70 mg, 0.29 mmol) and
2,4-dichlorophenyl isocyanate (54 mg, 0.29 mmol) were combined to
afford
1-(3-t-butyl-1-(3-methoxyphenyl)-1H-pyrazol-5-yl)-3-(2,4-dichlorophenyl)u-
rea (76 mg, 61% yield). .sup.1H NMR (CDCl.sub.3): .delta. 7.96 (d,
J=9.0 Hz), 7.67 (s, 1H), 7.65 (s, 1H), 7.29 (d, J=2.4 Hz, 1H), 7.19
(t, J=7.8 Hz, 1H), 7.14 (dd, J=2.4, and 9.0 Hz, 1H), 6.9-7.0 (m,
2H), 6.78 (dd, J=2.4, and 8.7 Hz, 1H), 6.33 (s, 1H), 3.70 (s, 3H),
1.32 (s, 9H); MS (EI) m/z: 433 (M+H.sup.+). ##STR666##
[0912] Using General method A, Example A4 (86 mg, 0.35 mmol) and
5-isocyanatobenzo[d][1,3]dioxole (69 mg, 0.43 mmol) were combined
to afford
1-(benzo[d][1,3]dioxo-5-yl)-3-(3-t-butyl-1-(3-methoxyphenyl)-1H-py-
razol-5-yl)urea as a pale yellow solid (98 mg, 68% yield). .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .delta. 8.94 (s, 1H), 8.92 (brs, 1H),
8.31 (s, 1H), 7.42 (t, J=8.1 Hz, 1H), 7.0-7.2 (m, 3H), 6.98 (dd,
J=1.8, and 8.4 Hz, 1H), 6.80 (d, J=8.4 Hz, 1H), 6.71 (dd, J=2.0,
and 8.4 Hz, 1H), 6.35 (s, 1H), 5.96 (s, 2H), 3.80 (s, 3H), 1.28 (s,
9H); MS (EI) m/z: 409 (M+H.sup.+). ##STR667##
[0913] To a solution of Example A4 (123 mg, 0.5 mmol) and
triethylamine (101 mg, 1.0 mmol) in anhydrous THF (5 mL) was added
1-fluoro-2-isocyanato-benzene (69 mg, 0.5 mmol) at 0.degree. C.
This resulted mixture was stirred at RT for 3 h, and extracted with
EtOAc. The combined organic extracts were washed with brine, dried
(Na.sub.2SO.sub.4), filtered, concentrated and purified by
preparative TLC to afford
1-[3-t-butyl-1-(3-methoxy-phenyl)-1H-pyrazol-5-yl]-3-(2-fluorophenyl)urea-
. .sup.1H-NMR (300 MHz, DMSO-d.sub.6): .delta. 8.92 (s, 1H), 8.80
(s, 1H), 8.06 (t, J=7.5 Hz, 1H), 7.39 (t, J=7.5 Hz, 1H), 7.17-6.96
(m, 6H), 6.35 (s, 1H), 3.75 (s, 3H), 1.22 (s, 9H); MS (ESI) m/z:
383(M+H.sup.+). ##STR668##
[0914] Using General method B, Example A4 (123 mg, 0.5 mmol) and
2,3-difluoro-phenylamine (65 mg, 0.5 mmol) were combined to afford
1-[3-t-butyl-1-(3-methoxy-phenyl)-1H-pyrazol-5-yl]-3-(2,3-difluorophenyl)-
urea. .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 9.11 (s, 1H),
8.84 (s, 1H), 7.87 (t, J=7.8 Hz, 1H), 7.40 (t, J=7.8 Hz, 1H),
7.09-6.94 (m, 5H), 6.36 (s, 1H), 3.76 (s, 3H), 1.23 (s, 9H); MS
(ESI) m/z: 401(M+H.sup.+). ##STR669## A mixture of
(4-methoxy-phenyl)-hydrazine (17.4 g, 0.1 mol) and
4,4-dimethyl-3-oxo-pentanenitrile (13.8 g, 0.11 mol) in ethanol
(500 mL) and conc. HCl (50 mL) was heated to reflux overnight.
After removal of the solvent, the residue was purified by column
chromatography to give
3-t-butyl-1-(4-methoxyphenyl)-1H-pyrazol-5-amine (20 g, 82% yield).
.sup.1H-NMR (300 MHz, DMSO-d.sub.6): .delta. 7.38 (d, J=9.0 Hz,
2H), 6.97 (d, J=9.0 Hz, 2H), 5.32 (s, 1H), 4.99 (br s, 2H), 3.75
(s, 3H), 1.17 (s, 9H); MS (ESI) m/z: 246 (M+H.sup.+).
##STR670##
[0915] Using General method A, Example A63 (123 mg, 0.5 mmol) and
1-fluoro-2-isocyanato-benzene (69 mg, 0.5 mmol) were combined to
afford
1-[3-t-butyl-1-(4-methoxyphenyl)-1H-pyrazol-5-yl]-3-(2-fluorophenyl)urea.
.sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 9.01 (s, 1H), 8.89 (s,
1H), 8.09 (t, J=7.8 Hz, 1H), 7.36 (d, J=8.7 Hz, 2H), 7.09-7.21 (m,
2H), 7.05 (d, J=8.7 Hz, 2H), 6.97 (t, J=8.7 Hz, I H), 6.32 (s, 1H),
3.79 (s, 3H), 1.23 (s, 9H); MS (ESI) m/z: 383 (M+H.sup.+).
##STR671##
[0916] Using General method A, Example A63 (123 mg, 0.5 mmol) and
1-isocyanato-3-trifluoromethyl-benzene (93 mg, 0.5 mmol) were
combined to afford
1-[3-t-butyl-1-(4-methoxyphenyl)-1H-pyrazol-5-yl]-3-(3-trifluorome-
thylphenyl)urea (65 mg, 30% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.38 (s, 1H), 8.40 (s, 1H), 7.94 (br s, 1H),
7.45 (d, J=4.8 Hz, 2H), 7.38 (d, J=9.0 Hz, 2H), 7.27 (m, 1H), 7.03
(d, J=9.0 Hz, 2H), 6.32 (s, 1H), 3.78 (s, 3H), 1.24 (s, 9H); MS
(ESI) m/z: 433 (M+H.sup.+). ##STR672##
[0917] Using General method A, Example A63 (123 mg, 0.5 mmol) and
1-bromo-3-isocyanato-benzene (98 mg, 0.5 mmol) were combined to
afford
1-(3-bromophenyl)-3-[3-t-butyl-1-(4-methoxyphenyl)-1H-pyrazol-5-yl]urea
(65 mg, 29% yield). .sup.1H-NMR (300 MHz, DMSO-d.sub.6): .delta.
9.18 (s, 1H), 8.34 (s, 1H), 7.80 (br s, 1H), 7.37 (d, J=9.0 Hz,
2H), 7.18 (d, J=5.1 Hz, 2H), 7.12 (m, 1H), 7.03 (d, J=9.0 Hz, 2H),
6.31 (s, 1H), 3.78 (s, 3H), 1.24 (s, 9H); MS (ESI) m/z: 443
(M+H.sup.+). ##STR673##
[0918] Using General method A, Example A63 (123 mg, 0.5 mmol) and
1-chloro-3-isocyanato-benzene (76 mg, 0.5 mmol) were combined to
afford
1-[3-t-butyl-1-(4-methoxyphenyl)-1H-pyrazol-5-yl]-3-(3-chlorophenyl)urea
(65 mg, 33% yield). .sup.1H-NMR (300 MHz, DMSO-d.sub.6): .delta.
9.17 (s, 1H), 8.34 (s, 1H), 7.65 (t, J=2.1 Hz, 1H), 7.37 (d, J=9.0
Hz, 2H), 7.22 (m, 1H), 7.15 (m, 1H), 6.31 (s, 1H), 3.78 (s, 3H),
1.24 (s, 9H); MS (ESI) m/z: 399 (M+H.sup.+). ##STR674##
[0919] Using General method B, Example A63 (123 mg, 0.5 mmol) and
1-fluoro-2,3-difluorophenylamine (65 mg, 0.5 mmol) were combined to
afford
1-[3-t-butyl-1-(4-methoxyphenyl)-1H-pyrazol-5-yl]-3-(2,3-difluorop-
henyl)urea (65 mg, 32% yield). .sup.1H-NMR (300 MHz, DMSO-d.sub.6):
.delta. 9.08 (s, 1H), 8.77 (s, 1H), 7.90 (t, J=7.2 Hz, 1H), 7.37
(d, J=9.0 Hz, 2H), 7.13-6.95 (m, 4H), 6.33 (s, 1H), 3.79 (s, 3H),
1.23 (s, 9H); MS (ESI) m/z: 401 (M+H.sup.+). ##STR675##
[0920] Ethyl 4-(3-t-butyl-5-amino-1H-pyrazol-1-yl)benzoate (3.67
mmol) was prepared from ethyl 4-hydrazinobenzoate and
pivaloylacetonitrile by the procedure of Regan, et al., J. Med.
Chem., 45, 2994 (2002). ##STR676##
[0921] Using General method B, Example A64 (287 mg, 1.0 mmol), and
2,3-difluorophenylamine (134 mg, 1.0 mmol) were combined to afford
ethyl
4-{3-t-butyl-5-[3-(2,3-difluorophenyl)ureido]-1H-pyrazol-1-yl}benzoate
(250 mg, 57% yield). ##STR677##
[0922] Using the same procedure as for Example A18, Example A64 (1
g, 3.09 mmol) and 1,2-dichloro-3-isocyanato-benzene (0.7 g, 3.71
mmol) were combined to afford ethyl
4-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]-1H-pyrazol-1-yl}benzoate
(0.7 g, 48% yield). .sup.1H-NMR (300 MHz, DMSO-d.sub.6): .delta.
9.20 (br s, 1H), 8.77 (br s, 1H), 8.04 (m, 1H), 7.44 (br s, 4H),
7.29-7.26 (m, 2H), 6.36 (s, 1H), 4.31 (q, J=7.2 Hz, 2H), 1.27 (s,
9H), 1.26 (t, J=7.2 Hz, 3H). ##STR678##
[0923] Using General method E, Example 243 (80 mg, 0.17 mmol) was
saponified to afford
4-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]-1H-pyrazol-1-yl}benzoic
acid (60 mg, 79% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 9.39 (br s, 1H), 8.78 (br s, 1H), 8.07-8.02 (m, 3H), 7.68
(d, J=8.4 Hz, 2H), 7.29 (d, J=7.8 Hz, 1H), 6.41 (s, 1H), 1.21 (s,
9H) ##STR679##
[0924] To a solution of Example 1 (100 mg, 0.23 mmol) and Et.sub.3N
(50 mg 0.5 mmol) in anhydrous CH.sub.2Cl.sub.2 (10 mL), was add
acetyl chloride (22 mg, 0.28 mmol) at 0.degree. C. The mixture was
stirred at RT for 3 h and then poured into H.sub.2O. The mixture
was extracted with CH.sub.2Cl.sub.2 (3.times.50 mL). The combined
organic layers were washed with brine, dried (Na.sub.2SO.sub.4),
filtered, concentrated and purified via reverse phase
chromatography to afford
3-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)benzyl
acetate (58 mg 53% yield). .sup.1H NMR (DMSO-d.sub.6): 9.25 (s,
1H), 8.73 (s, 1H), 8.00 (m, 1H), 7.48-7.41 (m, 3H), 7.36 (m, 1H),
7.26-7.22 (m, 2H), 6.33 (s, 1H), 5.09 (s, 2H), 1.98 (s, 3H), 1.22
(s, 9H). MS (ESI) m/z: 475 (M+H.sup.+). ##STR680##
[0925] Using General method C, Example 242 (230 mg, 0.52 mmol) was
reduced to afford
1-{3-t-butyl-1-[4-(hydroxymethyl)phenyl]-1H-pyrazol-5-yl}-3-(2,3-difluoro-
-phenyl)urea (160 mg, 80% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.14 (s, 1H), 8.95 (s, 1H), 7.84-6.82 (m,
7H), 6.25 (s, 1H), 5.27 (t, J=5.7 Hz, 1H), 4.42 (br s, 2H), 1.14
(s, 9H); MS (ESI) m/z: 401 (M+H.sup.+). ##STR681##
[0926] To a solution of Example A5 (1.0 g, 3.32 mmol) and
triethylamine (606 mg, 6.0 mmol) in THF (50 mL) was added
5-isocyanato-benzo[1,3]dioxole (570 mg, 3.5 mmol) in THF (5.0 mL)
at 0.degree. C. The mixture was stirred at RT for 3 h, and then
poured into water (100 mL). The mixture was extracted with
CH.sub.2Cl.sub.2 (3.times.). The combined organic extracts were
washed with brine, dried (Na.sub.2SO.sub.4), filtered, concentrated
and purified via column chromatography to afford ethyl
2-(3-{5-[3-(benzo[d][1,3]dioxol-5-yl)ureido]-3-t-butyl-1H-pyrazol-1-yl}ph-
enyl)-acetate (950 mg, 62% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 8.84 (s, 1H), 8.28 (s, 1H), 7.48-7.34 (m,
3H), 7.27 (d, J=8.4 Hz, 1H), 7.11 (s, 1H), 6.76 (d, J=7.8 Hz, 1H),
6.66 (d, J=7.8 Hz, 1H), 6.31 (s, 1H), 5.92 (s, 2H), 4.04 (q, J=7.2
Hz, 2H), 3.73 (s, 2H), 1.23 (s, 9H), 1.15 (t, J=7.8 Hz, 3H); MS
(ESI) m/z: 465 (M+H.sup.+). ##STR682##
[0927] A suspension of Example A5 (575 mg, 1.70 mmol) in THF (10
mL) was cooled in a dry ice/acetone bath under Ar and treated with
KHMDS (0.5 M in toluene, 6.0 mL, 3 mmol). The resultant
red-brown-colored reaction mixture was stirred 15 min at
-78.degree. C. and was treated with methyl iodide (0.22 mL, 3.5
mmol) and stirred 30 min at -78.degree. C., then allowed to warm to
RT and quenched with saturated aqueous NH.sub.4Cl (15 mL). The
reaction mixture was partitioned between EtOAc (40 mL) and H.sub.2O
(15 mL). The organic layer was washed with H.sub.2O, 5%
Na.sub.2S.sub.2O.sub.3, brine, dried (Na.sub.2SO.sub.4), filtered,
concentrated and purified via column chromatography to yield 323 mg
of a mixture of ethyl
2-(3-(5-amino-3-t-butyl-1H-pyrazol-1-yl)phenyl)propanoate and ethyl
2-(3-(5-amino-3-t-butyl-1H-pyrazol-1-yl)phenyl)-2-methylpropanoate
(approx 2.5:1 ratio).
[0928] Using general method A, this mixture was combined with
2,3-dichlorophenyl isocyanate (0.15 mL, 1.14 mmol) to yield ethyl
2-(3-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)phenyl)--
2-methylpropanoate [MS (ESI) m/z: 517.0 (M+H.sup.+)] and ethyl
2-(3-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)phenyl)p-
ropanoate (200 mg, MS (ESI) m/z: 503.0 (M+H.sup.+), which were
separable by column chromatography. The latter compound was
saponified using general method E to yield
2-(3-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)phenyl)p-
ropanoic acid (61.5 mg, 72% yield) as a colorless crystalline
solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 12.43 (s, 1H),
9.24 (s, 1H), 8.75 (s, 1H), 8.07 (m, 1H), 7.49 (t, J=8.0 Hz, 1H),
7.45-7.39 (m, 2H), 7.35-7.29 (m, 3H), 6.39 (s, 1H), 3.79 (q, J=7.2
Hz, 1H), 1.39 (d, J=7.2 Hz, 3H), 1.28 (s, 9H); MS (ESI) m/z: 475.0
(M+H.sup.+). ##STR683##
[0929] Using general method I, Example 248 (38 mg, 0.08 mmol) and
NH.sub.3 (0.5 M in dioxane, 0.48 mL, 0.24 mmol) were combined and
the product crystallized from Et.sub.2O to yield
1-(1-(3-(1-amino-1-oxopropan-2-yl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2-
,3-dichlorophenyl)urea (13 mg, 34% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.25 (s, 1H), 8.75 (s, 1H), 8.09 (m, 1H),
7.49-7.43 (m, 3H), 7.39-7.33 (m, 2H), 7.32-7.27 (m, 2H), 6.87 (br
s, 1H), 6.39 (s, 1H), 3.66 (q, J=7.2 Hz, 1H), 1.34 (d, J=7.2 Hz,
3H), 1.28 (s, 9H); MS (ESI) m/z: 474.2 (M+H.sup.+). ##STR684##
[0930] Using general method C, Example 247 (930 mg, 2.0 mmol) was
reduced to afford
1-(benzo[d][1,3]dioxol-5-yl)-3-{3-t-butyl-1-[3-(2-hydroxyethyl)-
phenyl]-1H-pyrazol-5-yl}urea (800 mg, 95% yield). .sup.1H NMR (300
MHz, DMSO-d.sub.6): .delta. 8.86 (s, 1H), 8.26 (s, 1H), 7.39-7.30
(m, 4H), 7.11 (s, 1H), 6.76 (d, J=8.1 Hz, 1H), 6.65 (d, J=7.8 Hz,
1H), 6.31 (s, 1H), 5.92 (s, 2H), 4.64 (t, J=5.4 Hz, 1H), 3.60 (q,
J=6.9 Hz, 2H), 2.76 (t, J=7.2 Hz, 2H), 1.23 (s, 9H), 1.05 (t, J=7.2
Hz, 3H); MS (ESI) m/z: 423(M+H.sup.+). ##STR685##
[0931] To a solution of Example 250 (750 mg, 1.78 mmol) in THF (50
mL) was added dropwise SOCl.sub.2 (1.0 mL, 14 mmol) at 0.degree. C.
The mixture was heated to reflux for 3 h, then concentrated under
reduced pressure to yield
1-(benzo[d][1,3]dioxol-5-yl)-3-{3-t-butyl-1-[3-(2-chloroethyl)phenyl]-1H--
pyrazol-5-yl}urea (680 mg, 87% yield), which was used for the next
reaction without further purification. MS (ESI) m/z: 441
(M+H.sup.+). ##STR686##
[0932] To a solution of Example 251 (680 mg, 1.5 mmol) in DMF
(15mL) was added NaN.sub.3 powder (130 mg, 2.0 mmol), which was
stirred at RT overnight. The mixture was poured into ice-water and
extracted with EtOAc (3.times.). The combined organic extracts were
washed with brine, dried (Na.sub.2SO.sub.4), filtered, concentrated
and purified via column chromatography to afford
1-{1-[3-(2-azidoethyl)phenyl]-3-t-butyl-1H-pyrazol-5-yl}-3-(benzo[d][1,3]-
dioxol-5-yl)urea (450 mg, 67% yield). MS (ESI) m/z: 448
(M+H.sup.+). ##STR687##
[0933] A mixture of Example 252 (200 mg, 0.45 mmol) and Pd/C (40
mg, 20%) in methanol (20 mL) was stirred at RT under 20 psi of
H.sub.2 for 3 h, and then filtered. The filtrate was concentrated
and purified by preparative HPLC to afford the TFA salt. The
mixture of TFA salt in MeCN/H.sub.2O (50 mL) was basified to
pH=10.0 with a aqueous solution of 1.0 N Na.sub.2CO.sub.3. After
lyophylization, the residue was dissolved in THF and filtered. The
filtrate was adjusted to pH=6.0 with 1.0 N HCl/MeOH (2.0 mL), then
concentrated to yield
1-{1-[3-(2-aminoethyl)phenyl]-3-t-butyl-1H-pyrazol-5-yl}-3-(benzo[d][1,3]-
dioxol-5-yl)urea as the hydrochloride salt (80 mg, 40% yield).
.sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 9.37 (s, 1H), 8.65 (s,
1H), 7.92 (br s, 3H), 7.52-7.47 (m, 3H), 7.28 (d, J=7.8 Hz, 1H),
7.02 (s, 1H), 6.65-6.69 (m, 2H), 6.31 (s, 1H), 5.92 (s, 2H),
3.13-3.07 (m, 2H), 2.96-2.88 (m, 2H), 1.24 (s, 9H); MS (ESI) m/z:
422 (M+H.sup.+). ##STR688##
[0934] To a stirring solution of Example A17 (0.180 g, 0.51 mmol)
in dry CH.sub.2Cl.sub.2 (5 ml) at RT was added 4-chlorophenyl
isocyanate (82 mg, 0.53 mmol). The resulting mixture was stirred at
RT overnight. More 4-chlorophenyl isocyanate was added (40 mg, 0.26
mmol) and stirring was continued. After 2 h, the reaction was
concentrated to dryness and purified by flash chromatography to
yield pure
1-(3-t-butyl-1-{3-[2-(2,2,2-trifluoroacetamido)ethyl]-phenyl}-1H-pyrazol--
5-yl)-3-(4-chlorophenyl)urea as an orange foam (0.134 g, 52%
yield). .sup.1H NMR (CDCl.sub.3): .delta. 8.14 (br s, 1H),
7.39-7.20 (m, 8H), 7.03 (br s, 1H), 6.57 (s, 1H), 3.77 (m, 2H),
2.88 (m, 2H), 1.35 (s, 9H); MS (ESI) m/z: 508.3 (M+H.sup.+).
##STR689##
[0935] To a stirring solution of Example 254 (0.134 g, 0.264 mmol)
in MeOH (10 ml) and H.sub.2O (0.6 ml) at RT was added potassium
carbonate (0.182 g, 1.32 mmol). The resulting suspension was
stirred at 60-65.degree. C. for 2 h, then cooled to RT and the
volatiles evaporated. The residue was carefully dissolved in 1M HCl
to pH 1-2 and extracted with Et.sub.2O (2.times.). The aqueous was
then basified (pH 13-14) with 3M NaOH and extracted with
CH.sub.2Cl.sub.2 (4.times.). The combined CH.sub.2Cl.sub.2 extracts
were washed with brine (1.times.), dried (Na.sub.2SO.sub.4),
filtered, and concentrated to provided
1-{1-[3-(2-aminoethyl)phenyl]-3-t-butyl-1H-pyrazol-5-yl}-3-(4-chloropheny-
l)urea as a foam (70.6 mg, 65% yield). .sup.1H NMR (CDCl.sub.3):
.delta. 8.64 (br s, 1H), 7.33-7.00 (m, 8H), 6.39 (s, 1H), 2.65 (m,
4H), 1.31 (s, 9H); MS (ESI) m/z: 412.3 (M+H.sup.+). ##STR690##
[0936] Using General method A, Example A15 (50 mg, 0.14 mmol) and
3-chlorophenyl isocyanate (0.034 ml, 0.28 mmol) were combined to
afford
1-(3-t-butyl-1-{3-[2-(2,2,2-trifluoroacetamido)ethyl]phenyl}-1H-pyrazol-5-
-yl)-3-(3-chlorophenyl)urea (32.2 mg, 45% yield). .sup.1H NMR (300
MHz, CDCl.sub.3): .delta. 8.18 (s, 1H), 7.51-7.48 (m, 2H), 7.43 (s,
1H), 7.37-7.34 (m, 3H), 7.20-7.14 (m, 2H), 7.08-7.05 (m, 1H),
7.02-6.99 (m, 1H), 6.58 (s, 1H), 3.78 (q, J=6.4 Hz, 2H), 2.88 (t,
J=6.4 Hz, 2H), 1.36 (s, 9H); MS (ESI) m/z: 508.3 (100, M+H.sup.+),
510.2 (37, M+2H.sup.+). ##STR691##
[0937] Using the same procedure as for Example 39, Example 122
(32.2 mg, 0.063 mmol) was deprotected to afford
1-{1-[3-(2-aminoethyl)phenyl]-3-t-butyl-1H-pyrazol-5-yl}-3-(3-chloropheny-
l)urea (19.1 mg, 73% yield). .sup.1H NMR (400 MHz, CDCl.sub.3):
.delta. 8.29 (brs, 1H), 7.46 (s, 1H), 7.43-7.29 (m, 1H), 7.23-7.19
(m, 2H), 7.16-7.10 (m, 3H), 7.01-6.97 (m, 2H), 6.41 (s, 1H), 2.94
(brs, 2H), 2.71 (brs, 2H), 1.34 (s, 9H); MS (ESI) m/z: 412.3 (100,
M+H.sup.+), 414.2 (36, M+2). ##STR692##
[0938] To a solution of
1-(3-t-butyl-1-(3-(2-(methylamino)-2-oxoethyl)phenyl)-1H-pyrazol-5-yl)-3--
(2,3-dichlorophenyl)urea (0.071 g, 0.15 mmol) in THF (2 mL) was
added a solution of 1M BH.sub.3-THF (1 mL, 1 mmol) at 0.degree. C.
under Ar. After stirring the mixture at 60.degree. C. for 24 h, it
was cooled to 0.degree. C., and 3M HCl was added slowly. The
mixture was heated to 60.degree. C. for 30 min, cooled to 0.degree.
C., and basified with 20% NaOH solution. The product was extracted
with CHCl.sub.3 (3.times.25 mL). The combined organic extracts were
washed with H.sub.2O (1.times.30 mL), brine, dried
(Na.sub.2SO.sub.4) and concentrated. The resultant residue was
dissolved in CH.sub.2Cl.sub.2 (2 mL) and 3M HCl/EtOAc solution (1
mL) was added and stirred for 10 min to yield (0.025 g, 36%)
1-(3-t-butyl-1-(3-(2-(methylamino)ethyl)phenyl)-1H-pyrazol-5-yl)-3-(2,3-d-
ichlorophenyl)urea as a solid. .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.quadrature. 9.52 (s, 1H), 8.92 (s, 1H), 8.70-8.66 (brs, 2H), 8.05
(dd, J=6.0 Hz, 4.0 Hz, 1H), 7.51-7.42 (m, 3H), 7.34-7.28 (m, 3H),
6.39 (s, 1H), 3.24-3.17 (m, 2H), 3.02-2.98 (m, 2H), 2.58-2.55 (m,
3H), 1.28 (s, 9H). MS (ESI) m/z: 460.2 (M+H.sup.+). ##STR693##
[0939] Using the same procedure as for Example 258, Example 441
(0.083 g, 0.16 mmol) was reacted with 1M B.sub.3-THF (1 mL, 1 mmol)
to afford (0.071 g, 88%)
1-(3-t-butyl-1-(3-(2-(isopropylamino)ethyl)phenyl)-1H-pyrazol-5-yl)-3-(2,-
3-dichlorophenyl)urea as a solid. .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .quadrature. 9.70 (s, 1H), 9.03 (s, 1H), 8.93 (brs,
1H), 8.02 (dd, J=6.0 Hz, 4.0 Hz, 1H), 7.51-7.42 (m, 3H), 7.33-7.28
(m, 3H), 6.38 (s, 1H), 3.03-3.17 (m, 3H), 3.07-3.02 (m, 2H), 1.28
(s, 9H), 1.23 (d, J=6.8 Hz, 6H); MS (ESI) m/z: 488.2 (M+H.sup.+)
##STR694##
[0940] To a solution of Example A35 (100 mg, 0.23 mmol) in
CH.sub.3OH (3 mL) was added NH.sub.2OH.HCl (61 mg, 0.58 mmol) and
I-PR2NET (0.073 mL, 0.28 mmol), then the solution was stirred
overnight at RT. After the solvent was removed, the residue was
purified by prep-HPLC to give
4-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]pyrazol-1-yl}-N-hydroxybenza-
midine (75 mg, 71% yield) as a white power. .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.33 (s, 1H), 8.75 (s, 1H), 7.99 (m, 1H),
7.84-7.81 (d, J=9.0 Hz, 2H), 7.76-7.73 (d, J=9.0 Hz, 2H), 7.27-7.24
(d, J=6.9 Hz, 2H), 6.40 (s, 1H), 1.26 (s, 9H); MS (ESI) m/z: 461
(M+H.sup.+). ##STR695##
[0941] Using General method B, Example A18 (300 mg, 1 mmol) and
2,3-difluorophenylamine (129 mg, 1.0 mmol) were combined to afford
ethyl
2-(4-(3-t-butyl-5-(3-(2,3-difluorophenyl)ureido)-1H-pyrazol-1-yl)phenyl)a-
cetate (220 mg, 48% yield). ##STR696##
[0942] Using General method C, Example 261 (100 mg, 0.21 mmol) was
transformed to
1-(3-t-butyl-1-(4-(2-hydroxyethyl)phenyl)-1H-pyrazol-5-yl)-3-(2,3-difluor-
o-phenyl)urea (55 mg, 63% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.10 (br s, 1H), 8.85 (s, 1H), 7.89 (m, 1H),
7.36 (br s, 4H), 7.11-6.98 (m, 2H), 6.35 (s, 1H), 4.66 (t, J=5.1
Hz, 1H), 3.62 (q, J=6.9 Hz, 2H), 2.76 (t, J=7.2 Hz, 2H), 1.23 (s,
9H); MS (ESI) m/z: 415 (M+H.sup.+). ##STR697##
[0943] To a solution of 3-nitro-benzaldehyde (15.1 g, 0.1 mol) in
CH.sub.2Cl.sub.2 (200 mL) was added dropwise
(triphenyl-.lamda.5-phosphanylidene)-acetic acid ethyl ester (34.8
g, 0.1 mol) in CH.sub.2Cl.sub.2 (100 mL) at 0.degree. C. After the
addition was complete, the resulting mixture was stirred for 1 h.
After removal the solvent under reduced pressure, the residue was
purified by column chromatography to afford
3-(3-nitrophenyl)acrylic acid ethyl ester (16.5 g, 74.6% yield).
.sup.1H NMR (400 MHz, CDCl.sub.3): .delta. 8.42 (s, 1H), 8.23 (dd,
J=0.8, and 8.0 Hz, 1H), 7.82 (d, J=7.6 Hz, 1H), 7.72 (d, J=16.0 Hz,
1H), 7.58 (t, J=8.0 Hz, 1H), 6.56 (d, J=16.0 Hz, 1H), 4.29 (q,
J=7.2 Hz, 2H), 1.36 (t, J=6.8 Hz, 3H).
[0944] A mixture of 3-(3-nitrophenyl)acrylic acid ethyl ester (16.5
g, 74.6 mmol) and Pd/C (1.65 g) in methanol (200 mL) was stirred
under 40 psi of H.sub.2 at RT for 2 h, then filtered through
celite. After removal the solvent, 14 g of
3-(3-aminophenyl)propionic acid ethyl ester was obtained. .sup.1H
NMR (400 MHz, CDCl.sub.3): .delta. 7.11 (t, J=5.6 Hz, 1H), 6.67 (d,
J=7.2 Hz, 1H), 6.63-6.61 (m, 2H), 4.13 (q, J=7.2 Hz, 2H), 2.87 (t,
J=8.0 Hz, 2H), 2.59 (t, J=7.6 Hz, 2H), 1.34 (t, J=6.8 Hz, 3H); MS
(ESI): m/z: 194 (M+H.sup.+).
[0945] To a solution of 3-(3-aminophenyl)propionic acid ethyl ester
(14 g, 72.5 mmol) in conc. HCl (200 mL) was added aqueous (10 mL)
of NaNO.sub.2 (5 g, 72.5 mmol) at 0.degree. C. and the resulting
mixture was stirred for 1 h. A solution of SnCl.sub.2.2H.sub.2O (33
g, 145 mmol) in conc. HCl (150 mL) was then added at 0.degree. C.
The reaction solution was stirred for an additional 2 h at RT. The
precipitate was filtered and washed with ethanol and ether to yield
3-(3-hydrazinophenyl)propionic acid ethyl ester as a white solid,
which was used for the next reaction without further purification.
MS (ESI): m/z: 209 (M+H.sup.+).
[0946] A mixture of 3-(3-hydrazinophenyl)propionic acid ethyl ester
(13 g, 53.3 mmol) and 4,4-dimethyl-3-oxopentanenitrile (6.9 g, 55
mol) in ethanol (150 mL) was heated to reflux overnight. The
reaction solution was evaporated under vacuum. The residue was
purified by column chromatography to yield ethyl
3-(3-(3-t-butyl-5-amino-1H-pyrazol-1-yl)phenyl)propanoate (14.3 g,
85% yield) as a white solid. .sup.1H NMR (300 MHz, DMSO-d.sub.6);
.delta. 7.50-7.42 (m, 4H), 5.63 (s, 1H), 5.14 (s, 2H), 4.04 (q,
J=6.9 Hz, 2H), 2.92 (t, J=7.5 Hz, 2H), 2.66 (t, J=7.5 Hz, 2H), 1.27
(s, 9H), 1.16 (t, J=7.5 Hz, 3H); MS (ESI) m/z: 316 (M+H.sup.+).
##STR698##
[0947] Using General method A, Example A65 (101 mg, 1.0 mmol) and
1-fluoro-2-isocyanato-benzene (137 mg, 1.0 mmol) were combined to
afford
3-(3-{3-t-butyl-5-[3-(2-fluorophenyl)-ureido]-1H-pyrazol-1-yl}phenyl)prop-
ionic acid ethyl ester (240 mg, 53% yield), which was used with
further purification. ##STR699##
[0948] Using General method A, Example A65 (300 mg, 1.0 mmol) and
1,2-dichloro-3-isocyanato-benzene (187 mg, 1.0 mmol) were combined
to afford
3-(3-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]-1H-pyrazol-1-yl}p-
henyl)propionic acid ethyl ester (210 mg, 42% yield), which was
used without further purification .sup.1H NMR (DMSO-d.sub.6):
.delta. 9.20 (s, 1H), 8.76 (s, 1H), 8.05 (m, 1H), 7.47-7.26 (m,
6H), 6.38 (s, 1H), 4.04 (q, J=7.2 Hz, 2H), 2.93 (t, J=7.5 Hz, 2H),
2.65 (t, J=7.5 Hz, 2H), 1.28 (s, 9H), 1.15 (t, J=7.2 Hz, 3H); MS
(ESI) m/z: 503 (M+H.sup.+). ##STR700##
[0949] Using General method E, Example 263 (100 mg, 0.221 mmol) was
saponified to afford
3-(3-{3-t-butyl-5-[3-(2-fluorophenyl)ureido]-1H-pyrazol-1-yl}-phenyl)prop-
ionic acid (80 mg, 85% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 8.90 (br s, 1H), 8.81 (s, 1H), 7.08 (t, J=7.5 Hz, 1H), 7.42
(t, J=7.5 Hz, 1H), 7.35 (s, 1H), 7.28 (t, J=6.9 Hz, 1H), 7.28 (m,
1H), 7.07 (t, J=7.5 Hz, 1H), 6.98 (m, 1H), 6.37 (s, 1H), 2.87 (t,
J=7.5 Hz, 2H), 2.55 (t, J=7.5 Hz, 2H), 1.24 (s, 9H); MS (ESI) m/z:
425 (M+H.sup.+). ##STR701##
[0950] To a suspension of
2-(3-bromo-phenyl)-5-t-butyl-2H-pyrazol-3-ylamine (5.8 g, 20 mmol),
Pd(OAc).sub.2 (450 mg, 2 mmol), PPh.sub.3 (1.0 g, 4 mmol), and
K.sub.2CO.sub.3 (5.5 g, 40 mmol) in DMF (50 mL) was added
2-methyl-acrylic acid ethyl ester (2.8 g, 25 mmol) at RT under
N.sub.2. The mixture was stirred at 80.degree. C. overnight,
concentrated under reduced pressure, and purified by column
chromatography to afford
(E)-3-[3-(5-amino-3-t-butyl-1H-pyrazol-1-yl)phenyl]-2-methylacrylic
acid (3.2 g). MS (ESI) m/z: 328 (M+H.sup.+)
[0951] A mixture of
(E)-3-(3-(3-t-butyl-5-amino-1H-pyrazol-1-yl)phenyl)-2-methylacrylic
acid ethyl ester (3.0 g, 9.14 mmol) and Pd/C (0.3 g) in methanol
(50 mL) was stirred at RT under 40 psi of H.sub.2 for 2 h. The
reaction mixture was filtered and the filtrate was concentrated to
afford ethyl
3-[3-(5-amino-3-t-butyl-1H-pyrazol-1-yl)phenyl]-2-methylpropanoate
(2.5 g, 83% yield). MS (ESI) m/z: 330 (M+H.sup.+). ##STR702##
[0952] Using General method A, Example A66 (200 mg, 0.61 mmol) and
1,2-dichloro-3-isocyanatobenzene (187 mg, 1.0 mmol) were combined
to yield 180 ethyl
3-(3-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]-1H-pyrazol-1-yl}phenyl)--
2-methylpropanoate (180 mg, 57% yield). MS (ESI) m/z: 517
(M+H.sup.+). ##STR703##
[0953] Using General method E, Example 266 (100 mg, 0.19 mmol) was
saponified to afford
3-(3-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]-1H-pyrazol-1-yl}-phenyl)-
-2-methylpropanoic acid (60 mg, 65% yield). .sup.1H-NMR
(DMSO-d.sub.6): .delta.9.20 (s, 1H), 8.72 (s, 1H), 8.03 (m, 1H),
7.43-7.19 (m, 6H), 6.34 (s, 1H), 2.95 (m, 1H), 2.69-2.62 (m, 2H),
1.24 (s, 9H), 1.01 (d, J=6.3 Hz, 3H); MS (ESI) m/z: 489
(M+H.sup.+). ##STR704##
[0954] To a stirred solution of Example A1 (19.5 g, 68.0 mmol) in
THF (200 mL) was added LiAlH.sub.4 powder (5.30 g, 0.136 mol) at
-10.degree. C. under N.sub.2. The N mixture was stirred for 2 h at
RT and excess LiAlH.sub.4 was destroyed by slow addition of ice.
The reaction mixture was acidified to pH=7 with diluted HCl, the
solution concentrated under reduced pressure, and the residue was
extracted with ethyl acetate. The combined organic extracts were
concentrated to yield
[3-(5-amino-3-t-butyl-pyrazol-1-yl)-phenyl]-methanol (16.35 g, 98%)
as a white powder. .sup.1H NMR (DMSO-d6): 9.19 (s, 1H), 9.04 (s,
1H), 8.80 (s, 1H), 8.26-7.35 (m, 1H), 6.41 (s, 1H), 4.60 (s, 2H),
1.28 (s, 9H); MS (ESI) m/z: 415 (M+H.sup.+). ##STR705##
[0955] A solution of Example A67 (13.8 g, 56 mmol) and SOCl.sub.2
(8.27 mL, 0.11 mol) in THF (200 mL) was refluxed for 3 h and
concentrated under reduced pressure to yield
5-t-butyl-2-(3-chloromethyl-phenyl)-2H-pyrazol-3-ylamine (14.5 g,
98%) as a white powder which was used without further purification.
.sup.1H NMR (DMSO-d6), 87.62 (s, 1H), 7.53 (d, J=8.0 Hz, 1H), 7.43
(t, J=8.0 Hz, 1H), 7.31 (d, J=7.2 Hz, 1H), 5.38 (s, 1H), 5.23 (br
s, 2H), 4.80 (s, 2H), 1.19 (s, 9H). MS (ESI) m/z: 264 (M+H.sup.+).
##STR706##
[0956] To a suspension of NaH (26 mg, 0.67 mmol) in DMSO (2 mL) was
added powder 1-methyl-[1,2,4]triazolidine-3,5-dione (77 mg, 0.67
mmol) at RT under N.sub.2 atmosphere. The resulting mixture was
stirred for 30 min and then added to a solution of Example A68 (100
mg, 0.33 mmol) and Et.sub.3N (1 mL) in DMSO (2 mL). After stirring
for 3 h, the reaction mixture was quenched with methanol,
concentrated and purified by column chromatography to afford 90 mg
of
4-[3-(5-amino-3-t-butyl-pyrazol-1-yl)-benzyl]-1-methyl-[1,2,4]triazolidin-
e-3,5-dione. ##STR707##
[0957] To a suspension of Example A69 (90 mg, 0.26 mmol) and
triethylamine (0.5 mL) in fresh THF (10 mL) was added a solution of
1,2-dichloro-3-isocyanato-benzene (95 mg, 0.5 mmol) in THF (2 mL)
dropwise through syringe at 0.degree. C. under N.sub.2 atmosphere.
The mixture was allowed to rise to RT and stirred overnight. The
reaction mixture was quenched with ice-cold aqueous HCl (1 mol/L)
and extracted with EtOAc (3.times.50 mL). The combined organic
layers were washed with brine, dried (Na.sub.2SO.sub.4), filtered,
concentrated and purified column chromatography to afford 80 mg of
1-{5-t-butyl-2-[3-(1-methyl-3,5-dioxo-[1,2,4]triazolidin-4-ylmethyl)-phen-
yl]-2H-pyrazol-3-yl}-3-(2,3-dichloro-phenyl)-urea. .sup.1H-NMR
(DMSO-d.sub.6), .delta.11.30 (s, 1H), 9.27 (s, 1H), 8.70 (s, 1H),
8.04 (m, 1H), 7.50-7.46 (m, 3H), 7.28-7.26 (m, 3H), 6.37 (s, 1H),
4.74 (s, 2H), 2.96(s, 3H), 1.25 (s, 9H). ##STR708##
[0958] To a solution of aniline (2.51 g, 27 mmol) dissolved in
glacial acetic acid (14 mL) and water (28 mL) was slowly added a
solution of potassium cyanate (4.4 g, 54 mmol) dissolved in water
(35 mL). The mixture stirred for 2 h at RT, filtered, washed with
water and dried under reduced pressure to yield phenylurea as a
white solid (1.85 g, 50% yield). .sup.1H NMR (DMSO-d.sub.6):
.delta. 8.47 (s, 1H), 7.38 (dd, J=8.4 Hz, 0.9 Hz, 2H), 7.2 (t,
J=7.6 Hz, 2H), 6.88 (t, J=7.6 Hz, 1H), 5.81 (brs, 2H); MS (ESI)
m/z: 137 (M+H.sup.+).
[0959] A suspension of Example A19 (0.4 g, 3 mmol) in ether (20 mL)
was added oxalylchloride (0.8 g, 6 mmol) and refluxed for 3 h.
Solvent was removed under reduced pressure and solid was dried to
yield 1-phenylimidazolidine-2,4,5-trione (0.51 g, 89% yield), which
was used without purification. .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 7.53-7.38 (m, 5H); MS (ESI) m/z: 191 (M+H.sup.+).
##STR709##
[0960] To a solution of triphenyl phosphine (0.23 g, 0.88 mmol) in
THF (5 mL) at -20.degree. C. were added di-t-butyl azadicarboxylate
(DBAD) (0.2 g, 0.88 mmol), a solution of Example 224 (0.175 g, 0.44
mmol) in THF (5 mL) and Example A70 (0.1 g, 0.53 mmol). The
resulting clear yellow solution was heated at 60.degree. C. for 8
h, followed by the further addition of one equivalent of triphenyl
phosphine and DBAD and additional heating at 60.degree. C.
overnight. One additional equivalent of triphenyl phosphine and
DBAD were added and reaction mixture was heated at 60.degree. C.
for 3 h. The reaction mixture was concentrated and purified via
column chromatography to yield
1-(3-t-butyl-1-(3-[(2,4,5-trioxo-3-phenylimidazolidin-1-yl)methyl]phenyl}-
-1H-pyrazol-5-yl)-3-(4-chlorophenyl)urea as a white solid (70 mg,
28% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.02 (s,
1H), 8.45 (s, 1H), 7.53-7.28 (m, 12H), 6.39 (s, 1H), 4.87 (s, 2H),
1.28 (s, 9H); MS (ESI) m/z: 571 (M+H.sup.+). ##STR710##
[0961] To a solution of Example A1 (0.57 g, 2 mmol) in THF were
added pyridine (0.31 g, 4 mmol) 4-fluoro phenyl isocyanate (0.27 g,
2 mmol) and reaction mixture was stirred at RT for 20 h. Then
solvent was removed under reduced pressure, and the residue was
solidified by stirring with hexane to yield of ethyl
3-{3-t-butyl-5-[3-(4-fluorophenyl)ureido)-1H-pyrazol-1-yl}benzoate
as a white solid (0.78 g, 92% yield) .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .quadrature. 9.02 (s, 1H), 8.44 (s, 1H), 8.08 (t,
J=1.6 Hz, 1H), 7.95 (d, J=8.0 Hz, 1H), 7.83 (dd, J=8 Hz, 1.6 Hz,
1H), 7.67 (t, J=8 Hz, 1H), 7.42-7.39 (m, 2H), 7.09 (t, J=8.8 Hz,
2H), 6.37 (s, 1H), 4.32 (q, J=7.2 Hz, 2H), 1.30-1.28 (m, 12H); MS
(ESI) m/z: 425 (M+H.sup.+). ##STR711##
[0962] To a solution of Example 270 (0.78 g, 1.8 mmol) in THF (20
mL) was added LAH (5.5 mL of 1M solution in THF) at 0.degree. C.
The mixture was warmed to RT, stirred for 1 h, quenched with ice at
0.degree. C. and concentrated under reduced pressure. The residue
was acidified with 1M HCl and product was extracted with EtOAc
(2.times.50 mL). The combined organic extracts were washed with
brine, dried (Na.sub.2SO.sub.4) and concentrated under reduced
pressure to yield
1-{3-t-butyl-1-[3-(hydroxymethyl)phenyl]-1H-pyrazol-5-yl}-3-(4-fluorophen-
yl)urea as a white solid (0.66 g, 94% yield) .sup.1H NMR
(DMSO-d.sub.6): .delta. 9.20 (s, 1H), 8.48 (s, 1H), 7.48-7.36 (m,
6H), 7.10 (t, J=8.8 Hz, 2H), 6.37 (s, 1H), 4.58 (s, 2H), 1.28 (s,
9H); MS (ESI) m/z: 383 (M+H.sup.+). ##STR712##
[0963] To a solution of Example 271 (0.45 g, 1.2 mmol) in
chloroform (20 mL) was added thionyl chloride (0.28 g, 2.4 mmol)
and mixture was stirred for 2 h at 65.degree. C. Water was added
and organic layer separated. The aqueous layer was extracted with
CH.sub.2Cl.sub.2 (1.times.50 mL) and the combined organic extracts
were washed with brine, dried (Na.sub.2SO.sub.4) and concentrated
under reduced pressure to yield
1-{3-t-butyl-1-[3-(chloromethyl)phenyl]-1H-pyrazol-5-yl}-3-(4-fluoropheny-
l)urea as a solid (0.43 g, 96% yield). .sup.1H NMR (CDCl.sub.3):
.delta. 7.52 (s, 1H), 7.39-7.34 (m, 3H), 7.23-7.19 (m, 2H),
6.97-6.95 (m, 3H), 6.41 (s, 1H), 4.57 (s, 2H), 1.36 (s, 9H); MS
(ESI) m/z: 401 (M+H.sup.+). ##STR713##
[0964] A solution of Example A70 (80 mg, 0.45 mmol), DMF (4 mL) and
NaH (5 mg, 0.22 mmol) under Ar at 0.degree. C. was stirred for 30
min. Example A71 (90 mg, 0.22 mmol) was added and the mixture was
warmed to RT, stirred for 6 h, quenched with water (20 mL) and
extracted with ethyl acetate (2.times.25 mL). The combined organic
extracts were washed with water, brine, dried Na.sub.2SO.sub.4),
concentrated under reduced pressure and purified via column
chromatography to yield
1-(3-t-butyl-1-{3-[(3,5-dioxo-1-phenyl-1,2,4-triazolidin-4-yl)methyl]phen-
yl}-1H-pyrazol-5-yl)-3-(4-fluorophenyl)urea as a white solid (65
mg, 53% yield) .sup.1H NMR (DMSO-d.sub.6): .delta. 8.96 (s, 1H),
8.44 (s, 1H), 7.49-7.33 (m, 9H), 7.24 (s, 1H), 7.12-7.08 (m, 3H),
6.35 (s, 1H), 4.64 (s, 2H), 1.28 (s, 9H); MS (ESI) m/z: 542
(M+H.sup.+). ##STR714##
[0965] Using the same procedure as for Example A71, Example 1 (0.61
g, 1.4 mmol) was transformed to yield
1-(3-t-butyl-1-(3-(chloromethyl)phenyl)-1H-pyrazol-5-yl)-3-(2,3-dichlorop-
henyl)urea as a solid (0.6 g, 94% yield). .sup.1H NMR (CDCl.sub.3):
.delta. 8.12-8.09 (m, 1H), 7.65 (s, 1H), 7.58 (s, 1H), 7.47-7.36
(m, 3H), 7.19-7.17 (m, 2H), 6.95 (br s, 1H), 6.44 (s, 1H), 4.58 (s,
2H), 1.38 (s, 9H); MS (ESI) m/z: 451 (M+H.sup.+). ##STR715##
[0966] A solution of Example A70 (70 mg, 0.4 mmol), DMF (5 mL) and
(5 mg, 0.2 mmol) under Ar at 0.degree. C. was stirred for 30 min,
after which Example A72 (90 mg, 0.2 mmol) was added. The mixture
was warmed to RT, stirred for 6 h, quench with water (20 mL) and
extracted with EtOAc (2.times.). The combined organic extracts were
washed with water, brine, dried (Na.sub.2SO.sub.4), concentrated
under reduced pressure and purified via column chromatography to
yield
1-(3-t-butyl-1-{3-[(3,5-dioxo-1-phenyl-1,2,4-triazolidin-4-yl)methyl]phen-
yl}-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea as a white solid
(85 mg, 72% yield). .sup.1H NMR (DMSO-d.sub.6): .delta. 9.29 (s,
1H), 8.73 (s, 1H), 8.07 (dd, J=6.4 Hz, 3.2 Hz, 1H), 7.50-7.44
(m,4H), 7.37-7.25 (m, 5H), 7.12-7.10 (m, 1H), 6.38 (s, 1H), 4.64
(s, 2H), 1.28 (m, 9H); MS (ESI) m/z: 592 (M+H.sup.+).
