U.S. patent number 10,907,188 [Application Number 16/093,074] was granted by the patent office on 2021-02-02 for compositions and methods for the production of compounds.
This patent grant is currently assigned to Ginkgo Bioworks, Inc.. The grantee listed for this patent is Warp Drive Bio, Inc.. Invention is credited to Joshua A. V. Blodgett, Brian R. Bowman, Lucy Foulston, Daniel C. Gray, Jay P. Morgenstern, Keith Robison, Gregory L. Verdine.
![](/patent/grant/10907188/US10907188-20210202-C00001.png)
![](/patent/grant/10907188/US10907188-20210202-D00001.png)
![](/patent/grant/10907188/US10907188-20210202-D00002.png)
![](/patent/grant/10907188/US10907188-20210202-D00003.png)
![](/patent/grant/10907188/US10907188-20210202-D00004.png)
![](/patent/grant/10907188/US10907188-20210202-D00005.png)
![](/patent/grant/10907188/US10907188-20210202-D00006.png)
![](/patent/grant/10907188/US10907188-20210202-D00007.png)
![](/patent/grant/10907188/US10907188-20210202-D00008.png)
![](/patent/grant/10907188/US10907188-20210202-D00009.png)
![](/patent/grant/10907188/US10907188-20210202-D00010.png)
View All Diagrams
United States Patent |
10,907,188 |
Bowman , et al. |
February 2, 2021 |
Compositions and methods for the production of compounds
Abstract
The present disclosure provides nucleic acids encoding a Large
ATP-binding regulator of the LuxR family (LAL) of transcription
factors, vectors and host cells including such nucleic acids, and
methods for producing compounds (e.g., polyketides or .beta.-lactam
compounds) with such nucleic acids, vectors, and/or host cells.
Inventors: |
Bowman; Brian R. (New Rochelle,
NY), Blodgett; Joshua A. V. (Webster Groves, MO),
Verdine; Gregory L. (Boston, MA), Gray; Daniel C.
(Medford, MA), Morgenstern; Jay P. (Boston, MA),
Foulston; Lucy (Medford, MA), Robison; Keith (Andover,
MA) |
Applicant: |
Name |
City |
State |
Country |
Type |
Warp Drive Bio, Inc. |
Cambridge |
MA |
US |
|
|
Assignee: |
Ginkgo Bioworks, Inc. (Boston,
MA)
|
Family
ID: |
1000005335064 |
Appl.
No.: |
16/093,074 |
Filed: |
April 12, 2017 |
PCT
Filed: |
April 12, 2017 |
PCT No.: |
PCT/US2017/027215 |
371(c)(1),(2),(4) Date: |
October 11, 2018 |
PCT
Pub. No.: |
WO2017/180748 |
PCT
Pub. Date: |
October 19, 2017 |
Prior Publication