General Experimental for Examples 274-277
[0967] A solution of Example A20 and the appropriate isocyanate
(general method A) or the appropriate aniline (general method D)
were combined to yield the indicated compound. TABLE-US-00008 MS
(EI) Example Name (M + H.sup.+) .sup.1H NMR (400 MHz, DMSO-d.sub.6)
##STR716## 1-[5-t-butyl-2-(3- pyridin-3-yl-phenyl)-
2H-pyrazol-3-yl]-3- cyclohexyl-urea 95 mg, 37% general method A 418
9.07 (s, 1H), 8.71 (d, J=4.5 Hz, 1H), 8.43 (d, J=7.8 Hz, 1H), 8.11
(s, 1H), 7.83 (s, 1H),7.77-7.74 (m, 2H), 7.63 (t, J=7.8 Hz, 1H),
7.54 (d, J=7.8 Hz, 2H), 6.47 (s, J=7.8 Hz, 1H), 6.26 (s, 1H), 3.31
(m, 1H), 1.71-1.52 (m, 5H), 1.22 (s, 9H), 1.18-0.97 (m, 5H)
##STR717## 1-(3-butyl-1-(3- pyridin-3- yl)phenyl)-1H-
pyrazol-5-yl)-3- (2,4,5- trifluorophenyl)urea 49 mg, 14% yield, 2
steps general method D 466.2 9.21 (brs, 2H), 9.16 (s, 1H), 8.80
(dd, J=1.2, and 5.2 Hz, 1H), 8.65 (brd, J=8.0 Hz, 1H), 8.13 (m,
1H), 7.98 (t, J=2.0 Hz, 1H), 7.87 (m, 2H), 7.72 (t, J=8.0 Hz, 1H),
7.66 (m, 1H), 7.60 (dd, J=3.2, and 10.8, 1H), 6.45 (s, 1H), 1.30
(s, 9H) ##STR718## 1-[5-t-butyl-2-(3- pyridin-3-yl-phenyl)-
2H-pyrazol-3-yl]-3- (2,3- dichlorophenyl)urea 115 mg, 39% general
method A 480 9.35 (s, 1H), 9.01 (s, 1H), 8.79 (s, 1H), 8.64 (d,
J=4.5 Hz, 1H), 8.29 (d, J=8.4 Hz, 1H), 7.98 (t, J=4.5 Hz, 1H), 7.86
(s, 1H), 7.77 (d, J=7.8 Hz, 1H), 7.67-7.57 (m, 3H) 7.26 (d, J=5.1
Hz, 2H), 6.39 (s, 1H), 1.25 (s, 9H); MS (ESI) ##STR719##
1-(3-t-butyl-1-(3- (pyridin-3- yl)phenyl)-1H- pyrazol-5-yl)-3-(3-
(pyridin-3- yloxy)phenyl)urea 0.80 g, 40% 505.2 9.80 (s, 1H), 9.33
(s, 1H), 8.96 (s, 1H), 8.85 (d, J=5.2 Hz, 1H), 8.81 (d, J=8.0 Hz,
1H), 8.54 (d, J=1.6 Hz, 1H), 8.49 (d, J=4.4 Hz, 1H), 8.00 (m, 2H),
7.86 (d, J=6.8 Hz, 1H), 7.69 (m, 4H), 7.35 (s, 1H), 7.31 (d, J=8.4,
1H), 7.13 (d, J=8.0 Hz, 1H), # 6.72 (bd, J=7.6 Hz, 1H), 6.40 (s,
1H), 1.29 (s, 9H); LC-MS (EI
[0968] ##STR720##
[0969] Using General method E, Example A1 (318 mg, 0.982 mmol) was
saponified to yield (277 mg, >100% yield)
3-(5-amino-3-t-butyl-1H-pyrazol-1-yl)benzoic acid as a foam.
[0970] Using general method J, this crude material (277 mg, 0.983
mmol) and hydrazine hydrate (0.18 mL, 3.69 mmol) were combined to
yield 3-(5-amino-3-t-butyl-1H-pyrazol-1-yl)benzohydrazide (100 mg,
37% yield). MS (ESI) m/z: 274.2 (M+H.sup.+).
[0971] This material (30 mg, 0.11 mmol) in THF (2 mL) was treated
with CDI (30 mg, 0.19 mmol) and the reaction mixture was stirred at
RT. After 30 min, another portion of CDI (30 mg, 0.19 mmol) was
added. After another 30 min, the reaction was quenched with satd.
NaHCO.sub.3 (5 mL) and extracted with EtOAc (2.times.15 mL). The
organics were washed with 5% citric acid (2.times.10 mL), H.sub.2O
(10 mL), brine (10 mL), dried (Na.sub.2SO.sub.4), filtered and
concentrated to yield
5-(3-(5-amino-3-t-butyl-1H-pyrazol-1-yl)phenyl)-1,3,4-oxadiazol-2(3H)-one
(50 mg, >100% yield) as a film. MS (ESI) m/z: 300.3
(M+H.sup.+).
[0972] Using General method A, this crude material (50 mg, 0.11
mmol theory) and 2,3-dichlorophenyl isocyanate (0.060 mL, 0.45
mmol) were combined to yield
1-(3-t-butyl-1-(3-(5-oxo-4,5-dihydro-1,3,4-oxadiazol-2-yl)phenyl)-1H-pyra-
zol-5-yl)-3-(2,3-dichlorophenyl)urea (40 mg, 74% yield over 2
steps). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 12.69 (br s,
1H), 9.30 (s, 1H), 8.76 (s, 1H), 8.00 (m, 1H), 7.92 (t, J=1.7 Hz,
1H), 7.82-7.66 (m, 3H), 7.32-7.29 (m, 2H), 6.42 (s, 1H), 1.30 (s,
9H). MS (ESI) m/z: 487.3.0 (M+H.sup.+). ##STR721##
[0973] Pivalamidine hydrochloride (5.00 g, 37 mmol) dissolved in
methanol (80 mL) was treated with NaOMe (2.0 g, 37 mmol) and
stirred at RT for 15 min. To this was added dimethyl
2-(methoxymethylene)malonate (6.4 g, 37 mmol) and the solution
stirred at RT overnight. The solution was heated at reflux for 1 h,
then cooled to RT and concentrated. The oily mass was dissolved in
H.sub.2O (125 mL) and the pH adjusted to .about.3 (wet litmus) with
AcOH. The precipitated solids were collected by filtration, washed
with H.sub.2O (50 mL) and dried to yield methyl
2-t-butyl-4-hydroxypyrimidine-5-carboxylate (3.50 g, 45%). .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .delta. 1.29 (s, 9H), 2.97 (s, 3H),
8.47 (s, 1H).
[0974] To ice cold (0-5.degree. C.) POCl.sub.3 (35 mL) was added
dropwise Et.sub.3N (0.4 mL), followed by methyl
2-t-butyl-4-hydroxypyrimidine-5-carboxylate (3.45 g, 16.4 mmol).
The mixture was then warmed to 40.degree. C. and stirred under Ar
for 1 h, then concentrated and diluted with CHCl.sub.3 (100 mL) and
poured carefully onto ice (.about.300 g) and stirred at RT until
the ice all melted. The organic phase was separated, washed with
NaHCO.sub.3 (100 mL), H.sub.2O (100 mL), dried (Na.sub.2SO.sub.4),
concentrated and dried to yield methyl
2-t-butyl-4-chloropyrimidine-5-carboxylate (3.28 g, 87% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 1.35 (s, 9H), 3.90 (s,
3H), 9.14 (s, 1H).
[0975] In a mixture of satd. NaHCO.sub.3:PhMe:EtOH (1:2:1) (12 mL)
was dissolved the material from the previous reaction (3.25 g, 14.2
mmol), phenylboronic acid (3.5 g, 28.4 mmol) and
Pd(PPh.sub.3).sub.4 (328 mg). The mixture was stirred at 75.degree.
C., under Ar overnight, then diluted with EtOAc (60 mL) and
H.sub.2O (60 mL) and the mixture filtered through Celite.RTM. and
the organic phase separated. The organic phase was washed with 5%
citric acid (50 mL), brine (50 mL) dried (Na.sub.2SO.sub.4),
concentrated to an oil and purified by column chromatography to
yield methyl 2-t-butyl-4-phenylpyrimidine-5-carboxylate (1.26 g,
33% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 1.29 (s,
9H), 3.61 (s, 3H), 7.40-7.42 (m, 3H), 7.51-7.53 (m, 2H), 8.66 (s,
1H).
[0976] Using general method E, the material from the previous
reaction (1.26 g, 4.70 mmol) was saponified to yield
2-t-butyl-4-phenylpyrimidine-5-carboxylic acid (1.10 g, 92% yield)
as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 1.40
(s, 9H), 7.50-7.52 (m, 3H), 7.67-7.69(m, 2H), 9.02 (s, 1H).
2-t-butyl-4-phenylpyrimidine-5-carboxylic acid (1.10 g, 4.29 mmol)
was combined in t-BuOH (11 mL) with DPPA (1.18 g, 4.29 mmol) and
Et.sub.3N (0.434 g, 4.29 mmol). The mixture was heated at reflux,
stirred overnight, then cooled to RT and diluted with EtOAc (75 mL)
and H.sub.2O (75 mL). The organic phase was separated, washed with
brine, dried (Na.sub.2SO.sub.4) and concentrated. The resultant
solid was treated with EtOAc (5 mL) and sonicated for 5 min then
filtered free of solids and evaporated to a small volume and the
solution purified by column chromatography to yield t-butyl
2-t-butyl-4-phenylpyrimidin-5-ylcarbamate (1.2 g, 85% yield) as a
white foam. LC-MS (EI) m/z: 328.3 (M+H.sup.+). This material (1.02
g, 3.0 mmol) was dissolved in CH.sub.2Cl.sub.2 (10 mL) and treated
with 3N HCl/EtOAc (10 mL), stirred at RT and subsequently treated
with additional 3N HCl/EtOAc (5 mL) and then concentrated to yield
2-t-butyl-4-phenylpyrimidin-5-amine hydrochloride as a yellow solid
(0.724 g, 88%). LC-MS (EI) m/z: 228.2 (M+H.sup.+). Using general
method A, this material (120 mg, 0.455 mmol) and
1,2-dichloro-3-isocyanatobenzene (94 mg, 0.500 mmol) were combined
to yield
1-(2-t-butyl-4-phenylpyrimidin-5-yl)-3-(2,3-dichlorophenyl)urea (45
mg, 24% yield). .sup.1H NMR (400 MHz, DMSO-d6): .delta. 1.39 (s,
9H), 7.29-7.34 (m, 2H), 7.53-7.59 (m, 3H), 7.77-7.79 (m, 2H),
8.06-8.08 (m, 1H), 8.20 (s, 1H), 8.98-9.02 (m, 2H); LC-MS (EI) m/z:
417.0 (M+H.sup.+). ##STR722##
[0977] Using general method A, 2-t-butyl-4-phenylpyrimidin-5-amine
hydrochloride (100 mg, 0.379 mmol, available from Example 279) and
1-(3-isocyanatophenoxy)benzene (88 mg, 0.417 mmol) were combined to
yield 1-(2-t-butyl-4-phenylpyrimidin-5-yl)-3-(3-phenoxyphenyl)urea
(42 mg, 25% yield). .sup.1H NMR (DMSO-d6): .delta. 1.38 (s, 9H),
6.61-6.63 (m, 1H), 7.01-7.56 (m, 1H), 7.73-7.75 (m, 2H), 8.10 (s,
1H), 9.02 (s, 1H), 9.19 (s, 1H). LC-MS (EI) m/z: 439.3 (M+H.sup.+).
##STR723##
[0978] Using general method D, 2-t-butyl-4-phenylpyrimidin-5-amine
hydrochloride (150 mg, 0.569 mmol, available from Example 279) and
3-(pyridin-3-yloxy)benzenamine (128 mg, 0.683 mmol) were combined
to yield
1-(2-t-butyl-4-phenylpyrimidin-5-yl)-3-(3-(pyridin-3-yloxy)phenyl)u-
rea (133 mg, 51% yield). .sup.1H NMR (DMSO-d6) .delta. 1.38 (s,
9H), 6.73-6.76 (m, 1H), 6.89-7.05 (m, 1H), 7.14-7.16 (m, 1H),
7.32-7.38 (m, 2H), 7.51-7.56 (m, 3H), 7.74-7.79 (m, 4H), 8.38 (s,
1H), 8.53-8.62 (m, 2H), 9.00 (s, 1H), 9.56 (s, 1H). LC-MS (EI) m/z:
440.2 (M+H+). ##STR724##
[0979] Using general method A, Example A21 (133 mg, 0.5 mmoL) and
isocyanatobenzene (60 mg, 0.5 mmol) were combined to afford
1-[3-t-butyl-1-(quinolin-6-yl)-1H-pyrazol-5-yl]-3-phenylurea (90
mg, 47% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 8.99
(s, 1H), 8.97 (d, J=4.5 Hz, 1H), 8.58 (s, 1H), 8.56 (d, J=8.4 Hz,
1H), 8.19 (s, 1H), 8.16 (d, J=8.7 Hz, 1H), 7.99 (d, J=8.7 Hz, 1H),
7.67 (m, 1H), 7.35 (d, J=7.8 Hz, 2H), 7.21 (t, J=7.8 Hz, 2H), 6.92
(t, J=7.8 Hz, 1H), 6.42 (s, 1H), 1.28 (s, 9H).
General Experimental for Examples 283-285
[0980] A solution of Example A21 and the appropriate isocyanate or
aniline was converted to the target compound using the general
method indicated. TABLE-US-00009 MS (EI) .sup.1H NMR (300 MHz/400
MHz, Example Name (M + H.sup.+) DMSO-d6) ##STR725## 1-(3-t-butyl-1-
(quinolin-6-yl)-1H- pyrazol-5-yl)-3-(2,3- difluorophenyl)urea 38
mg, 14% yield General method D 422.2 9.01 (s, 1H), 9.04 (s, 1H),
8.97 (dd, J=1.6, and 4.0 Hz, 1H), 8.49 (d, J=8.4 Hz, 1H), 8.18 (d,
J=9.2 Hz, 1H), 8.16 (s, 1H), 7.94 (dd, J=2.4, and 9.2 Hz, 1H). 7.90
(d, J=8.0 Hz, 1H), 7.63 (dd, J=4.4, 8.8 Hz, 1H), 7.11 (m, 1H), 7.03
(m, 1H), 6.48 (s, 1H), 1.31 (s, 9H) ##STR726## 1-(3-t-butyl-1-
(quinolin-6-yl)-1H- pyrazol-5-yl)-3-(2,4- difluorophenyl)urea 35
mg, 11% yield General method D 422.2 8.97 (dd, J=1.6, and 4.0 Hz,
1H), 8.95 (s, 1H), 8.87 (d, J=1.6 Hz, 1H), 8.49 (dd, J=1.6, and 8.8
Hz, 1H), 8.17 (d, J=11.6 Hz, 1H), 8.16 (s, 1H), 8.04 (m, 1H), 7.63
(dd, J=4.0, and 8.4 Hz, 1H). 7.29 (m, 1H), 7.03 (m, 1H), 6.47 (s,
1H), 1.30 (s, 9H) ##STR727## 1-(3-t-butyl-1- (quinolin-6-yl)-1H-
pyrazol-5-yl)-3- (2,3,4- trifluorophenyl)urea 36 mg, 5% yield
General method D 440.2 9.04 (s, 1H), 8.99 (s, 1H), 8.97 (dd, J=1.6,
and 4.4 Hz, 1H), 8.48 (d, J=8.4 Hz, 1H), 8.17 (d, J=10.2 Hz, 1H),
8.16 (s, 1H), 7.94 (dd, J=2.0, and 8.8 Hz, 1H). 7.83 (m, 1H), 7.63
(dd, J=4.0, and 8.4 Hz, 1H), 7.26 (m, 1H), 6.47 (s, 1H), 1.31 (s,
9H)
[0981] ##STR728##
[0982] Using general method A, Example A23 (169 mg, 0.5 mmol) and
isocyanatobenzene (60 mg, 0.5 mmol) were combined to afford ethyl
3-[3-t-butyl-5-(3-phenylurido)-1H-pyrazol-1-yl]-1-naphthoate (110
mg, 48% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 8.96
(s, 1H), 8.73 (d, J=8.1 Hz, 1H), 8.53 (s, 1H), 8.33 (s, 1H), 8.23
(s, 1H), 8.10 (d, J=8.1 Hz, 1H), 7.62-7.71 (m, 2H), 7.35 (d, J=7.5
Hz, 2H), 7.21 (t, J=7.5 Hz, 2H), 6.92 (t, J=7.2 Hz, 1H), 6.41 (s,
1H), 4.37 (q, J=7.2 Hz, 2H), 1.30 (t, J=7.2 Hz, 3H), 1.29 (s, 9H).
##STR729##
[0983] Using general method E, Example 58 (100 mg, 0.20 mmol) is
saponified to afford
3-{3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido]-1H-pyrazol-1-yl}-1-naphthoi-
c acid (60 mg, 60% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 9.37 (s, 1H), 8.35 (d, J=8.7 Hz, 1H), 8.76 (s, 1H), 8.30
(m, 1H), 8.10 (m, 1H), 8.00 (t, J=4.8 Hz, 1H), 57.67 (m, 1H), 7.28
(d, J=4.8 Hz, 1H), 6.45 (s, 1H), 1.30 (s, 9H); MS (EI) m/z: 497.1
(M+H.sup.+). ##STR730##
[0984] Using general method A, Example A23 (200 mg, 0.593 mmol) and
4-cyclohexylisocyanate (256 mg, 1.78 mmol) were combined to afford
ethyl
3-(3-t-butyl-5-(3-cyclohexylureido)-1H-pyrazol-1-yl)-1-naphthoate
(15 mg, 5.5% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
1.05-1.30 (m, 5H), 1.29 (s, 9H), 1.36-1.41 (m, 3H), 1.47-1.73 (m,
5H), 3.32-3.38 (m, 1H), 4.40-4.46 (m, 2H), 6.32 (s, 1H), 6.40-6.42
(m, 1H), 7.67-7.71 (m, 2H), 8.09-8.27 (m, 4H), 8.74-8.76 (m, 1H);
LC-MS (EI) m/z: 462.7 (M+H.sup.+). ##STR731##
[0985] Using general method D, Example A24 (120 mg, 0.234 mmol) and
2,4-difluoroaniline (30 mg, 0.234 mmol) were combined to yield
ethyl
3-(3-t-butyl-5-(3-(2,4-difluorophenyl)ureido)-1H-pyrazol-1-yl)-1-naphthoa-
te (89 mg, 77% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.
1.25-1.31 (m, 3H), 1.29 (s, 9H), 4.39-4.47 (m, 2H), 6.45 (s, 1H),
7.02-7.03 (m, 1H), 7.28-7.29 (m, 1H), 7.68-7.73 (m, 2H), 7.99-8.01
(m, 1H), 8.13-8.15 (m, 1H), 8.24 (s, br, 1H), 8.36 (s, 1H),
8.76-8.78 (m, 1H), 8.84 (s, 1H), 8.91 (s, 1H); LC-MS (EI) m/z:
493.2 (M+H.sup.+). ##STR732##
[0986] Using general method C, Example 286 (100 mg, 0.22 mmol) was
reduced to afford
1-[3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl]-3-phen-
ylurea (50 mg, 55% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 8.99 (s, 1H), 8.49 (s, 1H), 8.06 (m, 1H), 8.01 (m, 1H),
7.92 (s, 1H), 7.69 (s, 1H), 7.54-7.60 (m, 2H), 7.35 (d, J=7.8 Hz,
2H), 7.21 (t, J=7.8 Hz, 2H), 6.92 (t, J=7.5 Hz, 1H), 6.41 (s, 1H),
5.01 (s, 2H), 1.28 (s, 9H). ##STR733##
[0987] Using General method D, Example A24 (120 mg, 0.234 mmol) and
2-fluoroaniline (26 mg, 0.234 mmol) were combined to yield ethyl
3-(3-t-butyl-5-(3-(2-fluorophenyl)ureido)-1H-pyrazol-1-yl)-1-naphthoate
(104 mg, 93% yield). Using General method C, ethyl
3-(3-t-butyl-5-(3-(2-fluorophenyl)ureido)-1H-pyrazol-1-yl)-1-naphthoate
(104 mg, 0.22 mmol) was reduced to afford
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-(2-f-
luorophenyl)urea (32 mg, 34% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 1.30 (s, 9H), 5.04 (s, 2H), 6.46 (s, 1H),
6.98-7.02 (m, 1H), 7.09-7.22 (m, 2H), 7.61 (s, br, 2H), 7.71 (s,
1H), 7.95 (s, 1H), 8.03-8.14 (m, 3H), 8.92-8.95 (m, 2H); LC-MS (EI)
m/z: 433.2 (M+H.sup.+). ##STR734##
[0988] Using general method D, Example A24 (120 mg, 0.234 mmol) and
cyclohexylamine (23 mg, 0.234 mmol) were combined to afford 65 mg
(60%), ethyl
3-(3-t-butyl-5-(3-cyclohexylureido)-1H-pyrazol-1-yl)-1-naphthoate,
used as is. Using general method C, this ester (65 mg, 0.14 mmol)
was reduced to give
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-cycl-
ohexylurea (34 mg, 58% yield) as a foam. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 1.07-1.98 (m, 10H), 1.29 (s, 9H), 3.34-3.39
(m, 1H), 5.02 (brs, 2H), 5.47 (s, br, 1H), 6.32 (brs, 1H),
6.46-6.47 (m, 1H), 7.60-7.68 (m, 3H), 7.86 (brs, 1H), 8.00-8.08 (m,
3H); LC-MS (EI) m/z: 421.2 (M+H.sup.+). ##STR735##
[0989] Using general method D, Example A24 (120 mg, 0.234 mmol) and
4-fluoroaniline (26 mg, 0.234 mmol) to afford 89 mg (80%), ethyl
3-(3-t-butyl-5-(3-(4-fluorophenyl)ureido)-1H-pyrazol-1-yl)-1-naphthoate.
Using general method C, this ester (89 mg, 0.19 mmol) was reduced
to give
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-cycl-
ohexylurea (59 mg, 73% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6);
.delta. 1.31 (s, 9H), 5.04 (s, 2H), 6.43 (s, 1H), 7.06-7.11 (m,
2H), 7.38-7.41 (m, 2H), 7.57-7.62 (m, 2H), 7.73 (s, br, 1H), 7.98
(s, 1H), 8.02-8.10 (m, 2H), 8.62 (s, 1H), 9.24 (s, 1H). LC-MS (EI)
m/z: 433.3 (M+H.sup.+). ##STR736##
[0990] Using general method D, Example A24 (120 mg, 0.234 mmol) and
2,3-difluoroaniline (30 mg, 0.234 mmol) were combined to give 82 mg
(71%), ethyl
3-(3-t-butyl-5-(3-(2,3-difluorophenyl)ureido)-1H-pyrazol-1-yl)-1-naphthoa-
te. Using general method C, this ester (82 mg, 0.17 mmol) was
reduced give
1-(3-t-butyl-1-(4-(hydroxymethyl)naphthalen-2-yl)-1H-pyrazol-5-yl)-3-cycl-
ohexylurea (51 mg, 68% yield) an off white solid. .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 1.31 (s, 9H), 5.04-5.05 (m, 2H), 5.50
(m, 1H), 6.46 (s, 1H), 7.02-7.14 (m, 2H), 7.60-7.62 (m, 2H),
7.59-7.62 (m, 2H), 7.71 (s, 1H), 7.91-7.96 (m, 2H), 8.03-8.11 (m,
2H), 8.98 (s, 1H), 9.11 (s, 1H). LC-MS (EI) m/z: 451.2 (M+H.sup.+).
##STR737##
[0991] To a solution of Example A23 (400 mg, 1.25 mmol) and
triethylamine (303 mg, 3.0 mmol) in THF (10.0 mL) was added
isocyanato-benzene (250 mg, 1.5 mmol) in THF (2.0 mL) at 0.degree.
C. The mixture was stirred at RT overnight then poured into water
(50 mL). The mixture was extracted with CH.sub.2Cl.sub.2
(3.times.100 mL). The combined organic extracts were washed with
brine, dried (Na.sub.2SO.sub.4), filtered, concentrated and
purified via column chromatography to afford
1-[1-(4-(azidomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl]-3-phenyl-
urea (320 mg, 58% yield). MS (ESI) m/z: 440 (M+H.sup.+).
##STR738##
[0992] A mixture of Example A73 (300 mg, 0.68 mmol) and Pd/C (60
mg, 20%) in methanol (20 mL) was stirred at RT under 20 psi of
H.sub.2 for 3 h and then filtered. The filtrate was concentrated to
yield the crude product, which was purified by preparative HPLC to
afford the TFA salt. The mixture of TFA salt in MeCN/H.sub.2O (50
mL) was basified to pH=10 with 1N Na.sub.2CO.sub.3. After
lyophylization, the residue was dissolved in THF and filtered. The
filtrate was adjusted to pH=6 with 1N HCl/MeOH (2.0 mL) and then
concentrated to
1-[1-(4-(aminomethyl)naphthalen-2-yl)-3-t-butyl-1H-pyrazol-5-yl]-3-phenyl-
urea (180 mg, 64% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 9.81 (s, 1H), 8.96 (s, 1H), 8.58 (brs, 1H), 8.16 (s, 2H),
8.09 (d, J=5.1 Hz, 1H), 7.87 (s, 1H), 7.64 (s, 2H), 7.38 (d, J=5.7
Hz, 2H), 7.21 (t, J=5.4 Hz, 2H), 6.91 (t, J=5.4 Hz, 1H), 6.44 (s,
1H), 4.61 (s, 2H), 1.29 (s, 9H); MS (ESI) m/z: 414 (M+H.sup.+).
##STR739##
[0993] To a solution of Example 70 (0.12 g, 0.24 mmol) in water (5
mL) was added glacial acetic acid (43 mg, 0.71 mmol). Potassium
cyanate (58 mg, 0.71 mmol) was added into the reaction mixture over
a period of 30 min. The reaction mixture was stirred at room
temperature overnight. The mixture was kept in refrigerator. The
solid was filtered, washed with water and acetic acid (1:1)
mixture. The solid was dissolved in CH.sub.3CN:H.sub.2O (1:1 4 mL)
and lyophilized to obtain the diurea solid (105 mg, 86% yield) as
an off-white. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.43 (s,
1H), 9.17 (brs, 1H), 8.20 (m, 1H), 8.05 (m, 1H), 7.97 (d, J=1.6 Hz,
1H), 7.87 (m, 1H), 7.61 (m, 1H), 7.10 (m, 1H), 6.61 (t, J=5.6 Hz,
1H), 6.48 (s, 1H), 4.73 (d, J=5.6 Hz, 2H), 1.31 (s, 9H); LC-MS (EI)
m/z: 511.2 (M+H.sup.+). ##STR740##
[0994] Using the same procedure as for Example 296, Example 71
(0.10 g, 0.21 mmol) and potassium cyanate (51 mg, 0.63 mmol) were
combined to afford the diurea (78 mg, 73% yield) as an off-white
solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.12 (s, 1H),
8.98 (brs, 1H), 8.18 (m, 2H), 8.05 (m, 1H), 7.96 (d, J=1.6 Hz, 1H),
7.61 (m, 3H), 6.59 (t, J=5.6 Hz, 1H), 6.47 (s, 1H), 4.73 (d, J=5.6
Hz, 2H), 1.31 (s, 9H); LC-MS (EI) m/z: 511.2 (M+H.sup.+).
##STR741##
[0995] Using general method A, Example A27 (400 mg, 1.1 mmol)
1-chloro-4-isocyanatobenzene (260 mg, 1.7 mmol) were combined to
afford
(3-{3-t-butyl-5-[3-(4-chlorophenyl)ureido]pyrazol-1-yl}naphthalen-1-yl)ac-
etic acid ethyl ester (154 mg, 30% yield) as a white solid. .sup.1H
NMR (300 MHz, DMSO-d.sub.6): .delta. 9.10 (s, 1H), 8.51 (s, 1H),
8.00-7.93 (m, 3H), 7.60-7.55 (m, 3H), 7.37 (d, J=9.0 Hz, 2H), 7.28
(d, J=9.0 Hz, 2H), 6.40 (s, 1H), 4.19 (s, 2H), 4.07 (q, J=7.2 Hz,
2H), 1.26 (s, 9H), 1.13 (t, J=7.2 Hz, 3H); MS (ESI) m/z: 505
(M+H.sup.+). ##STR742##
[0996] Using general method A, Example A27 (1 g, 2.8 mmol) and
isocyanatobenzene (407 mg, 3.4 mmol) were combined to afford
{3-[3-t-butyl-5-(3-phenylureido)pyrazol-1-yl]naphthalen-1-yl}acetic
acid methyl ester (790 mg, 62% yield) as a white solid. .sup.1H NMR
(300 MHz, DMSO-d.sub.6): .delta. 8.97 (s, 1H), 8.49 (s, 1H),
8.02-7.94 (m, 3H), 7.62 (s, 1H), 7.60-7.56 (m, 2H), 7.35 (d, J=7.5
Hz, 2H), 7.22 (t, J=8.1 Hz, 2H), 6.95 (t, J=7.5 Hz, 1H), 6.41 (s,
1H), 4.23 (s, 2H), 3.57 (s, 3H), 1.27 (s, 9H); MS (ESI) m/z: 457
(M+H.sup.+). ##STR743##
[0997] Using general method E, Example 298 (100 mg, 0.2 mmol) was
saponified to afford
(3-{3-t-butyl-5-[3-(4-chlorophenyl)ureido]pyrazol-1-yl}naphthalen-1-yl)ac-
etic acid (85 mg, 90% yield) as a white solid. .sup.1H NMR (300
MHz, DMSO-d.sub.6): .delta. 9.28 (s, 1H), 9.18 (s, 1H), 8.64 (s,
1H), 7.97 (brs, 2H), 7.60-7.54 (m, 2H), 7.45-7.36 (m, 3H),
7.29-7.23 (m, 3H), 6.39 (s, 1H), 4.10 (s, 2H), 1.27 (s, 9H); MS
(ESI) m/z: 511(M+H.sup.+). ##STR744##
[0998] Using general method E, Example 299 (250 mg, 0.54 mmol) was
saponified to afford
{3-[3-t-butyl-5-(3-phenylureido)pyrazol-1-yl]naphthalen-1-yl}acetic
acid (180 mg, 87% yield) as a white solid. .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 8.00-7.94 (m, 3H), 7.58-7.56 (m, 3H), 7.33
(d, J=8.4 Hz, 2H), 7.21 (t, J=8.1 Hz, 2H), 6.91 (t, J=6.6 Hz, 1H),
6.40 (s, 1H), 4.10 (s, 2H), 1.26 (s, 9H); MS (ESI) m/z:
443(M+H.sup.+). ##STR745##
[0999] Using general method C, Example 298 (350 mg, 0.7 mmol) was
reduced to afford
1-{5-t-butyl-2-[4-(2-hydroxyethyl)naphthalen-2-yl]-2H-pyrazol-3-
-yl}-3-(4-chlorophenyl)urea (268 mg, 83% yield) as a white solid.
.sup.1H-NMR (300 MHz, DMSO-d.sub.6): .delta. 9.17 (s, 1H), 8.53 (s,
1H), 8.12 (m, 1H), 7.96 (m, 1H), 7.89 (s, 1H), 7.55 (m, 2H), 7.51
(s, 1H), 7.31 (dd, J=9.0 Hz, 9.0 Hz, 4H), 6.39 (s, 1H), 3.71 (t,
J=6.9 Hz, 2H), 3.23 (t, J=6.9 Hz, 2H), 1.27(s, 1H); MS (ESI) m/z:
463 (M+H.sup.+). ##STR746##
[1000] Using general method C, Example 76 (70 mg, 0.13 mmol) was
reduced to afford 1-{5-t-butyl-2-[4-(2-hydroxyethyl)
naphthalen-2-yl]-2H-pyrazol-3-yl}-3-(2,3-dichlorophenyl)urea (57
mg, 86% yield) as a white solid. .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.29 (s, 1H), 8.77 (s, 1H), 8.12 (m, 1H),
8.13-7.95 (m, 2H), 7.90 (s, 1H), 7.56-7.52 (m, 3H), 7.28-7.26 (m,
2H), 6.41 (s, 1H), 3.73 (t, J=6.9 Hz, 2H), 3.24 (t, J=6.9 Hz, 2H),
1.27(s, 9H); MS (ESI) m/z: 497 (M+H.sup.+). ##STR747##
[1001] To a mixture of Example 102 (120 mg, 0.26 mmol) and
K.sub.2CO.sub.3 (0.1 g, 0.7 mmol) in ethanol (20 mL) was added
hydroxylamine hydrochloride (500 mg). The resulting mixture was
heated to reflux for 3 h. After removal of the solvent, the residue
was purified by preparative HPLC to give
1-[5-t-butyl-2-(3-hydroxyiminoindan-5-yl)-2H-pyrazol-3-yl]-3-(2,3-dichlor-
o phenyl)urea (75 mg, 61% yield). .sup.1H NMR (300 MHz,
MeOD-d.sub.6): .delta. 8.04 (d, J=5.4 Hz, 1H), 7.73 (s, 1H),
7.52-7.43 (m, 2H), 7.22-7.20 (m, 2H), 6.48 (s, 1H), 3.20-3.12 (m,
2H), 2.97 (m, 2H), 1.33 (s, 9H); MS (ESI) m/z: 473 (M+H.sup.+).
##STR748##
[1002] In a 1:1:1 mix of EtOH:H2O:dioxane (6 mL) was placed ethyl
6-(3-cyclopentyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-2,3-di-
hydro-1H-indene-1-carboxylate (520 mg, 0.986 mmol) and lithium
hydroxide (71 mg, 2.96 mmol). The solution warmed to 40C and
stirred, ON. LC shows complete reaction. The solution cooled to RT
and diluted with 5% citric acid (20 mL) and Ethyl acetate (20 mL).
The organic phase separated, washed with brine and dried over
sodium sulfate. The solvents were evaporated at reduced pressure to
give
6-(3-cyclopentyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-2,3-di-
hydro-1H-indene-1-carboxylic acid as a foam, 474 mg (96%), used as
is. In DMF (5 mL) was placed
6-(3-cyclopentyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-2,3-di-
hydro-1H-indene-1-carboxylic acid (474 mg, 0.949 mmol), HOBt (196
mg, 1.09 mmol) and EDAC (218 mg, 1.42 mmol). The mixture was
stirred at RT for 1 hr and then treated with a solution of 0.5N
ammonia in dioxane (7.59 mL, 3.80 mmol). The mixture was stirred at
RT, ON. LC shows complete reaction. The mixture was diluted with 5%
citric acid (20 mL) and Ethyl acetate (20 mL). The organic phase
separated, washed with saturated sodium bicarbonate (20 mL), brine
(20 mL) and dried over sodium sulfate. The solvents evaporated at
reduced pressure to give a foam, dried on high vacuum line at RT
for 2 hrs. The foam was then purified by Biotage chromatography
(S1-25 column, 65-95% Ethyl acetate/Hex). Fractions 10-19 were
combined and evaporated at reduced pressure to give
1-(1-(3-carbamoyl-2,3-dihydro-1H-inden-5-yl)-3-cyclopentyl-1H-pyrazol-5-y-
l)-3-(2,3-dichlorophenyl)urea as a white solid. The solid was dried
on the high vacuum line at 65C in the abderhalden for 3 hrs, 210 mg
(44%). .sup.1H NMR (DMSO-d6) 1.59-1.73 (m, 6H), 1.95-1.99 (m, 2H),
2.23-2.33 (m, 2H), 2.88-3.06 (m, 3H), 3.90-4.04 (m, 1H), 6.31 (s,
1H), 6.98 (s, 1H), 7.26-7.42 (m, 5H), 7.63 (br s, 1H), 8.07-8.09
(m, 1H), 8.77 (s, 1H), 9.21 (s, 1H). LC-MS (EI) m/z: 500.0
(M+H.sup.+). ##STR749##
[1003] Using general method D, Example A78 (70 mg, 0.20 mmol,) and
1-fluoro-3-isocyanatobenzene (27 mg, 0.20 mmol) were combined to
yield
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(3-fluorophenyl)urea
HCl salt (47 mg, 60% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.53 (s, 1H), 8.66 (s, 1H), 7.49 (s, 1H), 7.43 (m, 1H),
7.37 (m, 1H), 7.27 (m, 2H), 7.06 (dd, J=1.2, and 8.0 Hz, 1H), 6.78
(dt, J=2.4, and 8.8 Hz, 1H), 6.37 (s, 1H), 3.70 (t, J=8.4 Hz, 2H),
3.20 (t, J=8.4 Hz, 2H), 1.28 (s, 9H); LC-MS (EI) m/z: 490.2
(M+H.sup.+). ##STR750##
[1004] Using general method D, A78 (85 mg, 0.24 mmol,) and
2,3-difluorobenzenamine (90 mg, 0.68 mmol) were combined to yield
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(2,3-difluorophenyl)urea
HCl salt (80 mg, 74% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.20 (s, 1H), 9.03 (brs, 1H), 7.90 (t, J=8.0 Hz, 1H), 7.48
(brs, 1H), 7.36 (m, 1H), 7.26 (m, 1H), 7.13 (m, 1H), 7.02 (m, 1H),
6.39 (d, J=1.6 Hz, 1H), 3.70 (t, J=6.4 Hz, 2H), 3.19 (t, J=8.0 Hz,
2H), 1.28 (s, 9H); LC-MS (EI) m/z: 412.3 (M+H.sup.+).
##STR751##
[1005] Using the same method as for Example 108, Example 307 (80
mg, 0.20 mmol,) and triflic anhydride (70 mg, 0.2 mmol) were
combined to yield
1-(3-t-butyl-1-(1-(trifluoromethylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-
-3-(2,3-dichlorophenyl)urea (50 mg, 43% yield) as a pale yellow
solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.08 (brs, 1H),
8.89 (brs, 1H), 7.90 (dt, J=1.6, and 7.6 Hz, 1H), 7.53 (brs, 1H),
7.43 (d, J=2.0 Hz, 1H), 7.13 (m, 1H), 7.04 (m, 1H), 6.39 (s, 1H),
4.32 (t, J=8.8 Hz, 2H), 3.32 (s, 2H), 3.31 (t, J=8.4 Hz, 2H), 1.27
(s, 9H); LC-MS (EI) m/z: 544.2 (M+H.sup.+).
General Experimental for Examples 309-314
[1006] A solution of Example A35 and the appropriate isocyanate
(general method A) or the appropriate anline (general method D)
were combined to yield the indicated compound. TABLE-US-00010 MS
(EI) Example Name (M + H.sup.+) .sup.1H NMR (400 MHz, DMSO-d.sub.6)
##STR752## 1-[3-t-butyl-1-(1- oxo-1,2,3,4- tetrahydroisoquinolin-
7-yl)-1H- pyrazol-5-yl]-3-(4- chlorophenyl)urea 1.5 g, 55% yield
General method A 300 MHz, CDCl.sub.3: .delta. 9.03 (s, 1H), 8.77
(s, 1H), 7.90 (s, 1H), 7.54 (d, J=7.5 Hz, 1H), 7.30 (d, J=9 Hz,
3H), 7.19 (d, J=9 Hz, 2H), 6.88 (brs, 1H), 6.74 (s, 1H), 3.45 (brs,
2H), 2.88 (t, J=6 Hz, 2H), 1.37 (s, 9H) ##STR753##
1-(3-t-butyl-1-(1- oxo-1,2,3,4- tetrahydroisoquinolin- 7-yl)-1H-
pyrazol-5-yl)-3- cyclohexylurea 38mg, 24% yield General method D
410.2 1.05-1.30 (m, 5H), 1.27 (s, 9H), 1.48-1.52 (m, 1H), 1.58-1.63
(m, 2H), 1.70-1.75 (m, 2H), 2.94-2.97 (m, 2H), 3.32-3.41 (m, 3H),
6.25 (s, 1H), 6.39-6.41 (m, 1H), 7.42-7.44 (m, 1H), 7.53-7.56 (m,
1H), 7.87 (s, 1H), 8.03 (s, 1H), 8.10 (s, 1H). ##STR754##
1-(3-t-butyl-1-(1- oxo-1,2,3,4- tetrahydroisoquinolin- 7-yl)-1H-
pyrazol-5-yl)-3- (2,4- difluorophenyl)urea 84 mg, 54% yield General
method D 440.2 1.28 (s, 9H), 2.90-2.92 (m, 2H), 3.39-3.42 (m, 2H),
6.37 (s, 1H), 7.02 (m, 1H), 7.28-7.29 (m, 1H), 7.46-7.48 (m, 1H),
7.61-7.64 (m, 1H), 7.92 (s, 1H), 8.01-8.02 (s, 1H), 8.11 (s, br,
1H), 8.90 (s, br, 1H), 8.94 (s, br, 1H). ##STR755##
1-(3-t-butyl-1-(1- oxo-1,2,3,4- tetrahydroisoquinolin- 7-yl)-1H-
pyrazol-5-yl)-3-(2- fluorophenyl)urea 28 mg, 28% yield General
method D 422.2 1.28 (s, 9H), 2.97-2.99 (m, 2H), 3.40-3.49 (m, 2H),
6.39 (s, 1H), 6.95-7.25 (m, 3H), 7.47-7.49 (m, 1H), 7.62 (m, 1H),
7.91 (s, 1H), 8.09-8.12 (m, 2H), 8.89 (s, 2H). ##STR756##
1-(3-t-butyl-1-(1- oxo-1,2,3,4- tetrahydroisoquinolin- 7-yl)-1H-
pyrazol-5-yl)-3-(2- chlorophenyl)urea 41 mg, 33% yield General
method D 437.8 1.28 (s, 9H), 2.95-2.98 (m, 2H), 3.38-3.43 (m, 2H),
6.38 (s, 1H), 7.01-7.06 m, 1H), 7.26-7.30 (m, 1H), 7.42-7.48 (m,
2H), 7.62-7.65 (m, 1H), 7.94 (s, br, 1H), 8.04-8.07 (s, 1H), 8.11
(s, br, 1H), 8.58 (s, 1H), 9.23 (s, br, 1H). ##STR757##
1-(3-t-butyl-1-(1- oxo-1,2,3,4- tetrahydroisoquinolin- 7-yl)-1H-
pyrazol-5-yl)-3-(5- methylisoxazol-3- yl)urea 336 mg, 34% yield
General method D 409.2 1.28 (s, 9H), 2.33 (s, 3H), 2.94-2.98 (m,
2H), 3.39-3.42 (m, 2H), 6.37 (s, 1H), 6.46 (s, 1H), 7.44-7.46 (m,
1H), 7.60-7.63 (m, 1H), 7.90 (s, 1H), 8.11 (s, br, 1H), 8.75 (s,
1H), 9.84 (s, 1H).
General Experimental for Examples 315-326
[1007] A solution of Example A35 and the appropriate isocyanate
(general method A) or the appropriate aniline (general method D)
were combined to yield the indicated compound. TABLE-US-00011 MS
(EI) Example Name (M + H.sup.+) .sup.1H NMR (400 MHz, DMSO-d.sub.6)
##STR758## 1-(3-t-butyl-1-(2- oxo-1,2,3,4- tetrahydroquinolin-6-
yl)-1H-pyrazol-5-yl)- 3-(4- chlorophenyl)urea 461 mg, 60% yield
General method A 438.3 acetone-d.sub.6: .delta. 9.29 (brs 1H), 8.55
(brs, 1H), 7.87 (brs, 1H), 7.50 (dt, J=8.8, and 2.4 Hz, 2H), 7.36
(brs, 1H), 7.32 (dd, J=8.4, 2.4 Hz, 1H), 7.27 (dt, J=8.4, 2.4 Hz,
2H), 7.03 (d, 1H, J=8.0 Hz), 6.44 (s, 1H), 3.00 (t, J=7.4 Hz, 2H),
2.53 (t, J=7.4 Hz, 2H), # 1.31 (s, 9H) ##STR759##
1-(3-t-butyl-1-(2- oxo-1,2,3,4- tetrahydroquinolin-6-
yl)-1H-pyrazol-5-yl)- 3-(thiophen-3-yl)urea 0.33 g, 22% yield
General method A 410.0 10.3 (s, 1H), 9.24 (s, 1H), 8.29 (s, 1H),
7.43 (dd, J=3.2, and 5.2 Hz, 1H), 7.30 (m, 1H), 7.24 (m, 2H), 6.96
(m, 1H), 6.34 (s, 1H), 2.95 (t, J=7.2 Hz, 2H), 1.26 (s, 9H)
##STR760## 1-(3-t-butyl-1-(2- oxo-1,2,3,4- tetrahydroquinolin-6-
yl)-1H-pyrazol-5-yl)- 3-(4- fluorophenyl)urea 72 mg, 49% yield
General method A 422.2 10.3 (s, 1H), 9.02 (s, 1H), 8.32 (s, 1H),
7.44 (m, 2H), 7.31 (brs, 1H), 7.26 (dd, J=2.0, and 8.4 Hz, 1H),
7.12 (m, 2H), 6.97 (d, J=8.4 Hz, 1H), 6.33 (s, 1H), 4.79 (m, 1H),
2.97 (t, J=7.6 Hz, 2H), 1.26 (s, 9H) ##STR761## 1-(3-t-butyl-1-(2-
oxo-1,2,3,4- tetrahydroquinolin-6- yl)-1H-pyrazol-5-yl)-
3-cyclohexylurea 52 mg, 39% yield General method A 410.2 10.3 (s,
1H), 7.91 (s, 1H), 7.24 (d, J=2.0 Hz, 1H), 7.18 (dd, J=2.4, and 8.0
Hz, 1H), 6.94 (d, J=8.4 Hz, 1H), 6.47 (d, J=8.0 Hz, 1H), 6.24 (s,
1H), 3.39 (m, 1H), 2.93 (t, J=7.6 Hz, 2H), 2.47 (m, 2H), 1.75 (m,
2H), 1.62 (m, 2H), 1.51 (m, 1H), 1.28 (m, 2H), 1.23 (s, 9H), 1.12
(m, 3H) ##STR762## 1-(3-t-butyl-1-(2- oxo-1,2,3,4-
tetrahydroquinolin-6- yl)-1H-pyrazol-5-yl)- 3-phenylurea as a
off-white powder 27 mg, 19% yield General method A 404.2 10.3 (s,
1H), 8.99 (s, 1H), 8.33 (s, 1H), 7.39 (dd, J=0.8, and 8.4 Hz, 2H),
7.27 (m, 4H), 6.97 (d, J=8.8 Hz, 2H), 6.35 (s, 1H), 4.79 (m, 1H),
2.96 (t, J=7.6 Hz, 2H), 1.26 (s, 9H) ##STR763## 1-(3-t-butyl-1-(2-
oxo-1,2,3,4- tetrahydroquinolin-6- yl)-1H-pyrazol-5-yl)- 3-(2,3-
difluorophenyl)urea 0.035 g, 13% yield, 2 steps General method D
440.2 10.3 (s, 1H), 9.11 (brs, 1H), 8.85 (s, 1H), 7.94 (t, J=6.8
Hz, 1H), 7.31 (d, J=2.0 Hz, 1H), 7.25 (dd, J=2.0, and 8.0 Hz, 1H),
7.13 (m, 1H), 7.03 (m, 1H), 6.98 (d, J=8.4 Hz, 1H), 6.37 (s, 1H),
2.96 (t, J=7.2 Hz, 2H), 1.26 (s, 9H) ##STR764## 1-(3-t-butyl-1-(2-
oxo-1,2,3,4- tetrahydroquinolin-6- yl)-1H-pyrazol-5-yl)- 3-(2,4-
difluorophenyl)urea 58 mg, 51% yield General method D 440.2 1.26
(s, 9H), 2.45-2.52 (m, 2H), 2.93-2.97 (m, 2H), 6.35 (s, 1H),
6.96-7.03 (m, 2H), 7.23-7.32 (m, 3H), 8.03-8.07 (m, 1H), 8.76 (brs,
1H), 8.89 (brs, 1H), 10.28 (s, 1H) ##STR765## 1-(3-t-butyl-1-(2-
oxo-1,2,3,4- tetrahydroquinolin-6- yl)-1H-pyrazol-5-yl)- 3-(2,3,4-
trifluorophenyl)urea 16 mg, 16% yield General method D 458.3 1.25
(s, 9H), 2.45-2.52 (m, 2H), 2.93-2.97 (m, 2H), 6.35 (s, 1H),
6.96-6.98 (m, 1H), 7.23-7.31 (m, 3H), 7.85-7.87 (m, 1H), 8.78 (s,
1H), 9.05 (s, 1H), 10.29 (s, 1H) ##STR766## 1-(3-t-butyl-1-(2-
oxo-1,2,3,4- tetrahydroquinolin-6- yl)-1H-pyrazol-5-yl)- 3-(2,4,5-
trifluorophenyl)urea, 23 mg, 23% yield General method D 458.3 1.26
(s, 9H), 2.47-2.56 (m, 2H), 2.93-2.97 (m, 2H), 6.37 (s, 1H),
6.97-6.99 (d, 1H), 7.23-7.31 (m, 2H), 7.60-7.64 (m, 1H), 8.16-8.19
(m, 1H), 8.84 (s, 1H), 9.10 (s, 1H), 10.29 (m, 1H) ##STR767##
1-(3-t-butyl-1-(2- oxo-1,2,3,4- tetrahydroquinolin-6-
yl)-1H-pyrazol-5-yl)- 3-(3,4,5- trifluorophenyl)urea 28 mg, 28%
yield General method D 458.3 1.26 (s, 9H), 2.46-2.52 (m, 2H),
2.92-2.96 (m, 2H), 6.34 (s, 1H), 6.94-6.96 (d, 1H), 7.23-7.34 (m,
4H), 8.51 (s, 1H), 9.30 (s, 1H), 10.27 (s, 1H) ##STR768##
1-(3-t-butyl-1-(2- oxo-1,2,3,4- tetrahydroquinolin-6-
yl)-1H-pyrazol-5-yl)- 3-(3- phenoxyphenyl)urea. 50 mg, 42% yield
General method A 496.3 1.24 (s, 9H), 2.46-2.50 (m, 2H), 2.92-2.95
(m, 2H), 6.31 (s, 1H), 6.61 (d, 1H), 6.95-7.41 (m, 11H), 8.29 (s,
1H), 9.09 (s, 1H), 10.27 (s, 1H) ##STR769## 1-(3-t-butyl-1-(2-
oxo-1,2,3,4- tetrahydroquinolin-6- yl)-1H-pyrazol-5-yl- 3-(3,5-
difluorophenyl)urea 34 mg, 18% yield General method A 440.2 1.26
(s, 9H), 2.46-2.50 (m, 2H), 2.92-2.96 (m, 2H), 6.34 (s, 1H),
6.77-6.82 (m, 1H), 6.95-6.97 (m, 1H), 7.11-7.14 (m, 2H), 7.23-7.31
(m, 2H), 8.49 (s, 1H), 9.36 (s, 1H), 10.27 (s, 1H)
[1008] ##STR770##
[1009] To a solution of amide compound (Example 310, 0.31 g, 0.8
mmol) in THF (10 mL) was added a solution of Lithium Aluminum
Hydride (8 mL of 1M soln, 8 mmol) at RT and stirred for 16 h at
65.degree. C. under Ar. The mixture was cooled to 0.degree. C., to
this were added 0.3 mL of water, 0.3 mL of 3M NaOH and 0.3 mL water
sequentially. The resultant suspension was stirred at RT for 6 h,
filtered over celite, celite was washed with EtOAC (3.times.5 mL).
The combined filtrate was concentrated to afford residue, which was
stirred with 1 mL of HCl in ethyl acetate for 30 min. The resultant
solid was filtered and washed with ether, dried under vacuum to
yield
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-7-yl)-1H-pyrazol-5-yl)-3-cy-
clohexylurea (80 mg, 27% yield) as a solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.57 (brs, 2H), 8.27 (s, 1H), 7.40-7.32 (m,
3H), 6.73 (brs, 1H), 6.25 (s, 1H), 4.35-4.31 (m, 2H), 3.39-3.37 (m,
3H), 3.04 (t, J=6.4 Hz, 2H), 1.74-1.51 (m, 6H), 1.25 (s, 9H),
1.19-1.07 (s, 4H). MS (ESI) m/z: 393.3 (M+H.sup.+). ##STR771##
[1010] Using the same method as for Example 108, Example 144 (70
mg, 0.15 mmol) and methanesulfonyl chloride (34 mg, 0.30 mmol) were
combined to yield
1-(3-t-butyl-1-(2-(methylsulfonyl)-1,2,3,4-tetrahydroisoquinolin-6--
yl)-1H-pyrazol-5-yl)-3-(2,3-difluorophenyl)urea (60 mg, 80% yield).
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.11 (brs, 1H), 8.87
(s, 1H), 7.92 (m, 1H), 7.35 (m, 3H), 7.13 (m, 1H), 7.03 (m, 1H),
6.40 (s, 1H), 4.43 (s, 2H), 3.50 (t, J=6.0 Hz, 2H), 3.00 (t, J=6.0
Hz, 2H), 2.98 (s, 3H), 1.27 (s, 9H); LC-MS (EI) m/z: 504.2
(M+H.sup.+).
General Experimental for Examples 329-333
[1011] A solution of Example A5 and the appropriate isocyanate
(general method A) or the appropriate aniline (general method D)
were combined to yield the indicated compound. TABLE-US-00012 MS
(EI) Example Name (M + H.sup.+) .sup.1H NMR (400 MHz, DMSO-d.sub.6)
##STR772## 1-(3-t-butyl-1-(2- oxo-1,2- dihydroquinolin-6-
yl)-1H-pyrazol-5-yl)- 3-(2,3- difluorophenyl)urea 39 mg, 41% yield
General method A 438.0 9.06 (s, 1H), 8.88 (s, 1H), 8.01 (d, J=9.6
Hz, 1H), 7.93 (m, 1H), 7.84 (d, J=2.4 Hz, 1H), 7.63 (dd, J=2.0 Hz,
1H), 7.44 (d, J=8.8 Hz, 1H), 7.13 (m, 1H), 7.03 (m, 1H), 6.60 (dd,
J=2.0, and 9.6 Hz, 1H), 6.41 (s, 1H), 1.28 (s, 9H) ##STR773##
t-butyl-1-(2-oxo-1,2- dihydroquinolin-6- yl)-1H-pyrazol-5-yl)-
3-(2,4,5- trifluorophenyl)urea as a pale yellow powder 35 mg, 39%
yield General method D 456.0 9.06 (s, 1H), 8.88 (s, 1H), 8.18 (m,
1H), 8.00 (d, J=6.4 Hz, 1H), 7.84 (d, J=2.4 Hz, 1H), 7.63 (m, 2H),
7.43 (d, J=8.8 Hz, 1H), 6.59 (dd, J=2.0, and 9.6 Hz, 1H), 6.42 (s,
1H), 1.28 (s, 9H) ##STR774## 1-(3-t-butyl-1-(2- oxo-1,2-
dihydroquinolin-6- yl)-1H-pyrazol-5-yl)- 3-(2,3,5-
trifluorophenyl)urea as a pale yellow powder 15 mg, 17% yield
General method D 456.0 9.30 (s, 1H), 8.97 (s, 1H), 8.01 (d, J=9.6
Hz, 1H), 7.87 (m, 1H), 7.84 (d, J=2.4 Hz, 1H), 7.63 (dd, J=2.4, and
8.4 Hz, 1H), 7.12 (m, 1H), 6.59 (dd, J=2.0, and 9.6 Hz, 1H), 6.43
(s, 1H), 1.28 (s, 9H) ##STR775## 1-(3-t-butyl-1-(2- oxo-1,2-
dihydroquinolin-6- yl)-1H-pyrazol-5-yl)- 3-(2,4-
difluorophenyl)urea as off-white solid 8 mg, 12% yield General
method D 438.0 8.84 (d, J=2.0 Hz, 1H), 8.79 (s, 1H), 8.06 (m, 1H),
8.00 (d, J=9.6 Hz, 1H), 7.83 (d, J=2.0 Hz, 1H), 7.62 (dd, J=2.0,
and 8.8 Hz, 1H), 7.43 (d, J=8.8 Hz, 1H), 7.29 (m, 1H), 7.04 (m,
1H), 6.59 (dd, J=2.0, and 9.6 Hz, 1H), 6.40 (s, 1H), 1.28 (s, 9H)
##STR776## 1-(3-t-butyl-1-(2- oxo-1,2- dihydroquinoiln-6-
yl)-1H-pyrazol-5-yl)- 3-(2,3,4- trifluorophenyl)urea 9 mg, 13%
yield General method D 456.0 9.05 (s, 1H), 8.83 (s, 1H), 8.06 (m,
1H), 8.00 (d, J=9.6 Hz, 1H), 7.83 (d, J=2.0 Hz, 1H), 7.63 (dd,
J=2.0, and 8.8 Hz, 1H), 7.43 (d, J=8.8 Hz, 1H), 7.26 (m, 1H), 6.60
(dd, J=2.0, and 9.6 Hz, 1H), 6.40 (s, 1H), 1.28 (s, 9H)
[1012] ##STR777##
[1013] Using general method D, Example A46 (0.55 mg, 1.8 mmol) and
2,3-difluoroaniline (27 mg, 0.21 mmol) were combined to yield
1-(3-t-butyl-1-(2-oxo-2,3,4,5-tetrahydro-1H-benzo[d]azepin-7-yl)-1H-pyraz-
ol-5-yl)-3-(2,3-difluorophenyl)urea as a pale yellow powder (15 mg,
2% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.11 (s,
0.65H), 9.06 (s, 0.35H), 8.86 (s, 0.65H), 8.72 (s, 0.35H), 7.91 (m,
1H), 7.68 (t, J=5.6 Hz, 0.65H), 7.61 (t, J=5.6 Hz, 0.35H),
7.38-7.02 (m, 4H), 6.39 (s, 0.35H), 6.38 (s, 0.65H), 3.89 (s,
0.70H), 3.87 (s, 1.30H), 3.52 (dd, J=5.6, and 11.6 Hz, 1.30H), 3.41
(m, 0.70H), 3.07 (t, J=6.0 Hz, 2H), 1.26 (s, 5.85H), 1.24 (s,
3.15H); MS (EI) m/z: 454.0 (M+H.sup.+). ##STR778##
[1014] Using general method A, Example A46 (70 mg, 0.18 mmol) and
3-fluorophenyl isocyanate (25 mg, 0.18 mmol) were combined to yield
1-(3-t-butyl-1-(2,3,4,5-tetrahydro-1H-benzo[d]azepin-7-yl)-1H-pyrazol-5-y-
l)-3-(3-fluorophenyl)urea HCl salt. (0.21 g, 25% yield). .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .delta. 9.59 (brs, 1H), 9.09 (m, 1H),
9.04 (m, 1H), 8.63 (s, 1H), 7.45 (t, J=2.0 Hz, 1H), 7.42 (m, 2H),
7.34 (m, 1H), 7.28 9m, 1H), 7.06 (dd, J=1.6, and 8.0 Hz, 1H), 6.78
(dt, J=2.4, and 8.4 Hz, 1H), 6.36 (d, J=1.6 Hz, 1H), 3.20 (m, 4H),
3.15 (m, 4H), 1.27 (s, 9H); LC-MS (EI) m/z: 422.2 (M+H.sup.+).
##STR779##
[1015] Using the same method as for Example 108, Example 166 (70
mg, 0.14 mmol) and methanesulfonyl chloride (19 mg, 0.17 mmol) were
combined to yield
1-(3-t-butyl-1-(3-(methylsulfonyl)-2,3,4,5-tetrahydro-1H-benzo[d]az-
epin-7-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea as a white
off solid (22 mg, 29% yield). .sup.1H NMR (400 MHz, CDCl.sub.3):
.delta. 8.17 (dd, J=2.0, and 7.2 Hz, 1H), 7.70 (s, 1H), 7.24 (m,
5H), 6.55 (bs, 1H), 6.46 (s, 1H), 3.47 (m, 4H), 3.07 (m, 4H), 2.82
(s, 3H), 1.40 (s, 9H); LC-MS (EI) m/z: 550.0 (M+H.sup.+).
##STR780##
[1016] 3-Aminophenylacetic acid (2.00 g, 13 mmol, 1.0 eq) was
dissolved with sonication in 1M HCl (40 ml, 40 mmol, 3.00 eq) and
cooled thoroughly in an ice/salt bath until the internal
temperature was -5-0.degree. C. A solution of NaNO.sub.2 (0.98 g,
14 mmol, 1.07 eq) in H.sub.2O (3 ml) was added slowly such that the
internal temperature did not exceed 0.degree. C. After 15 min the
reaction was treated with a solution of SnCl.sub.2.2H.sub.2O (15 g,
66 mmol, 5.00 eq) in conc. HCl (15 ml). The reaction was stirred
for 2 h with warming to +15.degree. C. The yellow solution was
filtered through a cotton plug (to remove particulates and a little
dark sludge) into a solution of
3-oxo-3-(thiophen-3-yl)propanenitrile (2.4 g, 16 mmol, 1.2 eq) in
EtOH (60 ml). The reaction was heated in a 75.degree. C. oil bath
overnight. The reaction was complete, consisting of a roughly 2:1
mixture of desired ester and the corresponding acid. The reaction
was cooled to RT and then concentrated to remove most of the EtOH.
The aqueous residue was chilled in an ice bath and treated with 6M
NaOH (ca. 55 ml) to pH 8. EtOAc (100 ml) was added and the mixture
shaken to dissolve product. The suspension was vacuum filtered
through paper to remove tin salts and the cake washed with EtOAc
(50 ml). The layers of the clear filtrate were separated and the
organic washed with brine (2.times.) and dried (MgSO.sub.4).
Filtration and evaporation gave 4.6 g of a dark oil. This was
dissolved in EtOH (55 ml), treated with satd. HCl/EtOH (5-6 ml) and
heated at 75.degree. C. overnight. When the esterification was
complete, the reaction was cooled to RT and concentrated to remove
EtOH. The residue was treated with satd. NaHCO.sub.3 and extracted
with EtOAc (2.times.). The combined organics were washed with satd.
NaHCO.sub.3 (1.times.), brine (1.times.) and dried (MgSO.sub.4).
Filtration and evaporation gave 4.2 g of crude product as an oil.
This was purified by flash chromatography, eluting with 13-50%
EtOAc/hexanes. Fractions containing product were pooled and
concentrated to yield ethyl
2-(3-(5-amino-3-(thiophen-3-yl)-1H-pyrazol-1-yl)phenyl)acetate (2.4
g, 55% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): 7.73-7.72 (m,
1H), 7.56-7.53 (m, 3H), 7.46-7.42 (m, 2H), 7.24-7.22 (m, 1H), 5.82
(s, 1H), 5.43 (brs, 2H), 4.11 (q, 2H, J=7.2 Hz), 3.76 (s, 2H), 1.21
(t, 3H, J=7.2 Hz); MS (ESI) m/z: 328.0 (M+H.sup.+). ##STR781##
[1017] Using general method A, Example A4 (70 mg, 0.29 mmol) and
3,4-dichlorophenyl isocyanate (54 mg, 0.29 mmol) were combined to
afford
1-(3-t-butyl-1-(3-methoxyphenyl)-1H-pyrazol-5-yl)-3-(3,4-dichlorophenyl)u-
rea (38 mg, 31% yield). .sup.1H NMR (300 MHz, CDCl.sub.3): .delta.
8.13 (s, 1H), 7.35 (d, J=2.4 Hz, 1H), 7.24 (dd, J=0.6, and 3.3 Hz,
1H), 7.19 (s, 1H), 7.12 (t, J=8.1 Hz, 1H), 6.96 (dd, J=2.4, and 8.7
Hz, 1H), 6.7-6.9 (m, 3H), 6.37 (s, 1H), 3.62 (s, 3H), 1.24 (s, 9H);
MS (EI) m/z: 433 (M+H.sup.+). ##STR782##
[1018] Using general method A, Example A4 (70 mg, 0.29 mmol) and
4-nitrophenylisocyanate (47 mg, 0.29 mmol) were combined to afford
1-(3-t-butyl-1-(3-methoxyphenyl)-1H-pyrazol-5-yl)-3-(4-nitrophenyl)urea
(62 mg, 53% yield). .sup.1H NMR (300 MHz, CDCl.sub.3): .delta. 8.54
(s, 1H), 8.08 (AB quartet, J=9.0 Hz, 2H), 7.45 (AB quartet, J=9.0
Hz, 2H), 7.38 (s, 1H), 7.11 (t, J=8.1 Hz, 1H), 6.7-6.9 (m, 3H),
6.45 (s, 1H), 3.61 (s, 3H), 1.26 (s, 9H); MS (EI) m/z: 410
(M+H.sup.+). ##STR783##
[1019] Using general method A, Example A21 (133 mg, 0.5 mmoL) and
1-chloro-4-isocyanatobenzene (90 mg, 0.6 mmoL) were combined to
afford
1-[3-t-butyl-1-(quinolin-6-yl)-1H-pyrazol-5-yl]-3-(4-chlorophenyl)urea
(100 mg, 48% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
9.12 (s, 1H), 8.91 (d, J=3.9 Hz, 1H), 8.60 (s, 1H), 8.43 (d, J=8.4
Hz, 1H), 8.12 (d, J=8.7 Hz, 1H), 8.10 (s, 1H), 7.93 (d, J=8.7 Hz,
1H), 7.57 (m, 1H), 7.38 (d, J=8.7 Hz, 2H), 7.25 (d, J=8.7 Hz, 2H),
6.41 (s, 1H), 1.28 (s, 9H). ##STR784##
[1020] Using general method A, Example A18 (5 g, 14.8 mmol) and
1,2-dichloro-3-isocyanatobenzene (2.8 g, 15.0 mmol) were combined
to afford
2-(4-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]-1H-pyrazol-1-yl}p-
henyl)acetic acid (2.1 g, 29% yield). .sup.1H NMR (DMSO-d.sub.6):
.delta. 9.24 (s, 1H), 8.77 (s, 1H), 8.05 (m, 1H), 7.47-7.38 (m,
4H), 7.30-7.28 (m, 2H), 6.36 (s, 1H), 4.08 (q, J=7.2 Hz, 2H), 2.72
(s, 2H), 1.25 (s, 9H), 1.18 (t, J=7.2 Hz, 3H); MS (ESI) m/z: 489
(M+H.sup.+). ##STR785##
[1021] Using general method A, Example A34 (5 g, 14.8 mmol) and
1-isocyanatonaphthalene (2.5 g, 15.0 mmol) were combined to afford
ethyl
2-(3-{3-t-butyl-5-[3-(naphthalen-1-yl)ureido]-1H-pyrazol-1-yl}phenyl)acet-
ate (1.5 g, 22% yield). MS (ESI) m/z: 471 (M+H.sup.+).
[1022] Using general method C, the previous compound (80 mg, 0.17
mmol) was reduced to afford
1-{3-t-butyl-1-[3-(2-hydroxyethyl)phenyl]-1H-pyrazol-5-yl}-3-(naphthalen--
1-yl)urea (50 mg, 69% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 9.00 (s, 1H), 8.75 (s, 1H), 8.00-7.87 (m, 3H), 7.65-7.21
(m, 8H), 6.38 (s, 1H), 4.68 (m, 1H), 3.65 (t, J=7.2 Hz, 2H), 2.79
(t, J=6.9 Hz, 2H), 1.26 (s, 9H); MS (ESI) m/z: 429 (M+H.sup.+).
##STR786##
[1023] Using general method A, Example A5 (5 g, 14.8 mmol) and
1-chloro-4-isocyanato-benzene (2.2 g, 15.0 mmol) were combined to
afford ethyl
2-(3-{3-t-butyl-5-[3-(4-chlorophenyl)ureido]-1H-pyrazol-1-yl}phenyl-
)acetate (2.7 g, 40% yield). .sup.1H NMR (DMSO-d.sub.6): .delta.
9.10 (s, 1H), 8.39 (s, 1H), 7.46-7.37 (m, 5H), 7.28-7.25 (m, 3H),
6.34 (s, 1H), 4.04 (q, J=7.2 Hz, 2H), 3.72 (s, 2H), 1.25 (s, 9H),
1.14 (t, J=7.2 Hz, 3H); MS (ESI) m/z: 455 (M+H.sup.+).
[1024] Using general method C, the previous compound (100 mg, 0.22
mmol) was reduced to afford
1-{3-t-butyl-1-[3-(2-hydroxyethyl)phenyl]-1H-pyrazol-5-yl}-3-(4-chlorophe-
nyl)-urea (65 mg, 72% yield). .sup.1H NMR (DMSO-d.sub.6): .delta.
9.11 (s, 1H), 8.36 (s, 1H), 7.41-7.21 (m, 8H), 6.33 (s, 1H), 3.61
(q, J=7.2 Hz, 2H), 2.76 (t, J=6.9 Hz, 2H), 1.24 (s, 9H); MS (ESI)
m/z: 413 (M+H.sup.+). ##STR787##
[1025] Using general method C, Example 114 (87 mg, 0.22 mmol) was
reduced to afford
1-{1-[3-(aminomethyl)phenyl]-3-t-butyl-1H-pyrazol-5-yl}-3-(4-ch-
loro-phenyl)urea as the HCl salt (78 mg, 82% yield). .sup.1H NMR
(DMSO-d.sub.6): .delta. 9.96 (s, 1H), 8.85 (s, 1H), 8.42 (br s,
3H), 7.72 (s, 1H), 7.56-7.55 (m, 2H), 7.48-7.45 (m, 3H), 7.32-7.30
(m, 2H), 6.41 (s, 1H), 4.16-4.12 (m, 2H), 1.29 (s, 9H); MS (ESI)
m/z: 398.3 (M+H.sup.+), 400.2 (M+2+H.sup.+).
[1026] The previous compound (100.0 mg, 0.25 mmol) and CDI (45 mg,
0.28 mmol) were combined in DMF (2 mL) and stirred at RT for 2 h.
Morpholine (0.028 mL) was added and the mixture was stirred
overnight at RT. The mixture was concentrated and the residue was
purified silica gel column chromatography to yield
1-(3-t-butyl-1-{3-[(morpholine-4-carboxamido)methyl]phenyl}-1H-pyrazol-5--
yl)-3-(4-chlorophenyl)urea (25 mg, 20% yield). .sup.1H-NMR (300
MHz, DMSO-d.sub.6): .delta. 9.18 (s, 1H), 8.40 (s, 1H), 7.25-7.45
(m, 8H), 7.15 (t, J=6.0 Hz, 1H), 6.35 (s, 1H), 4.29 (d, J=5.4 Hz,
2H), 3.49 (t, J=4.8 Hz, 4H), 3.25 (t, J=4.8 Hz, 4H), 1.25 (s, 9H).
##STR788##
[1027] Using general method I, Example 373 (200 mg, 0.46 mmol) and
piperidine-4-carboxylic acid ethyl ester (102 mg, 0.65 mmol) were
combined to afford ethyl
1-[2-(3-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]-1H-pyrazol-1-yl}pheny-
l)acetyl]piperidine-4-carboxylate (125 mg, 45% yield). .sup.1H NMR
(300 MHz, DMSO-d.sub.6): .delta. 9.21 (br s, 1H), 8.74 (br s, 1H),
8.03 (m, 1H), 7.42-7.24 (m, 6H), 6.35 (s, 1H), 4.15 (m, 1H), 4.01
(q, J=7.2 Hz, 2H), 3.88 (m, 1H), 3.76 (q, J=5.4 Hz, 2H), 3.04 (m,
1H), 2.71 (m, 1H), 2.50 (m, 1H), 1.78-1.70 (m, 2H), 1.47-1.30 (m,
2H), 1.24 (s, 9H), 1.12 (t, J=7.2 Hz, 3H); MS (ESI) m/z: 600
(M+H.sup.+). ##STR789##
[1028] Using general method E, Example 344 (75 mg, 0.13 mmol) was
saponified to afford acid
1-[2-(3-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]-1H-pyrazol-1-yl}pheny-
l)acetyl]piperidine-4-carboxylic acid (50 mg, 67% yield). .sup.1H
NMR (300 MHz, DMSO-d.sub.6): .delta. 9.22 (s, 1H), 8.75 (s, 1H),
8.03 (m, 1H), 7.42-7.20 (m, 6H), 6.35 (s, 1H), 4.17 (m, 1H), 3.86
(m, 1H), 3.76 (s, 2H), 3.56 (m, 1H), 2.69 (m, 1H), 2.60 (m, 1H),
1.77-1.63 (m, 2H), 1.44-1.25 (m, 2H), 1.24 (s, 9H); MS (ESI) m/z:
572 (M+H.sup.+). ##STR790##
[1029] Using general method I, Example 383 (200 mg, 0.43 mmol) and
piperidine-3-carboxylic acid ethyl ester (102 mg, 0.65 mmol) were
combined to afford ethyl
1-[2-(4-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]-1H-pyrazol-1-yl}pheny-
l)acetyl]piperidine-3-carboxylate (120 mg, 47% yield). .sup.1H NMR
(300 MHz, CDCl.sub.3): .delta. 8.60 (s, 1H), 8.50 (s, 1H), 8.12 (m,
1H), 7.37 (d, J=7.8 Hz, 2H), 7.25-7.15 (m, 4H), 6.59 (s, 1H), 4.35
(m, 1H), 4.18-4.12 (m, 2H), 3.88-3.52 (m, 5H), 2.41 (m, 1H),
2.05-1.88 (m, 2H), 1.78-1.62 (m, 2H), 1.34 (s, 9H), 1.25 (t, J=7.2
Hz, 3H); MS (ESI) m/z: 600 (M+H.sup.+). ##STR791##
[1030] Using general method E, Example 346 (70 mg, 0.12 mmol) was
saponified to afford
1-[2-(4-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]-1H-pyrazol-1-yl}-phen-
yl)acetyl]piperidine-3-carboxylic acid (50 mg, 73% yield). .sup.1H
NMR (300 MHz, DMSO-d.sub.6): .delta. 9.26 (s, 1H), 8.77 (s, 1H),
8.02 (m, 1H), 7.41 (d, J=8.4 Hz, 2H), 7.34-7.25 (m, 4H), 6.30 (s,
1H), 4.36 (m, 1H), 3.84 (m, 1H), 3.79-3.74 (m, 2H), 3.40 (m, 1H),
3.00 (m, 1H), 2.55 (m, 1H), 1.88-1.85 (m, 2H), 1.67-1.48 (m, 2H),
1.23 (s, 9H); MS (ESI) m/z: 572(M+H.sup.+). ##STR792##
[1031] Using general method A, Example A34 (2.0 g, 6.2 mmol) and
1-isocyanatonaphthalene (1.27 g, 7.5 mmol) were combined to afford
1-[3-t-butyl-1-(1-oxo-1,2,3,4-tetrahydroisoquinolin-7-yl)-o
1H-pyrazol-5-yl]-3-(naphthalen-1-yl)urea. .sup.1H NMR (300 MHz,
CDCl.sub.3): .delta. 8.59 (brs, 1H), 8.32 (brs, 1H), 8.02 (brs,
1H), 7.85-7.04 (m, 10H), 6.62 (s, 1H), 3.42 (m, 2H), 2.83 (m, 2H),
1.34 (s, 9H) ##STR793##
[1032] Using general method C, Example 348 (1.5 g, 3.3 mmol) was
reduced to afford
1-[3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-7-yl)-1H-pyrazol--
5-yl]-3-(naphthalen-1-yl)urea (1.0 g, 69% yield). .sup.1H NMR (400
MHz, CDCl.sub.3): .delta. 7.86-6.92 (m, 10H), 6.44 (s, 1H), 3.03
(t, J=6 Hz, 2H), 2.70 (t, J=6 Hz, 2H), 1.33 (s, 9H).
General Experimental for Examples
[1033] The specified intermediates and the appropriate isocyanate
(general method A) or the appropriate aniline (general method D)
were combined to yield the pyrazole urea ester which was saponified
using General method E to yield the indicated compound.
TABLE-US-00013 MS (EI) Example Name (M + H.sup.+) .sup.1H NMR (400
MHz, DMSO-d.sub.6) ##STR794## 2-(3-(3-t-butyl-5-(3-
((S)-2,3-dihydro-1H- inden-1-yl)ureido)- 1H-pyrazol-1-
yl)phenyl)acetic acid From Example A5 0.42 g, 60% yield, 3 steps
General method D 433.2 8.09 (s, 1H), 7.46-7.18 (m, 8H), 6.91 (d,
J=8.0 Hz, 1H), 6.33 (s, 1H), 5.09 (q, J=7.6 Hz, 1H), 3.65 (s, 2H),
2.92-2.74 (m, 2H), 2.43-2.36 (m, 1H), 1.76-1.67 (m, 1H), 1.27 (s,
9H). ##STR795## 2-(3-(5-(3-(2,3- dichlorophenyl)ureido)-
3-phenyl-1H- pyrazol-1- yl)phenyl)acetic acid From Example 500 1.4
g, 64% yield, 2 steps General method A 481.0 9.42 (s, 1H), 8.88 (s,
1H), 8.09 (dd, J=6.8 Hz, 3.2 Hz, 1H), 7.86-7.83 (m, 2H), 7.60-7.57
(m, 2H), 7.50-7.32 (m, 7H), 6.95 (s, 1H), 3.69 (s, 2H). ##STR796##
2-(3-(5-(3-(2,3- dichlorophenyl)ureido)- 3-(thiazol-4-yl)-
1H-pyrazol-1- yl)phenyl)acetic acid From Example 503 0.6 g, 55%, 2
steps General method A 488.0 9.41 (s, 1H), 9.18 (d, J=2.4 Hz, 1H),
8.67 (s, 1H), 8.08 (dd, J=6.8 Hz, 2.8 Hz, 1H), 8.01 (d, J=2.4 Hz,
1H), 7.54-7.51 (m, 3H), 7.41-7.32 (m, 3H) 6.92 (s, 1H), 3.72 (s,
2H). ##STR797## 2-(3-(5-(3-(2,3- dichlorophenyl)ureido)- 3-(3-
fluorophenyl)-1H- pyrazol-1- yl)phenyl)acetic acid From Example 504
0.3 g, 68% yield, 2 steps General method A 499.0 9.40 (s, 1H), 8.85
(s, 1H), 8.07 (dd, J=6.4 Hz, 3.6 Hz, 1H), 7.70 (d, J=8.0 Hz, 1H),
7.65-7.63 (m, 1H), 7.56-7.45 (m, 4H), 7.40-7.31 (m, 3H), 7.18 (td,
J=8.8 Hz, 2.4 Hz, 1H), 7.01 (s, 1H), ##STR798## 2-(3-(5-(3-(2,3-
dichlorophenyl)ureido)- 3-(2- fluorophenyl)-1H- pyrazol-1-
yl)phenyl)acetic acid From Example 505 0.17 g,, 39% yield, 2 steps
General method A 499.0 9.44 (s, 1H), 8.88 (s, 1H), 8.08 (dd, J=6.4
Hz, 3.6 Hz, 1H), 7.99 (td, J=7.6 Hz, 1.6 Hz, 1H), 7.56-7.52 (m,
3H), 7.42-7.31 (m, 5H), 7.29-7.26 (m, 1H), 6.91 (d, J=4.0 Hz, 1H),
3.71 (s, 2H) ##STR799## 2-(3-(3-t-butyl-5-(3- (2,3-
difluorophenyl)ureido)- 1H-pyrazol-1- yl)phenyl)acetic acid From
Example A5 0.28 g, 44% yield, 3 steps General method D 429.0
.delta. 9.13 (s, 1H), 8.92 (s, 1H), 7.94-7.90 (m, 1H), 7.50-7.32
(m, 4H), 7.16-7.00 (m, 2H), 6.40 (s, 1H), 3.69 (s, 2H), 1.28 (s,
9H) ##STR800## 2-(3-(3-t-butyl-5-(3- (2,3,4-
trifluorophenyl)ureido)- 1H-pyrazol-1- yl)phenyl)acetic acid From
Example A5 0.65 g, 95% yield, 3 steps General method D 447.2
.delta. 9.12 (s, 1H), 8.92 (s, 1H), 7.88-7.81 (m 1H), 7.49-7.40 (m,
3H), 7.33-7.25 (m, 2H), 6.38 (s, 1H), 3.68 (s, 2H), 1.27 (s, 9H).
##STR801## ethyl 2-(3-(3-t-butyl- 5-(3-((S)-1,2,3,4-
tetrahydronaphthalen- 1-yl)ureido)-1H- pyrazol-1- yl)phenyl)acetate
From Example A5 0.55 g, 67% yield, 3 steps General method D 447.3
8.02 (s, 1H), 7.45-7.41 (m, 1H), 7.37-7.33 (m, 2H), 7.30-7.28 (m,
1H), 7.20-7.13 (m, 3H), 7.09--7.06 (m, 1H), 6.94-6.92 (m, 1H), 6.33
(s, 1H), 4.81-4.76 (m, 1H), 3.65 (s, 2H), 2.78-2.64 (m, 1H), #
1.89-1.84 (m, 1H), 1.78-1.68 (m, 3H), 1.27 (s, 9H) ##STR802##
2-(3-(5-(3-(2,3- dichloro- fluorophenyl)-1H- pyrazol-1-
yl)phenyl)acetic acid 0.15 g, 79% yield, 2 steps General method A
501.0 9.39 (s, 1H), 8.86 (s, 1H), 8.09-8.06 (m, 1H), 7.91-7.87 (m,
2H), 7.55-7.51 (m, 2H), 7.40-7.37 (m, 1H), 7.34-7.24 (m, 4H), 6.95
(s, 1H), 3.72 (s, 2H) ##STR803## 2-(3-(5-(3-(2,3-
dichlorophenyl)ureido)- 3-(thiazol-2-yl)- 1H-pyrazol-1-
yl)phenyl)acetic acid 55 mg, 11% yield, 2 steps General method A
490.0 9.49 (s, 1H), 8.91 (s, 1H), 8.09-8.06 (m, 1H), 7.92-7.91 (m,
1H), 7.75-7.74 (m, 1H), 7.59-7.51 (m 3H), 7.45-7.43 (m, 1H),
7.37-7.32 (m, 2H), 6.99 (s, 1H), 3.74 (s, 2H) ##STR804##
2-(3-(5-(3-((S)-2,3- dihydro-1H-inden-1- yl)ureido)-3-(2-
fluorophenyl)-1H- pyrazol-1- yl)phenyl)acetic acid From Example 505
0.184 g, 67% yield, 3 steps General method D 471.3 9.27 (brs, 1H),
8.10-7.99 (m, 2H), 7.52 (brs, 1H), 7.40-7.12 (m, 10H), 6.87-6.85
(m, 1H), 5.15-5.09 (m, 1H), 3.25 (s, 2H), 2.95-2.88 (m, 1H),
2.81-2.72 (m, 1H), 2.43-2.32 (m, 1H), 1.80-1.71 (m, 1H) ##STR805##
2-(3-(5-(3-((S)-2,3- dihydro-1H-inden-1- yl)ureido)-3-
(thiophen-2-yl)-1H- pyrazol-1- yl)phenyl)acetic acid. From Example
506 0.1091 g 8% yield, 3 steps General method D 459.0 8.27 (s, 1H),
7.50-7.41 (m, 5H), 7.37-7.36 (m, 1H), 7.25-7.18 (m, 4H), 7.13-7.10
(m, 1H), 7.02-7.00 (m, 1H), 6.81 (s, 1H), 5.13 (q, 1H, J=7.6 Hz),
3.70 (s, 2H), 2.94-2.87 (m, 1H), 2.83-2.75 (m, 1H), 2.45-2.38 (m,
1H), # 1.79-1.69 (m, 1H) ##STR806## 2-(3-(3-(2- fluorophenyl)-5-(3-
(2,3,4- trifluorophenyl)ureido)- 1H-pyrazol-1- yl)phenyl)acetic
acid From Example 505 0.40 g, 62% yield, 3 steps General method D
485.0 9.14 (s, 1H), 9.02 (s, 1H), 7.99 (dt, J=2.0, and 8.0 Hz, 1H),
7.86 (m, 1H), 7.20-7.60 (m, 8H), 6.91 (d, J=4.4 Hz, 1H), 3.73 (s,
2H) ##STR807## 2-(3-(3-(2- Fluorophenyl)-5-(3- (naphthalen-1-
yl)ureido)-1H- pyrazol-1- yl)phenyl)acetic acid From Example 505
0.30 g, 86% yield, 2 steps General method A 485.0 9.14 (s, 1H),
9.02 (s, 1H), 7.99 (dt, J=2.0, and 8.0 Hz, 1H), 7.86 (m, 1 H),
7.20-7.60 (m, 8H), 6.91 (d, J=4.4 Hz, 1H), 3.73 (s, 2H) ##STR808##
2-(3-(5-(3- (naphthalen-1- yl)ureido)-3- (thiophen-2-yl)-1H-
pyrazol-1- yl)phenyl)acetic acid From Example 506 0.35 g, 15%
yield, 3 steps General method D 469.0 10.7 (brs, 1H), 10.5 (brs,
1H), 8.70 (d, J=6.8 Hz, 1H), 8.03 (d, J=Hz, 1H), 7.86 (dd, J=2.4
and 9.6 Hz, 1H), 7.68 (s, 1H), 7.58 (d, J=8.4 Hz, 1H), 7.45 (m,
5H), 7.38 (t, J=7.6 Hz, 1H), 7.30 (d, J=7.6 Hz, 1H), 7.20 (d, J=7.2
Hz, 1H), 7.12 # (dd, J=3.6, and 5.2 Hz, 1H), 6.90 (s, 1H), 3.40 (s,
2H) ##STR809## 2-(3-(3-(thiophen-2- yl)-5-(3-(2,3,4-
trifluorophenyl)ureido)- 1H-pyrazol-1- yl)phenyl)acetic acid From
Example 506 0.36 g, 14% yield, 3 steps General method D 473.0 7.58
(brs, 1H), 7.54 (m, 1H), 7.45 (dd, J=0.8, and 5.2 Hz, 1H), 7.43
(dd, J=1.2, and 3.6 Hz, 1H), 7.31 (q, J=7.6 Hz, 1H), 7.26 (m, 1H),
7.14 (m, 2H), 7.08 (dd, J=3.2, and 4.8 Hz, 1H), 6.71 (s, 1H)
##STR810## 2-(3-(5-(3-(2,3- dichlorophenyl)ureido)-
3-(thiophen-2-yl)- 1H-pyrazol-1- yl)phenyl)acetic acid From Example
506 73.8 mg, 96% yield, 3 steps General method D 489.0
(CDCl.sub.3): 9.21 (s, 1H), 8.54 (s, 1H), 8.10-8.08 (m, 1H), 7.47
(s, 1H), 7.36-7.35 (m, 2H), 7.25-7.23 (m 2H), 7.13-7.01 (m, 3H),
6.94-6.92 (m, 1H), 6.74 (s, 1H), 3.55 (s, 2H). ##STR811##
2-(3-(5-(3-(2,3- dichlorophenyl)ureido)- 3-(thiophen-3-yl)-
1H-pyrazol-1- yl)phenyl)acetic acid From Example A74 0.25 g, 94%
yield, 2 steps General method A 487.0 9.41 (s, 1H), 8.87 (s, 1H),
8.08 (dd, J=6.8 Hz, 3.2 Hz, 1H), 7.88-7.87 (m, 1H), 7.61 (dd, J=5.2
Hz, 2.8 Hz, 1H), 7.53-7.49 (m, 4H), 7.38-7.31 (m, 3H), 6.86 (s,
1H), 3.71 (s, 2H). ##STR812## 2-(3-(3-cyclopentyl- 5-(3-(2,3-
dichlorophenyl)ureido)- 1H-pyrazol-1- yl)phenyl)acetic acid From
Example A14 0.214 g, 61%, yield, 2 steps General method A 475.0
9.24 (s, 1H), 8.77 (s, 1H), 8.09-8.04 (m, 1H), 7.49-7.39 (m, 3H),
7.34-7.29 (m, 3H), 6.33 (s, 1H), 3.68 (s, 2H), 3.06-2.98 (m, 1H),
2.02-1.93 (m, 2H), 1.76-1.59 (m, 6H); ##STR813##
2-(3-(3-t-butyl-5-(3- (2,4- difluorophenyl)ureido)- 1H-pyrazol-1-
yl)phenyl)acetic acid From Example A5 0.46 g, 66% yield, 3 steps
General method D 429.0 .delta. 8.91 (s, 1H), 8.84 (s, 1H),
8.07-8.01 (m, 1H), 7.47 (t, J=8.0 Hz, 1H), 7.42-7.27 (m, 4H),
7.06-7.00 (m, 1H), 6.38 (s, 1H), 3.69 (s, 2H), 1.27 (s, 9H);
##STR814## 2-(3-(3-t-butyl-5-(3- (2,4,5- trifluorophenyl)ureido)-
1H-pyrazol-1- yl)phenyl)acetic acid From Example A5 47 g, 54%
yield, 3 steps General method D 447.2 .delta. 9.12 (s, 1H), 8.91
(s, 1H), 8.20-8.13 (m, 1H), 7.66-7.58 (m, 1H), 7.48 (t, J=8.0 Hz,
1H), 7.42-7.38 (m, 2H), 7.33 (d, J=8.0 Hz, 1H), 6.40 (s, 1H), 3.69
(s, 2H), 1.27 (s, 9H). ##STR815## 2-(3-(3-t-butyl-5-(3- (2-
fluorophenyl)ureido)- 1H-pyrazol-1- yl)phenyl)acetic acid From
Example A5 0.38 g, 70% yield, 2 steps) General method A 410.7
.delta. 8.93 (d, J=2.0 Hz, 1H), 8.87 (s, 1H), 8.12 (dt, J=2.0, and
8.4 Hz, 1H), 7.48 (t, J=8.0 Hz, 1H), 7.39 (m, 2H), 7.33 (d, J=7.6
Hz, 1H), 7.22 (m, 1H), 7.13 (t, J=7.6 Hz, 1H), 7.01 (m, 1H), 6.40
(s, 1H), 3.69 (s, 2H), 1.28 (s, 9H). ##STR816## 2-(3-{5-[3-
(benzo[1,3]dioxol-5- yl)ureido]-3-t-butyl- 1H-pyrazol-1-
yl}phenyl)acetic acid From Example A5 450 mg, 94% yield, 2 steps
General method A 437 7.52-7.35 (m, 4H), 7.01 (s, 1H), 6.70-6.61 (m,
2H), 6.40 (s, 1H), 5.89 (s, 2H), 3.72 (s, 2H), 1.32 (s, 9H)
##STR817## 2-(3-{3-t-butyl-5-[3- (2,3-
dichlorophenyl)ureido]-1H-pyrazol-1- yl}phenyl)acetic acid From
Example A5 1.7 g, 84% yield, 2 steps General method A 461 9.26 (s,
1H), 8.76 (s, 1H), 8.03 (m, 1H), 7.48-7.35 (m, 3H), 7.27-7.25 (m,
3H), 6.36 (s, 1H), 3.64 (s, 2H), 1.24 (s, 9H) ##STR818##
2-(3-(3-phenyl-5-(3- (3-(pyridin-3- yloxy)phenyl)ureido)-
1H-pyrazol-1- yl)phenyl)acetic acid From Example 500 General method
D 506.0 .delta. 8.38-8.35 (m, 2H), 7.84 (s, 1H), 7.82 (s, 1H), 7.59
(s, 1H), 7.43-7.26 (m, 12H), 7.17-7.15 (m, 1H), 6.83 (s, 1H),
6.64-6.62 (m, 1H), 3.56 (s, 2H).
General Experimental for Examples
[1034] The specified intermediates and the appropriate isocyanate
(general method A) or the appropriate aniline (general method D)
were combined to yield the pyrazole urea ester which was saponified
using General method E to yield the indicated compound.
TABLE-US-00014 MS (EI) Example Name (M + H.sup.+) .sup.1H NMR (400
MHz, DMSO-d.sub.6) ##STR819## 2-(4-(5-(3-(2,3-
dichlorophenyl)ureido)- 3-phenyl-1H- pyrazol-1- yl)phenyl)acetic
acid 61 mg, 61% yield, 2 steps General method A 481.0 9.42 (s, 1H),
8.88 (s, 1H), 8.09 (dd, J=6.8 Hz, 3.2 Hz, 1H), 7.85-7.83 (m, 2H),
7.59-7.57 (m, 2H), 7.50-7.32 (m, 7H), 6.95 (s, 1H), 3.69 (s, 2H)
##STR820## 2-(4-(3-t-butyl-5-(3- (2,4- difluorophenyl)ureido)-
1H-pyrazol-1- yl)phenyl)acetic acid From Example A18 0.55 g, 64%
yield, 3 steps General method D 429.0 9.15 (s, 1H), 8.93 (s, 1H),
7.94 (t, J=8.0 Hz, 1H), 7.46 (d, J=8.4 Hz, 2H), 7.43 (d, J=8.4 Hz,
2H), 7.18-7.0 (m, 3H), 6.40 (s, 1H), 3.66 (s, 2H), 1.27 (s, 9H)
##STR821## 2-(4-(3-t-butyl-5-(3- (2,3,4- trifluorophenyl)ureido)-
1H-pyrazol-1- yl)phenyl)acetic acid From Example A18 0.15 g, 53%
yield, 3 steps General method D 447.2 9.11 (s, 1H), 8.91 (s, 1H),
7.87-7.81 (m, 1H), 7.46 (d, J=8.4 Hz, 2H), 7.42 (d, J=8.4 Hz, 2H),
7.29-7.22 (m, 1H), 6.38 (s, 1H), 3.75 (s, 2H), 1.27 (s, 9H)
##STR822## 2-(4-(5-(3-(2,3- dichlorophenyl)ureido)-
3-(thiophen-2-yl)- 1H-pyrazol-1- yl)phenyl)acetic acid From Example
511 0.18 g, 47% yield, 2 steps General method A 487.0 9.45 (s, 1H),
8.90 (s, 1H), 8.09 (dd, J=6.8 Hz, 3.2 Hz, 1H), 7.55-7.47 (m, 5H),
7.34-7.31 (m, 3H), 7.11 (dd, J=4.8 Hz, 3.6 Hz, 1H), 6.86 (s, 1H),
3.69 (s, 2H) ##STR823## 2-(4-(5-(3-(2,3- dichlorophenyl)ureido)-
3-(3- fluorophenyl)-1H- pyrazol-1- yl)phenyl)acetic acid 0.15 g,
55% yield, 2 steps General method A 499.0 9.45 (s, 1H), 8.89 (s,
1H), 8.09 (dd, J=6.8 Hz, 3.2 Hz, 1H), 7.69 (d, J=8.0 Hz, 1H),
7.64-7.62 (m, 1H), 7.58 (d, J=8.0 Hz, 2H), 7.49-7.45 (m, 3H),
7.34-7.31 (m, 2H), 7.17 (td, J=8.8 Hz, 2.4 Hz, 1H), 7.01 (s, 1H),
3.70 (s, 2H) ##STR824## 2-(4-(5-(3-(2,3- dichlorophenyl)ureido)-
3-(2- fluorophenyl)-1H- pyrazol-1- yl)phenyl)acetic acid 0.19 g,
55% yield, 2 steps General method A 499.0 9.47 (s, 1H), 8.90 (s,
1H), 8.12 (dd, J=6.4 Hz, 3.2 Hz, 1H), 7.99 (td, J=7.6 Hz, 2.4 Hz,
1H), 7.59 (d, J=8.4 Hz, 2H), 7.49 (d, J=8.4 Hz, 2H), 7.44-7.31 (m,
4H), 7.29-7.26 (m, 1H), 6.91 (d, J=4.0 Hz, 1H), 3.71 (s, 2H)
##STR825## 2-(4-(5-(3-(2,3- dichlorophenyl)ureido)-
3-(thiophen-3-yl)- 1H-pyrazol-1- yl)phenyl)acetic acid 0.20 g, 50%
yield, 2 steps General method A 487.0 9.40 (s, 1H), 8.86 (s, 1H),
8.09 (dd, J=6.8 Hz, 3.2 Hz, 1H), 7.87 (dd, J=3.2 Hz, 1.2 Hz, 1H),
7.61 (dd, J=5.2 Hz, 2.8 Hz, 1H), 7.56 (d, J=8.4 Hz, 2H), 7.51 (dd,
J=5.2 Hz, 1.2 Hz, 1H), 7.48 (d, J=8.4 Hz, 2H), 7.34-7.32 (m, 2H),
6.86 (s, 1H), 3.80 (s, 2H) ##STR826## 2-(4-(3-t-butyl-5-(3- (2,3-
difluorophenyl)ureido)- 1H-pyrazol-1- yl)phenyl)acetic acid From
Example A18 0.231 g, 48% yield, 3 steps General method D 429.2
(Acetone-d.sub.6): .delta. 8.51 (s, 1H), 8.45 (s, 1H), 8.13-8.09
(m, 1H), 7.56-7.53 (m, 2H),7.47-7.45 (m, 2H), 7.18-7.11 (m, 1H),
6.99-6.92 (s, 1H), 6.52 (s, 1H), 3.74 (m, 2H), 1.33 (s, 9H)
##STR827## 2-(4-{5-t-butyl-3-[3- (2,3- dichlorophenyl)ureido]-
2H-pyrazol-1- yl}phenyl)acetic acid From Example A18 1.5 g, 80%
yield, 2 steps General method A 461 9.70 (s, 1H), 9.00 (s, 1H),
7.98 (m, 1H), 7.46 (d, J=8.4 Hz, 2H), 7.35 (d, J=8.4 Hz, 2H),
7.25-7.24 (m, 2H), 6.30 (s, 1H) 3.61 (s, 2H), 1.23 (s, 9H)
##STR828## 2-(4-(5-(3-(2,3- dichlorophenyl)ureido)-
3-(thiazol-4-yl)- 1H-pyrazol-1- yl)phenyl)acetic acid From Example
47 0.15 g, 31% yield, 2 steps General method A 488.0 9.54 (s, 1H),
9.18 (d, J=1.6 Hz, 1H), 8.94 (s, 1H), 8.08 (dd, J=7.2 Hz, 2.8 Hz,
1H), 7.99 (d, J=2.0 Hz, 1H), 7.58 (d, J=8.4 Hz, 2H), 7.48 (d, J=8.4
Hz, 2H), 7.36-7.30 (m, 2H), 6.91 (s, 1H), 3.70 (s, 2H) ##STR829##
(S)-2-(4-(3-t-butyl-5- (3-(2,3-dihydro-1H- inden-1-yl)ureido)-
1H-pyrazol-1- yl)phenyl)acetic acid From Example A18 0.08 g, 22%
yield, 3 steps General method D 433.2 8.10 (s, 1H), 7.43-7.37 (m,
4H), 7.24-7.19 (m, 4H), 6.93 (d, J=7.6 Hz, 1H), 6.33 (s, 1H), 5.09
(q, J=7.6 Hz, 1H), 3.64 (s, 2H), 2.92-2.74 (m, 2H), 2.43-2.37 (m,
1H), 1.76-1.67 (m, 1H), 1.27 (s, 9H) ##STR830##
2-(4-(3-t-butyl-5-(3- (2- fluorophenyl)ureido)- 1H-pyrazol-1-
yl)phenyl)acetic acid From Example A18 0.28 g, 62% yield, 2 steps
General method A 411.2 8.96 (s, 1H), 8.88 (s, 1H), 8.12 (td, J=8.0
Hz, 1.6 Hz, 1H), 7.47-7.41 (m, 4H), 7.24-7.19 (m, 1H), 7.12 (t,
J=8.0 Hz, 1H), 7.03-6.98 (m, 1H), 6.39 (s, 1H), 3,66 (s, 2H), 1.27
(s, 9H) ##STR831## (S)-2-(4-(3-t-butyl-5- (3-(1,2,3,4-
tetrahydronaphthalen- 1-yl)ureido)-1H- pyrazol-1- yl)phenyl)acetic
acid From Example A18 0.49 g, 72% yield, 3 steps General method D
447.3 8.05 (s, 1H), 7.42-7.37 (m, 4H), 7.21-7.14 (m, 3H), 7.09-7.06
(m, 1H), 6.97-6.95 (m, 1H), 6.34 (s, 1H), 4.81-4.76 (m, 1H), 3.64
(s, 2H), 2.78-2.64 (m, 2H), 1.90-1.84 (m, 1H), 1.79-1.68 (m, 3H),
1.27 (s, 9H) ##STR832## 2-(4-(3-(2- fluorophenyl)-5-(3- (2,3,4-
trifluorophenyl)ureido)- 1H-pyrazol-1- yl)phenyl)acetic acid 0.20
g, 53% yield, 2 steps General method A 485.2 9.17 (s, 1H), 9.05 (s,
1H), 8.01-7.96 (m, 1H), 7.90-7.84 (m, 1H), 7.59-7.56 (m, 2H),
7.51-7.49 (m, 2H), 7.44-7.38 (m, 1H), 7.34-7.24 (m, 3H), 6.92-6.91
(m, 1H), 3.71 (s, 2H) ##STR833## 2-(4-(5-(3-((S)-2,3-
dihydro-1H-inden-1- yl)ureido)-3- (thiophen-2-yl)-1H- pyrazol-1-
yl)phenyl)acetic acid 51.6 mg, 83% yield, 3 steps General method D
459.0 8.28 (s, 1H), 7.50-7.43 (m, 6H), 7.25-7.18 (m, 4H), 7.12-7.10
(m, 1H), 7.05-7.03 (m, 1H), 6.80 (s, 1H), 5.16-5.10 (m, 1H), 3.67
(s, 2H), 2.94-2.87 (m, 1H), 2.83-2.73 (m, 1H), 2.45-2.37 (m, 1H),
1.79-1.69 (m, 1H) ##STR834## 2-(4-(3-cyclopentyl- 5-(3-(2,3-
dichlorophenyl)ureido)- 1H-pyrazol-1- yl)phenyl)acetic acid 0.1113
g, 72%, 2 steps General method A 473 9.29 (s, 1H), 8.81 (s, 1H),
8.11-8.06 (m, LH), 7.48-7.41 (m, 4H), 7.34-7.29 (m, 2H), 6.33 (s,
1H), 3.66 (s, 2H), 3.05-2.97 (m, 1H), 2.01-1.95 (m, 2H), 1.73-1.59
(m, 6H);
General Experimental for Examples
[1035] The specified example and the appropriate amine were coupled
using the method indicated to produce the target amide.
Alternatively, the specified example and the appropriate isocyanate
were coupled to yield the target amide. TABLE-US-00015 MS (EI)
Example Name (M + H.sup.+) .sup.1H NMR (400 MHz, DMSO-d.sub.6)
##STR835## 1-{1-[3-(2-amino- 2-oxoethyl)phenyl]- 3-t-butyl-1H-
pyrazol-5-yl}-3- cyclohexylurea From Example A8 60 mg, 30% yield
General method A 397 8.11 (s, 1H), 7.48 (br s, 1H), 7.41-7.13 (m,
4H), 6.88 (br s, 1H), 6.42 (d, J=7.2 Hz, 1H), 6.23 (s, 1H), 3.41
(s, 2H), 3.35 (m, 1H), 1.77-1.37 (m, 4H), 1.21 (s, 9H), 1.22-1.10
(m, 6H) ##STR836## 1-{1-[3-(2-amino- 2-oxoethyl)phenyl]-
3-t-butyl-1H- pyrazol-5-yl}-3- ((S)-1- phenylethyl)urea From
Example A8 85 mg, 41% yield General method A 8.09 (s, 1H), 7.49 (br
s, 1H), 7.36 (t, J=7.5 Hz, 1H), 7.19-7.29 (m, 8H), 7.00 (d, J=7.8
Hz, 1H), 6.90 (br s, 1H), 6.22 (s, 1H), ##STR837##
1-{1-[3-(2-amino- 2-oxoethyl)phenyl]- 3-t-butyl-1H-
pyrazol-5-yl}-3-(2- fluorophenyl)urea From Example A8 55 mg, 27%
yield General method A 8.90 (br s, 1H), 8.85 (br s, 1H), 8.05 (br
s, 1H), 7.50-7.20 (m, 5H), 7.20-7.00 (m, 2H), 7.00-6.80 (m, 2H),
6.34 (s, 1H), 3.41 (s, 2H), 1.22 (s, 9H) ##STR838##
1-{1-[3-(2-amino- 2-oxoethyl)phenyl]- 3-t-butyl-1H-
pyrazol-5-yl}-3- (2,3- difluorophenyl)urea From Example A8 60 mg,
28% yield General method A 428 7.86 (m, 1H), 7.55-7.37 (m, 4H),
7.08 (m, 1H), 6.89 (m, 1H), 6.46 (s, 1H), 3.63 (s, 2H), 1.32 (s,
9H) ##STR839## 1-{1-[3-(2-amino- 2-oxoethyl)phenyl]- 3-t-butyl-1H-
pyrazol-5-yl}-3- (benzo[d][1,3]dioxo 1-5-yl)urea From Example 372
70 mg, 80% yield General method K 436 8.85 (s, 1H), 8.31 (s, 1H),
7.51-7.26 (m, 5H), 7.11 (s, 1H), 6.90 (br s, 1H), 6.76 (d J=8.4 Hz,
1H), 6.65 (d, J=7.8 Hz, 1H), 6.32 (s, 1H), 5.92 (s, 2H), 3.42 (s,
2H), 1.23 (s, 9H) ##STR840## 1-(3-t-butyl-1-{3-
[2-(1,1-dioxo-1.quadrature.6- thiomorpholin-4- oxoethyl]phenyl}-
1H-pyrazol-5- yl- 3-(2,3- dichlorophenyl)urea From Example 373 54
mg, 42% yield General method I 578 9.22 (s, 1H), 8.75 (s, 1H), 8.05
(m, 1H), 7.46-7.21 (m, 6H), 6.35 (s, 1H), 3.87 (s, 2H), 3.85-3.79
(m, 4H), 3.20-3.12 (m, 2H), 3.09-3.04 (m, 2H), 1.24 (s, 9H)
##STR841## ethyl 1-[2-(3-{3-t- butyl-5-[3-(2,3-
dichlorophenyl)ureido]- 1H-pyrazol-1- yl}phenyl)acetyl]piperidine-
3-carboxylate From Example 373 130 mg, 47% yield General method I
600 9.22 (s, 1H), 8.74 (s, 1H), 8.02 (m, 1H), 7.46-7.21 (m, 6H),
6.34 (s, 1H), 4.30 (m, 1H), 4.01 (q, J=7.2 Hz, 2H), 3.90-3.70 (m,
3H), 3.34 (m, 1H), 2.95 (m, 1H), 2.72 (m, 1H), 1.90-1.75 (m, 2H),
1.70-1.40 (m, 2H), # 1.24 (s, 9H), 1.11 (t, J=7.2 Hz, 3H)
##STR842## 1-[2-(3-{3-t-butyl- 5-[3-(2,3- dichlorophenyl)-
ureido]-1H- pyrazol-1-yl}- phenyl)acetyl]piperidine- 3-carboxylic
acid From Example 373 55 mg, 69% yield General method E 572 9.21
(s, 1H), 8.74 (s, 1H), 8.02 (m, 1H), 7.42-7.21 (m, 6H), 6.34 (s,
1H), 4.38 (m, 1H), 3.88-3.74 (m, 3H), 3.32 (m, 1H), 2.97 (m, 1H),
2.68 (m, 1H), 1.90-1.75 (m, 2H), 1.70-1.40 (m, 2H), 1.24 (s, 9H)
##STR843## (2R)-methyl 1-[2- (3-{3-t-butyl-5-[3- (2,3-
dichlorophenyl)ureido]- 1H-pyrazol-1- yl}phenyl)-
acetyl]pyrrolidine- 2-carboxylate From Example 373 160 mg, 64%
yield General method I 572 9.25 (s, 1H), 8.76 (s, 1H), 8.04 (m,
1H), 7.46-7.09 (m, 6H), 6.35 (s, 1H), 4.25 (m, 1H), 3.62-3.58 (m,
2H), 3.57-3.55 (m, 2H), 3.51 (s, 3H), 1.90-1.66 (m, 4H), 1.24 (s,
9H) ##STR844## (2R)-1-[2-(3-{3-t- butyl-5-[3-(2,3-
dichlorophenyl)ureido]- 1H-pyrazol-1- yl}phenyl)acetyl]pyrrolidine-
2-carboxylic acid From Example 373 68 mg, 55% yield General method
E 558 9.25 (s, 1H), 8.77 (s, 1H), 8.04 (m, 1H), 7.46-7.21 (m, 6H),
6.53 (s, 1H), 4.18 (m, 1H), 3.73 (s, 2H), 3.60-3.57 (m, 2H),
1.88-1.73 (m, 4H), 1.24 (s, 9H) ##STR845## 1-(3-t-butyl-1-(3-
(2-(methylainino)- 2-oxoethyl)phenyl)- 1H-pyrazol-5-yl)-3- (2,3-
difluorophenyl)urea Example 355 0.09 g, 89% yield General method I
442.2 8.58 (s, 1H), 8.52 (s, 1H), 8.12-8.08 (m, 1H), 7.65 (d, J=0.8
Hz, 1H), 7.46-7.44 (m, 2H), 7.35-7.30 (m, 2H), 7.18-7.12 (m, 1H),
6.99-6.92 (m, 1H), 6.54 (s, 1H), 3.60 (s, 2H), 2.72 (d, J=4.4 Hz,
3H), 1.34 (s, 9H) ##STR846## 1-(3-t-butyl-1-(3- (2-(methylamino)-
2-oxoethyl)phenyl)- 1H-pyrazol-5-yl)-3- (2,3,4-
trifluorophenyl)urea Example 356 0.045 g, 44% yield General method
I 460.2 9.05 (s, 1H), 8.85 (s, 1H), 8.03-8.01 (m, 1H), 7.89-7.83
(m, 1H), 7.46 (t, J=8.0 Hz, 1H), 7.41-7.25 (m, 5H), 6.38 (s, 1H),
3.47 (s, 2H), 3.16 (d, J=5.2 Hz, 3H), 1.27 (s, 9H) ##STR847##
1-(1-(3-(2-amino-2- oxoethyl)phenyl)-3- t-butyl-1H-pyrazol-
5-yl)-3-((S)-1,2,3,4- tetrahydronaphthalen- 1-yl)urea Example 357
0.254 g. 51% yield General method J 446.3 8.03 (s, 1H), 7.50 (brs,
1H), 7.43-7.37 (m, 2H), 7.32-7.28 (m, 2H), 7.21-7.13 (m, 3H),
7.09-7.06 (m, 1H), 6.93-6.91 (m, 2H), 6.34 (s, 1H), 4.81-4.76 (m,
1H), 3.44 (s, 2H), 2.79-2.64 (m, 2H), 1.90-1.67 (m, 4H), 1.27 (s,
9H) ##STR848## 1-(3-t-butyl-1-(3- (2-((S)-3- hydroxypyrrolidin-
1-yl)-2- oxoethyl)phenyl)- 1H-pyrazol-5-yl)-3- (2,3-
dichlorophenyl)urea Example 373 37.7 mg, 63% yield General method K
532.2 9.27 9s, 1H), 8.79 (s, 1H), 8.10-8.07 (m, 1H), 7.48-7.37 (m,
3H), 7.34-7.28 (m 3H), 6.39 (s, 1H), 5.02 and 4.92 (d, 1H, J=3.6
Hz), 4.29-4.27 and 4.22-4.21 (m, 1H), 3.72-3.69 (m, 2H), 3.62-3.56
and 3.39-3.30 (m, # 3H), 1.93-1.69 (m, 2H), 1.28 (s, 9H) ##STR849##
1-(1-(3-(2-amino-2- oxoethyl)phenyl)-3- (4-fluorophenyl)-
1H-pyrazol-5-yl)-3- (2,3- dichlorophenyl)urea Example 358 45.4 mg
46% yield General method K 498.0 9.40 (s, 1H), 8.85 (s, 1H),
8.10-8.08 (m, 1H), 7.91-7.87 (m, 2H), 7.55-7.47 (m, 4H), 7.39-7.24
(m, 5H), 6.95 (s, 2H), 3.50 (s, 2H) ##STR850## 1-(3-t-butyl-1-(3-
(2-((R)-3- (dimethylamino)pyrrolidin- 1-yl)-2- oxoethyl)phenyl)-
1H-pyrazol-5-yl)-3- (2,3- dichlorophenyl)urea Example 373 0.053 g,
29% yield General method K 557.3 9.41 and 9.39 (s, 1H), 8.88 and
8.87 (s, 1H), 8.08-8.05 (m, 1H), 7.50-7.39 (m, 4H), 7.34-7.27 (m,
4H), 6.38 (s, 1H), 3.02-3.75 (m, 4H), 3.59-3.48 (m, 2H), 2.81-2.75
(m, 6H), 2.33-2.07 (m, 2H), 1.28 (s, 9H) ##STR851##
1-(3-t-butyl-1-(3- (2-((R)-2- (hydroxymethyl)pyrrolidin- 1-yl)-2-
oxoethyl)phenyl)- 1H-pyrazol-5-yI)-3- (2,3- dichlorophenyl)urea
Example 373 34 mg, 21% yield General method K 544.2 9.26 (s, 1H),
8.79 (s, 1H), 8.10-8.07 (m, 1H), 7.48-7.44 (m 1H), 7.39-7.37 (m
2H), 7.36-7.27 (m, 3H), 6.38 (s, 1H), 5.01-4.98 and 4.75-4.72 (m
2H), 4.05-3.92 (m 2H), 3.72-7.70 (m, 2H), 3.51-3.41 (m 3H),
3.32-3.23 (m, # 2H), 1.91-1.74 (m, 4H), 1.28 (s, 9H) ##STR852##
1-(3-t-butyl-1-(3- (2-((S)-2- (hydroxymethyl)pyrrolidin- 1-yl)-2-
oxoethyl)phenyl)- 1H-pyrazol-5-yl)-3- (2,3- dichlorophenyl)urea
Example 373 32.7 mg, 20% yield General method K 544.2 9.26 (s, 1H),
8.79 (s, 1H), 8.10-8.07 (m, 1H), 7.49-7.44 (m, 1H), 7.39-7.37 (m,
2H), 7.34-7.27 (, 3H) 6.39 (s, 1H), 5.00-4.98 and 4.74-4.71 (m 2H),
4.05-4.04 and 3.96-3.90 (m, 2H), 3.72 (brs, # 2H), 3.54-3.41 and
3.31-3.28 (m, 3H), 1.92-1.74 (m, 4H), 1.28 (s, 9H) ##STR853##
1-(3-t-butyl-1-(3- (2-((S)-2- (methoxymethyl)pyrrolidin- 1-yl)-2-
oxoethyl)phenyl)- 1H-pyrazol-5-yl)-3- (2,3- dichlorophenyl)urea
Example 373 22.6 mg, 14% yield General method K 558.3 9.26 (s, 1H),
8.78 (s, 1H), 8.10-8.06 (m, 1H), 7.49-7.44 (m, 1H), 7.39-7.37 (m,
2H), 7.34-7.25 (m, 3H), 6.38 (s, 1H), 4.25-4.21 and 4.05-4.01 (m,
1H), 3.86-3.76 and 3.75-3.67 (m, 2H), 3.52-3.46 and # 3.42-3.38 (m,
2H), 3.36-3.28 and 3.26-3.19 (m, 2H), 3.27 and 3.19 (s, 3H),
1.91-1.76 (m, 4H), 1.28 (s, 9H) ##STR854## 1-(1-(3-(2-amino-2-
oxoethyl)phenyl)-3- (thiazol-2-yl)-1H- -pyrazol-5-yl)-3- (2,3-
dichlorophenyl)urea Example 359 7.0 mg, 27% yield General method J
487.0 9.51 (s, 1H), 8.90 (s, 1H), 8.10-8.08 (m, 1H), 7.92-7.91 (m,
1H), 7.75-7.74 (m, 1H), 7.57-7.42 (m, 5H), 7.37-7.32 (m, 2H), 6.99
(s, 1H), 6.96 (brs, 1H), 3.62 (s, 2H) ##STR855##
1-(1-(3-(2-amino-2- oxoethyl)phenyl)-3- (2-fluorophenyl)-
1H-pyrazol-5-yl)-3- ((S)-2,3-dihydro- 1H-inden-1-yl)urea Example
360 56.4 mg, 24% yield General method J 470.2 8.29 (s, 1H),
8.01-7.97 (m, 1H), 7.53-7.19 (m, I1H), 7.03-7.01 (m, 1H), 6.95
(brs, 1H), 6.87-6.86 (m, 1H), 5.16-5.10 (m, 1H), 3.48 (s, 2H),
2.94-2.75 (m, 2H), 2.46-2.38 (m, 1H), 1.79-1.70 (m, 1H) ##STR856##
1-((S)-2,3-dihydro- 1H-inden-1-yl)-3- (3-(2- fluorophenyl)-1-(3-
(2-(2- hydroxyethylamino)- 2-oxoethyl)phenyl)- 1H-pyrazol-5-
yl)urea Example 360 87.9 mg, 67% yield General method K 514.2 8.30
(s, 1H), 8.15-8.12 (m, 1H), 8.01-7.96 (m, 1H), 7.51-7.17 (m, 11H),
7.03-7.01 (m, 1H), 6.88-6.86 (m, 1H), 5.16-5.10 (m, 1H), 3.53 (m,
2H), 3.43-3.39 (m, 2H), 3.13-3.09 (m, 2H), 2.94-2.87 (m, # 1H),
2.83-2.75 (m, 1H), 2.46-2.38 (m, 1H), 1.79-1.69 (m, 1H) ##STR857##
1-((S)-2,3-dihydro- 1H-inden-1-yl)-3- (1-(3-(2-(2,3-
dihydroxypropylamino)- 2- oxoethyl)phenyl)-3- (2-fluorophenyl)-
1H-pyrazol-5- yl)urea Example 360 108.7 mg, 78% yield General
method K 544.2 8.29 (s, 1H), 8.12-8/09 (m, 1H), 8.01-7.97 (m, 1H),
7.52-7.19 (m, 10H), 7.03-7.01 (m, 1H), 6.88-6.87 (m, 1H), 5.16-5.10
(m, 1H), 4.76 (d, 1H, J=5.2 Hz), 4.52 (t, 1H, J=5.6 Hz), 3.55 (s,
2H), # 3.52-3.45 (m, 1H), 3.30-3.19 (m, 3H), 2.99-2.87 (m, 2H),
2.83-2.74 (m, 1H), 2.46-2.38 (m, 1H), 1.79-1.70 (m, 1H) ##STR858##
1-(2,3- dichlorophenyl)-3- (1-(3-(2-((S)-3- hydroxypyrrolidin-
1-yl)-2- oxoethyl)phenyl)-3- (thiophen-2-yl)-1H- pyrazol-5-yl)urea
Example 366 128.5 mg, 75% yield General method K 556.0 9.42 (s,
1H), 8.87 (s, 1H), 8.11-8.09 (m, 1H), 7.54-7.45 (m, 5H), 7.38-7.32
(m, 3H), 7.13-7.11 (m, 1H), 6.87 (s, 1H), 5.03 and 4.92 (d, 1H,
J=3.6 Hz), 4.31-4.29 and 4.23-4.22 (m, 1H), 3.76 and # 3.72 (s,
2H), 3.64-3.59 (m, 1H), 3.45-3.36 (m, 1H), 3.35-3.25 (m, 1H),
1.97-1.70 (m, 2H) ##STR859## 1-(1-(3-(2-amino-2-
oxoethyl)phenyl)-3- (thiophen-2-yl)-1H- pyrazol-5-yl)-3-
((S)-2,3-dihydro- 1H-inden-1-yl)urea Example 361 27.2 mg, 38% yield
General method J 458.0 8.26 (s, 1H), 7.53 (brs, 1H), 7.50-7.45 (m,
4H), 7.41-7.35 (m, 2H), 7.26-7.18 (m, 4H), 7.12-7.10 (m, 1H),
7.02-6.99 (m, 1H), 6.94 (brs, 1H), 6.81 (s, 1H), 5.13 (q, 1H, J=7.6
Hz), 3.48 (s, 2H), 2.94-2.87 (m, 1H), 2.83-2.73 (m, # 1H),
2.47-2.38 (m, 1H), 1.79-1.69 (m, 1H) ##STR860## 1-((S)-2,3-dihydro-
1H-inden-1-yl)-3- (1-(3-(2-(2- hydroxyethylamino)- 2-
oxoethyl)phenyl)-3- (thiophen-2-yl)-1H- pyrazol-5-yl)urea Example
361 13.3 mg, 17% yield General method J 502.2 8.26 (s, 1H),
8.15-8.11 (m, 1H), 7.49-7.45 (m, 4H), 7.40-7.34 (m, 2H), 7.26-7.18
(m, 4H), 7.12-7.10 (m, 1H), 7.02-6.99 (m, 1H), 6.81 (s, 1H),
5.15-5.10 (m, 1H), 3.52 (s, 2H), 3.41-3.37 (m, 2H), # 3.14-3.09 (m,
2H), 2.95-2.74 (m, 2H), 2.45-2.38 (m, 1H), 1.79-1.71 (m, 1H)
##STR861## 1-((S)-2,3-dihydro- 1H-inden-1-yl)-3- (1-(3-(2-(2,3-
dihydroxypropylamino)- 2- oxoethyl)phenyl)-3- (thiophen-2-yl)-1H-
pyrazol-5-yl)urea Example 361 24.5 mg, 30% yield General method K
532.3 8.28 (s, 1H), 8.12-8.09 (m, 1H), 7.50-7.45 (m, 4H), 7.40-7.36
(m, 2H), 7.25-7.18 (m, 4H), 7.12-7.10 (m, 1H), 7.02-7.00 (m, 1H),
6.81 (s, 1H), 5.16-5.10 (m, 1H), 4.75 (brs, 1H), 4.52 (brs, 1H), #
3.55 (s, 2H), 3.51-3.45 (m, 1H), 3.28-3.19 (m, 3H), 2.99-2.87 (m,
2H), 2.83-2.75 (m, 1H), 2.46 2.38 (m, 1H), 1.79-1.69 (m, 1H)
##STR862## 1-(3-cyclopentyl-1- (3-(2-(2,3- dihydroxypropylamino)-
2- oxoethyl)phenyl)- 1H-pyrazol-5-yl)-3- (2,3- dichlorophenyl)urea
Example 368 24.5 mg, 30% yield General method K 546.0 9.27 (s, 1H),
8.78 (s, 1H), 8.11-8.06 (m, 2H), 7.47-7.43 (m, 2H), 7.37-7.29 (m,
3H), 6.33 (s, 1H), 3.53 (s, 2H), 3.51-3.44 (m, 1H), 3.30-3.18 (m,
3H), 3.03-2.92 (m, 2H), 1.99-1.95 (m, 2H), 1.74-1.59 (m, 6H)
##STR863## 1-(3-cyclopentyl-1- (3-(2-((S)-3-
(dimethylamino)pyrrolidin- 1-yl)-2- oxoethyl)phenyl)-
1H-pyrazol-5-yl)-3- (2,3- dichlorophenyl)urea Example 368 68.0 mg,
46% yield General method K 569.3 9.54 (s, 1H), 8.95 (s, 1H),
8.05-8.02 (m, 1H), 7.48-7.20 (m, 5H), 7.20-7.02 (m, 1H), 6.32 (s,
1H), 4.09-3.67 (m, 5H), 3.62-3.49 (m, 2H), 3.06-2.97 (m, 1H),
2.74-2.72 (m, 6H), 2.32-2.11 (m, 2H), # 2.02-1.92 (m, 2H),
1.74-1.57 (m, 6H) ##STR864## 1-(2,3- dichlorophenyl)-3-
(1-(3-(2-((S)-3- (dimethylamino)pyrrolidin- 1-yl)-2-
oxoethyl)phenyl)-3- (thiophen-2-yl)-1H- pyrazol-5-yl)urea Example
366 133.7 mg, 56% yield General method K 583.0 10.74 (brs, 1H),
9.52 (s, 1H), 8.94 (s, 1H), 8.09-8.06 (m, 1H), 7.55-7.47 (m, 5H),
7.39-7.31 (m, 3H), 7.13-7.11 (m, 1H), 6.87 (s, 1H), 4.07-4.02 and
3.93-3.73 (m, 5H), 3.61-3.45 and 3.30-3.22 (m, # 2H), 2.80-2.76 (m,
6H), 2.37-2.04 (m, 2H) ##STR865## 1-(3-cyclopentyl-1- (3-(2-(2-
hydroxyethylamino)- 2- oxoethyl)phenyl)- 1H-pyrazol-5-yl)-3- (2,3-
dichlorophenyl)urea Example 368 41.0 mg, 34% yield General method K
516.0 9.27 (s, 1H), 8.78 (s, 1H), 8.13-8.07 (m, 2H), 7.47-7.43 (m,
2H), 7.38-7.35 (m, 1H), 7.34-7.29 (m, 3H), 6.33 (s, 1H), 4.39-4.37
(m, 1H), 3.50 (s, 2H), 3.41-3.38 (m, 2H), 3.12-3.08 (m, 2H),
3.05-2.97 (m, 1H), 1.99-1.95 (m, 2H), # 1.74-1.59 (m, 6H)
##STR866## 1-(1-(3-(2-amino- 2-oxoethyl)phenyl)-
3-(2-fluorophenyl)- 1H-pyrazol-5-yl)-3- (2,3,4-
trifluorophemyl)urea Example 362 100 mg, 84% yield General method I
484.2 9.13 (s, 1H), 9.03 (s, 1H), 7.99 (dt, J=2.0, and 8.0 Hz, 1H),
7.87 (m, 1H), 7.20-7.60 (m, 8H), 6.95 (brs, 1H), 6.91 (d, J=4.4 Hz,
1H), 3.51 (s, 2H) ##STR867## 1-(1-(3-(2-amino-2-
oxoethyl)phenyl)-3- (2-fluorophenyl)- 1H-pyrazol-5-yl)-3-
(naphthalen-1- yl)urea Example 363 70 mg, 70% yield General method
I 480.2 9.13 (s, 1H), 9.02 (s, 1H), 7.9-8.1 (m, 4H), 7.2-7.7 (m,
12H), 6.96 (brs, 1H), 6.95 (d, J=4.4 Hz, 1H), 3.53 (s, 2H)
##STR868## 1-(1-(3-(2-(2,3- Dihydroxypropylamino)- 2-
oxoethyl)phenyl)-3- (2-fluorophenyl)- 1H-pyrazol-5-yl)-3-
(2,3,4-
trifluorophenyl)urea Example 362 95 mg, 83% yield General method J
558.3 9.14 (s, 1H), 9.04 (s, 1H), 8.12 (t, J=6.8Hz, 1H), 7.99 (dt,
J=2.0, and 8.0 Hz, 1H), 7.88 (m, 1H), 7.55 (s, 1H), 7.52 (d, J=7.2
Hz, 1H), 7.2-7.5 (m, 6H), 6.91 (d, J=4.0 Hz, 1H), 4.76 (d, J=4.4
Hz, 1H), 4.52 (t, J=5.6 # Hz, 1H), 3.58 (s, 2H), 3.49 (m, 1H),
3.2-3.4 (m, 4H), 2.97 (m, 1H) ##STR869## 1-(1-(3-(2-(2,3-
dihydroxypropylamino)- 2- oxoethyl)phenyl)-3- (2-fluorophenyl)-
1H-pyrazol-5-yl)-3- (naphthalen-1- yl)urea Example 363 49 mg, 50%
yield General method J 554.2 9.14 (s, 1H), 9.03 (s, 1H), 7.9-8.2
(m, 5H), 7.2-7.7 (m, 12H), 6.95 (d, J=4.0 Hz, 1H), 4.77 (d, J=5.2
Hz, 1H), 4.52 (t, J=6.0 Hz, 1H), 3.60 (s, 2H), 3.49 (m, 1H),
3.2-3.4 (m, 4H), 2.98 (m, 1H) ##STR870## 1-(3-(2-
fluorophenyl)-1-(3- (2-(2- hydroxyethylamino)- 2- oxoethyl)phenyl)-
1H-pyrazol-5-yl)-3- (naphthalen-1- yl)urea Example 363 50 mg, 57%
yield General method J 524.3 9.13 (s, 1H), 9.02 (s, 1H), 8.16 (t,
J=5.2 Hz, 1H), 7.9-8.1 (m, 4H), 7.3-7.7 (m, 11H), 6.95 (d, J=4.4
Hz, 1H), 4.69 (t, J=4.8 Hz, 1H), 3.57 (s, 2H), 3.40 (q, J=6.0 Hz,
2H), 3.14 (s, J=6.0 Hz, 2H) ##STR871## 1-(1-(3-(2-amino-2-
oxoethyl)phenyl)-3- (thiophen-2-yl)-1H- pyrazol-5-yl)-3-
(naphthalen-1- yl)urea Example 364 66 mg, 83% yield General method
I 468.0 9.12 (s, 1H), 9.01 (s, 1H), 8.02 (d, J=8.0 Hz, 1H), 7.95
(d, J=7.6 Hz, 1H), 7.93 (dd, J=2.0, and 9.2 Hz, 1H), 7.67 (d, J=8.0
Hz, 1H), 7.45-7.60 (m, 8H), 7.41 (d, J=7.2 Hz, 1H), 7.12 (dd,
J=3.6, and 4.8 Hz, 1H), 6.96 (s, 1H), 6.90 (s, 1H), 3.53 (s, 2H)
##STR872## 1-(1-(3-(2-(2- hydroxyethylamino)- 2-
oxoethyl)phenyl)-3- (thiophen-2-yl)-1H- pyrazol-5-yl)-3-
(naphthalen-1- yl)urea Example 364 51 mg, 58% yield General method
J 512.3 9.12 (s, 1H), 9.00 (s, 1H), 8.17 (brt, J=5.6 Hz, 1H), 8.02
(brd, J=8.0 Hz, 1H), 7.96 (d, J=6.8 Hz, 1H), 7.92 (dd, J=2.0, and
7.2 Hz, 1H), 7.67 (d, J=8.0 Hz, 1H), 7.45-7.60 (m, 8H), 7.41 (d,
J=7.6 Hz, 1H), 7.12 (dd, J=4.0, # and 5.2 Hz, 1H), 6.90 (s, 1H),
4.69 (t, J=5.2 Hz, 1H), 3.57 (s, 2H), 3.40 (q, J=6.4 Hz, 2H), 3.12
(q, J=6.0 Hz, 2H) ##STR873## 1-(1-(3-(2-(2,3-
dihydroxypropylamino)- 2- oxoethyl)phenyl)-3- (thiophen-2-yl)-1H-
pyrazol-5-yl)-3- (naphthalen-1- yl)urea Example 364 60 mg, 65%
yield General method J 542.3 9.13 (s, 1H), 9.00 (s, 1H), 8.13 (brt,
J=5.6 Hz, 1H), 8.02 (brd, J=8.0 Hz, 1H), 7.96 (d, J=6.8 Hz, 1H),
7.93 (dd, J=2.0, and 7.2 Hz, 1H), 7.67 (d, J=8.0 Hz, 1H), 7.45-7.60
(m, 8H), 7.42 (d, J=7.6 Hz, 1H), 7.12 (dd, J=4.0, # and 5.2 Hz,
1H), 6.90 (s, 1H), 4.77 (d, J=4.8 Hz, 1H), 4.52 (t, J=5.2 Hz, 1H),
3.59 (s, 2H), 3.48 (m, 1H), 3.26 (m, 2H), 2.98 (m, 1H) ##STR874##
1-(1-(3-(2-(1,3- dihydroxypropan-2- ylamino)-2- oxoethyl)phenyl)-3-
(thiophen-2-yl)-1H- pyrazol-5-yl)-3- (naphthalen-1- yl)urea Example
364 67 mg, 72% yield General method J 542.3 9.13 (s, 1H), 9.00 (s,
1H), 8.02 (d, J=8.0 Hz, 1H), 7.93 (m, 2H), 7.67 (d, J=8.0 Hz, 1H),
7.45-7.60 (m, 8H), 7.41 (d, J=7.2 Hz, 1H), 7.12 (dd, J=3.6, and 5.2
Hz, 1H), 6.90 (s, 1H), 4.64 (t, J=5.6 Hz, 2H), 3.71 (m, # 1H), 3.60
(s, 2H), 3.42 (t, J=5.6 Hz, 2H) ##STR875## 1-(1-(3-(2-amino-2-
oxoethyl)phenyl)-3- (thiophen-3-yl)-1H- pyrazol-5-yl)-3- (2,3,4-
trifluorophenyl)urea Example 365 0.06 g, 75% yield General method I
472.0 9.10 (brs, 1H), 8.97 (s, 1H), 7.87 (m, 2H), 7.60 (dd, J=2.8,
and 4.8 Hz, 1H), 7.51 (m, 4H), 7.44 (m, 1H), 7.38 (m, 1H), 7.28 (m,
1H), 6.95 (brs, 1H), 6.86 (s, 1H), 3.50 (s, 2H) ##STR876##
1-(1-(3-(2-amino-2- oxoethyl)phenyl)-3- t-butyl-1H-pyrazol-
5-yl)-3-(2,4- difluoropnenyl)urea From Example 369 0.105 g, 84%
yield General method I 428.3 8.88 (s, 1H), 8.80 (s, 1H), 8.09-8.03
(m, 1H), 7.52 (brs, 1H), 7.46 (t, J=8.0 Hz, 1H), 7.41-7.27 (m, 4H),
7.06-7.01 (m, 1H), 6.93 (brs, 1H), 6.38 (s, 1H), 3.47 (s, 2H), 1.27
(s, 9H); ##STR877## 1-(1-(3-(2-amino-2- oxoethyl)phenyl)-3-
t-butyl-1H-pyrazol- 5-yl)-3-(3- phenoxyphenyl)urea From Example A8
0.05 g, 50% yield General method D 484.2 .sup.1H NMR
(DMSO-d.sub.6): .delta. 9.10 (s, 1H), 8.37 (s, 1H), 7.44 (brs, 1H),
7.42-7.01 (m, 12H), 6.93 (brs, 1H), 6.63-6.61 (m, 1H), 6.34 (s,
1H), 3.45 (s, 2H), 1.28 (s, 9H). ##STR878## 1-(1-(3-(2-amino-2-
oxoethyl)phenyl)-3- t-butyl-1H-pyrazol- 5-yl)-3-(2,4,5-
trifluorophenyl)urea From Example A8 0.048 g, 18% yield General
method D 446.2 .sup.1H NMR (DMSO-d.sub.6): .delta. 9.10 (s, 1H),
8.89 (s, 1H), 8.21-8.14 (m, 1H), 7.65-7.58 (m, 1H), 7.52 (brs, 1H),
7.46 (t, J=8.0 Hz, 1H), 7.41-7.31 (m, 3H), 6.40 (s 1H) 3.46 (s,
2H), 1.28 (s, 9H). ##STR879## 1-(1-(3-(2-amino-2-
oxoethyl)phenyl)-3- t-butyl-1H-pyrazol- 5-yl)-3-(2,3,4-
trifluorophenyl)urea From Example 356 0.045 g, 46% yield General
method I 446.2 .sup.1H NMR (DMSO-d.sub.6):.delta.+05 9.06 (s, 1H),
8.85 (s, 1H), 7.88-7.82 (m, 1H), 7.53 (brs, 1H), 7.46 (t, J=8.0 Hz,
1H), 7.42-7.25 (m, 4H), 6.94 (brs, 1H), 6.38 (s, 1H), 3.46 (s, 2H),
1.27 (s, 9H) ##STR880## 1-(1-(3-(2-amino-2- oxoethyl)phenyl)-3-
t-butyl-1H-pyrazol- 5-yl)-3-(3,4- difluorophenyl)urea From Example
A8 0.045 g, 47% General method D 428.2 .sup.1H NMIR (DMSO-d.sub.6):
.delta. 9.40 (s, 1H), 8.58 (s, 1H), 7.65-7.59 (m, 1H), 7.54 (brs,
1H), 7.46-7.28 (m, 5H), 7.07-7.04 (m, 1H), 6.94 (brs, 1H), 6.37 (s,
1H), 3.46 (s, 2H), 1.28 (s, 9H); Exact mass: 427.2 found: (M +
1).sup.+. ##STR881## 1-(1-(3-(2-amino-2- oxoethyl)phenyl)-3-
t-butyl-1H-pyrazol- 5-yl)-3-(3-(pyrazin- 2-yl)phenyl)urea From
Example A8 0.08 g, 68% General method D 470.2 .sup.1H NMR
(DMSO-d.sub.6): .delta. 9.22 (s, 1H), 9.18 (d, J=1.2 Hz, 1H), 8.72
(dd, J= 2.8 Hz, 1.2 Hz, 1H), 8.62 (d, J=2.8 Hz, 1H), 8.27 (t, J=1.6
Hz, 1H), 7.75-7.72 (m, 1H), 7.53-7.31 (m, 7H), 6.94 (s, 1H), 6.41
(s, 1H). ##STR882## 1-(1-(3-(2-amino-2- oxoethyl)phenyl)-3-
t-butyl-1H-pyrazol- 5-yl)-3-(3-(pyridin- 3-yl)phenyl)urea From
Example A8 0.08 g, 38% General method D 469.2 .sup.1H NMR
(DMSO-d.sub.6): .delta. 9.15 (s, 1H), 8.83 (s, 1H), 8.58 (s, 1H),
8.48 (s, 1H), 8.02 (d, J=7.6 Hz, 1H), 7.79 (s, 1H), 7.52-7.31 (m,
9H), 6.93 (s, 1H), 6.40 (s, 1H), 3.47 (s, 2H), 1.28 (s, 9H).
##STR883## 1-(1-(3-(2-amino-2- oxoethyl)phenyl)-3-
t-butyl-1H-pyrazol- 5-yl)-3-(3-(6- aminopyridin-3- yl)phenyl)urea
From Example A8 35 mg, 29% General method D 484.2 .sup.1H NMR
(DMSO-d.sub.6): .delta. 9.46 (s, 1H), 8.70 (s, 1H), 8.23-8.16 (m,
3H), 7.77 (s, 1H), 7.57 (s, 1H), 7.46-7.23 (s, 7H), 7.12-7.09 (m,
1H), 6.94 (s, 1H), 6.38 (s, 1H), 3.47 (s, 1H), 1.28 (s, 9H).
##STR884## 1-(3-t-butyl-1-(3- (2-(2,3- dihydroxypropylamino)- 2-
oxoethyl)phenyl)- 1H-pyrazol-5-yl)-3- (2,3- dichlorophenyl)urea
From Example 373 69 mg ,46% yield General method J 536.0 .delta.
1.27 (s, 9H), 2.95-2.96 (m, 1H), 3.19-3.48 (m, 4H), 3.53 (s, 2H),
4.40-4.80 (br. M, 2H), 6.39 (s, 1H), 7.30-7.45 (m, 6H), 8.07-8.10
(m, 2H), 8.78 (s, 1H), 9.26 (s, 1H). ##STR885## 1-(3-t-butyl-1-(3-
(2- (isopropylamino)- 2-oxoethyl)phenyl)- 1H-pyrazol-5-yl)-3- (2,3-
dichlorophenyl)urea From Example 373 (90 mg, 59 % yield) General
method I 502.0 .delta. 9.27 (s, 1H), 8.79 (s, 1H), 8.09 (dd, J=3.2,
and 6.4 Hz, 1H), 8.01 (d, J=7.6 Hz, 1H), 7.2-7.5 (m, 5H), 6.39 (s,
1H), 3.78 (m, 1H), 3.45 (s, 2H), 1.28 (s, 9H), 1.04 (d, J=6.8 Hz,
6H) ##STR886## 1-(1-(3-(2-amino-2- oxoethyl)phenyl)-3-
cyclopentyl-1H- pyrazol-5-yl)-3- (2,3- dichlorophenyl)urea From
Example 368 56.0 mg 41% General method J 472.2 9.27 (s, 1H), 8.78
(s, 1H), 8.10-8.05 (m, 1H), 7.52 (brs, 1H), 7.49-7.44 (m, 2H),
7.38-7.28 (m, 4H), 6.93 (brs, 1H), 6.33 (s, 1H), 3.46 (s, 2H),
3.05-2.98 (m, 1H), 2.01-1.93 (m, 2H), 1.74-1.60 (m, 6H) ##STR887##
1-(3-t-butyl-1-(3- (2-((R)-3- hydroxypyrrolidin- 1-yl)-2-
oxoethyl)phenyl)- 1H-pyrazol-5-yl)-3- dichlorophenyl)urea 51.8 mg,
87% yield General method K 530.2 9.26 (s, 1H), 8.78 (s, 1H),
8.10-8.07 (m, 1H), 7.48-7.37 (m, 3H), 7.32-7.28 (m 3H), 6.39 (s,
1H), 5.02 and 4.91 (d, 1H, J=3.6 Hz), 4.29-4.27 and 4.22-4.21 (m,
1H), 3.72-3.69 (m, 2H), 3.62-3.56 and 3.39-3.27 (m, 3H), 1.93-1.69
(m, 2H), 1.28 (s, 9H) ##STR888## 1-(3-t-butyl-1-(3- (2-((R)-3-
methoxypyrrolidin- 1-yl)-2- oxoethyl)phenyl)- 1H-pyrazol-5-yl)-3-
(2,3- dichlorophenyl)urea 67 mg, 63% yield General method K 544.2
9.27 and 9.26 (s, 1H), 8.79 (s, 1H), 8.10-8.07 (m, 1H), 7.48-7.45
(m, 1H), 7.41-7.37 (m, 2H), 7.34-7.28 (m 3H), 6.39 (s, 1H),
3.96-3.94 and 3.91-3.88 (m, 1H), 3.73 and 3.72 (s, 2H), 3.66-3.56
and 3.53-3.39 (m, 3H), 3.33-3.21 # (m, 1H), 3.20 and 3.19 (s, 3H),
1.97-1.79 (m, 2H), 1.28 (s, 9H) ##STR889## 1-(1-(3-(2-amino-2-
oxoethyl)phenyl)-3- (thiophen-2-yl)-1H- pyrazol-5-yl)-3- (2,3-
dichlorophenyl)urea: From Example 366 0.052 g, 69% yield General
method I 486.0 9.42 (s, 1H), 8.86 (s, 1H), 8.10 (dd, J=6.8 Hz, 3.2
Hz, 1H), 7.54-7.447 (m, 6H), 7.39-7.32 (m, 3H), 7.12 (dd, J=4.8 Hz,
3.2 Hz, 1H), 6.95 (brs, 1H), 6.87 (s, 1H), 3.72 (s, 2H) ##STR890##
(S)-1-(1-(4-(2- amino-2- oxoethyl)phenyl)-3- t-butyl-1H-pyrazol-
5-yl)-3-(2,3- dihydro-1H-inden- 1-yl)urea 0.04 g, 49% yield General
method I 432.2 8.09 (s, 1H), 7.52 (s, 1H), 7.41-7.36 (m, 4H),
7.24-7.19 (m, 4H), 6.95-6.92 (m, 2H), 6.32 (s, 1H), 5.09 (q, J=7.6
Hz, 1H), 3.43 (s, 2H), 2.92-2.74 (m, 2H), 2.44-2.36 (m, 1H),
1.76-1.66 (m, 1H), 1.27 (s, 9H) ##STR891## 1-(1-(3-(2-amino-2-
oxoethyl)phenyl)-3- phenyl-1H-pyrazol- 5-yl)-3-(2,3-
dichlorophenyl)urea From Example 351 61 mg, 61% yield General
method J 480.0 9.42 (s, 1H), 8.88 (s, 1H), 8.09 (dd, J=6.8 Hz, 2.8
Hz, 1H), 7.83 (d, J=8 Hz, 2H), 7.58-7.55 (m, 3H), 7.49-7.32 (m,
7H), 6.94 (brs, 2H), 3.48 (s, 2H) ##STR892## 1-(1-(3-(2-amino-2-
oxoethyl)phenyl)-3- thiazol-4-yl)-1H- pyrazol-5-yl)-3- (2,3-
dichlorophenyl)urea From Example 352 87 mg, 61% yield General
method J 487.0 9.42 (s, 1H), 9.18 (d, J=2.0 Hz, 1H), 8.86 (s, 1H),
8.09 (dd, J=7.4 Hz, 2.8 Hz, 1H), 8.01 (d, J=2.4 Hz, 1H), 7.54-7.48
(m, 4H), 7.40-7.32 (m, 3H) 6.95 (brs, 1H), 6.92 (s, 1H), 3.50 (s,
2H) ##STR893## 1-(1-(3-(2-amino-2- oxoethyl)phenyl)-3-
t-butyl-1H-pyrazol- 5-yl)-3-(thiazol-2- yl)urea From Example 512
0.017 g, 21% yield General method I 399.2 10.83 (s, 1H), 8.92 (s,
1H), 7.52 (brs, 1H), 7.46 (t, J=8.0 Hz, 1H), 7.42-7.32 (m, 4H),
7.13 (d, J=3.2 Hz, 1H), 6.93 (brs, 1H), 6.44 (s, 1H), 3.47 (s, 2H),
1.28 (s, 9H) ##STR894## 1-(1-(3-(2-amino-2- oxoethyl)phenyl)-3-
phenyl-1H-pyrazol- 5-yl)-3-(3-(pyridin- 3- yloxy)phenyl)urea 37 mg,
67% yield General method I 505.2 9.21 (s, 1H), 8.57 (s, 1H),
8.40-8.37 (m, 2H), 7.85-7.83 (m, 2H), 7.54-7.27 (m, 12H), 7.14-7.11
(m, 1H), 6.95 (brs, 1H), 6.91 (s, 1H), 6.69 (dd, J=8.0 Hz, 2.4 Hz,
1H), 3.49 (s, 2H) ##STR895## 1-(1-(3-(2-amino-2-
oxoethyl)phenyl)-3- (thiophen-3-yl)-1H- pyrazol-5-yl)-3- (2,3-
dichlorophenyl)urea From Example 367 61 mg, 77% yield General
method I 486.0 9.38 (s, 1H), 8.84 (s, 1H), 8.10 (dd, J=6.8 Hz, 2.8
Hz, 1H), 7.88-7.87 (m, 1H), 7.62-7.60 (m, 1H), 7.52-7.44 (m, 5H),
7.38-7.32 (m, 3H), 6.94 (brs, 1H), 6.86 (s, 1H), 3.49 (s, 2H
##STR896## 1-(1-(3-(2-amino-2- oxoethyl)phenyl)-3-
(2-fluorophenyl)- 1H-pyrazol-5-yl)-3- (2,3- dichlorophenyl)urea
From Example 354 42 mg, 58% yield General method I 498.0 9.44 (s,
1H), 8.88 (s, 1H), 8.09 (dd, J=6.4 Hz, 3.6 Hz, 1H), 7.99 (td, J=7.6
Hz, 1.2 Hz, 1H), 7.56-7.48 (m, 4H), 7.41-7.31 (m, 5H), 7.28 (t,
J=7.6 Hz, 1H), 6.96 (brs, 1H), 6.92 (d, J=4.0 Hz, 1H), 3.50 (s, 2H)
##STR897## 1-(2,3- dichlorophenyl)-3- (1-(3-(2-(1,3-
dihydroxypropan-2- ylamino)-2- oxoethyl)phenyl)-3-
(2-fluorophenyl)- 1H-pyrazol-5- yl)urea From Example 354 68 mg, 60%
yield General method I 572.0 9.45 (s, 1H), 8.89 (s, 1H), 8.10 (dd,
J=6.4 Hz, 3.6 Hz, 1H), 8.00 (td, J=7.6 Hz, 2.0 Hz, 1H), 7.90 (d,
J=8.4 Hz, 1H), 7.56-7.47 (m, 3H), 7.42-7.26 (m, 6H), 6.92 (d, J=4.0
Hz, 1H), 3.72-3.68 1H), 3.57 (s 2H) 3.43 3.40 # (m, 4H) ##STR898##
1-(2,3- dichlorophenyl)-3- (1-(3-(2-(2,3- dihydroxypropylamino)- 2-
oxoethyl)phenyl)-3- (2-fluorophenyl)- 1H-pyrazol-5- yl)urea From
Example 354 26 mg, 23% yield General method I 572.0 9.45 (s, 1H),
8.88 (s, 1H), 8.14-8.09 (m, 2H), 7.99 (td, J=8.0 Hz, 1.6 Hz, 1H),
7.57-7.48 (m, 3H), 7.4 1-7.26 (m, 6H), 6.92 (d, J=4.0 Hz, 1H), 4.76
(d, J=4.4 Hz, 1H), 4.52 (t, J=6.0 Hz, 1H), # 3.57 (s, 2H),
3.50-3.46 (m, 1H), 3.30-3.19 (m, 3H), 2.99-2.93 (m, 1H) ##STR899##
1-(2,3- dichlorophenyl)-3- (3-(4- fluorophenyl)-1-(3- (2-(2-
hydroxyethylamino)- 2- oxoethyl)phenyl)- 1H-pyrazol-5- yl)urea 55%
yield General method I 542.0 9.44 (s, 1H), 8.87 (s, 1H), 8.15 (t,
J=5.2 Hz, 1H), 8.09 (dd, J 6.8 Hz, 3.6 Hz, 1H), 7.90-7.87 (m, 2H),
7.55 (brs, 1H), 7.51-7.46 (m, 2H), 7.38-7.3 1 (m, 3H), 7.26 (t,
J=8.8 Hz, 2H), 6.94 (s, 1H), 3.54 (s, 2H), 3.39 (t, J=6.0 # Hz,
2H), 3.11 (q, J=6.0 Hz, 2H) ##STR900## 1-(2,3- dichlorophenyl)-3-
(1-(3-(2-(2,3- dihydroxypropylamino)- 2- oxoethyl)phenyl)-3-
(thiophen-2-yl)-1H- pyrazol-5-yl)urea From Example 366 59 mg, 68%
yield General method I 560.0 9.44 (s, 1H), 8.88 (s, 1H), 8.14-8.08
(m, 2H), 7.53-7.43 (m, 4H), 7.40-7.3 1 (m, 3H), 7.13-7.10 (m, 1H),
6.87 (s, 1H), 3.57 (s, 2H), 3.50-3.46 (m, 1H), 3.28-3.20 (m, 3H),
2.99-2.94 (m, 1H); ##STR901## 1-(2,3- dichlorophenyl)-3-
(1-(3-(2-(2- hydroxyethylamino)- 2- oxoethyl)phenyl)-3-
(thiophen-2-yl)-1H- pyrazol-5-yl)urea From Example 366 68 mg, 83%
yield General method I 530.0 .42 (s, 1H), 8.87 (s, 1H), 8.14 (t,
J=5.6 Hz, 1H), 8.10 (dd, J=6.8 Hz, 2.8 Hz, 1H), 7.53-7.43 (m, 4H),
7.39-7.31 (m, 3H), 7.13-7.10 (m, 1H), 6.87 (s, 1H), 4.66 (brs, 1H),
3.54 (s, 2H), 3.41-3.38 (m, 2H), 3.11 (q, J=6.0 Hz, 2H) ##STR902##
1-(2,3- dichlorophenyl)-3- (1-(3-(2-(1,3- dihydroxypropan-2-
ylamino)-2- oxoethyl)phenyl)-3- (thiophen-2-yl)-1H-
pyrazol-5-yl)urea From Example 366 55 mg, 64% yield General method
I 560.2 9.43 (s, 1H), 8.88 (s, 1H), 8.10 (dd, J=6.8 Hz, 3.2 Hz,
1H), 7.90 (d, J=3.6 Hz, 1H), 7.53-7.38 (m, 6H), 7.34-7.31 (m, 2H),
7.13-7.10 (m, 1H), 6.87 (s, 1H), 4.63 (t, J=5.6 Hz, 2H), 3.73-3.68
(m, 1H), 3.57 (s, 2H), 3.42 # (t, J=5.6 Hz, 4H) ##STR903## 1-(2,3-
dichlorophenyl)-3- (3-(3- fluorophenyl)-1-(3- (2-(2-
hydroxyethylamino)- 2- oxoethyl)pbenyl)- 1H-pyrazol-5- yl)urea From
Example 353 65 mg, 74% yield General method I 542.0 9.43 (s, 1H),
8.86 (s, 1H), 8.14 (t, J=5.2 Hz, 1H), 8.09 (dd, J=6.8 Hz, 2.8 Hz,
1H), 7.70 (d, J=7.6 Hz, 1H), 7.65-7.62 (m, 1H), 7.55 (brs, 1H),
7.51-7.45 (m, 3H),
7.39-7.31 (m, 3H), 7.18 (dt, J=8.8 Hz, 3.2 Hz, 1H), 7.01 (s, # 1H),
4.68 (t, J=5.2 Hz, 2H), 3.54 (s, 2H), 3.42-3.37 (m, 2H), 3.11 (q,
J=6.0 Hz, 2H) ##STR904## 1-(1-(3-(2-amino-2- oxoethyl)phenyl)-3-
(3-fluorophenyl)- 1H-pyrazol-5-yl)-3- (2,3- dichlorophenyl)urea
From Example 353 67 mg, 90% yield General method I 498.0 9.410 (s,
1H), 8.85 (s, 1H), 8.09 (dd, J=6.8 Hz, 3.6 Hz, 1H), 7.70 (d, J=8.0
Hz, 1H), 7.65-7.62 (m, 1H), 7.55-7.45 (m, 5H), 7.40-7.3 1 (m, 3H),
7.18 (td, J=8.8 Hz, 2.8 Hz, 1H), 7.01 (s, 1H), 6.95 (brs, 1H), 3.50
(s, 2H ##STR905## 1-(2,3- dichlorophenyl)-3- (1-(3-(2-(2-
hydroxyethylamino)- 2- oxoethyl)phenyl)-3- (thiophen-3 -yl)-1H-
pyrazol-5-yl)urea From Example 367 37 mg, 43% yield General method
I 530.0 9.38 (s, 1H), 8.84 (s, 1H), 8.15-8.09 (m, 2H), 7.87 (dd,
J=3.2 Hz, 1.2 Hz, 1H), 7.61 (dd, J=5.2 Hz, 3.2 Hz, 1H), 7.52-7.44
(m, 4H), 7.38-7.32 (m, 3H), 6.86 (s, 1H), 4.67 (t, J=5.6 Hz, 1H),
3.53 (s, 2H), 3.42-3.37 (m, 2H), # 3.11 (q, J=5.6 Hz, 2H)
##STR906## 1-(2,3- dichlorophenyl)-3- (3-(2- fluorophenyl)-1-(3-
(2-(2- hydroxyethylamino)- 2- oxoethyl)phenyl)- 1H-pyrazol-5-
yl)urea From Example 354 75 mg, 70% yield General method I 542.0
9.47 (s, 1H), 8.89 (s, 1H), 8.15 (t, J=5.2 Hz, 1H), 8.10 (dd, J=6.4
Hz, 3.2 Hz, 1H), 7.99 (td, J=8.0 Hz, 1.6 Hz, 1H), 7.56-7.48 (m,
3H), 7.42-7.26 (m, 6H), 6.91 (d, J=4.0 Hz, 1H), 3.55 (s, 2H), #
3.39 (t, J=6.0 Hz, 2H), 3.13-3.09 (m, 2H ##STR907##
1-(1-(3-(2-amino-2- oxoethyl)phenyl)-3- t-butyl-1H-pyrazol-
5-yl)-3-(4-(1- oxoisoindolin-4- yl)phenyl)urea From Example A8
0.053 g, 36% General method D 523.2 9.15 (s, 1H), 8.66 (s, 1H),
8.41 (s, 1H), 7.66-7.31 (m, 12H), 6.94 (s, 1H), 6.40 (s, 1H), 4.50
(s, 2H), 3.47 (s, 2H), 1.29 (s, 9H) ##STR908## 1-(1-(4-(2-amino-2-
oxoethyl)phenyl)-3- t-butyl-1H-pyrazol- 5-yl)-3-(2-
fluorophenyl)urea From Example 386 56 mg, 69% yield General method
I 410.2 (Acetone-d.sub.6): .delta. 8.42 (s, 1H), 8.36 (s, 1H), 8.31
(td, J=8.4 Hz, 1.6 Hz, 1H), 7.51-7.48 (m, 3H), 7.45-7.43 (m, 2H),
7.17-7.11 (m, 2H), 7.05-7.00 (m, 1H), 6.52 (s, 1H), 3.58 (s, 2H),
1.33 (s, 9H) ##STR909## 1-(1-(4-(2-amino-2- oxoethyl)phenyl)-3-
t-butyl-1H-pyrazol- 5-yl)-3-(2,3- difluorophenyl)urea From Example
382 0.04 g, 49% yield General method I 428.2 9.14 (s, 1H), 8.92 (s,
1H), 7.94 (dd, J=8.0 Hz, 6.8 Hz, 1H), 7.55 (brs, 1H), 7.45-7.41 (m,
4H), 7.16-7.10 (m, 1H), 7.06-7.00 (m, 1H), 6.93 (brs, 1H), 6.39 (s,
1H), 3.45 (s, 2H), 1.27 (s, 9H) ##STR910## 1-(1-(4-(2-amino-2-
oxoethyl)phenyl)-3- t-butyl-1H-pyrazol- 5-yl)-3-(2,3,4-
trifluorophenyl)urea From Example 377 0.075 g, 84% yield General
method I 446.2 9.08 (s, 1H), 8.85 (s, 1H), 7.88-7.83 (m, 1H), 7.54
(brs, 1H), 7.45-7.40 (m, 4H), 7.29-7.22 (m,-1H), 6.93 (brs, 1H),
6.38 (s, 1H), 3.44 (s, 2H), 1.27 (s, 9H) ##STR911##
1-(1-(4-(2-amino-2- oxoethyl)phenyl)-3- t-butyl-1H-pyrazol-
5-yl)-3-(2,4- difluorophenyl)urea From Example 376 0.125 g, 80%
yield General method I 428.2 8.92 (s, 1H), 8.82 (s, 1H), 8.09-8.03
(m, 1H), 7.55 (brs, 1H), 7.45-7.40 (m, 4H), 7.32-7.27 (m, 1H),
7.06-7.01 (m, 1H), 6.94 (brs, 1H), 6.37 (s, 1H), 3.44 (s, 2H), 1.27
(s, 9H) ##STR912## 1-(1-(4-(2-amino-2- oxoethyl)phenyl)-3-
(thiophen-2-yl)-1H- pyrazol-5-yl)-3- (2,3- dichlorophenyl)urea From
Example 378 41 mg, 55% yield General method I 486.0 9.44 (s, 1H),
8.90 (s, 1H), 8.10 (dd, J=6.8 Hz, 2.8 Hz, 1H), 7.57 (brs, 1H),
7.53-7.46 (m, 6H), 7.34-7.31 (m, 2H), 7.11 (dd, J=5.2 Hz, 3.2 Hz,
1H), 6.95 (brs, 1H), 6.86 (s, 1H), 3.48 (s, 2H) ##STR913## 1-(2,3-
dichlorophenyl)-3- (1-(4-(2-(2,3- dihydroxypropylamino)- 2-
oxoethyl)phenyl)-3- (thiophen-2-yl)-1H- pyrazol-5-yl)urea From
Example 378 81 mg, 79% yield General method I 560.0 9.50 (s, 1H),
8.93 (s, 1H), 8.17 (t, J=5.6 Hz, 1H), 8.10 (dd, J=6.8 Hz, 3.6 Hz,
1H), 7.53-7.46 (m, 6H), 7.36-7.30 (m, 2H), 7.12-7.10 (m, 1H), 6.85
(s, 1H), 3.55 (s, 2H), 3.53-3.47 (m, 1H), 3.31-3.21 (m, 3H),
3.02-2.95 (m, # 1H) ##STR914## 1-(2,3- dichlorophenyl)-3-
(1-(4-(2-(1,3- dihydroxypropan-2- ylamino)-2- oxoethyl)phenyl)-3-
(thiophen-2-yl)-1H- pyrazol-5-yl)urea From Example 378 57 mg, 56%
yield General method I 560.2 9.47 (s, 1H), 8.91 (s, 1H), 8.10 (dd,
J=6.8 Hz, 2.8 Hz, 1H), 7.92 (d, J=8.4 Hz, 1H), 7.53-7.46 (m, 6H),
7.34-7.31 (m, 2H), 7.12-7.10 (m, 1H), 6.85 (s, 1H), 3.74-3.69 (m,
1H), 3.55 (s, 2H), 3.43 (d, J=5.2 Hz, 4H) ##STR915##
1-(1-(4-(2-amino-2- oxoethyl)phenyl)-3- (thiophen-3-yl)-1H-
pyrazol-5-yl)-3- (2,3- dichlorophenyl)urea: From Example 381 mg,
71% yield General method I 486.0 9.41 (s, 1H), 8.88 (s, 1H), 8.10
(dd, J=7.2 Hz, 3.2 Hz, 1H), 7.86 (dd, J=2.8 Hz, 1.2 Hz, 1H),
7.61-7.59 (m, 1H), 7.57 (brs, 1H), 7.54-7.50 (m, 3H), 7.47 (d,
J=8.4 Hz, 2H), 7.33-7.32 (m, 2H), 6.95 (brs, 1H), 6.85 (s, 1H),
3.47 (s, 2H) ##STR916## 1-(1-(4-(2-amino-2- oxoethyl)phenyl)-3-
(thiazol-4-yl)-1H- pyrazol-5-yl)-3- (2,3- dichlorophenyl)urea 20
mg, 27% yield General method I 487.0 9.46 (s, 1H), 9.18 (d, J=2.0
Hz, 1H), 8.90 (s, 1H), 8.10 (dd, J=7.2 Hz, 2.4 Hz, 1H), 8.01 (d,
J=2.4 Hz, 1H), 7.58 (s, 1H), 7.55 (d, J=8.4 Hz, 2H), 7.48 (d, J=8.4
Hz, 2H), 7.34-7.31 (m, 2H) 6.96 (brs, 1W), 6.92 (s, 1H), 3.50 (s,
2H) ##STR917## 1-(1-(4-(2-amino-2- oxoethyl)phenyl)-3-
phenyl-1H-pyrazol- 5-yl)-3-(2,3- dichlorophenyl)urea From Example
375 61 mg, 61% yield General method J 480.0 9.42 (s, 1W), 8.88 (s,
1W), 8.11 (dd, J=6.8 Hz, 2.8 Hz, 1H), 7.83 (d, .=8 2H), 7.57-7.55
(m, 3W), 7.49-7.32 (m, 7H), 6.94 (brs, 2W), 3.48 (s, 2H).
##STR918## 1-(2,3- dichlorophenyl)-3- (1-(4-(2-(4-
methylpiperazin-1- yl)-2- phenyl-1H-pyrazol- oxoethyl)phenyl)-3-
5-yl)urea From Example 375 36 mg, 38% yield General method I 563.2
10.16 (brs, 1W), 9.46 (s, 1H), 8.89 (s, 1H), 8.09 (dd, J=6.4 Hz,
3.2 Hz, 1W), 7.84 (d, J=7.2 Hz, 2H), 7.59 (d, J=8.4 Hz, 2H),
7.45-7.31 (m, 7H), 6.95 (s, 1H), 4.49-4.46 (m, 1H), 4.27-4.23 (m,
1H), 3.89-3.84 (m, 2H), # 3.46-3.43 (m, 3H), 3.04-2.95 (m, 3H),
2.81 (d, J=4.4 Hz, 3H). ##STR919## (R)-1-(2,3- dichlorophenyl)-3-
(1-(4-(2-(2- (hydroxymethyl)pyrrolidin- 1-yl)-2-
oxoethyl)phenyl)-3- phenyl-1H-pyrazol- 5-yl)urea From Example 375
45 mg, 48% yield General method I 564.1 9.42 (s, 1H), 8.87 (s, 1H),
8.09 (dd, J=7.2 Hz, 2.8 Hz, 1H), 7.85-7.83 (m, 2H), 7.57-7.54 (m,
2H), 7.45-7.32 (m, 7H), 6.95 (s, 1H), 4.04-3.73 (m, 3H), 3.54-3.46
(m, 2H), 3.30-3.26 (m, 1H), 1.94-1.81 (m, 4H); ##STR920## 1-(2,3-
dichlorophenyl)-3- (1-(4-(2-(2- hydroxyethylamino)- 2-
oxoethyl)phenyl)-3- phenyl-1H-pyrazol- 5-yl)urea From Example 375
72 mg, 65% yield General method I 524.0 9.43 (s, 1H), 8.89 (s, 1H),
8.18 (t, J=5.6 Hz, 1H), 8.10 (dd, J=6.8 Hz, 2.8 Hz, 1H), 7.85-7.83
(m, 2H), 7.56-7.31 (m, 9H), 6.94 (s, 1H), 4.71 (t, J=5.6 Hz, 1H),
3.52 (s, 2H), 3.45-3.40 (m, 2H), 3.16-3.12 (m, 2H) ##STR921##
1-(2,3- dichlorophenyl)-3- (1-(4-(2-(2,3- dihydroxypropylamino)- 2-
oxoethyl)phenyl)-3- (2-fluorophenyl)- 1H-pyrazol-5- yl)urea From
Example 380 68 mg, 73% yield General method I 572.0 9.53 (s, 1H),
8.94 (s, 1H), 8.18 (t, J=5.6 Hz, 1H), 8.10 (dd, J=6.8 Hz, 3.2 Hz,
1H), 7.98 (td, J=8.0 Hz, 1.6 Hz, 1H), 7.57 (d, J=8.4 Hz, 2H), 7.49
(d, J=8.4 Hz, 2H), 7.42-7.25 (m, 5H), 6.91 (d, J=4.0 Hz, 1H), 3.56
(s, 2H), # 3.52-3.49 (m, 1H), 3.34-3.21 (m, 3H), 3.02-2.96 (m, 1H)
##STR922## 1-(1-(4-(2-amino-2- oxoethyl)phenyl)-3-
(2-fluorophenyl)- 1H-pyrazol-5-yl)-3- (2,3- dichlorophenyl)urea
From Example 380 59 mg, 82% yield General method I 498.0 9.48 (s,
1H), 8.91 (s, 1H), 8.10 (dd, J=6.8 Hz, 2.8 Hz, 1H), 7.99 (td, J=8.0
Hz, 2.4 Hz, 1H), 7.57 (d, J=8.4 Hz, 3H), 7.49 (d, J=8.4 Hz, 2H),
7.43-7.27 (m, 5H), 6.96 (brs, 1H), 6.92 (d, J=4.0 Hz, 1H), 3.50 (s,
2H) ##STR923## 1-(2,3- dichlorophenyl)-3- (1-(4-(2-(1,3-
dihydroxypropan-2- ylamino)-2- oxoethyl)phenyl)-3-
(2-fluorophenyl)- 1H-pyrazol-5- yl)urea From Example 380 64 mg, 69%
yield General method I 572.0 9.49(s, 1H), 8.92 (s, 1H), 8.11 (dd,
J=6.8 Hz, 2.8 Hz, 1H), 7.98 (td, J=8.0 Hz, 1.6 Hz, 1H), 7.94 (d,
J=8.0 Hz, 1H), 7.57 (d, J=8.4 Hz, 2H), 7.49 (d, J=8.4 Hz, 2H),
7.42-7.25 (m, 5H), 6.91 (d, J=4.0 Hz, 3.74-3.71 # (m, 1H), 3.56 (s,
2H), 3.43 (d, J=5.6 Hz, 4H) ##STR924## 1-(1-(4-(2-amino-2-
oxoethyl)phenyl)-3- (3-fluorophenyl)- (2,3- dichlorophenyl)urea:
From Example 379 48 mg, 64% yield General method I 498.0 9.47 (s,
1H), 8.90 (s, 1H), 8.09 (dd, J=7.2 Hz, 2.8 Hz, 1H), 7.61 (m, 1H),
7.56 (d, J=8.0 Hz, 3H), 7.50-7.45 (m, 3H), 7.34-7.31 (m, 2H), 7.17
(td, J=8.8 Hz, 2.4 Hz, 1H), 7.00 (s, 1H), 6.95 (brs, 1H), 3.48 (s,
2H) ##STR925## 1-(2,3- dichlorophenyl)-3- (1-(4-(2-(2,3-
dihydroxypropylamino)- 2- oxoethyl)phenyl)-3- (3-fluorophenyl)-
1H-pyrazol-5- yl)urea From Example 379 25 mg, 27% yield General
method I 572.0 9.43 (s, 1H), 8.88 (s, 1H), 8.14 (t, J=5.2 Hz, 1H),
8.10 (dd, J=7.2 Hz, 3.2 Hz, 1H), 7.69 (d, J=8.0 Hz, 1H), 7.63-7.61
(m, 1H), 7.56 (d, J=8.0 Hz, 2H), 7.50-7.45 (m, 3H), 7.36-7.31 (m,
2H), # 7.20-7.14 (m, 1H), 7.00 (s. 1H), 4.79 (d, J=4.8 Hz, 1H),
4.54 (t, J=5.6 Hz, 1H), 3.55 (s, 2H), 3.53-3.48 (m, 1H), 3.30-3.22
(m, 3H), 3.02-2.96 (m, 1H) ##STR926## (S)-1-(1-(4-(2- amino-2-
oxoethyl)phenyl)-3- t-butyl-1H-pyrazol- 5-yl)-3-(1,2,3,4-
tetrahydronaphthalen- 1-yl)urea From Example 387 0.329 g, 72% yield
General method K 446.3 8.03 (s, 1H), 7.52 (brs, 1H), 7.41-7.37 (m,
4H), 7.21-7.13 (m 3H), 7.09-7.06 (m, 1H), 6.96-6.95 (m, 1H), 6.92
(brs, 1H), 6.33 (s, 1H), 4.81-4.76 (m 1H), 3.42 (s, 2H), 2.78-3.64
(m, 2H), 1.90-1.84 (m, 1H), 1.79-1.66 (m, 3H), 1.26 (s, 9H)
##STR927## (S)-1-(3-t-butyl-1- (4-(2-(3- hydroxypyrrolidin-
1-yl)-2- oxoethyl)phenyl)- 1H-pyrazol-5-yl)-3- (2,3-
dichlorophenyl)urea From Example 383 0.329 g, 72% yield General
method K 530.2 9.30 (s, 1H), 8.82 (s, 1H), 8.10-8.08 (m, 1H),
7.46-7.44 (m, 2H), 7.41-7.39 (m, 2H), 7.34-7.29 (m, 2H), 6.39 (s,
1H), 4.335-4.31 and 4.27-4.24 (m, 1HY), 3.71 na d 3.67 (s, 2H),
3.64-3.56 and 3.46-3.26 (m, 4H), 1.99-1.71 (m, # 2H), 1.27 (s, 9H)
##STR928## (R)-1-(3-t-butyl-1- (4-(2-(2- (methoxymethyl)pyrrolidin-
1-yl)-2- oxoethyl)phenyl)- 1H-pyrazol-5-yl)-3- (2,3-
dichlorophenyl)urea From Example 383 115 mg 96% yield General
method K 558.3 9.28 (s, 1H), 8.81 (s, 1H), 8.10-8.07 (m, 1H),
7.46-7.44 (m, 2H), 7.39-7.36 (m, 2H), 7.34-7.29 (m, 2H), 6.39 (s,
1H), 4.27-4.22 and 4.09-4.06 (m, 1H), 3.85-3.74 and 3.72-3.66 (m,
2H), 3.54-3.31 (m, # 3H), 3.30 and 3.23 (s, 3H), 3.29-3.24 (m, 1H),
1.97-1.80 (m, 4H), 1.28 (s, 9H) ##STR929## (S)-1-(3-t-butyl-1-
(4-(2-(2- (methoxymethyl)pyrrolidin- 1-yl)-2- oxoethyl)phenyl)-
1H-pyrazol-5-yl)-3- (2,3- dichlorophenyl)urea. From Example 383 104
mg, 87% yield General method K 558.3 9.28 (s, 1H), 8.81 (s, 1H),
8.10-8.07 (m, 1H), 7.46-7.44 (m, 2H), 7.39-7.36 (m, 2H), 7.34-7.29
(m, 2H), 6.39 (s, 1H), 4.27-4.22 and 4.10-4.04 (m, 1H), 3.85-3.75
and 3.74-3.66 (m, 2H), 3.54-3.31 (m, # 3H), 3.30 and 3.23 (s, 3H),
3.29-3.24 (m, 1H), 1.97-1.80 (m, 4H), 1.28 (s, 9H) ##STR930##
(S)-1-(3-t-butyl-1- (4-(2-(3- (dimethylamino)pyrrolidin- 1-yl)-2-
oxoethyl)phenyl)- 1H-pyrazol-5-yl)-3- (2,3- dichlorophenyl)urea
From Example 383 44 mg, 59% yield General method K 557.3 9.42 and
9.40 (s, 1H), 8.88 and 8.87 (s, 1H), 8.10-8.05 (m, 1H), 7.48-7.46
(m, 2H), 7.42-7.36 (m, 2H), 7.34-7.28 (m 2H), 6.38 (s, 1H),
4.07-3.24 (m, 7H), 2.80-2.76 (m, 6H), 2.40-2.08 (m, 2H), 1.28 (s,
9H) ##STR931## (R)-1-(3-t-butyl-1- (4-(2-(3-
(dimethylamino)pyrrolidin- 1-yl)-2- oxoethyl)phenyl)-
1H-pyrazol-5-yl)-3- (2,3- dichlorophenyl)urea From Example 383 105
mg, 86% yield General method K 557.3 9.41 (brs, 1H), 8.88 (brs,
1H), 8.10-8.05 (m, 1H), 7.48-7.46 (m, 2H), 7.42-7.37 (m, 2H),
7.34-7.29 (m, 2H), 6.38 (s, 1H), 4.07-3.71 (m, 5H), 3.64-3.24 (m,
2H), 2.80-2.76 (m, 6H), 2.41-2.09 (m, 2H), 1.28 (s, 9H) ##STR932##
1-(2,3- dichlorophenyl)-3- (3-(2- fluorophenyl)-1-(4- (2-((S)-3-
hydroxypyrrolidin- 1-yl)-2- oxoethyl)phenyl)- 1H-pyrazol-5- yl)urea
From Example 380 33.9 mg, 30% yield General method K 568.1 9.47 (s,
1H), 8.91 (s, 1H), 8.12-8.09 (m, 1H), 8.01-7.97 (m, 1H), 7.58-7.57
(m, 2H), 7.48-7.46 (m, 2H), 7.44-7.39 (m, 1H), 7.36-7.25 (m, 4H),
6.92 and 6.91 (s, 1H), 4.36-4.32 and 4.28-4.25 (m, # 1H), 3.75 and
3.72 (s, 2H), 3.66-3.62 (m, 1H), 3.48-3.31 (m 2H), 2.01-1.72 (m,
2H) ##STR933## 1-(1-(4-(2-amino-2- oxoethyl)phenyl)-3-
(thiophen-2-yl)-1H- pyrazol-5-yl)-3- ((S)-2,3-dihydro-
1H-inden-1-yl)urea From Example 389 31.0 mg, 18% yield General
method J 458.0 8.27 (s, 1H), 7.55 (brs, 1H), 7.49-7.43 (m, 6H),
7.26-7.19 (m, $H), 7.12-7.10 (m, 1H), 7.05-7.03 (m, 1H), 6.94 (s,
1H), 6.80 (s, 1H), 5.16-5.10 (m, 1H), 3.46 (s, 2H), 2.94-2.87 (m,
1H), 2.83-2.75 (m, 1H), 2.46-2.38 (m, 1H), # 1.78-1.69 (m, 1H)
##STR934## 1-((S)-2,3-dihydro- 1H-inden-1-yl)-3- (1-(4-(2-(2-
hydroxyethylamino)- 2- oxoethyl)phenyl)-3- (thiophen-2-yl)-1H-
pyrazol-5-yl)urea From Example 389 55.6 mg, 29% yield General
method J 502.2 8.27 (s, 1H), 8.17-8.14 (m, 1H), 7.49-7.42 (m, 6H),
7.26-7.19 (m, 4H), 7.12-7.10 (m, 1H), 7.05-7.03 (m, 1H), 6.80 (s,
1H), 5.16-5.10 (m, 1H), 3.51 (s, 2H), 3.42 (t, 2H, J=6.0 Hz), 3.13
(q, 2H, # J=5.60 Hz), 2.94-2.87 (m, 1H), 2.83-2.75 (m, 1H),
2.45-2.38 (m, 1H), 1.78-1.69 (m, 1H) ##STR935## 1-(1-(4-(2-amino-2-
oxoethyl)phenyl)-3- cyclopentyl-1H- pyrazol-5-yl)-3- (2,3-
dichlorophenyl)urea From Example 390 39 mg, 48% yield General
method K 472.2 9.29 (s, 1H), 8.82 (s, 1H), 8.10-8.08 (m, 1H), 7.55
(brs, 1H), 7.46-7.41 (m, 4H), 7.34-7.29 (m, 2H), 6.93 (brs, 1H),
6.33 (s, 1H), 3.44 (s, 2H), 3.04-2.97 (m, 1H), 2.01-1.93 (m, 2H),
1.73-1.58 (m, 6H) ##STR936## 1-(1-(4-(2-amino-2-
oxoethyl)phenyl)-3- t-butyl-1H-pyrazol- dichlorophenyl)urea 459.1
##STR937## 1-(3-t-butyl-1-(4- (2-(2,3- dihydroxypropylamino)-
2-
oxoethyl)phenyl)- 1H-pyrazol-5-yl)-3- (2,3- dichlorophenyl)urea
From Example 383 119 mg, 72% yield General method J 536.0 .delta.
1.27 (s, 9H), 2.95-3.00 (m, 1H), 3.20-3.49 (m, 4H), 3.51 (s, 1H),
7.29-7.34 (m, 2H), 7.40-7.45 (m, 4H), 8.08-8.12 (m, 2H), 8.82 (s,
1H), 9.28 (s, 1H). ##STR938## ethyl 2-(4-(3- cyclopentyl-5-(3-
(2,3- dichlorophenyl)ureido)- 1H-pyrazol-1- yl)phenyl)acetate 959.3
##STR939## 1-(3-t-butyl-1-{4- [2-(1,1-dioxo-1.quadrature.6-
thiomorpholin-4- yl)-2- oxoethyl]phenyl- 1H- pyrazol-5-yl)- 3-(2,3-
dichlorophenyl)urea From Example 383 45 mg, 35% yield General
method I 578 9.26 (s, 1H), 8.78 (s, 1H), 8.03 (m, 1H), 7.42 (d,
J=7.8 Hz, 2H), 7.34 (d, J=8.4 Hz, 2H), 7.27-7.26 (m, 2H), 6.34 (s,
1H), 3.90-3.88 (m, 4H), 3.84 (s, 2H), 3.34-3.15 (m, 2H), 3.15-3.02
(m, 2H), 1.23 (s, 9H) ##STR940## 1-(3-t-butyl-1-{4-
[2-(4-hydroxy-4- methylpiperidin-1- yl)-2- oxoethyl]phenyl}-
1H-pyrazol-5-yl)-3- (2,3- dichlorophenyl)urea From Example 383 50
mg, 41% yield General method I 558 9.22 (s, 1H), 8.75 (s, 1H), 8.03
(m, 1H), 7.40 (d, J=7.8 Hz, 2H), 7.32 (d, J=8.4 Hz, 2H), 7.26-7.22
(m, 3H), 6.34 (s, 1H), 3.93-3.89 (m, 2H), 3.17-2.97 (m, 4H),
1.43-1.31 (m, 4H), 1.23 (s, 9H), 1.06 (s, 3H) ##STR941## ethyl
1-[2-(4-{3-t- dichlorophenyl)ureido]- 1H-pyrazol-1-
ylphenyl)-acetyl]- piperidine-4- carboxylate From Example 383 140
mg, 53% yield General method I 600 8.49 (s, 1H), 8.14-8.11 (m, 2H),
7.37 (d, J=8.4 Hz, 2H), 7.20 (d, J=8.1Hz, 2H), 7.15 (d, J=5.1 Hz,
1H), 6.56 (s, 1H), 4.33 (m, 1H), 4.14 (q, J=7.2 Hz, 2H), 3.87 (m,
1H), 3.68 (hr s, 2H), 3.15 (m, 1H), 2.86 (m, 1H), 2.54 (m, 1H),
1.93-1.87 (m, 2H), # 1.63-1.48 (m, 2H), 1.33 (s, 9H), 1.25 (t,
J=7.2 Hz, 3H) ##STR942## 1-[2-(4-{3-t-butyl- 5 -[3-(2,3-
dichlorophenyl)ureido]- 1H-pyrazol-1- phenyl)acetyl]piperidine-
4-carboxylic acid From Example 497 55 mg, 74% yield General method
E 572 9.35 (s, 1H), 8.83 (s, 1H), 8.02 (m, 1H), 7.42 (d, J=8.4 Hz,
2H), 7.32 (d, J=8.4 Hz, 2H), 7.27-7.25 (m, 2H), 6.32 (s, 1H), 4.19
(m, 1H), 3.88 (m, 1H), 3.74 (d, J=5.1 Hz, 2H), 3.33 (m, 1H), 3.08
(m, 1H), 2.52 (m, 1H), 1.78-1.74 (m, 2H), # 1.38-1.31 (m, 2H), 1.23
(s, 9H)
[1036] ##STR943##
[1037] To a flask charged with THF (250 mL) was added dropwise
n-butyl lithium (18.4 mL, 46 mmol) at -78.degree. C. under a
N.sub.2 atmosphere. After addition the resulting solution was
warmed to -50.degree. C. and dry MeCN (1.86 g, 45 mmol) was added
slowly. After 1 h, the reaction was cooled to -78.degree. C. and
was treated with thiophene-2-carboxylic acid ethyl ester (6.93 g,
44.5 mmol). After stirring for 1 h the resulting mixture was warmed
to RT and stirred for 1 h. Water was added dropwise at 0.degree. C.
to quench the reaction and the solution was extracted with ethyl
acetate (3.times.200 mL). The organic layers were combined, washed
with brine, dried (Na.sub.2SO.sub.4) and the solvent was evaporated
under reduced pressure to give a solid residue, which was
re-crystallized from CH.sub.2Cl.sub.2. After the solid was
collected by filtration, they were redissolved in ethyl acetate
(100 mL), and acidified with dilute hydrochloride (2N). The aqueous
layer was extracted with ethyl acetate (3.times.200 mL) and the
combined organic layers were washed with brine, dried
(Na.sub.2SO.sub.4), filtered and concentrated to yield
3-oxo-3-thiophen-2-yl-propionitrile (4.7 g, yield=70%) as a yellow
solid, which was used directly in the next step without
purification. ##STR944##
[1038] To a flask charged with KOtBu (4 g, 36 mmol) and ether (100
mL, dry) was added dropwise a mixture of 2-fluorobenzonitrile (2.1
g, 17.5 mmol) and MeCN (0.738 g, 18 mmol) at 0.degree. C. After
addition the Example A76 mixture was stirred at RT. for 2 days.
Water was added and the reaction and extracted with ether
(3.times.100 mL). The organic layers were combined, washed with
brine and dried (Na.sub.2SO.sub.4). The solvent was evaporated
under reduced pressure to afford a yellow oil, which was dissolved
in CH.sub.2Cl.sub.2 and the solution was acidified with 3M HCl.
After stirring the solution at RT for 2 hours, the solution was
extracted with dichloromethane (3.times.200 mL). The organic layers
were combined, washed with brine and dried (Na.sub.2SO.sub.4).
After filtration, the filtrate was concentrated in vacuo to give
3-(2-fluoro-phenyl)-3-oxo-propionitrile (2 g, 70% yield) as a
yellow solid.
[1039] .sup.1H NMR (300 MHz, DMSO-d.sub.6): 7.99-7.92 (m, 1H),
7.70-7.58 (m, 1H), 7.35-7.14 (m, 2H), 4.09 (m, 2H).
General Experimental for Examples
[1040] Using General method M, the following Examples were prepared
from the appropriate aniline and 3-oxo-3-substituted-propanenitrile
(General method L) TABLE-US-00016 MS (EI) .sup.1H NMR (400 MHz,
Example Name (M +H.sup.+) DMSO-d.sub.6) ##STR945## ethyl 2-(3-(5-
amino-3-t-butyl- 1H-pyrazol-1- yl)phenyl)acetate 18 g, 40% yield
303.3 .delta. 7.6-7.4 (m, 4H), 6.61 (s, 1H), 4.09-5.05 (m, 2H),
3.76 (s, 2H), 1.26 (s, 9H), 1.19-1.15 (m, 3H) ##STR946## ethyl
2-(3-(5- amino-3-phenyl- 1H-pyrazol-1- yl)phenyl)acetate 322.2
.delta. 7.74-7.20 (m, 9H), 5.89 (s, 1H), 5.42 (s, 2H), 4.10-4.05
(m, 2H), 3.73 (s, 2H), 1.19-1.13 (m, 3H) ##STR947## ethyl 2-(3-(5-
amino-3-(4- fluorophenyl)- 1H-pyrazol-1- yl)phenyl)acetate 340.1
##STR948## ethyl 2-(3-(5- amino-3- (thiazol-2-yl)- 1H-pyrazol-1-
yl)phenyl)acetate 329.1 ##STR949## ethyl 2-(3-(5- amino-3-
(thiazol-4-yl)- 1H-pyrazol-1- yl)phenyl)acetate 329.4 .delta.
9.11-9.1 (m, 1H), 7.88-7.87 (m, 1H), 7.52-7.22 (m, 4H), 5.93 (s,
1H), 5.61 (brs, 2H), 4.1-4.03 (m, 2H), 3.73 (s, 2H), 1.18-1.14 (m,
3H) ##STR950## ethyl 2-(3-(5- amino-3-(3- fluorophenyl)-
1H-pyrazol-1- yl)phenyl)acetate 340.4 ##STR951## ethyl 2-(3-(5-
amino-3-(2- fluorophenyl)- 1H-pyrazol-1- yl)phenyl)acetate 340.3
##STR952## ethyl 2-(3-(5- amino-3- (thiophen-2-yl)- 1H-pyrazol-1-
yl)phenyl)acetate 328.2 ##STR953## ethyl 2-(3-(5- amino-3-
(thiophen-3-yl)- 1H-pyrazol-1- yl)phenyl)acetate 328.4 ##STR954##
ethyl 2-(3-(5- amino-3- cyclopentyl-1H- pyrazol-1-
yl)phenyl)acetate 314.6 .delta. 7.6-7.4 (m, 4H), 5.72 (s, 1H),
4.1-4.03 (m, 2H), 3.76 (s, 2H), 3.07-3.0 (m, 1H), 2.00-1.98 (m,
2H), 1.7-1.58 (m, 6H), 1.04-0.98 (m, 3H) ##STR955## ethyl 2-(3-(5-
amino-3-phenyl- 1H-pyrazol-1- yl)phenyl)acetate 321.4 ##STR956##
ethyl 2-(4-(5- amino-3- (thiophen-3-yl)- 1H-pyrazol-1-
yl)phenyl)acetate 34% yield 328.0 .quadrature. 7.92 (brs, 1H),
7.63-7.59 (m, 3H), 7.51-7.50 (m, 1H), 7.44 (d, J=8.0 Hz, 2H) 5.97
(s, 1H), 4.10 (q, J=6.8 Hz, 2H); 3.76 (s, 2H), 1.20 (t, J=6.8 Hz,
3H); (M + 1).sup.+. ##STR957## ethyl 2-(4-(5- amino-3-
(thiophen-2-yl)- 1H-pyrazol-1- yl)phenyl)acetate (55%) 328.0
.quadrature. 7.57 (d, J=8.4 Hz, 2H), 7.46 (dd, J=4.8 Hz, 1.6 Hz,
1H), 7.41-7.36 (m, 3H), 7.09-7.07 (m, 1H), 5.85 (s, 1H), 4.10 (q,
J=7.2 Hz, 2H); 3.73 (s, 2H), 1.20 (t, J=7.2 Hz, 3H)
[1041] ##STR958##
[1042] Using general method D, Example 499 (0.22 g, 0.47 mmol) and
2-amino thiazole (0.071 g, 0.7 mmol) were combined to afford ethyl
2-(3-(3-t-butyl-5-(3-(thiazol-2-yl)ureido)-1H-pyrazol-1-yl)phenyl)acetate
(0.13, 64%) as a solid. .sup.1H NMR (400 MHz, Acetone-d.sub.6):
.quadrature. 10.05 (s, 1H), 7.56 (s, 1H), 7.53-7.44 (m, 2H),
7.38-7.36 (m, 1H), 7.28 (d, J=3.6 Hz, 1H), 7.06 (d, J=3.6 Hz, 1H),
6.54 (s, 1H), 4.12 (q, J=7.2 Hz, 2H), 3.75 (s, 2H), 1.34 (s, 9H),
1.21 (t, J=7.2 Hz, 3H); MS (ESI) m/z: 428.0 (M+H.sup.+).
##STR959##
[1043] Using general method E, ethyl
2-(3-(3-t-butyl-5-(3-(thiazol-2-yl)ureido)-1H-pyrazol-1-yl)phenyl)acetate
(0.12 g, 0.28 mmol) was saponified to afford
2-(3-(3-t-butyl-5-(3-(thiazol-2-yl)ureido)-1H-pyrazol-1-yl)phenyl)acetic
acid/Example 512 (0.1 g, 93%) as a solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): 8.92 (s, 1H), 7.48 (t, J=8.0 Hz, 1H), 7.42-7.39 (m,
2H), 7.34-7.32 (m, 2H), 7.12 (d, J=3.6 Hz, 1H), 6.44 (s, 1H), 3.68
(s, 2H), 1.28 (s, 9H); MS (ESI) m/z: 400.2 (M+H.sup.+).
##STR960##
[1044] Using general method D, Example A30 (53 mg, 0.15 mmol) and
(S)-1,2,3,4-tetrahydronaphthalen-1-amine (68 mg, 0.46 mmol) were
combined, and the product deprotected using general method G to
yield
1-(3-t-butyl-1-(indolin-6-yl)-1H-pyrazol-5-yl)-3-((S)-1,2,3,4-tetrahydron-
aphthalen-1-yl)urea (30 mg, 49% yield) as the HCl salt. .sup.1H NMR
(400 MHz, CD.sub.3OD): .delta. 7.52 (m, 1H), 7.13 (m, 2H), 3.89 (t,
J=7.6 Hz, 2H), 3.37 (t, J=7.6 Hz, 2H), 2.78 (m, 2H), 1.99 (m, 1H),
1.82 (m, 3H), 1.41 (s, 9H); LC-MS (EI) m/z: 526.2 (M+H.sup.+).
##STR961##
[1045] Using general method A, Example A30 (70 mg, 0.20 mmol) and
1-naphthalylisocyanate (34 mg, 0.20 mmol) were combined and the
resultant product deprotected using general method G to yield
1-(3-t-butyl-1-(indolin-6-yl)-1H-pyrazol-5-yl)-3-(naphthalen-1-yl)urea
as the HCl salt (71 mg, 84% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.32 (s, 1H), 9.24 (s, 1H), 8.17 (d, J=7.2
Hz, 1H), 7.92 (m, 2H), 7.63 (d, J=8.4 Hz, 1H), 7.51 (m, 5H), 6.41
(s, 1H), 3.72 (t, J=8.4 Hz, 2H), 3.19 (t, J=8.4 Hz, 2H), 1.30 (s,
9H); LC-MS (EI) m/z: 426.2 (M+H.sup.+). ##STR962##
[1046] Using general method A, Example A29 ((70 mg, 0.20 mmol) and
1-naphthalylisocyanate (34 mg, 0.20 mmol) were combined and the
resultant product deprotected using general method G to yield
1-(3-t-butyl-1-(indolin-5-yl)-1H-pyrazol-5-yl)-3-(naphthalen-1-yl)urea
(33 mg, 39% yield) as the HCl salt. .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.26 (s, 1H), 9.11 (s, 1H), 8.12 (d, J=8.0
Hz, 1H), 7.92 (d, J=8.0 Hz, 1H), 7.64 (d, J=8.0 Hz, 1H), 7.55 (m,
2H), 7.46 (t, J=7.6 Hz, 1H), 7.32 (m, 1H), 6.41 (s, 1H), 3.72 (t,
J=8.0 Hz, 2H), 3.22 (t, J=8.0 Hz, 2H), 1.30 (s, 9H); LC-MS (EI)
m/z: 426.2 (M+H.sup.+). ##STR963##
[1047] Using general method D, 2,3-dichloroaniline (0.31 g, 0.91
mmol) and 5-amino-3-(2-thienyl)pyrazole (0.15 g, 0.91 mmol,
available commercially) were combined to yield
1-(2,3-dichlorophenyl)-3-(3-(thiophen-2-yl)-1H-pyrazol-5-yl)urea
(0.31 g, 96% yield). LC-MS (EI) m/z: 353.0 (M+H.sup.+).
[1048] Using the same procedure as for Example 115, Example A33 (37
mg, 0.14 mmol) and the material from the previous reaction (50 mg,
0.14 mmol) were coupled and the resultant product deprotected using
general method G to yield
1-(2,3-dichlorophenyl)-3-(1-(indolin-5-yl)-3-(thiophen-2-yl)-1H--
pyrazol-5-yl)urea HCl salt (10 mg, 15% yield). .sup.1H NMR (400
MHz, DMSO-d.sub.6): .delta. 9.32 (bs, 1H), 8.92 (s, 1H), 8.08 (dd,
J=3.2, and 6.4 Hz, 1H), 7.48 (dd, J=0.8, and 4.8 Hz, 1H), 7.44 (dd,
J=0.8, and 3.2 Hz, 1H), 7.33 (m, 2H), 7.18 (m, 1H), 7.10 (dd,
J=3.6, and 4.8 Hz, 1H), 6.89 (m, 1H), 6.79 (s, 1H), 3.09 (t, J=8.0
Hz, 2H); LC-MS (EI) m/z: 470.0 (M+H.sup.+). ##STR964##
[1049] Using general method D, Example A30 was combined with
(S)-1-aminoindan (0.200 g, 1.50 mmol) and the resulting product
deprotected using general method G to yield 173 mg (90%) of
1-(3-t-butyl-1-(indolin-6-yl)-1H-pyrazol-5-yl)-3-((S)-2,3-dihydro-1H-inde-
n-1-yl)urea hydrochloride as a white solid. .sup.1H-NMR
(methanol-d.sub.4): .delta. 7.59 (d, 1H, J=7.6 Hz), 7.53 (s, 1H),
7.52 (d, 1H, J=8.0 Hz), 7.23-7.16 (m, 4H), 6.48 (s, 1H), 5.17 (t,
1H, J=7.6 Hz), 3.90 (t, 2H, J=7.8 Hz), 3.37 (t, 2H, J=8.0 Hz), 2.96
(ddd, 1H, J=16.0, 8.8, 4.0 Hz), 2.83 (ddd, 1H, J=16.4, 8.0, 8.0
Hz), 2.53-2.46 (m, 1H), 1.82-1.75 (m, 1H), 1.37 (s, 9H). LC-MS (EI)
m/z: 416.2 (M+H ##STR965##
[1050] A solution of -(2-fluorophenyl)-3-oxopropanenitrile (1.02 g,
6.25 mmol; general method L) and hydrazine hydrate (0.313 g, 6.25
mmol) in EtOH (10 mL) was heated at 70.degree. C. for 2 h. The
solvent was evaporated and the residue was purified by column
chromatography to give 3-(2-fluorophenyl)-1H-pyrazol-5-amine as a
yellow wax-like solid (400 mg, 36% yield). .sup.1H-NMR
(CDCl.sub.3): .delta. 7.64 (dt, 1H, J=7.8, 1.6 Hz), 7.35-7.29 (m,
1H), 7.23-7.13 (m, 2H), 6.06 (s, 1H), 5.28 (s, br, 3H). LC-MS (EI)
m/z: 178.2 (M+H+).
[1051] A solution of 2,2,2-trichloroethyl
2,3-dichlorophenylcarbamate (0.286 g, 0.847 mmol; general method
D), 3-(2-fluorophenyl)-1H-pyrazol-5-amine (0.150 g, 0.847 mmol) and
I-PR2NET (0.219 g, 1.69 mmol) in DMF (1 mL) was stirred at
90.degree. C. overnight. Water was added (30 mL) and the mixture
was extracted with EtOAc (3.times.30 mL), dried (MgSO.sub.4),
filtered and concentrated to yield crude
1-(2,3-dichlorophenyl)-3-(3-(2-fluorophenyl)-1H-pyrazol-5-yl)urea
as an off-white solid (285 mg, 92% yield). .sup.1H-NMR
(DMSO-d.sub.6): .delta. 9.86 (s, 1H), 8.25 (d, 1H, J=7.2 Hz), 7.81
(t, 1H, J=7.2 Hz), 7.45-7.27 (m, 5H), 6.65 (s, br, 1H).5.67 (s,
1H), one urea proton not visible. LC-MS (EI) m/z: 365.0 367.0
(M+H+).
[1052] A mixture of
1-(2,3-dichlorophenyl)-3-(3-(2-fluorophenyl)-1H-pyrazol-5-yl)urea
(0.100 g, 0.274 mmol), Example A56 (0.191 g, 0.548 mmol), pyridine
(0.065 g, 0.82 mmol), Cu(OAc).sub.2 (0.075 g, 0.411 mmol) and
CH.sub.2Cl.sub.2 (5 mL) was stirred open to air, occasionally
replacing evaporated solvent for 2d. Water was added (50 mL) and
the mixture was extracted with CH.sub.2Cl.sub.2 (3.times.50 mL).
The combined organic extracts were dried (MgSO.sub.4),
concentrated, and purified by column chromatography to yield
2-t-butyl 3-ethyl
6-(5-(3-(2,3-dichlorophenyl)ureido)-3-(2-fluorophenyl)-1H-pyrazol-1-yl)-3-
,4-dihydroisoquinoline-2,3(1H)-dicarboxylate as a yellow foam (139
mg, 76% yield). LC-MS (EI) m/z: 668.2 670.3 (M+H+).
[1053] To a solution of 2-t-butyl 3-ethyl
6-(5-(3-(2,3-dichlorophenyl)ureido)-3-(2-fluorophenyl)-1H-pyrazol-1-yl)-3-
,4-dihydroisoquinoline-2,3(1H)-dicarboxylate (0.050 g, 0.075 mmol)
in THF (2 mL) was added 6N HCl (2 mL) and the solution was stirred
at 50.degree. C. overnight. The organic solvent was evaporated and
the precipitate was collected to yield
6-(5-(3-(2,3-dichlorophenyl)ureido)-3-(2-fluorophenyl)-1H-pyrazol-1-yl)-1-
,2,3,4-tetrahydroisoquinoline-3-carboxylic acid hydrochloride as a
white solid (15 mg, 35% yield). .sup.1H-NMR (acetone-d.sub.6):
.delta. 8.01-7.96 (m, 2H), 7.62-7.60 (m, 2H), 7.47 (d, 1H, J=8.0
Hz), 7.42-7.37 (m, 1H), 7.27-7.19 (m, 4H), 6.92 (d, 1H, J=3.6 Hz),
4.59 (d, 1H, J=16.0 Hz), 4.50 (d, 1H, J=16.0 Hz), 4.48 (dd, 1H,
J=11.4, 5.0 Hz), 3.61 (dd, 1H, J=18.0, 5.2 Hz), urea, acid and
amine protons not visible, one proton is buried under the methanol
peak. LC-MS (EI) m/z: 540.0 542.0 (M+H+). ##STR966##
[1054] Using general method D, Example A29 (0.15 g, 0.28 mmol) was
combined with 2,4-difluoroaniline (0.11 g, 0.85 mmol) to yield
1-(3-t-butyl-1-(1-(2,2,2-trifluoroacetyl)indolin-5-yl)-1H-pyrazol-5-yl)-3-
-(2,4-difluorophenyl)urea. Using general method G, this product was
depr0toected and the resulting product transformed as in Example
109 to yield
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3--
(2,4-difluorophenyl)urea (32 mg, 23%). .sup.1H-NMR
(acetone-d.sub.6): .delta. 8.23-8.16 (m, 3H), 7.42 (s, br, 1H),
7.39 (d, 1H, J=8.4 Hz), 7.35 (dd, 1H, J=8.4, 2.0 Hz), 7.05 (ddd,
1H, J=11.6, 8.4, 2.8 Hz), 6.45 (s, 1H), 4.06 (t, 2H, J=8.4 Hz),
3.22 (t, 2H, J=8.4 Hz), 3.02 (s, 3H), 1.31 (s, 9H). ##STR967##
[1055] Using the same approach as described for Example 520,
Example A29 and 2,3-difluoroaniline were combined, deprotected and
transformed to yield
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3--
(2,3-difluorophenyl)urea (30 mg, 22%). .sup.1H-NMR
(acetone-d.sub.6): .delta. 8.41 (s, br 1H), 8.27 (s, br, 1H), 8.06
(t, 1H, J=7.8 Hz), 7.42 (s, 1H), 7.40 (d, 1H, J=7.2 Hz), 7.35 (dd
1H, J=8.8, 2.0 Hz), 7.16-7.09 (m, 1H), 6.97-6.90 (m, 1H), 6.47 (s,
1H), 4.07 (t, 2H, J=8.4 Hz), 3.23 (t, 2H, J=8.8 Hz), 3.02 (s, 3H),
1.31 (s, 9H). ##STR968##
[1056] Using the same approach as described for Example 520,
Example A29 and 3,5-difluoroaniline were combined, deprotected and
transformed to yield
1-(3-t-butyl-1-(1-(methylsulfonyl)indolin-5-yl)-1H-pyrazol-5-yl)-3--
(3,5-difluorophenyl)urea (35 mg, 25%). .sup.1H-NMR
(acetone-d.sub.6): .delta. 7.46 (s, 1H), 7.42 (d, 1H, J=8.8 Hz),
7.39 (d, 1H, J=8.4 Hz), 7.25-7.20 (m, 2H), 6.63-6.57 (m, 1H), 4.06
(t, 2H, J=8.6 Hz), 3.24 (t, 2H, J=8.6 Hz), 3.03 (s, 3H), 1.36 (s,
9H), urea and pyrazole protons not visible. ##STR969##
[1057] Using general method A, Example A30 (0.40 g, 1,14 mmol) was
combined with 2,3-dichloropheyl isocyanate (0.21 g 1.14 mmol) and
the resulting product deprotected according to general method G to
yield
1-(3-t-butyl-1-(indolin-6-yl)-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea
(0.23 g, 42%). This product was transformed
1-(1-(1-acetylindolin-6-yl)-3-t-butyl-1H-pyrazol-5-yl)-3-(2,3-dichlorophe-
nyl)urea (103 mg, 70%). .sup.1H-NMR (acetone-d.sub.6): .delta. 8.61
(s, br, 1H), 8.30 (s, 1H), 8.27 (dd, 1H, J=8.0, 1.2 Hz), 8.21 (s,
br, 1H), 7.30 (d, 1H, J=8.4 Hz), 7.29 (s, 1H), 7.28 (d, 1H, J=8.0
Hz), 7.22 (dd, 1H, J=8.0, 1.2 Hz), 7.12 (d, 1H, J=8.0, 2.0 Hz),
6.47 (s, 1H), 4.22 (t, 2H, J=8.8 Hz), 3.25 (t, 1H, J=8.6 Hz), 2.16
(s, 3H), 1.31 (s, 9H). ##STR970##
[1058] Using general method A, Example A34 (0.20 g, 0.675 mmol) and
2,3-dichlorophenyl isocyanate (0.127 g, 0.675 mmol) were combined
to yield
1-(3-cyclopentyl-1-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)-1H-pyraz-
ol-5-yl)-3-(2,3-dichlorophenyl)urea (195 mg, 60% yield) as an
off-white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.3
(s, 1H), 9.18 (s, 1H), 8.77 (s, 1H), 8.06 (dd, J=3.6, and 6.8 Hz,
1H), 7.32 (m, 3H), 7.26 (dd, J=2.8, and 8.4 Hz, 1H), 6.97 (d, J=8.4
Hz, 2H), 6.30 (s, 1H), 3.00 (m, 1H), 2.95 (t, J=8.0 Hz, 2H), 2.48
(t, J=8.0 Hz, 2H), 1.94 (m, 2H), 1.67 (m, 6H); LC-MS (EI) m/z:
484.0 (M+H.sup.+). ##STR971##
[1059] To a solution of
1-(3-((t-butyldimethylsilyloxy)methyl)phenyl)-3-(thiophen-2-yl)-1H-pyrazo-
l-5-amine (available from ethyl
3-(5-amino-3-(thiophen-2-yl)-1H-pyrazol-1-yl)benzoate using general
method C followed by protection with TBSCl) (0.5 g, 1.3 mmol) in
THF (3 mL) was added pyridine (0.10 g, 1.3 mmol) and
1,2,3-trifluoro-4-isocyanatobenzene (0.27 g, 1.6 mmol). The
reaction mixture was stirred at room temperature for 22 hours.
Water was added and the solid was filtered, washed with H.sub.2O
and dried under vacuum to obtain the crude product. To a solution
of the crude product in THF was added TBAF (1.6 mL, 1.0 M). The
reaction mixture was stirred at room temperature for 3 hours. The
solvent was removed under reduced pressure. Ethyl acetate was added
into the residue and then 1N--HCl (5 drops) was added. The organic
layer was washed with water, dried (Na.sub.2SO.sub.4) and
evaporated under reduced pressure to obtain the crude product. The
crude was dissolved in methanol and the solid filtered and dried
under vacuum to yield
1-(1-(3-(hydroxymethyl)phenyl)-3-(thiophen-2-yl)-1H-pyrazol-5-yl)-3-(2,3,-
4-trifluorophenyl)urea (0.42 g, 73% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.13 (brs, 1H), 8.99 (s, 1H), 7.85 (m, 1H),
7.4-7.6 (m, 6H), 7.28 (m, 1H), 7.11 (dd, J=3.6, and 4.8 Hz, 1H),
6.86 (s, 1H), 5.39 (t, J=6.0 Hz, 1H), 4.62 (d, J=6.0 Hz, 2H); MS
(EI) m/z: 445.0 (M+H.sup.+). ##STR972##
[1060] Using general method A,
1-(3-((t-butyldimethylsilyloxy)methyl)phenyl)-3-(2-fluorophenyl)-1H-pyraz-
ol-5-amine (available from ethyl
3-(5-amino-3-(2-fluorophenyl)-1H-pyrazol-1-yl)benzoate using
general method C, followed by protection with TBSCl) (0.4 g, 1.0
mmol) was combined with 2,3-dichlorophenyl isocyanate (0.32 g, 1.2
mmol) to yield
1-(2,3-dichlorophenyl)-3-(3-(2-fluorophenyl)-1-(3-(hydroxymethyl)phenyl)--
1H-pyrazol-5-yl)urea (0.28 g, 59% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.05 (s, 1H), 8.87 (s, 1H), 8.08 (m, 1H),
7.99 (dt, J=2.0, and 8.0 Hz, 1H), 7.58 (m, 1H), 7.55 (d, J=7.6 Hz,
1H), 7.50 (brd, J=7.6 Hz, 1H), 7.45 (brd, J=7.2 Hz, 1H), 7.41 (m,
1H), 7.32 (m, 3H), 6.91 (d, J=4.4 Hz, 1H), 5.39 (t, J=6.0 Hz, 1H),
4.62 (d, J=6.0 Hz, 2H); MS (EI) m/z: 471.0 (M+H.sup.+).
##STR973##
[1061] Using general method A,
1-(3-((t-butyldimethylsilyloxy)methyl)phenyl)-3-(2-fluorophenyl)-1H-pyraz-
ol-5-amine (available from ethyl
3-(5-amino-3-(2-fluorophenyl)-1H-pyrazol-1-yl)benzoate using
general method C, followed by protection with TBSCl) (0.4 g, 1.0
mmol) was combined with 2,3,4-triflulorophenyl isocyanate (0.32 g,
1.2 mmol) to yield
1-(2,3,4-troflulorophenyl)-3-(3-(2-fluorophenyl)-1-(3-(hydroxymethy-
l)phenyl)-1H-pyrazol-5-yl)urea (330 mg, 72% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 9.14 (brs, 1H), 9.01 (s, 1H), 7.98
(dt, J=1.6, and 8.0 Hz, 1H), 7.86 (m, 1H), 7.2-7.6 (m, 8H), 6.96
(d, J=4.0 Hz, 1H), 5.39 (t, J=6.0 Hz, 1H), 4.62 (d, J=6.0 Hz, 2H);
MS (EI) m/z: 457.0 (M+H.sup.+). ##STR974##
[1062] Using general method D, ethyl
4-(5-amino-3-t-butyl-1H-pyrazol-1-yl)benzoate (0.48 g, 0.87 mmol,
available from Example 19) and (S)-(+)-aminoindane (0.11 ml, 0.87
mmol, 1.0 eq) were combined to yield (S)-ethyl
4-(3-t-butyl-5-(3-(2,3-dihydro-1H-inden-1-yl)ureido)-1H-pyrazol-1-yl)benz-
oate (0.243 g, 62% yield) as an off-white solid. .sup.1H NMR
(CDCl.sub.3): .delta. 8.11-8.08 (m, 2H), 7.66-7.64 (m, 2H),
7.23-7.22 (m, 2H), 7.19-7.15 (m, 1H), 7.09-7.07 (m, 1H), 6.35 (s,
1H), 5.37-5.31 (m, 1H), 4.401-4.34 (m, 2H), 2.96-2.79 (m, 2H),
2.60-2.52 (m, 1H), 1.73-1.63 (m, 1H), 1.45-1.39 (m, 3H), 1.34 (s,
9H); MS (ESI) m/z: 447.3 (M+H.sup.+).
[1063] This material was reduced using general method C to yield
(S)-1-(3-t-butyl-1-(4-(hydroxymethyl)phenyl)-1H-pyrazol-5-yl)-3-(2,3-dihy-
dro-1H-inden-1-yl)urea (29.4 mg, 13% yield) as a white solid.
.sup.1H NMR (DMSO-d.sub.6): .delta. 8.07 (s, 1H), 7.43 (m, 4H),
7.24-7.19 (m, 4H), 6.95-6.93 (m, 1H), 6.33 (s, 1H), 5.12-5.06 (m,
2H), 4.56 (s, 2H), 2.93-2.86 (m, 1H), 2.82-2.74 (m, 1H), 2.43-2.36
(m, 1H), 1.76-1.67 (m, 1H), 1.27 (s, 9H); MS (ESI) m/z: 405.2
(M+H.sup.+). ##STR975##
[1064] To a stirring solution of Example 349 (0.060 g, 0.14 mmol)
and Et.sub.3N (0.023 ml, 0.16 mmol) in THF (1.4 ml) was added
t-butyl bromoacetate (0.021 ml, 0.14 mmol). The resulting mixture
was stirred at RT overnight. The completed reaction was diluted
with EtOAc and washed with H.sub.2O (1.times.), 5% citric acid
(1.times.), satd. NaHCO.sub.3 (1.times.), brine (1.times.), dried
(Na.sub.2SO.sub.4), filtered, concentrated and purified via column
chromatography to yield t-butyl
2-(7-(3-t-butyl-5-(3-(naphthalen-1-yl)ureido)-1H-pyrazol-1-yl)-3,4-dihydr-
oisoquinolin-2(1H)-yl)acetate (23.8 mg, 31% yield). .sup.1H NMR
(CDCl.sub.3): .delta. 7.89-7.82 (m, 2H), 7.73-7.72 (m, 1H),
7.68-7.66 (m, 1H), 7.46-7.38 (m, 2H), 7.34-7.31 (m, 1H), 7.08-7.03
(m, 2H), 6.97-6.95 (m, 1H), 6.43 (s, 1H), 3.72 (brs, 2H), 3.31
(brs, 2H), 2.86 (brs, 2H), 2.78-2.77 (m, 2H), 1.50 (s, 9H), 1.33
(s, 9H); MS (ESI) m/z: 554.2 (M+H.sup.+).
[1065] This material (0.0238 g, 0.0430 mmol) was dissolved in 100%
formic acid (2 ml) and stirred at RT overnight. The completed
reaction was concentrated to dryness. The residue was dissolved in
1M HCl and extracted with EtOAc (2.times.). The combined organics
were washed with 1M HCl (1.times.). The combined aqueous were
diluted with iPrOH and concentrated (3.times.) until a foam
resulted. This was dissolved in MeCN/H.sub.2O frozen and
lyopholized to yield
2-(7-(3-t-butyl-5-(3-(naphthalen-1-yl)ureido)-1H-pyrazol-1-yl)-3,4-dihydr-
oisoquinolin-2(1H)-yl)acetic acid (17.5 mg, 76% yield) as an
off-white solid as the HCl salt. .sup.1H NMR (DMSO-d.sub.6):
.delta. 9.51 (s, 1H), 9.44 (s, 1H), 8.27 (s, 1H), 7.95-7.90 (m,
2H), 7.63-7.61 (m, 1H), 7.56-7.51 (m, 4H), 7.46-7.38 (m, 2H),
7.23-7.10 (m, 1H), 6.38 (s, 1H), 4.59 (brs, 2H), 4.26 (brs, 2H),
3.47 (brs, 2H), 3.18 (brs, 2H), 1.29 (s, 9H); MS (ESI) m/z: 498.2
(M+H.sup.+). ##STR976##
[1066] To a stirring solution of Example 349 (0.060 g, 0.14 mmol),
glycolic acid (0.011 g, 0.15 mmol) and DCC (0.034 g, 0.16 mmol) in
MeCN (1.5 ml) was added DMAP (0.0050 g, 0.041 mmol). The resulting
mixture was stirred at RT for 30 min and then heated at
80-85.degree. C. overnight. The completed reaction was cooled to RT
and then cooled in ice to precipitate the DCU. The suspension was
filtered and the filtrate concentrated and purified by reverse
phase chromatography to yield of
1-(3-t-butyl-1-(2-(2-hydroxyacetyl)-1,2,3,4-tetrahydroisoquinolin-7-yl)-1-
H-pyrazol-5-yl)-3-(naphthalen-1-yl)urea (36.0 mg, 53% yield) as an
off-white solid. .sup.1H NMR (DMSO-d.sub.6; mixture of rotamers):
.delta. 9.05 (s, 1H), 8.83 and 8.79 (s, 1H), 8.03-8.01 (m, 1H),
7.96-7.91 (m, 2H), 7.66-7.64 (m, 1H), 7.59-7.52 (m, 2H), 7.49-7.36
(m, 4H), 6.42 (s, 1H), 4.73 and 4.66 (s, 2H), 4.21 and 4.19 (s,
2H), 3.76-3.73 and 3.63-3.61 (m, 2H), 2.95-2.92 and 2.87-2.86 (m,
1H), 1.29 (s, 9H); MS (ESI) m/z: 498.2 (M+H.sup.+). ##STR977##
[1067] Using general method K, Example 349 (0.300 g, 0.683 mmol)
and D-lactic acid, sodium salt (0.0841 g, 0.751 mmol) were combined
to yield
1-(3-t-butyl-1-(2-((R)-2-hydroxypropanoyl)-1,2,3,4-tetrahydroisoquinolin--
7-yl)-1H-pyrazol-5-yl)-3-(naphthalen-1-yl)urea (65.4 mg, 19%
yield). .sup.1H NMR (DMSO-d.sub.6; rotamers): .delta. 9.04 (s, 1H),
8.83 and 8.78 (s, 1H), 8.03-7.99 (m, 1H), 7.97-7.91 (m, 2H),
7.66-7.64 (m, 1H), 7.58-7.35 (m, 6H), 6.42 (s, 1H), 4.89-4.67 (m,
2H), 4.57-4.52 (m, 1H), 3.84-3.78 and 3.70-3.65 (m, 2H), 2.94-2.91
and 2.88-2.85 (m, 2H), 1.29 (s, 9H), 1.25-1.23 and 1.21-1.19 (m,
3H); MS (ESI) m/z: 512.3 (M+H.sup.+). ##STR978##
[1068] Using general method D, Example A34 (0.280 g, 0.609 mmol)
and (S)-(+)-aminoindane (0.0781 ml, 0.609 mmol, 1.00 eq) were
combined to yield
1-(3-t-butyl-1-(1-oxo-1,2,3,4-tetrahydroisoquinolin-7-yl)-1H-pyrazo-
l-5-yl)-3-((S)-2,3-dihydro-1H-inden-1-yl)urea (151.0 mg, 56% yield)
of as an off-white solid. .sup.1H NMR (CDCl.sub.3): .delta.
8.08-8.02 (m, 2H), 7.64-7.61 (m, 1H), 7.28-7.27 (m, 1H), 7.23-7.10
(m, 4H), 6/69 (brs, 1H), 6.39 (s, 1H), 5.82 (brs, 1H), 5.36-5.30
(m, 1H), 3.45-3.42 (m, 2H), 2.93-2.76 (m, 4H), 2.59-2.51 (m, 1H),
1.75-1.66 (m 1H), 1.33 (s, 9H); MS (ESI) m/z: 444.2
(M+H.sup.+).
[1069] This material was reduced using general method C to yield
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-7-yl)-1H-pyrazol-5-yl)-3-((-
S)-2,3-dihydro-1H-inden-1-yl)urea (0.103 g, 81% yield) as an
off-white solid as the HCl salt. .sup.1H NMR (DMSO-d.sub.6):
.delta. 9.54 (brs, 2H), 8.36 (s, 1H), 7.41-7.32 (m, 4H), 7.25-7.14
(m, 3H), 6.32 (s, 1H), 6.06 (s, 1H), 5.12-5.06 (m, 1H), 4.32 (brs,
2H), 3.38 (brs, 2H), 3.06-3.02 (m, 2H), 2.93-2.86 (m, 1H),
2.82-2.74 (m, 1H), 2.44-2.33 (m, 1H), 1.77-1.57 (m, 1H), 1.27 (s,
9H); MS (ESI) m/z: 430.2 (M+H.sup.+).
[1070] Te material from the previous reaction (0.0775 g, 0.166
mmol) and methanesulfonyl chloride (0.0386 ml, 0.499 mmol) were
combined to yield
1-(3-t-butyl-1-(2-(methylsulfonyl)-1,2,3,4-tetrahydroisoquinolin-7-yl)-1H-
-pyrazol-5-yl)-3-((S)-2,3-dihydro-1H-inden-1-yl)urea (18.5 mg, 22%
yield). .sup.1H NMR (CDCl.sub.3): .delta. 7.31-7.28 (m, 2H),
7.22-7.11 (m, 5H), 6.69 (brs, 1H), 6.32 (s, 1H), 5.45 (brs, 1H),
5.29-5.23 (m, 1H), 4.42 (brs, 2H), 3.54-3.46 (m, 2H), 2.96-2.77 (m,
3H), 2.81(s, 3H), 2.56-2.48 (m, 1H), 1.74-1.64 (m, 1H), 1.33 (s,
9H); MS (ESI) m/z: 508.3 (M+H.sup.+). ##STR979##
[1071] Using general method D, Example A34 0.280 g, 0.609 mmol) and
(S)-1,2,3,4-tetrahydro-naphthalen-1-amine were combined and the
resultant lactam (440 mg, 88.4% yield, MS (ESI)<m/z:458.3
(M+H.sup.+) was reduced using general method C to yield
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-7-yl)-1H-pyrazol-5-yl)-3-((-
S)-1,2,3,4-tetrahydronaphthalen-1-yl)urea (83.6 mg, 20% yield, MS
(ESI) m/z: 444.2 (M+H.sup.+)). This material (0.160 g, 0.361 mmol)
and methanesulfonyl chloride (0.0558 ml, 0.721 mmol) were combined
to yield pure
1-(3-t-butyl-1-(2-(methylsulfonyl)-1,2,3,4-tetrahydroisoquinolin-7-y-
l)-1H-pyrazol-5-yl)-3-((S)-1,2,3,4-tetrahydro-naphthalen-1-yl)urea
(62.3 mg, 33% yield) as a white solid. .sup.1H NMR (CDCl.sub.3):
.delta. 7.34-7.32 (m, 1H), 7.25-7.22 (m, 2H), 7.19-7.07 (m, 4H),
6.29 (s, 1H), 6.24 (brs, 1H), 5.18-5.15 (m, 1H), 5.04-4.99 (m, 1H),
4.49-4.42 (m, 2H), 3.58-3.50 (m, 2H), 2.99-2.96 (m, 2H), 2.83 (s,
3H), 2.77-2.74 (m, 2H), 2.04-1.99 (m, 1H), 1.83-1.71 (m, 3H), 1.33
(s, 9H); MS (ESI) m/z: 522.2 (M+H.sup.+). ##STR980##
[1072] To a solution of ethyl
2-(4-(5-amino-3-(thiophen-2-yl)-1H-pyrazol-1-yl)phenyl)acetate
(0.244 g, 0.745 mmol) in THF (7.5 ml), thoroughly cooled to
-78.degree. C., was added KHMDS in PhMe (1.79 ml, 0.894 mmol, 0.500
M). The resulting very dark mixture was stirred at -78.degree. C.
for 1 h and then treated with MeI (0.056 ml, 0.894 mmol). The
reaction was stirred with gradual warming to RT overnight. The
completed reaction was quenched by addition of 3M HCl, diluted with
EtOAc and the layers separated. The aqueous was extracted with
EtOAc (2.times.) and the combined organics were washed with satd.
NaHCO.sub.3 (1.times.), brine (1.times.), dried (MgSO.sub.4),
filtered, and concentrated to yield ethyl
2-(4-(5-amino-3-(thiophen-2-yl)-1H-pyrazol-1-yl)phenyl)propanoate
(0.25 g) of crude which was used without further purification in
the next reaction. MS (ESI) m/z: 342.3 (M+H.sup.+).
[1073] Using general method A, this material was combined with
2,3-dichlorophenyl isocyanate (0.0967 ml, 0.732 mmol) and the
resultant ester saponified using general method E to yield
2-(4-(5-(3-(2,3-dichlorophenyl)ureido)-3-(thiophen-2-yl)-1H-pyrazol-1-yl)-
phenyl)propanoic acid (68.9 mg, 35% yield). .sup.1H NMR
(DMSO-d.sub.6:acid): .delta. 9.47 (s, 1H), 8.89 (s, 1H), 8.12-8.09
(m, 1H), 7.58-7.47 (m, 6H), 7.34-7.31 (m, 2H), 7.13-7.01 (m, 1H),
6.87 (s, 1H), 3.81 (q, 1H, J=6.8 Hz), 1.43 (d, 3H, J=6.8 Hz); MS
(ESI) m/z: 501.0 (M+H.sup.+), 503.0 (M+2+H.sup.+). ##STR981##
[1074] To a solution of
2-(4-(5-(3-(2,3-dichlorophenyl)ureido)-3-(thiophen-3-yl)-1H-pyrazol-1-yl)-
phenyl)acetic acid (0.073 g, 0.15 mmol) in DMF (1 ml) were added
PyBop (0.18 mmol) and MeOH (0.1 g, 0.45 mmol) and stirred for 4 h
at RT. The reaction mixture was poured into cold H.sub.2O and the
product was extracted CO.sub.2Me with EtOAc (3.times.20 ml). The
combined organic extracts were Example 535 washed with 3M HCl,
brine, dried (Na.sub.2SO.sub.4) and concentrated to yield a crude
product. To the crude product was added CH.sub.2Cl.sub.2 (2 ml) and
stirred for 10 min and the resultant solid was filtered and dried
to afford pure methyl
2-(4-(5-(3-(2,3-dichlorophenyl)ureido)-3-(thiophen-3-yl)-1H-pyrazol-1-yl)-
phenyl)acetate. .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.40
(s, 1H), 8.87 (s, 1H), 8.10 (dd, J=6.8 Hz, 2.4 Hz, 1H), 7.87-7.86
(m, 1H), 7.60 (dd, J=4.8 Hz, 2.8 Hz, 1H), 7.57 (d, J=8.0 Hz, 2H),
7.52-7.49 (m, 1H), 7.48 (d, J=8.0 Hz, 2H), 7.34-7.32 (m, 2H), 6.85
(s, 1H), 3.80 (s, 2H), 3.65 (s, 3H); MS (ESI) m/z: 501.0
(M+H.sup.+). ##STR982##
[1075] Using the same general approach as for Example 524, ethyl
2-(3-(5-amino-3-(thiophen-3-yl)-1H-pyrazol-1-yl)phenyl)acetate
(0.2258 g, 0.450 mmol, 1.00 eq) was transformed to ethyl
2-(3-(5-amino-3-(thiophen-3-yl)-1H-pyrazol-1-yl)phenyl)propanoate.
This, in turn, was combined with 2,3-dichlorophenyl isocyanate,
according to general method A, to afford
2-(3-(5-(3-(2,3-dichlorophenyl)ureido)-3-(thiophen-3-yl)-1H-pyrazol-1-yl)-
phenyl)propanoic acid. Using general method J, this product was
combined with 0.5M N.sub.3 in dioxane (4.50 ml, 2.25 mmol, 5.00
eq). to afford 0.1731 g (77%) of pure
1-(1-(3-(1-amino-1-oxopropan-2-yl)phenyl)-3-(thiophen-3-yl)-1H-pyrazol-5--
yl)-3-(2,3-dichlorophenyl)urea. .sup.1H NMR (DMSO-d.sub.6): .delta.
9.38 (s, 1H), 8.82 (s, 1H), 8.12-8.09 (m, 1H), 7.88-7.87 (m, 1H),
7.62-7.60 (m, 1H), 7.57-7.42 (m, 6H), 7.36-7.31 (m, 2H), 6.89 (brs,
1H), 6.86 (s, 1H), 3.69 (q, 1H, J=7.2 Hz), 1.36 (d, 3H, J=7.2 Hz);
MS (ESI) m/z: 500.0 (M+H.sup.+), 502.0 (M+2+H.sup.+).
##STR983##
[1076] Using the same general approach as for Example 524, ethyl
2-(3-(5-amino-3-(thiophen-2-yl)-1H-pyrazol-1-yl)phenyl)acetate
(0.202 g, 0.403 mmol, 1.00 eq) was transformed to ethyl
2-(3-(5-amino-3-(thiophen-2-yl)-1H-pyrazol-1-yl)phenyl)propanoate.
This, in turn, was combined with 2,3-dichlorophenyl isocyanate,
according to general method A, to afford
2-(3-(5-(3-(2,3-dichlorophenyl)ureido)-3-(thiophen-2-yl)-1H-pyrazol-1-yl)-
phenyl)propanoic acid. Using general method J, this product was
combined with 0.5M NH.sub.3 in dioxane (4.03 ml, 2.01 mmol, 5.00
eq) to afford 0.145 g (72%) of
1-(1-(3-(1-amino-1-oxopropan-2-yl)phenyl)-3-(thiophen-2-yl)-1H-pyrazol-5--
yl)-3-(2,3-dichlorophenyl)urea. .sup.1H NMR (DMSO-d.sub.6): .delta.
9.42 (s, 1H), 8.84 (s, 1H), 8.12 (m, 1H), 7.55-7.43 (m, 7H),
7.36-7.31 (m, 2H), 7.13-7.11 (m, 1H), 6.89 (brs, 1H), 6.87 (s, 1H),
3.69 (q, 1H, J=7.2 Hz), 1.36 (d, 3H, J=7.2 Hz); MS (ESI) m/z: 500.0
(M+H.sup.+), 502.0 (M+2+H.sup.+). ##STR984##
[1077] 3-(2-Fluorophenyl)-1-(3-iodophenyl)-1H-pyrazol-5-amine
(0.500 g, 1.32 mmol, 1.00 eq), methacrylamide (0.281 g, 3.30 mmol,
2.50 eq), Pd(OAc).sub.2 (0.0118 g, 0.0527 mmol, 0.04 eq), Ph.sub.3P
(0.0346 g, 0.132 mmol, 0.10 eq) and Et.sub.3N (0.919 ml, 6.59 mmol,
5.00 eq) were combined in DMF (3 ml) and heated at 80.degree. C.
overnight. The reaction was cooled to RT, diluted with H.sub.2O and
extracted with EtOAc (2.times.). The combined organics were washed
with 5% citric acid (2.times.), brine (1.times.) and dried
(MgSO.sub.4). Filtration and evaporation gave crude product which
was purified by flash chromatography to afford 0.4192 g (95%) of
pure
(E)-3-(3-(5-amino-3-(2-fluorophenyl)-1H-pyrazol-1-yl)phenyl)-2-methylacry-
lamide. MS (ESI) m/z: 337.2 (M+H.sup.+).
[1078]
(E)-3-(3-(5-amino-3-(2-fluorophenyl)-1H-pyrazol-1-yl)phenyl)-2-met-
hylacrylamide (0.4192 g, 1.25 mmol, 1.00 eq) was hydrogenated (3.5
atm) over 10% Pd/C (0.0838 g, 0.0394 mmol, 0.0316 eq) in MeOH (5
ml) at RT for 36 h. Filtration through Celite.RTM. and evaporation
yielded 0.245 g (58%) of crude
3-(3-(5-amino-3-(2-fluorophenyl)-1H-pyrazol-1-yl)phenyl)-2-methylpropanam-
ide which was used as is in the next reaction. MS (ESI) m/z: 339.2
(M+H.sup.+).
[1079] Using general method A,
3-(3-(5-amino-3-(2-fluorophenyl)-1H-pyrazol-1-yl)phenyl)-2-methylpropanam-
ide (0.1225 g, 0.362 mmol, 1.00 eq) was combined with
2,3-dichlorophenyl isocyanate (0.102 g, 0.543 mmol, 1.50 eq) to
yield 34.2 mg (18%) of pure
1-(1-(3-(3-amino-2-methyl-3-oxopropyl)phenyl)-3-(2-fluorophenyl)-1H-pyraz-
ol-5-yl)-3-(2,3-dichlorophenyl)urea. .sup.1H NMR (DMSO-d.sub.6):
.delta. 9.40 (s, 1H), 8.89 (s, 1H), 8.11-8.08 (s, 1H), 8.02-7.98
(m, 1H), 7.53-7.39 (m, 4H), 7.36-7.26 (m, 6H), 6.92-6.91 (m, 1H),
6.76 (brs, 1H), 3.00-2.93 (m, 1H), 2.65-2.57 (m, 2H), 1.03-1.02 (m,
3H); MS (ESI) m/z: 526.0 (M+H.sup.+), 528.0 (M+2+H.sup.+).
##STR985##
[1080] Using general method J, Example 350 (81 mg, 0.2 mmol) and
0.5 M N.sub.3 in dioxane (1 mL) were combined to afford
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-t-butyl-1H-pyrazol-5-yl)-3-((S)-2,3-
-dihydro-1H-inden-1-yl)urea (25 mg, 31%) as white solid. .sup.1H
NMR (400 MHz, DMSO-d.sub.6): .quadrature. 8.08 (s, 1H), 7.50 (s,
1H), 7.44-7.19 (m, 8H), 6.91-6.89 (m, 2H), 6.33 (s, 1H), 5.09 (q,
J=7.6 Hz, 1H), 3.44 (s, 2H), 2.92-2.73 (m, 2H), 2.44-2.36 (m, 1H),
1.76-1.66 (m, 1H), 1.27 (s, 9H); MS (ESI) m/z: 432.2 (M+H.sup.+).
##STR986##
[1081] Example 506 (0.32 g, 1 mmol) was dissolved in 7N
N.sub.3/MeOH (10 mL) and the mixture was stirred for 24 h at
50.degree. C. Then solvent was removed under vacuum and the residue
was purified by column chromatography to afford
2-(3-(5-amino-3-(thiophen-2-yl)-1H-pyrazol-1-yl)phenyl)acetamide
(0.2 g, 67%) as a solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta.7.51-7.42 (m, 5H), 7.34 (dd, J=3.2 Hz, 1.2 Hz, 1H),
7.24-7.22 (m, 1H), 7.08-7.06 (m, 1H), 6.93 (brs, 1H), 5.82 (s, 1H),
5.47 (s, 2H), 3.46 (s, 2H); MS (ESI) m/z: 299.0 (M+H.sup.+).
##STR987##
[1082] To a solution of phosgene (0.3 mL of 20% w/v solution in
toluene) in MeCN (1 mL) was added a mixture of
3-(pyridin-3-yloxy)benzenamine (0.046 g, 0.25 mmol) and Et.sub.3N
(0.066 g, 0.66 mmol) in MeCN (1 mL) at 0.degree. C. under Ar over a
period of 10 min. After stirring for 30 min at RT, to the mixture
was added a solution that contained
2-(3-(5-amino-3-(thiophen-2-yl)-1H-pyrazol-1-yl)phenyl)acetamide
(0.05 g, 0.16 mmol) and Et.sub.3N (0.06 g, 0.66 mmol) and stirred
for 16 h at RT. The solvents were removed to afford a residue which
was purified by column chromatography to afford material that upon
treatment with 3M HCl/EtOAc yielded
1-(1-(3-(2-amino-2-oxoethyl)phenyl)-3-(thiophen-2-yl)-1H-pyrazol-5-yl)-3--
(3-(pyridin-3-yloxy)phenyl)urea (12 mg, 14%) urea as white solid.
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta.9.50 (s, 1H), 8.76 (s,
1H), 8.57 (s, 1H), 8.51 (d, J=4.8 Hz, 1H), 7.57-7.68 (m, 2H), 7.57
(s, 1H), 7.51-7.32 (m, 8H), 7.16-7.09 (m, 2H), 6.95 (s, 1H), 6.82
(s, 1H), 6.75 (dd, J=8.0 Hz, 2.4 Hz, 1H), 3.49 (s, 2H); MS (ESI)
m/z: 511.0 (M+H.sup.+). ##STR988##
[1083] Using general method J, Example 351 (81 mg, 0.17 mmol)
ethanolamine (13 mg, 0.22 mmol) were combined to afford
1-(2,3-dichlorophenyl)-3-(1-(3-(2-(2-hydroxyethylamino)-2-oxoethyl)phenyl-
)-3-phenyl-1H-pyrazol-5-yl)urea (55 mg, 62%) as a white solid.
.sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 9.41 (s, 1H), 8.86 (s,
1H), 8.15 (t, J=5.6 Hz, 1H), 8.09 (dd, J=6.8 Hz, 2.8 Hz, 1H),
7.86-7.84 (m, 2H), 7.56-7.31 (m, 9H), 6.95 (s, 1H), 3.54 (s, 2H),
3.39 (t, J=6 Hz, 2H), 3.13-3.09 (m, 2H); MS (ESI) m/z: 524.0
(M+H.sup.+). ##STR989##
[1084] To a solution of Example 213 (0.054 g, 0.137 mmol) in dry
ethanol (2 mL) was at -78.degree. C. added acetyl chloride (1.1 g,
14 mmol) and the resulting solution was kept at room temperature
overnight. The solvent was evaporated and to the residue was added
7N ammonia in methanol (2 mL) and the mixture was stirred at room
temperature overnight. The solvent was evaporated and the residue
was purified by reverse-phase chromatography (CV 12 mL, 20%
acetonitrile in water to 50% acetonitrile in water, both solvents
with 0.1% TFA, 20 CV). Basic extraction and reacidification with
HCl gave 21 mg (34%) of
1-(3-t-butyl-1-(3-carbamimidoylphenyl)-1H-pyrazol-5-yl)-3-(2,5-difluoroph-
enyl)urea as a white solid. .sup.1H-NMR (methanol-d.sub.4): .delta.
8.09 (t, 1H, J=1.8 Hz), 8.02-7.98 (m, 2H), 7.94-7.89 (m, 1H), 7.87
(t, 1H, J=8.2 Hz), 7.15-7.09 (m, 1H), 6.79-6.71 (m, 1H), 1.41 (s,
9H), amidine, urea and pyrazolamine protons not visible. LC-MS (EI)
m/z: 413.0 (M+H+). ##STR990##
[1085] Using the same method as Example A28, 5-nitroindoline (5.0
g, 152 mmol) was converted to
1-[5-(2-amino-4-t-butylpyrrol-1-yl)-2,3-dihydroindol-1-yl]-2,2,2-trifluor-
oethanone (9.2 g, 40% yield, 3 steps) as a light-brown solid.
.sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 8.13-8.16 (m, 1H),
7.57 (s, 1H), 7.44-7.47 (m, 1H), 5.61 (t, J=7.8 Hz, 2H), 4.34 (t,
J=7.8 Hz, 2H), 3.28 (s, 1H), 1.26 (s, 1H). MS (ESI) m/z: 353.2
(M+H.sup.+). ##STR991##
[1086] To a solution of
(S)-1,2,3,4-Tetrahydroisoquinolone-3-carboxylic acid (5.00 g, 28.2
mmol) in sulfuric acid (20 mL) was at 0.degree. C. dropwise added a
solution of potassium nitrate (2.95 g, 29.2 mmol) in sulfuric acid
(10 mL). When the addition was complete, the mixture was stirred
for 5 min and the carefully diluted with water and neutralized with
ammonium hydroxide (about 100 mL). The precipitate was filtered,
washed with water and dried in vacuo to give
(S)-7-nitro-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid (4.70
g, 75% yield) as a yellow solid. Acetyl chloride (20.0 mL, 22.1 g,
281 mmol) was added carefully to methanol (50 mL) at -20.degree. C.
The solution was allowed to reach room temperature and stirred for
10 min. (S)-7-nitro-1,2,3,4-tetrahydroisoquinoline-3-carboxylic
acid (4.70 g, 21.2 mmol) was then added and the resulting
suspension was stirred at 50.degree. C. for 5 h. The solvent was
evaporated and the residue was dried in vacuo to give (S)-methyl
7-nitro-1,2,3,4-tetrahydroisoquinoline-3-carboxylate hydrochloride
(5.77 g, 100% yield) as a crude form. (S)-methyl
7-nitro-1,2,3,4-tetrahydroisoquinoline-3-carboxylate hydrochloride
(4.77 g, 17.5 mmol) was suspended in methylene chloride (50 mL).
Triethylamine (2.93 mL, 2.12 g, 2.10 mmol) was added and then
carefully trifluoroacetyl anhydride (2.92 mL, 4.41 g, 21.0 mmol).
the mixture was stirred for 10 min. Water was added (100 mL) and
the mixture was extracted with methylene chloride (3.times.100 mL),
dried over magnesium sulfate and concentrated. Column
chromatography (CV 120 mL, 10% ethyl acetate hexanes to 30% ethyl
acetate in hexanes, 20 (CV) gave the desired product, (S)-methyl
7-nitro-2-(2,2,2-trifluoroacetyl)-1,2,3,4-tetrahydroisoquinoline-3-carbox-
ylate (2.70 g, 47% yield), and 1.28 g of coeluting byproduct
mixture. R.sub.f (ethyl acetate)=0.89. To a solution of (S)-methyl
7-nitro-2-(2,2,2-trifluoroacetyl)-1,2,3,4-tetrahydroisoquinoline-3-carbox-
ylate (2.70 g, 8.13 mmol) in methanol (50 mL) was added palladium
on charcoal (10%, 0.432 g, 0.406 mmol) and the resulting suspension
was stirred in an atmosphere of hydrogen overnight. The mixture was
filtered, charged with conc. HCl (1 mL) and concentrated to give
(S)-methyl
7-amino-2-(2,2,2-trifluoroacetyl)-1,2,3,4-tetrahydroisoquinoline-3-carbox-
ylate hydrochloride (2.60 g, 95% yield) as a grey solid. R.sub.f
(ethyl acetate)=0.82. Using general method M, (S)-methyl
7-amino-2-(2,2,2-trifluoroacetyl)-1,2,3,4-tetrahydroisoquinoline-3-carbox-
ylate hydrochloride (2.60 g, 7.68 mmol) and pivaloylacetonitrile
(0.961 g, 7.68 mmol) were combined to yield (3S)-methyl
7-(5-amino-3-t-butyl-1H-pyrazol-1-yl)-2-(2,2,2-trifluoroacetyl)-1,2,3,4-t-
etrahydroisoquinoline-3-carboxylate which was used without
purification. ##STR992##
[1087] Using General method D, Example A36 (0.500 g, 1.35 mmol) and
cyclohexylamine (0.031 g, 0.242 mmol) to yield t-butyl
6-(3-t-butyl-5-(3-cyclohexylureido)-1H-pyrazol-1-yl)-3,4-dihydroisoquinol-
ine-2(1H)-carboxylate (83 mg, 83% yield) as a white powder, which
was deprotected using general method F to afford
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-cy-
clohexylurea (59 mg, 85% yield) as a colorless solid. .sup.1H NMR
(400 MHz, CD.sub.3OD): .delta. 7.51-7.46 (m, 3H), 6.62 (s, 1H),
4.48 (s, 2H), 3.57 (t, J=6.2 Hz, 2H), 3.55-3.50 (m, 1H), 3.23 (t,
J=6.0 Hz, 2H), 1.86-1.82 (m, 2H), 1.73-1.69 (m, 2H), 1.61-1.58 (m,
1H), 1.39 (s, 9H), 1.38-1.20 (m, 2H), 1.26-1,16 (m, 3H); LC-MS (EI)
m/z: 396.3 (M+H.sup.+). ##STR993##
[1088] Using General method D, a solution of Example A79 (0.615 g,
7.68 mmol) and 2,3-difluoroaniline (0.032 g, 0.250 mmol) were
combined to yield the crude product which was deprotected by
ammonia in methanol (7N, 1 mL, 7 mmol) to afford the ammination and
de-trifluoroacetylation product,
1-(3-t-butyl-1-((3S)-3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-7-
-yl)-1H-pyrazol-5-yl)-3-(2,3-difluorophenyl)urea (20 mg, 24%, 2
steps) as an off-white solid. .sup.1H NMR (400 MHz, CD.sub.3OD):
.delta. 7.80 (t, 1H, J=7.6 Hz), 7.56-7.51 (m, 3H), 7.11-7.06 (m,
1H), 6.98-6.91 (m, 1H), 6.58 (s, 1H), 4.56 (d, J=15.2 Hz, 1H), 4.50
(d,, J=15.2 Hz, 1H), 4.30 (dd, J=11.2, and 5.0 Hz, 1H), 3.54 (dd,
J=17.2, 4.8 Hz, 1H), 1.28 (s, 9H); LC-MS (EI) m/z: 469.0
(M+H.sup.+). ##STR994##
[1089] Using the same method as for Example 544, Example A79 (0.615
g, 7.68 mmol) and 2,4-difluoroaniline (0.032 g, 0.250 mmol) were
combined to afford
1-(3-t-butyl-1-((3S)-3-carbamoyl-1,2,3,4-tetrahydroisoquinolin-7-y-
l)-1H-pyrazol-5-yl)-3-(2,4-difluorophenyl)urea (19 mg, 23% yield, 2
steps) as a green/white solid. .sup.1H NMR (400 MHz, CD.sub.3OD):
.delta. 7.93-7.87 (m, 1H), 7.56-7.51 (m, 3H), 7.04-6.99 (m, 1H),
6.95-6.89 (m, 1H), 6.54 (s, 1H), 4.55 (d, J=16.4 Hz, 1H), 4.50 (d,
J=15.6 Hz, 1H), 4.20 (dd, J=11.6, and 5.2 Hz, 1H), 3.53 (dd,
J=17.2, and 4.8 Hz, 1H), 1.37 (s, 9H); LC-MS (EI) m/z: 469.2
(M+H.sup.+). ##STR995##
[1090] Using the same method as for Example 544, Example A79 (0.615
g, 7.68 mmol) and 2,3-difluoroaniline (0.032 g, 0.250 mmol) were
combined to yield the crude product which was treated with
methylamine in ethanol (8N, 1 mL, 8 mmol) to afford the
methylamminated and deprotected product,
1-(3-t-butyl-1-((3S)-3-(methylcarbamoyl)-1,2,3,4-tetrahydroisoquinolin-7--
yl)-1H-pyrazol-5-yl)-3-(2,3-difluorophenyl)urea (13 mg, 15% yield,
2 steps) as an off-white solid. .sup.1H NMR (400 MHz, CD.sub.3OD):
.delta. 7.79 (dt, J=8.0, and 1.6 Hz, 1H), 7.56-7.49 (m, 3H),
7.12-7.05 (m, 1H), 6.98-6.91 (m, 1H), 6.57 (s, 1H), 4.55 (d, J=15.6
Hz, 1H), 4.50 (d, J=16.0 Hz, 1H), 4.25 (dd, J=11.6, and 5.2 Hz,
1H), 3.46 (dd, J=19.6, and 5.2 Hz, 1H), 2.86 (s, 3H), 1.37 (s, 9H);
LC-MS (EI) m/z: 483.3 (M+H.sup.+). ##STR996##
[1091] Using the same method as for Example 544, Example A79 (0.615
g, 7.68 mmol) and 2,4,5-trifluoroaniline (0.050 g, 0.334 mmol) were
combined to afford
1-(3-t-butyl-1-((3S)-3-carbamoyl-1,2,3,4-tetrahydroisoquinolin--
7-yl)-1H-pyrazol-5-yl)-3-(2,4,5-trifluorophenyl)urea (12 mg, 14%
yield, 2 steps) as an off-white solid. .sup.1H NMR (400 MHz,
CD.sub.3OD): .delta. 8.06-7.98 (m, 1H), 7.54-7.48 (m, 3H),
7.26-7.19 (m, 1H), 6.51 (s, 1H), 4.54 (d, J=16.0 Hz, 1H), 4.28 (dd,
J=12.0, and 5.2 Hz, 1H), 4.49 (d, J=16.4 Hz, 1H), 3.61-3.47 (m,
2H), 1.35 (s, 9H); LC-MS (EI) m/z: 487.3 (M+H.sup.+).
##STR997##
[1092] To a suspension of alpha-methyl-DL-phenylalanine (2.00 g,
11.2 mmol) in conc. HCl (30 mL) was added formaldehyde (37%, 4.0
mL, 4.36 g, 4.81 mmol) and the resulting suspension was stirred at
60.degree. C. for 48 h. The precipitated solid was collected and
dried in vacuo to give 1.02 g (40%) of
3-methyl-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid
hydrochloride. .sup.1H NMR (400 MHz, CD.sub.3OD): .delta. 7.33-7.24
(m, 4H), 4.53 (d, J=16.8 Hz, 1H), 4.42 (d, J=16.0 Hz, 1H), 3.43 (d,
J=17.6 Hz, 1H), 3.18 (d, J=17.2 Hz, 1H), 1.67 (s, 3H); LC-MS (EI)
m/z: 192.0 (M+H.sup.+). Using the same method as for VP-2851,
3-methyl-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid
hydrochloride (1.01 g, 4.436 mmol) was converted to yield methyl
7-amino-3-methyl-2-(2,2,2-trifluoroacetyl)-1,2,3,4-tetrahydroisoquinoline-
-3-carboxylate hydrochloride (600 mg, 38% yield, 2 steps) as a grey
solid. .sup.1H NMR (400 MHz, CD.sub.3OD): .delta. 7.48 (d, J=7.6
Hz, 1H), 7.38 (s, 1H), 7.37 (dd, J=8.0, 2.4 Hz, 1H), 4.83 (d,
J=15.2 Hz, 1H), 4.78 (d, J=15.2 Hz, 1H), 3.63 (s, 3H), 3.27 (d,
J=14.8 Hz, 1H), 3.15 (d, J=14.4 Hz, 1H), 1.51 (s, 3H); LC-MS (EI)
m/z: 317.0 (M+H.sup.+). Using general method M, methyl
7-amino-3-methyl-2-(2,2,2-trifluoroacetyl)-1,2,3,4-tetrahydroisoquinoline-
-3-carboxylate hydrochloride (0.600 g, 1.70 mmol) and
pivaloylacetonitrile (0.21 g, 1.7 mmol) were combined to afford
methyl
7-(5-amino-3-t-butyl-1H-pyrazol-1-yl)-3-methyl-2-(2,2,2-trifluoroacetyl)--
1,2,3,4-tetrahydroisoquinoline-3-carboxylate (240 mg, 30% yield) as
a yellow foam. LC-MS (EI) m/z: 439.0 (M+H.sup.+). ##STR998##
[1093] Using general method A, Example A80 (0.070 g, 0.160 mmol)
and 2,3-dichlorophenyl isocyanate (0.060 g, 0.319 mmol) were
combined to yield methyl
7-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-3-methyl-2-
-(2,2,2-trifluoroacetyl)-1,2,3,4-tetrahydroisoquinoline-3-carboxylate.
LC-MS (EI) m/z: 626.0 (M+H.sup.+).
[1094] Using general method G, methyl
7-(3-t-butyl-5-(3-(2,3-dichloro-phenyl)ureido)-1H-pyrazol-1-yl)-3-methyl--
2-(2,2,2-trifluoroacetyl)-1,2,3,4-tetrahydroisoquinoline-3-carboxylate
(0.100 g, 0.160 mmol) was deprotected to yield
7-(3-t-butyl-5-(3-(2,3-dichlorophenyl)ureido)-1H-pyrazol-1-yl)-3-methyl-1-
,2,3,4-tetrahydroisoquinoline-3-carboxylic acid (60 mg, 68% yield)
as a yellow solid. .sup.1H NMR (400 MHz, CD.sub.3OD): .delta.
8.08-8.05 (t, J=5.0 Hz, 1H), 7.62-7.55 (m, 3H), 7.28-7.25 (m, 2H),
6.76 (s, 1H), 4.68 (d, J=16.8 Hz, 1H), 4.57 (d, J=16.8 Hz, 1H),
3.58 (d, J=17.6 Hz, 1H), 3.35 (d, J=18.0 Hz, 1H), 1.68 (s, 3H),
1.40 (s, 9H); LC-MS (EI) m/z: 516.0 518.0 (M+H.sup.+).
##STR999##
[1095] Using general method D, Example A80 and
2,4,5-trifluoroaniline (0.041 g, 0.28 mmol) were combined to yield
methyl
7-(3-t-butyl-5-(3-(2,5-difluorophenyl)ureido)-1H-pyrazol-1-yl)-1-methyl-2-
-(2,2,2-trifluoroacetyl)-1,2,3,4-tetrahydroisoquinoline-3-carboxylate
which was deprocted using the general method G to afford
7-(3-t-butyl-5-(3-(2,4,5-trifluorophenyl)ureido)-1H-pyrazol-1-yl)-3-methy-
l-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid hydrochloride
(30 mg, 40% yield, 2 steps) as a yellow solid. .sup.1H NMR (400
MHz, CD.sub.3OD): .delta. 8.11-8.04 (m, 1H), 7.60-7.54 (m, 3H),
7.27-7.20 (m, 1H), 6.68 (s, 1H), 4.66 (d, J=16.8 Hz, 1H), 4.55 (d,
J=16.8 Hz, 1H), 3.56 (d, J=17.6 Hz, 1H), 1.74 (s, 3H), 1.39 (s,
9H); LC-MS (EI) m/z: 502.2 (M+H.sup.+). ##STR1000##
[1096] Using the general method A, Example C (60 mg, 0.21 mmol) and
3-fluorophenyl isocyanate (29 mg, 0.21 mmol) were combined to
afford
1-(3-t-butyl-1-(3-methoxyphenyl)-1H-pyrazol-5-yl)-3-(3-fluorophenyl)urea
(49 mg, 60% yield). .sup.1H NMR (300 MHz, CDCl.sub.3): .delta.
7.2-7.3 (m, 3H), 7.17 (brs, 1H), 6.95-7.05 (m, 2H), 6.93 (dd,
J=1.6, and 8.2 Hz, 1H), 6.87 (dd, J=1.8, and 7.6 Hz, 1H), 6.79 (dt,
J=1.9, and 8.8 Hz, 1H), 6.64 (s, 1H), 6.39 (s, 1H), 3.77 (s, 3H),
1.35 (s, 9H); MS (EI) m/z: 383 (M+H.sup.+). ##STR1001##
[1097] Using general method A, Example C (70 mg, 0.29 mmol) and
3-thienyl isocyanate (36 mg, 0.29 mmol) were combined to afford
1-(3-t-butyl-1-(3-methoxyphenyl)-1H-pyrazol-5-yl)-3-(thiophen-3-yl)urea
(45 mg, 43% yield). .sup.1H NMR (300 MHz, CDCl.sub.3): .delta.
7.05-7.3 (m, 4H), 6.8-7.0 (m, 4H), 6.76 (s, 1H), 6.40 (s, 1H), 3.76
(s, 3H), 1.35 (s, 9H); MS (EI) m/z: 371 (M+H.sup.+).
##STR1002##
[1098] To a solution of m-aminobenzoic acid ethyl ester (200 g,
1.21 mmol) in conc. HCl (200 mL) was added an aqueous solution (250
mL) of NaNO.sub.2 (102 g, 1.46 mmol) at 0.degree. C. and the
reaction mixture was stirred for 1 h. A solution of
SnCl.sub.2.2H.sub.2O (662 g, 2.92 mmol) in conc. HCl (2 L) was then
added at 0.degree. C. The reaction solution was stirred for 2 h at
RT. The precipitate was filtered and washed with ethanol and ether
to yield ethyl 3-hydrazinobenzoate, which was used for the next
reaction without further purification.
[1099] To a mixture of 3-hydrazinobenzoic acid ethyl ester (4.5 g,
25.0 mmol) and commercially available 3-oxo-3-phenylpropionitrile
(5.5 g, 37.5 mmol) in ethanol (50 mL) was added conc. HCl (5 mL).
The resulting mixture was heated to reflux for 3 h. After removal
of the solvent, the residue was washed with Et.sub.2O to afford
ethyl 3-(5-amino-3-phenyl-1H-pyrazol-1-yl)benzoate (7 g, 2% yield,
2 steps) which was used in the next reaction without further
purification. ##STR1003##
[1100] Using the same procedure as Example A81, 4-aminobenzoic acid
ethyl ester (200 g, 1.21 mmol) and commercially available,
3-oxo-3-phenylpropanenitrile were combined to ethyl
4-(5-amino-3-phenyl-1H-pyrazol-1-yl)benzoate (7.4 g, 2% yield, 2
steps) which was used in the next reaction without further
purification. ##STR1004##
[1101] To a suspension of NaH (60%, 6.0 g, 0.15 mol) in THF (100
mL) was added dropwise isobutyric acid ethyl ester (11.6 g, 0.1
mol) and anhydrous acetonitrile (50 g, 0.12 mol) in THF (100 mL) at
80.degree. C. The resulting mixture was refluxed overnight, then
cooled to RT. After removal of the volatiles in vacuo, the residue
was diluted in EtOAc and aqueous 10% HCL. The combined organic
extracts were dried (Na.sub.2SO.sub.4), filtered, concentrated to
yield 4-methyl-3-oxopentanenitrile (8.5 g), which was used for the
next step reaction without further purification.
[1102] To a mixture of ethyl 3-hydrazinobenzoate (from Example A81,
3 g, 16.6 mmol) and 4-methyl-3-oxopentanenitrile (2.7 g, 24.9 mmol)
in ethanol (50 mL) was added conc. HCl (5 mL). The resulting
mixture was heated to reflux for 3 h. After removal of the solvent,
the residue was washed with Et.sub.2O to afford ethyl
3-(5-amino-3-isopropyl-1H-pyrazol-1-yl)benzoate (4 g), which was
used in the next reaction without further purification.
##STR1005##
[1103] Using the same method as Example A83, 4-hydrazinobenzoic
acid ethyl ester (from Example A82, 3 g, 16.6 mmol) and
4-methyl-3-oxopentanenitrile (from Example A83, 2.7 g, 27.9 mmol)
were combined to afford ethyl
4-(5-amino-3-isopropyl-1H-pyrazol-1-yl)benzoate (4 g, 88% yield),
which was used to the next reaction without further purification.
##STR1006##
[1104] Using the same procedure as for Example 1, A84 (1.37 g, 5.0
mmol) and 1-chloro-4-isocyanatobenzene (0.9 g, 60 mol) were
combined to afford ethyl
4-{5-[3-(4-chlorophenyl)ureido]-3-isopropyl-1H-pyrazol-1-yl}benzoat-
e (1.3 g, 61% yield). Using the same procedure as for Example 2,
ethyl
4-{5-[3-(4-chlorophenyl)ureido]-3-isopropyl-1H-pyrazol-1-yl}benzoate
(100 mg, 0.23 mmol) was reduced to afford
1-(4-chlorophenyl)-3-{1-[4-(hydroxymethyl)phenyl]-3-isopropyl-1H-pyrazol--
5-yl}urea (80 mg, 91% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6):
.delta. 9.15 (brs, 1H), 8.70 (brs, 1H), 7.46-7.36 (m, 6H), 7.26 (d,
J=8.8 Hz, 2H), 6.25 (s, 1H), 5.28 (t, J=6.0 Hz, 1H), 4.52 (d, J=5.2
Hz, 2H), 2.85 (m, 1H), 1.20 (d, J=6.8 Hz, 6H). ##STR1007##
[1105] Using the same method as Example QQ, 4-hydrazinobenzoic acid
ethyl ester (From Example A82, 3.0 g, 16.6 mmol) and commercially
available 4,4,4-trifluoro-3-oxobutyronitrile (3.4 g, 24.9 mmol)
were combined to afford ethyl
4-[5-amino-3-(trifluoromethyl)-1H-pyrazol-1-yl]benzoate (4.5 g, 91%
yield), which was used to the next reaction without further
purification. ##STR1008##
[1106] Using the same procedure as for Example 1, Example A85 (1.45
g, 5.0 mmol) and 1-chloro-4-isocyanatobenzene (0.9 g, 6.0 mol) were
combined to afford ethyl
4-{5-[3-(4-chlorophenyl)ureido]-3-(trifluoromethyl)-1H-pyrazol-1-yl}benzo-
ate (0.85 g, 38% yield). Using the same procedure as for Example 2,
ethyl
4-{5-[3-(4-chlorophenyl)ureido]-3-(trifluoromethyl)-1H-pyrazol-1-yl}benzo-
ate (100 mg, 0.22 mmol) was reduced to afford
1-(4-chlorophenyl)-3-{3-(trifluoromethyl)-1-[4-(hydroxymethyl)phenyl]-1H--
pyrazol-5-yl}urea (80 mg, 89% yield). .sup.1H NMR (400 MHz,
DMSO-d.sub.6): .delta. 9.65 (s, 1H), 9.09 (s, 1H), 7.54 (d, J=8.4
Hz, 2H), 7.48 (d, J=8.4 Hz, 2H), 7.41 (d, J=8.8 Hz, 2H), 7.28 (d,
J=8.8 Hz, 2H), 6.81 (s, 1H), 5.36 (t, J=6.0 Hz, 1H), 4.56 (d, J=5.6
Hz, 2H). ##STR1009##
[1107] Using the same procedure as for Example 325, Example A62
(100 mg, 0.24 mmol), and Example A59 (29.0 mg, 0.24 mmol) were
combined to affored
1-{3-t-butyl-2-{3-[(2,4,5-trioxoimidazolidin-1-yl)methyl]phenyl}-1H-pyraz-
ol-3-yl}-3-(4-chlorophenyl)urea (55 mg, 46% yield). .sup.1H NMR
(300 MHz, DMSO-d.sub.6): .delta. 12.10 (s, 1H), 9.00 (s, 1H), 8.45
(s, 1H), 7.50-7.35 (m, 6H), 7.28 (d, J=8.7 Hz, 2H), 6.37 (s, 1H),
4.70 (s, 2H), 1.27 (s, 9H). ##STR1010##
[1108] A mixture of 1-phenylurazole (70 mg, 0.4 mmol), DMF (5 mL)
and NaH (5 mg, 0.2 mmol) under Ar at 0.degree. C. was stirred for
30 min. Example A62 (83 mg, 0.2 mmol) was added at 0.degree. C.,
reaction mixture was warmed to RT, stirred for 8 h, quenched with
water (25 mL), and extracted with EtOAc (2.times.25 mL). The
combined organic extracts were washed with water and brine, dried
(Na.sub.2SO.sub.4), concentrated under reduced pressure and
purified by column chromatography to yield
1-(3-t-butyl-1-{3-[(3,5-dioxo-1-phenyl-1,2,4-triazolidin-4-yl)methyl]phen-
yl}-1H-pyrazol-5-yl)-3-(4-chlorophenyl)urea as a white solid (85
mg, 77% yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): [9.06 (s, 1H),
8.49 (s, 1H), 7.48-7.29 (m, 12H), 7.24 (s, 1H), 7.1-7.08 (m, 1H),
6.36 (s, 1H), 4.64 (s, 2H), 1.28 (s, 9H); MS (ESI) m/z: 558
(M+H.sup.+). ##STR1011##
[1109] To a mixture of 4-nitrophenol (10.0 g, 71.9 mmol),
K.sub.2CO.sub.3 (19.9 g, 143.9 mmol) and KI (2.6 g, 15.8 mmol) in
acetonitrile was added chloromethylbenzene (10.0 g, 79.1 mmol) at
RT. The resultant mixture was heated to reflux for 3 h. After
removal of the solvent, the residue was dissolved in EtOAc. The
combined organic extracts were washed with brine, dried
(Na.sub.2SO.sub.4), filtered and concentrated to afford
4-benzyloxynitrobenzene (14.9 g, 90% yield). .sup.1H NMR (400 MHz,
CDCl.sub.3): .delta. 8.20 (d, J=8.0 Hz, 2H), 7.43-7.37 (m, 5H),
7.03 (d, J=8.0 Hz, 2H), 5.17 (s, 2H).
[1110] A mixture of 4-benzyloxynitrobenzene (13.0 g, 56.5 mmol) and
Raney-Ni (15.0 g) in EtOH (50 mL) was stirred at RT under 30 psi of
H.sub.2. The mixture was stirred at RT overnight, then filtered.
The filtrate was concentrated to 4-benzyloxyphenylamine (10.5 g,
93% yield) as a brown solid. .sup.1H NMR (400 MHz, CDCl.sub.3):
.delta.7.43 (d, J=7.2 Hz, 2H), 7.38 (t, J=7.2 Hz, 1H), 7.32 (d,
J=7.2 Hz, 2H), 6.83 (d, J=8.8 Hz, 2H), 6.65 (d, J=8.8 Hz, 2H), 5.00
(s, 2H), 2.94 (brs, 2H); MS(ESI) m/z: 200 (M+H.sup.+).
[1111] Using the same method as Example OO, 4-benzyloxyphenylamine
(10.0 g, 50.2 mmol) was converted to (4-benzyloxyphenyl)hydrazine
hydrochloride (9.6 g, 76% yield) which was treated with
commercially available 4,4-dimethyl-3-oxopentanenitrile (5.0 g, 40
mmol) to afford
3-t-butyl-1-(4-(benzyloxy)phenyl)-1H-pyrazol-5-amine (8.2 g, 85%
yield). .sup.1H NMR (400 MHz, DMSO-d.sub.6): .delta. 10.2 (brs,
3H), 7.49-7.45 (m, 4H), 7.39 (t, J=7.2 Hz, 1H), 7.34-7.29 (m, 2H),
7.19 (d, J=8.8 Hz, 2H), 5.62 (s, 1H), 5.19 (s, 2H), 1.26 (s, 9H);
MS(ESI) m/z: 322 (M+H.sup.+). ##STR1012##
[1112] Using general method A, Example A86 (350 mg, 1.5 mmol) and
1-chloro-4-isocyanatobenzene (230 mg, 1.5 mmol) were combined to
afford
1-(3-t-butyl-1-(4-hydroxyphenyl)-1H-pyrazol-5-yl)-3-(4-chlorophenyl)urea
(120 mg, 20% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
9.82 (brs, 1H), 9.12 (s, 1H), 8.25 (s, 1H), 7.41(d, J=9.0 Hz, 2H),
7.28 (d, J=9.0 Hz, 2H), 7.24 (d, J=8.7 Hz, 2H), 6.86 (d, J=8.7 Hz,
2H), 6.30 (s, 1H), 1.24 (s, 9H); MS (ESI) m/z: 385 (M+H.sup.+).
[1113] The material from the previous reaction,
1-(3-t-butyl-1-(4-hydroxyphenyl)-1H-pyrazol-5-yl)-3-(4-chlorophenyl)urea
(120 mg, 0.31 mmol) and chloroacetic acid ethyl ester (76.5 mg,
0.62 mmol) were combined to afford
1-(3-t-butyl-1-(4-(carbomethoxymethyl)oxyphenyl)-1H-pyrazol-5-yl)-3-(4-ch-
lorophenyl-1-yl)urea (110 mg, 75% yield) as a white solid. .sup.1H
NMR (300 MHz, DMSO-d.sub.6): .delta. 9.09 (s, 1H), 8.31 (s, 1H),
7.40 (d, J=5.4 Hz, 2H), 7.34 (d, J=5.4 Hz, 2H), 7.27 (d, J=9.0 Hz,
2H), 7.04 (d, J=9.0 Hz, 2H), 6.30 (s, 1H), 4.81 (s, 2H), 4.16 (q,
J=7.2 Hz, 2H), 1.24 (s, H), 1.20 (t, J=7.2 Hz, 3H); MS (ESI) m/z:
471 (M+H.sup.+).
[1114] Using the material from the previous reaction,
1-(3-t-butyl-1-(4-(carbomethoxymethyl)oxyphenyl)-1H-pyrazol-5-yl)-3-(4-ch-
lorophenyl-1-yl)urea (60 mg, 0.13 mmol) was saponified to afford
1-(3-t-butyl-1-(4-(carboxymethyl)oxyphenyl)-1H-pyrazol-5-yl)-3-(4-chlorop-
henyl-1-yl)urea (40 mg, 71% yield) as a white solid. .sup.1H NMR
(300 MHz, DMSO-d.sub.6): .delta. 9.14 (s, 1H), 8.35 (s, 1H), 7.40
(d, J=6.9 Hz, 2H), 7.37 (d, J=6.9 Hz, 2H), 7.27 (d, J=9.0 Hz, 2H),
7.02 (d, J=9.0 Hz, 2H), 6.30 (s, 1H), 4.71 (s, 2H), 1.23 (s, 9H);
MS (ESI) m/z: 443 (M+H.sup.+). ##STR1013##
[1115] Using general method I, Example 352 (88 mg, 0.18 mmol)
N,N-dimethylamine hydrochloride (0.044 g, 0.54 mmol) were combined
to yield
1-(2,3-dichlorophenyl)-3-(1-(3-(2-(dimethylamino)-2-oxoethyl)phenyl-
)-3-(thiazol-4-yl)-1H-pyrazol-5-yl)urea (46 mg, 51% yield) as a
pale yellow colored solid. .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 9.50 (s, 1H), 9.19 (s, 1H), 8.90 (s I H), 8.10 (dd, J=7.2
Hz, and 2.8 Hz, 1H), 8.06-8.01 (m, 2H), 7.54-7.47 (m, 3H),
7.39-7.31 (m, 3H), 6.91 (s, 1H), 3.51 (s, 2H), 2.56 (d, J=4.4 Hz,
3H); MS (ESI) m/z: 501.1 (M+H.sup.+). ##STR1014##
[1116] Using General method A, Example A17 (5 g, 0.014 mol) and
1-isocyanatonaphthalene (2.53 g, 0.015 mol) were combined to afford
{4-[3-t-butyl-5-(3-naphthalen-1-ylureido)pyrazol-1-yl]phenyl}acetic
acid ethyl ester (0.6 g, 25% yield) as a white solid. MS (ESI) m/z:
471(M+H.sup.+). This compound was saponified using General method E
to yield
{4-[3-t-butyl-5-(3-naphthalen-1-ylureido)pyrazol-1-yl]phenyl}acetic
acid (0.4 g, 99% yield) as a white solid. .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.05 (s, 1H), 8.84 (s, 1H), 8.00-7.40 (m,
11H), 6.38 (s, 1H), 3.64 (s, 1H), 1.25 (s, 9H); MS (ESI) m/z: 443
(M+H.sup.+). ##STR1015##
[1117] To a solution of
{4-[3-t-butyl-5-(3-naphthalen-1-yl-ureido)pyrazol-1-yl]phenyl}acetic
acid ethyl ester (150 mg, 0.32 mmol, intermediate in Example 559)
in MeOH (2 mL) was added NH.sub.3/MeOH (10 mL) at RT. The mixture
was stirred at that temperature overnight. After removal of the
solvent, the crude product was purified by preparative HPLC to
afford
2-{4-[3-t-butyl-5-(3-naphthalen-1-ylureido)pyrazol-1-yl]phenyl}acetamide
(48 mg, 31% yield). .sup.1H NMR (300 MHz, CD.sub.3OD): .delta. 7.87
(m, 2H), 7.76 (d, J=5.4 Hz, 1H), 7.68 (d, J=6.0 Hz, 1H), 7.53-7.42
(m, 7H), 6.57 (s, 1H), 3.64 (s, 2H), 1.36 (s, 9H); MS (ESI) m/z:
442 (M+H.sup.+). ##STR1016##
[1118] Using General method I, Example 385 (150 mg, 0.33 mmol) and
Me.sub.2NH HCl (80 mg, 0.398 mmol) were combined to afford
2-(4-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]pyrazol-1-yl}phenyl)N,N-d-
imethylacetamide (135 mg, 85% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.29 (s, 1H), 8.81 (s, 1H), 8.06 (q, J=3.3
Hz 1H), 7.43 (d, J=8.1 Hz, 2H), 7.35 (d, J=8.4 Hz, 2H), 7.29 (t,
J=3.0 Hz, 2H), 6.37 (s, 1H), 3.74 (s, 2H), 3.03 (s, 3H), 2.83 (s,
3H), 1.25 (s, 9H); MS (ESI) m/z: 488 (M+H.sup.+). ##STR1017##
[1119] Using General method I, Example 559 (250 mg, 0.56 mmol) and
HNMe.sub.2 HCl salt (50 mg, 1.1 mmol) were combined to afford
2-{4-[3-t-butyl-5-(3-naphthalen-1-yl-ureido)pyrazol-1-yl]phenyl}-N,N-dime-
thylacetamide (46 mg, 17% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.06 (s, 1H), 8.83 (s, 1H), 7.97 (d, J=7.5
Hz, 1H), 7.90-7.87 (m, 2H), 7.61 (d, J=8.1 Hz, 1H), 7.53-7.35 (m,
7H), 6.37 (s, 1H), 3.74 (s, 2H), 3.00 (s, 3H), 2.81 (s, 3H), 1.24
(s, 9H); MS (ESI) m/z: 470 (M+H.sup.+). ##STR1018##
[1120] To an ice-cold bath solution of 4-fluorobenzoic acid (100 g,
0.714 mmol) in ethanol was dropwise added SOCl.sub.2 (140 mL, 2.14
mol). After 30 min the ice bath was removed and the solution was
heated to reflux overnight. The reaction was monitored with TLC and
LC-MS until completion. After evaporation of the solvent, the
mixture was diluted with the aqueous solution of K.sub.2CO.sub.3
and EtOAc. The organic phase was collected and dried over sodium
sulfate and concentrated to the product of ethyl 4-fluorobenzoate
(119 g, 99% yield). .sup.1H-NMR (300 MHz, DMSO-d.sub.6): .delta.
8.06 (d, J=6.0 Hz, 2H), 7.10 (d, J=9.0 Hz, 2H), 4.36 (q, J=10.8 Hz,
2H), 1.39 (t, J=7.5 Hz, 3H). Using general method L, ethyl
4-fluorobenzoate (119 g, 0.71 mol) and MeCN (75 mL) were combined
to afford 3-(4-fluorophenyl)-3-oxopropionitrile (100 g, 86% yield).
.sup.1H NMR (300 MHz, CDCl.sub.3): .delta. 7.98-7.94 (m, 2H), 7.22
(d, J=6.6 Hz, 2H), 4.07 (s, 2H). Using general method M,
(4-hydrazinophenyl)acetic acid ethyl ester (36 g, 0.217 mol) and
3-(4-fluorophenyl)-3-oxopropionitrile (38 g, 0.26 mol) were
combined to yield
{4-[5-amino-3-(4-fluorophenyl)pyrazol-1-yl]phenyl}acetic acid ethyl
ester (50 g, 68% yield). .sup.1H NMR (300 MHz, CDCl.sub.3): .delta.
7.80 (s, 2H), 7.40 (m, 4H), 7.00 (m, 2H), 6.29 (s, 1H), 4.07 (q,
J=3.9 Hz, 2H), 3.53 (s, 2H), 1.23 (t, J=3.9 Hz, 3H); MS (ESI) m/z:
340 (M+H.sup.+). ##STR1019##
[1121] Using General method A, Example A87 (8 g, 0.024 mol)
1,2-dichloro-3-isocyanatobenzene (3.7 mL, 0.028 mol) were combined
to afford
{4-[5-[3-(2,3-dichlorophenyl)ureido]-3-(4-fluorophenyl)pyrazol-1-y-
l]phenyl}acetic acid ethyl ester (5 g, 40% yield). MS (ESI) m/z:
527(M+H.sup.+). Using General method E,
{4-[5-[3-(2,3-dichlorophenyl)ureido]-3-(4-fluorophenyl)pyrazol-1-yl]pheny-
l}acetic acid ethyl ester (5 g, 9.5 mmol) was saponified to yield
of
{4-[5-[3-(2,3-dichlorophenyl)ureido]-3-(4-fluorophenyl)pyrazol-1-yl]pheny-
l}acetic acid (2.6 g, 55% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.34 (s, 1H), 8.84 (s, 1H), 8.09-8.02 (m,
1H), 7.87-7.82 (m, 2H), 7.54 (d, J=4.2 Hz, 2H), 7.42 (d, J=4.2 Hz,
2H), 7.33-7.29 (m, 1H), 7.22 (t, J=9.0 Hz, 2H), 6.82 (s, 1H), 3.66
(s, 2H); MS (ESI) m/z: 499 (M+H.sup.+). ##STR1020##
[1122] To a solution of
2-(3-(3-t-butyl-5-(3-(naphthalen-1-yl)ureido)-1H-pyrazol-1-yl)phenyl)acet-
ic acid (200 mg, 0.43 mmol) in THF (10 mL) was added
2-amino-ethanol (260 mg, 4.3 mmol) and Et.sub.3N (0.5 mL), then
this mixture was heated to 40.degree. C. and stirred overnight.
After removal of the solvent, this mixture was extracted with EtOAc
and washed with 1N HCl aqueous solution and the organic layer was
dried over Na.sub.2SO.sub.4. After removal of the solvent, a crude
product was obtained, which was purified by preparative HPLC to
afford
2-{3-[3-t-butyl-5-(3-naphthalen-1-yl-ureido)pyrazol-1-yl]phenyl}-N-(2-hyd-
roxy-ethyl)acetamide (104 mg, 50% yield). .sup.1H NMR (300 MHz,
DMSO-d.sub.6): .delta. 9.01 (s, 1H), 8.81 (s, 1H), 8.12 (m, 1H),
7.98 (d, J=9.3 Hz, 1H), 7.92-7.87 (m, 2H), 7.61 (d, J=8.1 Hz, 1H),
7.53-7.49 (m, 2H), 7.47-7.38 (m, 4H), 7.29 (d, J=7.5 Hz, 1H), 6.39
(s, 1H), 3.49 (s, 2H), 3.35 (t, J=6.0 Hz, 2H), 3.07 (q, J=6.0 Hz,
2H), 1.25 (s, 9H); MS (ESI) m/z: 487 (M+H.sup.+). ##STR1021##
[1123] Example 349 (100 mg, 0.456 mmol) was acetylated to afford
1-[2-(2-acetyl-1,2,3,4-tetrahydroisoquinolin-7-yl)-5-t-butyl-2H-pyrazol-3-
-yl]-3-(3-fluorophenyl)urea (60 mg, 90% yield) as a white solid.
.sup.1H NMR (300 MHz, CD.sub.3OD): .delta. 7.85 (m, 2H), 7.70 (m,
2H), 7.44-7.51 (m, 3H), 7.40 (s, 3H), 6.53 (d, J=11.1 Hz, 1H), 4.77
(d, J=5.4 Hz, 2H), 3.71 (q, J=8.4 Hz, 2H), 3.01 (m, J=19.2 Hz, 2H),
2.19 (d, J=7.7 Hz, 3H), 1.35 (s, 9H); MS (ESI) m/z: 482
(M+H.sup.+). ##STR1022##
[1124] Example 349 (100 mg, 0.456 mmol) and methanesulfonyl
chloride (63 mg, 0.274 mmol) were combined to afford
1-[5-t-butyl-2-(2-methanesulfonyl-1,2,3,4-tetrahydroisoquinolin-7-yl)-2H--
pyrazol-3-yl]-3-(3-fluorophenyl)urea (60 mg, 87% yield) as a white
solid. .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 9.11 (s, 1H),
8.89 (s, 1H), 8.03 (m, 1H), 7.89-7.87 (m, 2H), 7.61 (m, 1H),
7.52-7.49 (m, 2H), 7.44 (m, 1H), 7.39-7.34 (m, 3H), 6.36 (s, 1H),
4.43 (s, 2H), 3.43 (m, J=11.4, 2H), 2.93 (m, 5H), 1.24 (s, 9H); MS
(ESI) m/z: 518 (M+H.sup.+). ##STR1023##
[1125] Using general method A, Example A20 (200 mg, 0.61 mmol) and
isocyanatobenzene (73 mg, 0.61 mmol) were combined to afford
1-[5-t-butyl-2-(3-pyridin-3-ylphenyl)-2H-pyrazol-3-yl]-3-phenylurea
(185 mg, 74% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta.
9.08 (s, 1H), 8.98 (s, 1H), 8.60 (d, J=5.4 Hz, 1H), 8.51 (s, 1H),
8.23 (d, J=6.6 Hz, 1H), 7.84 (s, 1H), 7.75 (d, J=6.9 Hz, 1H),
7.66-7.56 (m, 3H) 7.34 (d, J=8.1 Hz, 2H), 7.20 (t, J=7.8 Hz, 2H),
6.91 (t, J=6.9 Hz, 1H), 6.37 (s, 1H), 1.25 (s, 9H); MS (ESI) m/z:
412 (M+H.sup.+). ##STR1024##
[1126] Using general method B, Example A18 (287 mg, 1.0 mmol), and
1,2,3,4-tetrahydro-naphthalen-1-ylamine (147 mg, 1.0 mmol) were
combined to afford ethyl
4-(3-t-butyl-5-(3-(1,2,3,4-tetrahydronaphthalen-4-yl)ureido)-1H-pyrazol-1-
-yl)benzoate (245 mg, 59% yield).
[1127] Using general method E, ethyl
4-(3-t-butyl-5-(3-(1,2,3,4-tetrahydronaphthalen-4-yl)ureido)-1H-pyrazol-1-
-yl)benzoate (230 mg, 0.50 mmol) was reduced to afford
1-(3-t-butyl-1-(4-(hydroxymethyl)phenyl)-1H-pyrazol-5-yl)-3-(1,2,3,4-tetr-
ahydronaphthalen-4-yl)urea (170 mg, 81% yield). .sup.1H NMR (300
MHz, DMSO-d.sub.6): .quadrature. 7.97 (s, 1H), 7.38 (s, 4H),
7.14-7.04 (m, 4H), 6.92 (d, J=8.4 Hz, 1H), 6.29 (s, 1H), 5.27 (t,
J=5.7 Hz, 1H), 4.74 (m, 1H), 4.52 (d, J=5.7 Hz, 2H), 2.70-2.62 (m,
2H), 1.85-1.63 (m, 4H), 1.23 (s, 9H). MS (ESI) m/z: 419 (M+H.sup.+)
##STR1025##
[1128] Using general method B, Example A3 (120 mg, 0.5 mmol), and
indan-1-ylamine (133 mg, 1.0 mmol) were combined to afford
1-[3-t-butyl-1-(3-cyanophenyl)-1H-pyrazol-5-yl]-3-(2,3-dihydro-1H-indan-1-
-yl)urea (52 mg, 26% yield). .sup.1H NMR (300 MHz, DMSO-d.sub.6):
.delta. 8.17 (s, 1H), 7.94 (s, 1H), 7.83 (t, J=8.4 Hz, 2H), 7.67
(t, J=8.4 Hz, 1H), 7.19-7.08 (m, 4H), 6.92 (d, J=8.4 Hz, 1H), 6.31
(s, 1H), 5.04 (m, 1H), 2.86-2.73 (m. 2H), 2.34 (m, 1H), 1.70 (m,
1H), 1.24 (s, 9H); MS (ESI) m/z: 400 (M+H.sup.+). ##STR1026##
[1129] A solution of Example 295 (130 mg, 0.32 mmoL), DMF (2 mL)
and CDI (65 mg, 0.38 mmoL) was stirred at RT for 40 mins then was
treated with a solution of CH.sub.3SO.sub.2NH.sub.2 (36 mg, 0.38
mmoL) and NaH (16 mg, 0.4 mmoL) in DMF (2 mL). The reaction mixture
was stirred overnight, then quenched with water and extracted with
EtOAc (3.times.20 mL). The combined organic extracts were washed
with brine, dried (Na.sub.2SO.sub.4), filtered, concentrated and
purified via preparative TLC to yield
1-{3-t-butyl-1-[1-(methanesulfonylureidoamidomethyl)-naphthalen-3-yl]-1H--
pyrazol-5-yl}-3-(phenyl)urea (50 mg, 29% yield). .sup.1H NMR (300
MHz, DMSO-d.sub.6): .quadrature. 9.21 (br s, 1H), 8.60 (br s, 1H),
8.15 (br s, 1H), 8.00 (m, 1H), 7.99 (s, 1H), 7.55-7.58 (m, 3H),
7.35 (d, J=7.8 Hz, 2H), 7.19 (t, J=7.8 Hz, 2H), 6.90 (t, J=7.8 Hz,
1H), 6.39 (s, 1H), 4.69 (s, 2H), 2.91 (s, 3H), 1.28 (s, 9H); MS
(ESI) m/z: 535 (M+H.sup.+) ##STR1027##
[1130] Using general method D, Example A1 (143 mg, 0.5 mmol) and
1,2,3,4-tetrahydro-naphthalen-1-ylamine (67 mg, 0.5 mmol) were
combined to afford ethyl
3-{3-t-butyl-5-[3-(1,2,3,4-tetrahydronaphthalen-1-yl)ureido]-1H-pyrazol-1-
-yl}benzoate (60 mg, 26% yield).
[1131] Using general method C, the previous compound (55 mg, 0.12
mmol) was reduced to afford
1-{3-t-butyl-1-[3-(hydroxymethyl)phenyl]-1H-pyrazol-5-yl}-3-(1,2,3,4-tetr-
ahydronaphthalen-1-yl)urea (40 mg, 80% yield). .sup.1H-NMR (300
MHz, DMSO-d.sub.6): .quadrature. 7.97 (s, 1H), 7.44-7.38 (m, 2H),
7.30-7.28 (m, 2H), 7.17-7.02 (m, 4H), 6.90 (d, J=8.4 Hz, 1H), 6.30
(s, 1H), 4.74 (m, 1H), 4.52 (s, 2H), 2.71-2.64 (m, 2H), 1.70-1.65
(m, 4H), 1.24 (s, 9H); MS (ESI) m/z: 419 (M+H.sup.+).
##STR1028##
[1132] Using general method A, Example A17 (5 g, 14.8 mmol) and
1-isocyanatonaphthalene (2.5 g, 15.0 mmol) were combined to afford
ethyl
2-(4-{3-t-butyl-5-[3-(naphthalen-1-yl)ureido]-1H-pyrazol-1-yl}phenyl)acet-
ate (1.7 g, 24% yield). MS (ESI) m/z: 471 (M+H.sup.+).
[1133] Using general method C, the previous compound (80 mg 0.17
mmol) was reduced to afford
1-{3-t-butyl-1-[4-(2-hydroxyethyl)phenyl]-1H-pyrazol-5-yl}-3-(naphthalen--
1-yl)urea (50 mg, 69% yield). .sup.1H NMR (DMSO-d.sub.6): .delta.
9.05 (s, 1H), 8.79 (s, 1H), 8.00 (d, J=7.2 Hz, 1H), 7.93-7.89 (m,
2H), 7.63 (d, J=8.1 Hz, 1H), 7.55-7.51 (m, 2H), 7.47-7.37 (m, 5H),
6.39 (s, 1H), 4.68 (t, J=5.1 Hz, 1H), 3.65 (q, J=7.2 Hz, 2H), 2.79
(t, J=6.9 Hz, 2H), 1.26 (s, 9H). MS (ESI) m/z: 429 (M+H.sup.+).
##STR1029##
[1134] Using general method A, Example A17 (5 g, 14.8 mmol) and
1-chloro-4-isocyanato-benzene (2.2 g, 15.0 mmol) were combined to
afford ethyl
2-(4-{3-t-butyl-5-[3-(4-chlorophenyl)ureido]-1H-pyrazol-1-yl}phenyl-
)acetate (2.7 g, 40% yield). .sup.1H NMR (DMSO-d.sub.6): .delta.
9.12 (s, 1H), 8.42 (s, 1H), 7.46-7.37 (m, 6H), 7.28 (d, J=8.1 Hz,
2H), 6.34 (s, 1H), 4.08 (q, J=7.2 Hz, 2H), 2.79 (t, J=7.2 Hz, 2H),
3.72 (s, 2H), 1.25 (s, 9H), 1.18 (t, J=7.2 Hz, 3H); MS (ESI) m/z:
455 (M+H.sup.+).
[1135] Using general method C, the previous compound (100 mg, 0.22
mmol) was reduced to afford
1-{3-t-butyl-1-[4-(2-hydroxyethyl)phenyl]-1H-pyrazol-5-yl}-3-(4-chlorophe-
nyl)urea (65 mg, 72% yield). .sup.1H NMR (DMSO-d.sub.6): .delta.
9.57 (s, 1H), 8.92 (s, 1H), 7.45-7.39 (m, 4H), 7.34-7.25 (m, 4H),
6.30 (s, 1H), 4.65 (t, J=5.1 Hz, 1H), 3.62 (q, J=7.2 Hz, 2H), 2.70
(t, J=6.9 Hz, 2H), 1.25 (s, 9H). MS (ESI) m/z: 413 (M+H.sup.+).
##STR1030##
[1136] Using general method C, Example A1 (20.0 g, 69.6 mmol) was
reduced to afford
[3-(5-amino-3-t-butyl-1H-pyrazol-1-yl)phenyl]methanol (15.2 g,
89%). .sup.1H NMR (DMSO-d.sub.6): 7.49 (s, 1H), 7.37 (m, 2H), 7.19
(d, J=7.2 Hz, 1H), 5.35 (s, 1H), 5.25 (t, J=5.6 Hz, 1H), 5.14 (s,
2H), 4.53 (d, J=5.6 Hz, 2H), 1.19 (s, 9H); MS (ESI) m/z: 246.19
(M+H.sup.+).
[1137] The crude material from the previous reaction (5.0 g, 20.4
mmol) was dissolved in dry THF (50 mL) and SOCl.sub.2 (4.85 g, 40.8
mmol), stirred for 2 h at RT, concentrated in vacuo to yield
3-t-butyl-1-(3-chloromethylphenyl)-1H-pyrazol-5-amine (5.4 g),
which was added to NaN.sub.3 (3.93 g, 60.5 mmol) in DMF (50 mL).
The reaction mixture was heated at 30.degree. C. for 2 h, poured
into H.sub.2O (50 mL), and extracted with CH.sub.2Cl.sub.2. The
organic layers were combined, dried (MgSO.sub.4), filtered and
concentrated in vacuo to yield crude
3-t-butyl-1-[3-(azidomethyl)phenyl]-1H-pyrazol-5-amine (1.50 g,
5.55 mmol). ##STR1031##
[1138] Using general method A, Example A88 and 1-isocyano
naphthalene (1.13 g, 6.66 mmol) were combined to yield
1-[2-(3-azidomethyl-phenyl)-5-t-butyl-2H-pyrazol-3-yl]-3-naphthalen-1-yl--
urea (2.4 g, 98%) as a white solid.
[1139] The crude material from the previous reaction and 10% Pd/C
(0.4 g) in THF (30 mL) was reduced under H.sub.2 (1 atm) at RT for
2 h. The catalyst was removed by filtration and the filtrate
concentrated in vacuo to yield
1-(3-t-butyl-1-(3-(aminomethyl)phenyl)-1H-pyrazol-5-yl)-3-(napht-
halen-1-yl)urea (2.2 g, 96%) as a yellow solid. .sup.1H NMR
(DMSO-d.sub.6): 9.02 (s, 1H), 7.91 (d, J=7.2 Hz, 1H), 7.89 (d,
J=7.6 Hz, 2H), 7.67-7.33 (m, 9H), 6.40 (s, 1H), 3.81 (s, 2H), 1.27
(s, 9H); MS (ESI) m/z: 414 (M+H.sup.+).
[1140] The material from the previous reaction,
1-(3-t-butyl-1-(3-(aminomethyl)phenyl)-1H-pyrazol-5-yl)-3-(naphthalen-1-y-
l)urea (100 mg, 0.24 mmol) and methanesulfonamide (500 mg, 5.0
mmol) were combined to yield
N-{7-[3-t-butyl-5-(3-naphthalen-1-yl-ureido)-pyrazol-1-yl]-3-benzylamine--
2-carbonyl}methanesulfonamide (45 mg, 35% yield). .sup.1H-NMR (300
MHz, DMSO-d.sub.6): .delta. 10.35 (s, 1H), 9.15 (s, 1H), 8.88 (s,
1H), 8.00 (d, J=8.1 Hz, 1H), 7.85-7.91 (m, 2H), 7.61 (d, J=6.0 Hz,
2H), 7.40-7.53 (m, 6H), 7.27 (d, J=6.9 Hz, 1H), 7.15 (t, J=6.9 Hz,
1H), 6.39 (s, 1H), 4.33 (d, J=5.4 Hz, 2H), 3.18 (s, 3H), 1.27 (s,
9H). ##STR1032##
[1141] Using general method J, Example 373 (200 mg, 0.44 mmol) and
(S)-pyrrolidine-2-carboxylic acid methyl ester hydrochloride (100
mg, 0.60 mmol) were combined to afford
(2S)-methyl-1-[2-(3-{3-t-butyl-5-[3-(2,3-dichlorophenyl)-ureido]-1H-pyraz-
ol-1-yl}phenyl)acetyl]pyrrolidine-2-carboxylate (165 mg, 66%
yield). .sup.1H-NMR (300 MHz, DMSO-d.sub.6): 9.23 (s, 1H), 8.75 (s,
1H), 8.04 (m, 1H), 7.46-7.23 (m, 6H), 6.35 (s, 1H), 4.25 (m, 1H),
3.74 (s, 2H), 3.57-3.55 (m, 2H), 3.54 (s, 3H), 1.85-1.74 (m, 4H),
1.23 (s, 9H); MS (ESI) m/z: 572 (M+H.sup.+).
[1142] Using general method E,
(2S)-methyl-1-[2-(3-{3-t-butyl-5-[3-(2,3-dichlorophenyl)-ureido]-1H-pyraz-
ol-1-yl}phenyl)acetyl]pyrrolidine-2-carboxylate (100 mg, 0.22 mmol)
was saponified to afford
(2S)-1-[2-(3-{3-t-butyl-5-[3-(2,3-dichlorophenyl)ureido]-1H-pyrazol-1-yl}-
phenyl)acetyl]pyrrolidine-2-carboxylic acid (68 mg, 55% yield).
.sup.1H-NMR (300 MHz, DMSO-d.sub.6): .delta. 9.28 (s, 1H), 8.78 (s,
1H), 8.04 (m, 1H), 7.46-7.25 (m, 6H), 6.34 (s, 1H), 4.17 (m, 1H),
3.73 (s, 2H), 3.35-3.50 (m, 2H), 1.73-2.05 (m, 4H), 1.27 (s, 9H);
MS (ESI) m/z: 558 (M+H.sup.+). ##STR1033##
[1143] Example 373 (100 mg, 0.23 mmol) and 4-methyl-piperidin-4-ol
(35 mg, 0.3 mmol) were combined to afford
1-(3-t-butyl-1-{3-[2-(4-hydroxy-4-methylpiperidin-1-yl)-2-oxoethyl]phenyl-
}-1H-pyrazol-5-yl)-3-(2,3-dichlorophenyl)urea (50 mg, 39% yield).
.sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 9.20 (s, 1H), 8.74 (s,
1H), 8.02 (m, 1H), 7.45-7.20 (m, 6H), 6.35 (s, 1H), 3.90 (m, 1H),
3.75 (s, 2H), 3.57 (m, 1H), 3.31 (m, 1H), 2.95 (m, 1H), 1.41-1.25
(m, 4H), 1.24 (s, 9H), 1.04 (s, 3H); MS (ESI) m/z: 558 (M+H.sup.+).
##STR1034##
[1144] Using general method B, Example A34 (1.0 g, 3.5 mmol)
benzo[d]thiazol-6-amine (1.0 g, 7.0 mmol) were combined to yield
1-(benzo[d]thiazol-6-yl)-3-(3-butyl-1-(1-oxo-1,2,3,4-tetrahydroisoquinoli-
n-7-yl)-1H-pyrazol-5-yl)urea (650 mg, 41% yield) as a white solid.
.sup.1H NMR (300 MHz, DMSO-d.sub.6): .delta. 9.22 (s, 1H), 9.17 (s,
1H), 8.52 (s, 1H), 8.28 (s, 1H), 8.06 (s, 1H), 7.93-7.90 (m, 2H),
7.60 (m, 1H), 7.44-7.40 (m, 2H), 6.35 (s, 1H), 3.37 (t, J=6.6 Hz,
2H), 2.93 (t, J=6.6 Hz, 2H), 1.25 (s, 9H); MS (ESI): m/z: 461
(M+H.sup.+). Using general method C,
1-(benzo[d]thiazol-6-yl)-3-(3-butyl-1-(1-oxo-1,2,3,4-tetrahydro-
isoquinolin-7-yl)-1H-pyrazol-5-yl)urea (650 mg, 1.4 mmol) was
reduced to afford
1-(benzo[d]thiazol-6-yl)-3-(3-butyl-1-(1,2,3,4-tetrahydroisoquinol-
in-7-yl)-1H-pyrazol-5-yl)urea (400 mg, 63% yield). .sup.1H NMR (300
MHz, DMSO-d.sub.6): .delta. 9.55 (s, 1H), 9.33 (s, 1H), 9.05 (m,
2H), 8.22 (d, J=7.8 Hz, 1H), 7.69 (d, J=8.1 Hz, 1H), 7.43-7.28 (m,
3H), 6.38 (s, 1H), 4.30 (m, 2H), 3.34 (m, 2H), 3.00 (t, J=6.9 Hz,
2H), 1.25 (s, 9H); MS (ESI) m/z: 447 (M+H.sup.+). ##STR1035##
[1145] Using general method A, Example A36 (0.15 g, 0.40 mmol) and
phenylisocyanate (53 mg, 0.45 mmol) were combined to afford t-butyl
6-(3-t-butyl-5-(3-phenylureido)-1H-pyrazol-1-yl)-3,4-dihydroisoquinoline--
2(1H)-carboxylate which was deprotected using general method F to
yield
1-(3-t-butyl-1-(1,2,3,4-tetrahydroisoquinolin-6-yl)-1H-pyrazol-5-yl)-3-ph-
enylurea HCl salt as white solid (0.14 g, 80% yield). .sup.1H NMR
(400 MHz, DMSO-d.sub.6): .delta. 9.37 (m, 2H), 8.68 (brs, 1H),
7.3-7.5 (m, 4H), 7.25 (m, 2H), 6.95 (t, J=7.2 Hz, 1H), 6.35 (s,
1H), 4.30 (m, 2H), 3.38 (m, 2H), 3.08 (t, J=6.0 Hz, 2H), 1.28 (s,
9H); MS (ESI) m/z: 390.2 (M+H.sup.+).
[1146] Using the general procedures outlined herein, the following
examples were prepared. TABLE-US-00017 MS (EI) .sup.1H NMR (400
Example Name (M + H.sup.+) MHz, DMSO-d.sub.6) ##STR1036## ethyl
2-(4-(5-amino- 3-(4-chlorophenyl)- 1H-pyrazol-1- yl)phenyl)acetate
356.1 ##STR1037## ethyl 2-(4-(5-amino- 3-(3-fluorophenyl)-
1H-pyrazol-1- yl)phenyl)acetate 340.1 ##STR1038## ethyl
2-(4-(5-amino- 3-(2-fluorophenyl)- 1H-pyrazol-1- yl)phenyl)acetate
340.1 ##STR1039## ethyl 2-(4-(5-amino- 3-(thiazol-4-yl)-1H-
pyrazol-1- yl)phenyl)acetate 329 ##STR1040## ethyl 2-(4-(5-amino-
3-cyclopentyl-1H- pyrazol-1- yl)phenyl)acetate 314.2 ##STR1041##
2-(3-(3-phenyl-5-(3- (3-(pyridin-3- yloxy)phenyl)ureido)-
1H-pyrazol-1- yl)phenyl)acetic acid 0.055 g, 87% yield 506.0
.delta. 8.38-8.35 (m, 2H), 7.84 (s, 1H), 7.82 (s, 1H), 7.59 (s,
1H), 7.43-7.26 (m, 12H), 7.17-7.15 (m, 1H), 6.83 (s, 1H), 6.64-6.62
(m, 1H), 3.56 (s, 2H) ##STR1042## (S)-2-(4-(3-phenyl-5-
(3-(1,2,3,4- tetrahydronaphthalen- 1-yl)ureido)-1H- pyrazol-1-
yl)phenyl)acetic acid 467.2 ##STR1043## (S)-2-(4-(3-phenyl-5-
(3-(1,2,3,4- tetrahydronaphthalen- 1-yl)ureido)-1H- pyrazol-1-
yl)phenyl)acetic acid 467.2
Abl Kinase Assay
Assay A1
[1147] The activity of Abl kinase was determined by following the
production of ADP from the kinase reaction through coupling with
the pyruvate kinase/lactate dehydrogenase system (e.g., Schindler,
et al. Science (2000) 289, 1938-1942). In this assay, the oxidation
of NADH (thus the decrease at A.sub.340nm) was continuously
monitored spectrophotometrically. The reaction mixture (100 .mu.l)
contained Abl kinase (1.9 nM, nominal concentration), peptide
substrate (EAIYAAPFAKKK, 0.2 mM), pyruvate kinase (3.5 units),
lactate dehydrogenase (5.5 units), phosphoenolpyruvate (1 mM), and
NADH (0.28 mM) in 60 mM Tris buffer containing 0.13%
octyl-glucoside, 13 mM MgCl.sub.2 and 3.5% DMSO at pH 7.5. The
reaction was initiated by adding ATP (0.2 mM, final concentration).
The absorption at 340 nm was continuously monitored for 3 h at
30.degree. C. on a Polarstar Optima plate reader (BMG). The
reaction rate was calculated using the 1 h to 2 h time frame.
Percent inhibition was obtained by comparison of reaction rate with
that of a control (i.e. with no test compound). IC.sub.50 values
were calculated from a series of percent inhibition values
determined at a range of inhibitor concentrations using software
routines as implemented in the GraphPad Prism software package.
Assay A2
[1148] Abl kinase assay A2 is the same as for assay A1 except that
(1) a nominal concentration of 1.1 nM of enzyme was employed (2)
the reaction was pre-incubated at 30.degree. C. for 2 h prior to
initiation with ATP (3) 0.5 mM ATP (final concentration) was used
to initiate the reaction. TABLE-US-00018 Ab1 protein sequence used
for screening: SPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTM
EVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLR
ECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVK
VADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVL
LWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQW
NPSDRPSFAEIHQAFETMFQESSISDEVEKELGK
KDR Kinase Assay
Assay K1
[1149] The activity of KDR kinase was determined by following the
production of ADP from the kinase reaction through coupling with
the pyruvate kinase/lactate dehydrogenase system (e.g., Schindler,
et al. Science (2000) 289, 1938-1942). In this assay, the oxidation
of NADH (thus the decrease at A.sub.340nm) was continuously
monitored spectrophotometrically. The reaction mixture (100 .mu.l)
contained KDR (1.5 nM to 7.1 nM, nominal concentration),
polyE.sub.4Y (1 mg/ml), pyruvate kinase (3.5 units), lactate
dehydrogenase (5.5 units), phosphoenolpyruvate (1 mM), and NADH
(0.28 mM) in 60 mM Tris buffer containing 0.13% octyl-glucoside, 13
mM MgCl.sub.2, 6.8 mM DTT, and 3.5% DMSO at pH 7.5. The reaction
was initiated by adding ATP (0.2 mM, final concentration). The
absorption at 340 nm was continuously monitored for 3 h at
30.degree. C. on a Polarstar Optima plate reader (BMG). The
reaction rate was calculated using the 1 h to 2 h time frame.
Percent inhibition was obtained by comparison of reaction rate with
that of a control (i.e. with no test compound). IC.sub.50 values
were calculated from a series of percent inhibition values
determined at a range of inhibitor concentrations using software
routines as implemented in the GraphPad Prism software package.
Assay K2
[1150] KDR kinase assay K2 is the same as for assay K1 except that
(1) a nominal concentration of 2.1 nM of enzyme was employed (2)
the reaction was pre-incubated at 30.degree. C. for 2 h prior to
initiation with ATP (3) 1.0 mM ATP (final concentration) was used
to initiate the reaction. TABLE-US-00019 KDR protein sequence used
for screening: DPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGI
DKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACT
KPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKVAPEDLYKDFLTLEHLI
CYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKD
PDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPY
PGVKIDEEFCRRLKEGTRNRAPDYTTPEMYQTMLDCWHGEPSQRPTFSEL
VEHLGNLLQANAQQD
B-Raf(V599E) Kinase Assay
Assay B1
[1151] The activity of B-Raf(V599E) kinase was determined by
following the formation of ADP from the reaction through coupling
with the pyruvate kinase/lactate dehydrogenase system (e.g.,
Schindler, et al. Science (2000) 289, 1938-1942). In this assay,
the oxidation of NADH (thus the decrease at A.sub.340nm) was
continuously monitored spectrophotometrically. The reaction mixture
(100 .mu.l) contained B-Raf(V599E) kinase (0.34 nM nominal
concentration, construct 1), unphosphorylated, full-length MEK1 (42
nM), MgCl.sub.2 (13 mM), pyruvate kinase (3.5 units), lactate
dehydrogenase (5.5 units), phosphoenolpyruvate (1 mM), and NADH
(0.28 mM), in 60 mM Tris buffer, containing 0.13% octyl-glucoside
and 3.5% DMSO concentration at pH 7.5. The test compounds were
incubated with the reaction mixture at 30.degree. C. for 2 h. The
reaction was initiated by adding ATP (0.2 mM, final concentration).
The absorption at 340 nm was continuously monitored for 3 h at
30.degree. C. on a Polarstar Optima plate reader (BMG). The
reaction rate was calculated using the 1.5 h to 2.5 h time frame.
Percent inhibition was obtained by comparison of reaction rate with
that of a control (i.e. with no test compound). IC.sub.50 values
were calculated from a series of percent inhibition values
determined at a range of inhibitor concentrations using software
routines as implemented in the GraphPad Prism software package.
Assay B2
[1152] Same as assay B1 except that (1) construct 2 was employed at
a nominal concentration of 2 nM (2) the reaction was pre-incubated
at 30.degree. C. for 1 h prior to initiation with ATP (3) a reading
time frame of 0.5 h to 1.5 h. TABLE-US-00020 B-Raf(V599E) construct
1 protein sequence used for screening:
KSPGQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSF
GTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMG
YSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLH
AKSIIHRDLKSNNIFLHEDLTVKIGDFGLATEKSRWSGSHQFEQLSGSIL
WMAPEVIRNQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFM
VGRGYLSPDLSKVRSNCPKANKRLMAECLKKKRDERPLFPQILASIELLA
RSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGAFPVH B-Raf(V599E)
construct 2 protein sequence used for screening:
EDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAV
KMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWC
EGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNI
FLHEDLTVKIGDFGLATEKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNP
YSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVR
SNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPKIHR MEK1 protein sequence
used for screening:
MELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQ
IIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGR
IPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFG
VSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGR
YPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAI
FELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
P-38 Alpha Kinase Assay
Assay P1
[1153] The activity of phosphorylated p-38-alpha kinase was
determined by following the formation of ADP from the kinase
reaction through coupling with the pyruvate kinase/lactate
dehydrogenase system (e.g., Schindler, et al. Science (2000) 289,
1938-1942). In this assay, the oxidation of NADH (thus the decrease
at A.sub.340nm) was continuously measured spectrophotometrically.
The reaction mixture (100 .mu.l) contained phosphorylated p-38
alpha kinase (7.1-9 nM nominal concentration), peptide substrate
(IPTSPITTTYFFFKKK-OH, 0.2 mM), MgCl.sub.2 (13 mM), pyruvate kinase
(3.5 units), lactate dehydrogenase (5.5 units), phosphoenolpyruvate
(1 mM), and NADH (0.28 mM) in 60 mM Tris buffer at pH 7.5,
containing 130 uM n-Dodecyl-B-D-maltopyranoside and 3.5% DMSO
concentration. The test compounds were incubated with the reaction
mixture at 30.degree. C. for 2 h before the addition of ATP (0.3 mM
final concentration). The absorption at 340 nm was monitored
continuously for up to 3 h at 30.degree. C. on Polarstar Optima
plate reader (BMG). The reaction rate was calculated using the time
frame from 1.5 h to 2.5 h. Percent inhibition was obtained by
comparison of reaction rate with that of a control (i.e. with no
test compound). IC.sub.50 values were calculated from a series of
percent inhibition values determined at a range of inhibitor
concentrations using software routines as implemented in the
GraphPad Prism software package.
Assay P2
[1154] Same as assay P1 except that (1) the reaction was not
pre-incubated. TABLE-US-00021 P38-alpha protein sequence used for
screening: MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRV
AVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFN
DVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRD
LKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHY
NQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPAYLINRN
PSHEARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVP PPLDQEEMES
[1155] TABLE-US-00022 Abl Kinase Assay Data Example Abl Data Method
1 0.31 A1 2 2.0 A1 3 8.4 A1 4 2.9 A1 5 2.0 A1 6 3.0 A1 7 5.2 A1 8
81% @ 10 .mu.M A1 9 0.18 A1 10 4.3 A1 11 5.1 A1 12 0.39 A1 13 2.0
A1 14 2.4 A1 15 0.39 A1 16 5.9 A1 17 0.37 A1 18 0.83 A1 19 0.62 A1
20 1.6 A1 21 0.0018 A2 22 0.0022 A2 23 3.8 A1 24 0.83 A1 25 0.67 A1
26 0.021 A2 27 0.063 A1 28 0.023 A2 29 0.0066 A2 30 0.11 A2 31
0.077 A2 32 0.29 A2 33 0.25 A2 34 1.6 A1 35 1.2 A1 36 0.72 A1 37
1.4 A1 38 1.4 A2 39 0.35 A1 40 0.57 A1 41 3.7 A1 42 1.5 A1 43 0.68
A1 44 0.44 A1 45 0.78 A1 46 2.5 A1 48 4.2 A1 50 0.38 A1 51 0.052 A2
52 0.14 A1 53 0.36 A1 54 0.12 A1 55 0.0035 A2 56 4.8 A1 58 4.7 A1
59 0.079 A1 60 0.063 A1 61 0.81 A1 62 0.11 A1 63 0.30 A1 64 0.063
A1 65 0.11 A2 66 0.071 A1 67 0.001 A2 68 0.53 A1 69 0.14 A1 70
0.050 A1 71 0.090 A1 72 0.002 A2 73 0.19 A2 74 2.1 A1 75 0.063 A1
76 31% @ 10 .mu.M A1 77 0.26 A1 78 0.072 A1 79 0.18 A1 80 0.079 A1
81 0.12 A2 82 0.36 A1 83 0.087 A1 84 0.39 A1 85 0.033 A1 86 0.001
A2 87 0.073 A1 94 0.13 A2 95 0.056 A2 96 0.10 A1 97 0.0015 A2 98
0.034 A1 99 0.038 A1 100 0.15 A1 101 0.36 A1 102 0.11 A1 103 0.24
A1 105 0.24 A1 106 0.68 A1 107 0.18 A1 108 0.25 A1 109 0.14 A1 110
0.36 A1 111 0.62 A1 112 0.48 A1 113 0.19 A1 114 0.64 A1 115 0.17 A1
116 0.0066 A2 117 0.23 A1 118 0.011 A2 119 0.012 A2 120 5.1 A2 121
1.0 A2 122 2.8 A1 123 0.29 A2 124 1.4 A1 125 0.18 A1 126 0.44 A1
127 0.22 A1 128 7.5 A1 129 0.27 A1 130 0.23 A1 131 0.28 A1 132
0.013 A2 133 0.048 A2 134 0.052 A2 135 0.84 A1 136 0.10 A1 137 0.15
A1 138 0.10 A2 139 0.14 A2 140 0.12 A1 141 0.0015 A2 142 0.17 A1
143 0.25 A1 144 0.2 A1 145 0.41 A1 146 0.19 A2 147 0.14 A1 148
0.0012 A2 149 0.0012 A2 150 0.0013 A2 151 0.008 A2 152 0.57 A2 153
0.0012 A2 154 0.27 A1 155 0.26 A1 156 0.005 A2 157 0.031 A2 158
0.018 A2 159 0.0023 A2 160 14.9 A2 161 3% @ 1 .mu.M A2 162 0.080 A2
163 0.0063 A2 164 0.033 A2 165 0.20 A1 166 0.23 A1 167 0.31 A1 168
1.1 A2 169 0.021 A2 170 0.0018 A2 171 0.0040 A2 172 0.0019 A2 173
0.0042 A2 174 0.0018 A2 175 0.0015 A2 176 0.0028 A2 177 1.8 A1 178
0.23 A1 179 0.003 A2 180 0.009 A2 181 0.0066 A2 182 0.0034 A2 183
0.020 A2 184 0.010 A2 185 0.0027 A2 186 0.060 A1 187 0.56 A1 188
0.11 A1 189 0.003 A2 190 0.004 A2 191 0.021 A2 192 0.027 A2 193
0.081 A1 194 0.54 A2 195 0.91 A2 196 0.031 A2 197 0.012 A2 276 2.3
A1 277 0.029 A2 373 3.5 A1
[1156] TABLE-US-00023 KDR Kinase Assay Data Example KDR Data Method
1 0.13 K1 2 0.46 K1 3 0.72 K2 4 0.31 K2 5 0.85 K2 7 0.87 K2 8 96% @
10 .mu.M K2 9 0.047 K1 12 0.28 K2 13 0.36 K1 15 0.081 K1 16 3.4 K2
18 0.24 K2 19 0.71 K1 20 0.13 K1 23 1.0 K2 24 0.38 K1 33 0.014 K2
34 1.0 K1 39 0.24 K1 40 0.47 K1 42 0.36 K1 43 0.36 K1 44 2.4 K1 45
0.36 K1 46 0.17 K1 48 0.73 K1 49 0.086 K2 50 0.052 K1 52 0.063 K2
53 0.49 K2 54 0.24 K2 55 0.0040 K2 56 3.1 K2 60 0.062 K1 61 1.5 K1
68 1.4 K1 69 0.40 K1 72 0.0085 K2 74 2.5 K2 75 0.14 K1 106 0.12 K1
108 0.013 K2 109 0.038 K1 110 0.14 K2 112 0.21 K1 115 0.81 K2 116
0.0050 K2 117 0.058 K2 119 0.018 K1 122 1.4 K1 123 0.19 K1 126 0.21
K1 127 0.22 K1 129 0.50 K1 130 0.32 K1 131 0.077 K1 135 0.27 K1 136
0.029 K1 137 1.0 K1 138 0.30 K1 140 2.3 K1 141 0.0085 K2 143 0.94
K1 151 0.0035 K2 154 0.092 K1 156 0.0032 K2 165 0.21 K1 166 0.21 K1
177 0.23 K1 178 0.18 K1 179 0.0064 K2 180 0.0078 K2 186 0.90 K1 187
0.15 K1 188 0.15 K2 189 0.023 K1 190 0.0081 K2 198 1.3 K2 199 34.4
K2 200 2.7 K2 201 0.13 K1 202 0.23 K1 203 0.16 K1 204 0.099 K1 205
0.28 K1 206 0.48 K2 207 0.34 K1 208 0.47 K2 209 0.26 K2 210 0.11 K2
212 0.40 K1 213 0.21 K2 214 0.84 K1 220 0.95 K1 225 9.6 K2 227 9.3
K1 232 2.6 K2 233 0.41 K2 235 3.5 K2 236 3.5 K2 237 4.9 K2 240 3.7
K2 241 0.57 K1 249 0.59 K2 257 6.6 K1 262 2.7 K2 264 0.14 K1 265
9.8 K2 267 0.55 K1 268 2.6 K2 273 1.7 K1 277 0.010 K2 282 2.4 K1
283 0.44 K2 285 0.38 K1 296 0.20 K1 297 0.27 K1 307 0.72 K1 316
12.9 K1 318 10.1 K1 319 4.3 K1 330 0.39 K2 333 0.23 K2 334 3.4 K2
336 0.17 K1 337 2.0 K2 338 5.0 K2 339 1.2 K2 340 0.72 K2 341 5.5 K2
342 5.7 K2 343 18.0 K2 344 2.7 K2 345 2.9 K2 346 1.7 K2 347 1.1 K1
348 16.5 K2 349 4.1 K2 382 10.3 K2 383 0.28 K1 394 2.7 K2 396 3.1
K2 397 3.4 K2 398 2.7 K2 400 3.7 K2 495 1.5 K1 496 0.47 K1 497 1.2
K2 498 1.7 K2
[1157] TABLE-US-00024 BRaf Kinase Assay Data Example B-Raf Data
Method 1 0.0046 B1 2 0.019 B1 3 2.49 B2 5 0.087 B1 6 0.180 B1 7
0.0082 B1 9 0.0046 B1 13 0.0052 B1 14 0.070 B1 15 0.0033 B1 17
0.089 B1 18 0.458 B1 19 0.0048 B1 20 0.0085 B1 21 0.022 B1 22 0.075
B2 23 0.0048 B1 24 0.0023 B1 25 0.0035 B1 26 0.010 B1 27 0.043 B1
28 0.0080 B1 29 0.020 B1 31 0.036 B2 34 0.0038 B1 35 0.011 B1 37
0.0057 B1 39 0.0071 B1 40 0.0087 B1 41 0.089 B1 42 0.010 B1 43
0.0043 B1 44 0.0040 B1 45 0.0062 B1 46 0.0033 B1 48 0.0059 B1 49
0.0038 B1 50 0.168 B2 51 0.029 B2 52 0.0018 B1 53 0.0045 B1 54
0.0048 B1 55 0.0054 B1 59 0.0087 B1 60 0.0026 B1 61 0.018 B1 62
0.0032 B1 63 0.0040 B1 64 0.0033 B1 65 0.0030 B1 66 0.0085 B1 67
0.0048 B1 68 0.024 B1 69 0.0042 B1 70 0.0050 B1 71 0.0041 B1 72
0.0044 B1 73 0.045 B1 74 0.934 B2 75 0.0042 B1 76 0.011 B1 77
0.0039 B1 78 0.0035 B1 80 0.0045 B1 81 0.0041 B1 82 0.0059 B1 83
0.0085 B1 84 0.011 B1 85 0.219 B2 86 0.179 B2 88 0.012 B1 89 0.0055
B1 90 0.0039 B1 91 0.020 B1 92 0.0082 B1 93 0.060 B1 94 0.0048 B1
95 0.0029 B1 96 0.378 B2 97 0.0072 B1 100 0.0069 B1 101 0.0071 B1
102 0.0025 B1 103 0.0045 B1 105 0.012 B1 106 0.0036 B1 107 0.0021
B1 108 0.0015 B1 109 0.0027 B1 110 0.0034 B1 111 0.097 B1 112
0.0029 B1 113 0.0033 B1 114 0.115 B1 115 0.979 B2 116 0.0059 B1 117
0.0032 B1 118 0.023 B2 119 0.0091 B1 120 0.214 B2 121 0.105 B2 122
0.011 B1 123 0.0049 B1 124 0.173 B1 126 0.0065 B1 127 0.0034 B1 128
0.067 B1 129 0.0042 B1 131 0.0019 B1 132 0.0048 B1 134 0.041 B2 135
0.0045 B1 136 0.0049 B1 137 0.0025 B1 138 0.0032 B1 140 0.0046 B1
141 0.0075 B1 142 0.035 B1 143 0.014 B1 144 0.0096 B1 145 0.013 B1
146 0.0088 B1 147 0.010 B1 148 0.031 B1 149 0.0093 B1 150 0.0047 B1
153 0.027 B1 154 0.0029 B1 155 0.0014 B1 156 0.0041 B1 157 0.040 B2
158 0.0084 B1 159 0.014 B1 162 0.0067 B1 163 0.018 B1 165 0.0024 B1
166 0.0057 B1 168 0.030 B1 169 0.194 B2 170 0.040 B1 172 0.029 B1
173 0.063 B1 174 0.245 B2 175 0.030 B1 176 0.044 B2 177 0.0063 B1
178 0.0020 B1 179 0.017 B1 180 0.011 B1 185 0.0069 B1 186 0.0092 B1
187 0.0030 B1 188 0.0058 B1 189 0.918 B2 193 0.0026 B1 195 0.298 B2
196 0.029 B2 197 0.027 B2 211 0.785 B1 212 0.026 B1 213 0.012 B1
219 0.055 B1 220 0.033 B1 221 0.088 B1 222 0.047 B1 223 0.054 B1
225 0.170 B1 226 0.020 B1 227 0.061 B1 228 0.0038 B1 229 0.014 B1
230 0.052 B1 231 0.027 B1 232 0.038 B1 233 0.028 B1 234 0.032 B1
235 1.04 B2 236 2.05 B2 237 0.059 B1 238 0.065 B1 240 0.050 B1 241
0.024 B1 243 0.041 B1 244 0.038 B1 245 0.0053 B1 246 0.039 B1 247
0.070 B1 248 0.0081 B1 249 0.0045 B1 253 0.075 B1 255 0.086 B1 257
0.062 B1 258 0.0034 B1 259 0.0083 B1 260 0.0040 B1 262 0.034 B1 264
0.0073 B1 265 0.014 B1 267 0.0079 B1 268 0.011 B1 269 0.279 B1 272
0.061 B1 273 0.0087 B1 274 0.134 B1 275 0.832 B2 276 0.0049 B1 277
0.011 B1 278 0.153 B2 279 0.697 B1 280 0.275 B1 281 0.369 B1 282
0.041 B1 283 0.0064 B1 284 0.0085 B1 285 0.0051 B1 287 0.041 B1 288
0.056 B1 289 0.028 B1 290 0.012 B1 291 0.0053 B1 292 0.022 B1 293
0.0070 B1 294 0.0033 B1 295 0.052 B1 296 0.0030 B1 297 0.0032 B1
298 0.083 B1 299 0.020 B1 300 0.0092 B1 301 0.010 B1 302 0.013 B1
303 0.0043 B1 304 0.0036 B1 305 0.788 B2 306 0.036 B1 307 0.010 B1
308 0.047 B1 309 0.249 B1 310 0.098 B1 311 0.032 B1 312 0.035 B1
313 0.046 B1 314 0.266 B1 315 0.186 B1 316 0.066 B1
317 0.036 B1 318 0.029 B1 319 0.032 B1 320 0.0046 B1 321 0.0072 B1
322 0.0041 B1 323 0.0034 B1 324 0.017 B1 325 0.0045 B1 326 0.017 B1
327 0.330 B1 328 0.025 B1 329 0.0042 B1 330 0.0032 B1 331 0.0034 B1
332 0.0044 B1 333 0.0034 B1 334 0.011 B1 335 0.104 B1 336 0.0020 B1
356 0.014 B1 366 0.157 B1 367 3.69 B2 368 0.0062 B1 369 0.015 B1
370 0.0080 B1 371 0.010 B1 372 0.027 B1 373 0.0032 B1 382 0.077 B1
383 0.0081 B1 390 0.037 B1 391 0.037 B1 392 0.221 B1 393 0.020 B1
394 0.0088 B1 395 0.050 B1 396 0.032 B1 397 0.057 B1 398 0.012 B1
400 0.019 B1 432 0.010 B1 433 0.0051 B1 434 0.0067 B1 435 0.0073 B1
436 0.018 B1 437 0.279 B1 438 0.035 B1 439 0.020 B1 440 0.0041 B1
441 0.0064 B1 442 0.016 B1 443 0.0090 B1 444 0.020 B1 445 0.838 B1
491 0.032 B1 492 0.0064 B1 493 0.011 B1 494 0.161 B1 495 0.055 B1
496 0.026 B1 497 0.047 B1 498 0.052 B1
[1158] TABLE-US-00025 P38 Kinase Assay Data Example P-38 Data
method 1 0.011 P1 2 0.024 P1 3 0.11 P1 4 0.042 P1 5 0.038 P2 7 0.10
P1 8 0.025 P2 9 0.013 P1 13 0.045 P1 16 1.3 P1 19 0.007 P1 20 0.060
P1 21 0.015 P1 22 0.025 P1 23 0.021 P1 24 0.011 P1 27 0.082 P1 28
0.012 P1 29 0.009 P1 31 0.011 P1 33 0.30 P1 34 0.022 P1 39 0.037 P2
40 0.10 P1 43 0.013 P1 44 0.070 P1 45 0.005 P1 46 0.006 P1 48 0.014
P1 50 0.029 P1 52 0.023 P1 55 0.13 P1 60 0.018 P1 67 0.035 P1 69
0.11 P1 75 0.006 P1 86 0.024 P1 91 0.350 P1 94 0.068 P1 96 0.048 P1
97 0.025 P1 100 0.005 P1 101 0.15 P1 106 0.012 P1 108 0.009 P1 112
0.012 P1 115 0.49 P1 117 0.059 P1 119 0.060 P1 120 0.031 P1 121
0.040 P1 122 0.13 P1 123 0.052 P1 126 0.010 P1 127 0.013 P1 129
0.13 P1 131 0.033 P1 132 0.059 P1 135 0.044 P1 136 0.13 P1 137
0.055 P1 138 0.14 P1 141 0.73 P1 154 0.012 P1 155 0.11 P1 159 0.072
P1 165 0.007 P1 166 0.061 P1 175 0.16 P1 177 0.043 P1 178 0.046 P1
179 0.096 P1 180 0.065 P1 185 0.023 P1 186 0.050 P1 188 0.017 P1
190 0.078 P1 195 0.046 P1 196 0.013 P1 197 0.028 P1 198 0.059 P1
201 0.15 P1 202 0.012 P1 203 0.017 P1 204 0.009 P1 205 0.029 P1 210
0.024 P1 212 0.046 P1 213 0.067 P1 220 0.042 P1 224 0.038 P1 225
0.27 P1 227 0.11 P2 230 0.30 P2 232 0.35 P2 233 0.050 P1 235 0.12
P1 236 0.25 P1 237 0.58 P1 240 0.47 P1 241 0.22 P1 248 0.027 P1 249
0.011 P1 255 0.51 P2 257 0.40 P2 264 0.082 P1 265 0.19 P1 267 0.012
P1 268 0.024 P1 273 0.034 P1 277 0.18 P1 279 1.050 P1 281 5.8 P1
301 0.16 P1 305 0.019 P1 336 0.011 P1 337 0.068 P2 338 0.52 P2 340
0.011 P1 341 0.027 P1 343 0.52 P2 345 0.019 P1 347 0.006 P1 349
0.030 P1 353 0.011 P1 354 0.007 P1 356 0.072 P1 359 0.070 P1 360
0.020 P1 361 0.030 P1 362 0.038 P1 363 0.013 P1 364 0.013 P1 365
0.070 P1 367 0.007 P1 368 0.004 P1 377 0.008 P1 379 0.013 P1 380
0.009 P1 381 0.006 P1 382 0.049 P1 383 0.007 P1 388 0.091 P1 389
0.013 P1 390 0.005 P1 394 0.038 P1 396 0.031 P1 398 0.026 P1 400
0.046 P1 401 0.063 P1 402 0.026 P1 406 0.011 P1 407 0.045 P1 408
0.046 P1 409 0.15 P1 410 0.088 P1 411 0.037 P1 412 0.041 P1 413
0.028 P1 414 0.025 P1 415 0.017 P1 416 0.032 P1 417 0.029 P1 418
0.006 P1 419 0.038 P1 420 0.042 P1 421 0.007 P1 422 0.098 P1 423
0.021 P1 424 0.047 P1 425 0.029 P1 426 0.038 P1 427 0.014 P1 428
0.012 P1 429 0.014 P1 430 0.031 P1 434 0.068 P1 435 0.013 P1 438
0.18 P1 439 0.33 P1 440 0.007 P1 442 0.005 P1 444 0.063 P1 445
0.008 P1 450 0.076 P1 451 0.006 P1 452 0.013 P1 453 0.030 P1 454
0.005 P1 455 0.082 P1 456 0.008 P1 457 0.008 P1 458 0.008 P1 459
0.018 P1 460 0.022 P1 461 0.007 P1 462 0.015 P1 463 0.120 P1 466
0.022 P1 468 0.009 P1 469 0.010 P1 470 0.013 P1 471 0.009 P1 477
0.016 P1 478 0.038 P1 479 0.030 P1 480 0.073 P1 481 0.033 P1 483
0.006 P1 484 0.013 P1 485 0.012 P1 486 0.007 P1 487 0.007 P1 488
0.037 P1 489 0.035 P1 490 0.053 P1 491 0.011 P1 493 0.004 P1 495
0.008 P1 496 0.005 P1 498 0.009 P1
[1159]
Sequence CWU 1
1
6 1 284 PRT Homo sapiens MISC_FEATURE Abl 1 Ser Pro Asn Tyr Asp Lys
Trp Glu Met Glu Arg Thr Asp Ile Thr Met 1 5 10 15 Lys His Lys Leu
Gly Gly Gly Gln Tyr Gly Glu Val Tyr Glu Gly Val 20 25 30 Trp Lys
Lys Tyr Ser Leu Thr Val Ala Val Lys Thr Leu Lys Glu Asp 35 40 45
Thr Met Glu Val Glu Glu Phe Leu Lys Glu Ala Ala Val Met Lys Glu 50
55 60 Ile Lys His Pro Asn Leu Val Gln Leu Leu Gly Val Cys Thr Arg
Glu 65 70 75 80 Pro Pro Phe Tyr Ile Ile Thr Glu Phe Met Thr Tyr Gly
Asn Leu Leu 85 90 95 Asp Tyr Leu Arg Glu Cys Asn Arg Gln Glu Val
Asn Ala Val Val Leu 100 105 110 Leu Tyr Met Ala Thr Gln Ile Ser Ser
Ala Met Glu Tyr Leu Glu Lys 115 120 125 Lys Asn Phe Ile His Arg Asp
Leu Ala Ala Arg Asn Cys Leu Val Gly 130 135 140 Glu Asn His Leu Val
Lys Val Ala Asp Phe Gly Leu Ser Arg Leu Met 145 150 155 160 Thr Gly
Asp Thr Tyr Thr Ala His Ala Gly Ala Lys Phe Pro Ile Lys 165 170 175
Trp Thr Ala Pro Glu Ser Leu Ala Tyr Asn Lys Phe Ser Ile Lys Ser 180
185 190 Asp Val Trp Ala Phe Gly Val Leu Leu Trp Glu Ile Ala Thr Tyr
Gly 195 200 205 Met Ser Pro Tyr Pro Gly Ile Asp Leu Ser Gln Val Tyr
Glu Leu Leu 210 215 220 Glu Lys Asp Tyr Arg Met Glu Arg Pro Glu Gly
Cys Pro Glu Lys Val 225 230 235 240 Tyr Glu Leu Met Arg Ala Cys Trp
Gln Trp Asn Pro Ser Asp Arg Pro 245 250 255 Ser Phe Ala Glu Ile His
Gln Ala Phe Glu Thr Met Phe Gln Glu Ser 260 265 270 Ser Ile Ser Asp
Glu Val Glu Lys Glu Leu Gly Lys 275 280 2 315 PRT Homo sapiens
MISC_FEATURE KDR 2 Asp Pro Asp Glu Leu Pro Leu Asp Glu His Cys Glu
Arg Leu Pro Tyr 1 5 10 15 Asp Ala Ser Lys Trp Glu Phe Pro Arg Asp
Arg Leu Lys Leu Gly Lys 20 25 30 Pro Leu Gly Arg Gly Ala Phe Gly
Gln Val Ile Glu Ala Asp Ala Phe 35 40 45 Gly Ile Asp Lys Thr Ala
Thr Cys Arg Thr Val Ala Val Lys Met Leu 50 55 60 Lys Glu Gly Ala
Thr His Ser Glu His Arg Ala Leu Met Ser Glu Leu 65 70 75 80 Lys Ile
Leu Ile His Ile Gly His His Leu Asn Val Val Asn Leu Leu 85 90 95
Gly Ala Cys Thr Lys Pro Gly Gly Pro Leu Met Val Ile Val Glu Phe 100
105 110 Cys Lys Phe Gly Asn Leu Ser Thr Tyr Leu Arg Ser Lys Arg Asn
Glu 115 120 125 Phe Val Pro Tyr Lys Val Ala Pro Glu Asp Leu Tyr Lys
Asp Phe Leu 130 135 140 Thr Leu Glu His Leu Ile Cys Tyr Ser Phe Gln
Val Ala Lys Gly Met 145 150 155 160 Glu Phe Leu Ala Ser Arg Lys Cys
Ile His Arg Asp Leu Ala Ala Arg 165 170 175 Asn Ile Leu Leu Ser Glu
Lys Asn Val Val Lys Ile Cys Asp Phe Gly 180 185 190 Leu Ala Arg Asp
Ile Tyr Lys Asp Pro Asp Tyr Val Arg Lys Gly Asp 195 200 205 Ala Arg
Leu Pro Leu Lys Trp Met Ala Pro Glu Thr Ile Phe Asp Arg 210 215 220
Val Tyr Thr Ile Gln Ser Asp Val Trp Ser Phe Gly Val Leu Leu Trp 225
230 235 240 Glu Ile Phe Ser Leu Gly Ala Ser Pro Tyr Pro Gly Val Lys
Ile Asp 245 250 255 Glu Glu Phe Cys Arg Arg Leu Lys Glu Gly Thr Arg
Met Arg Ala Pro 260 265 270 Asp Tyr Thr Thr Pro Glu Met Tyr Gln Thr
Met Leu Asp Cys Trp His 275 280 285 Gly Glu Pro Ser Gln Arg Pro Thr
Phe Ser Glu Leu Val Glu His Leu 290 295 300 Gly Asn Leu Leu Gln Ala
Asn Ala Gln Gln Asp 305 310 315 3 348 PRT Homo sapiens MISC_FEATURE
B-Raf(V599E) construct 1 3 Lys Ser Pro Gly Gln Arg Glu Arg Lys Ser
Ser Ser Ser Ser Glu Asp 1 5 10 15 Arg Asn Arg Met Lys Thr Leu Gly
Arg Arg Asp Ser Ser Asp Asp Trp 20 25 30 Glu Ile Pro Asp Gly Gln
Ile Thr Val Gly Gln Arg Ile Gly Ser Gly 35 40 45 Ser Phe Gly Thr
Val Tyr Lys Gly Lys Trp His Gly Asp Val Ala Val 50 55 60 Lys Met
Leu Asn Val Thr Ala Pro Thr Pro Gln Gln Leu Gln Ala Phe 65 70 75 80
Lys Asn Glu Val Gly Val Leu Arg Lys Thr Arg His Val Asn Ile Leu 85
90 95 Leu Phe Met Gly Tyr Ser Thr Lys Pro Gln Leu Ala Ile Val Thr
Gln 100 105 110 Trp Cys Glu Gly Ser Ser Leu Tyr His His Leu His Ile
Ile Glu Thr 115 120 125 Lys Phe Glu Met Ile Lys Leu Ile Asp Ile Ala
Arg Gln Thr Ala Gln 130 135 140 Gly Met Asp Tyr Leu His Ala Lys Ser
Ile Ile His Arg Asp Leu Lys 145 150 155 160 Ser Asn Asn Ile Phe Leu
His Glu Asp Leu Thr Val Lys Ile Gly Asp 165 170 175 Phe Gly Leu Ala
Thr Glu Lys Ser Arg Trp Ser Gly Ser His Gln Phe 180 185 190 Glu Gln
Leu Ser Gly Ser Ile Leu Trp Met Ala Pro Glu Val Ile Arg 195 200 205
Met Gln Asp Lys Asn Pro Tyr Ser Phe Gln Ser Asp Val Tyr Ala Phe 210
215 220 Gly Ile Val Leu Tyr Glu Leu Met Thr Gly Gln Leu Pro Tyr Ser
Asn 225 230 235 240 Ile Asn Asn Arg Asp Gln Ile Ile Phe Met Val Gly
Arg Gly Tyr Leu 245 250 255 Ser Pro Asp Leu Ser Lys Val Arg Ser Asn
Cys Pro Lys Ala Met Lys 260 265 270 Arg Leu Met Ala Glu Cys Leu Lys
Lys Lys Arg Asp Glu Arg Pro Leu 275 280 285 Phe Pro Gln Ile Leu Ala
Ser Ile Glu Leu Leu Ala Arg Ser Leu Pro 290 295 300 Lys Ile His Arg
Ser Ala Ser Glu Pro Ser Leu Asn Arg Ala Gly Phe 305 310 315 320 Gln
Thr Glu Asp Phe Ser Leu Tyr Ala Cys Ala Ser Pro Lys Thr Pro 325 330
335 Ile Gln Ala Gly Gly Tyr Gly Ala Phe Pro Val His 340 345 4 294
PRT Homo sapiens MISC_FEATURE B-Raf(V599E) construct 2 4 Glu Asp
Arg Asn Arg Met Lys Thr Leu Gly Arg Arg Asp Ser Ser Asp 1 5 10 15
Asp Trp Glu Ile Pro Asp Gly Gln Ile Thr Val Gly Gln Arg Ile Gly 20
25 30 Ser Gly Ser Phe Gly Thr Val Tyr Lys Gly Lys Trp His Gly Asp
Val 35 40 45 Ala Val Lys Met Leu Asn Val Thr Ala Pro Thr Pro Gln
Gln Leu Gln 50 55 60 Ala Phe Lys Asn Glu Val Gly Val Leu Arg Lys
Thr Arg His Val Asn 65 70 75 80 Ile Leu Leu Phe Met Gly Tyr Ser Thr
Lys Pro Gln Leu Ala Ile Val 85 90 95 Thr Gln Trp Cys Glu Gly Ser
Ser Leu Tyr His His Leu His Ile Ile 100 105 110 Glu Thr Lys Phe Glu
Met Ile Lys Leu Ile Asp Ile Ala Arg Gln Thr 115 120 125 Ala Gln Gly
Met Asp Tyr Leu His Ala Lys Ser Ile Ile His Arg Asp 130 135 140 Leu
Lys Ser Asn Asn Ile Phe Leu His Glu Asp Leu Thr Val Lys Ile 145 150
155 160 Gly Asp Phe Gly Leu Ala Thr Glu Lys Ser Arg Trp Ser Gly Ser
His 165 170 175 Gln Phe Glu Gln Leu Ser Gly Ser Ile Leu Trp Met Ala
Pro Glu Val 180 185 190 Ile Arg Met Gln Asp Lys Asn Pro Tyr Ser Phe
Gln Ser Asp Val Tyr 195 200 205 Ala Phe Gly Ile Val Leu Tyr Glu Leu
Met Thr Gly Gln Leu Pro Tyr 210 215 220 Ser Asn Ile Asn Asn Arg Asp
Gln Ile Ile Phe Met Val Gly Arg Gly 225 230 235 240 Tyr Leu Ser Pro
Asp Leu Ser Lys Val Arg Ser Asn Cys Pro Lys Ala 245 250 255 Met Lys
Arg Leu Met Ala Glu Cys Leu Lys Lys Lys Arg Asp Glu Arg 260 265 270
Pro Leu Phe Pro Gln Ile Leu Ala Ser Ile Glu Leu Leu Ala Arg Ser 275
280 285 Leu Pro Lys Ile His Arg 290 5 333 PRT Homo sapiens
MISC_FEATURE MEK1 5 Met Glu Leu Lys Asp Asp Asp Phe Glu Lys Ile Ser
Glu Leu Gly Ala 1 5 10 15 Gly Asn Gly Gly Val Val Phe Lys Val Ser
His Lys Pro Ser Gly Leu 20 25 30 Val Met Ala Arg Lys Leu Ile His
Leu Glu Ile Lys Pro Ala Ile Arg 35 40 45 Asn Gln Ile Ile Arg Glu
Leu Gln Val Leu His Glu Cys Asn Ser Pro 50 55 60 Tyr Ile Val Gly
Phe Tyr Gly Ala Phe Tyr Ser Asp Gly Glu Ile Ser 65 70 75 80 Ile Cys
Met Glu His Met Asp Gly Gly Ser Leu Asp Gln Val Leu Lys 85 90 95
Lys Ala Gly Arg Ile Pro Glu Gln Ile Leu Gly Lys Val Ser Ile Ala 100
105 110 Val Ile Lys Gly Leu Thr Tyr Leu Arg Glu Lys His Lys Ile Met
His 115 120 125 Arg Asp Val Lys Pro Ser Asn Ile Leu Val Asn Ser Arg
Gly Glu Ile 130 135 140 Lys Leu Cys Asp Phe Gly Val Ser Gly Gln Leu
Ile Asp Ser Met Ala 145 150 155 160 Asn Ser Phe Val Gly Thr Arg Ser
Tyr Met Ser Pro Glu Arg Leu Gln 165 170 175 Gly Thr His Tyr Ser Val
Gln Ser Asp Ile Trp Ser Met Gly Leu Ser 180 185 190 Leu Val Glu Met
Ala Val Gly Arg Tyr Pro Ile Pro Pro Pro Asp Ala 195 200 205 Lys Glu
Leu Glu Leu Met Phe Gly Cys Gln Val Glu Gly Asp Ala Ala 210 215 220
Glu Thr Pro Pro Arg Pro Arg Thr Pro Gly Arg Pro Leu Ser Ser Tyr 225
230 235 240 Gly Met Asp Ser Arg Pro Pro Met Ala Ile Phe Glu Leu Leu
Asp Tyr 245 250 255 Ile Val Asn Glu Pro Pro Pro Lys Leu Pro Ser Gly
Val Phe Ser Leu 260 265 270 Glu Phe Gln Asp Phe Val Asn Lys Cys Leu
Ile Lys Asn Pro Ala Glu 275 280 285 Arg Ala Asp Leu Lys Gln Leu Met
Val His Ala Phe Ile Lys Arg Ser 290 295 300 Asp Ala Glu Glu Val Asp
Phe Ala Gly Trp Leu Cys Ser Thr Ile Gly 305 310 315 320 Leu Asn Gln
Pro Ser Thr Pro Thr His Ala Ala Gly Val 325 330 6 360 PRT Homo
sapiens MISC_FEATURE P38-alpha 6 Met Ser Gln Glu Arg Pro Thr Phe
Tyr Arg Gln Glu Leu Asn Lys Thr 1 5 10 15 Ile Trp Glu Val Pro Glu
Arg Tyr Gln Asn Leu Ser Pro Val Gly Ser 20 25 30 Gly Ala Tyr Gly
Ser Val Cys Ala Ala Phe Asp Thr Lys Thr Gly Leu 35 40 45 Arg Val
Ala Val Lys Lys Leu Ser Arg Pro Phe Gln Ser Ile Ile His 50 55 60
Ala Lys Arg Thr Tyr Arg Glu Leu Arg Leu Leu Lys His Met Lys His 65
70 75 80 Glu Asn Val Ile Gly Leu Leu Asp Val Phe Thr Pro Ala Arg
Ser Leu 85 90 95 Glu Glu Phe Asn Asp Val Tyr Leu Val Thr His Leu
Met Gly Ala Asp 100 105 110 Leu Asn Asn Ile Val Lys Cys Gln Lys Leu
Thr Asp Asp His Val Gln 115 120 125 Phe Leu Ile Tyr Gln Ile Leu Arg
Gly Leu Lys Tyr Ile His Ser Ala 130 135 140 Asp Ile Ile His Arg Asp
Leu Lys Pro Ser Asn Leu Ala Val Asn Glu 145 150 155 160 Asp Cys Glu
Leu Lys Ile Leu Asp Phe Gly Leu Ala Arg His Thr Asp 165 170 175 Asp
Glu Met Thr Gly Tyr Val Ala Thr Arg Trp Tyr Arg Ala Pro Glu 180 185
190 Ile Met Leu Asn Trp Met His Tyr Asn Gln Thr Val Asp Ile Trp Ser
195 200 205 Val Gly Cys Ile Met Ala Glu Leu Leu Thr Gly Arg Thr Leu
Phe Pro 210 215 220 Gly Thr Asp His Ile Asn Gln Leu Gln Gln Ile Met
Arg Leu Thr Gly 225 230 235 240 Thr Pro Pro Ala Tyr Leu Ile Asn Arg
Met Pro Ser His Glu Ala Arg 245 250 255 Asn Tyr Ile Gln Ser Leu Thr
Gln Met Pro Lys Met Asn Phe Ala Asn 260 265 270 Val Phe Ile Gly Ala
Asn Pro Leu Ala Val Asp Leu Leu Glu Lys Met 275 280 285 Leu Val Leu
Asp Ser Asp Lys Arg Ile Thr Ala Ala Gln Ala Leu Ala 290 295 300 His
Ala Tyr Phe Ala Gln Tyr His Asp Pro Asp Asp Glu Pro Val Ala 305 310
315 320 Asp Pro Tyr Asp Gln Ser Phe Glu Ser Arg Asp Leu Leu Ile Asp
Glu 325 330 335 Trp Lys Ser Leu Thr Tyr Asp Glu Val Ile Ser Phe Val
Pro Pro Pro 340 345 350 Leu Asp Gln Glu Glu Met Glu Ser 355 360
* * * * *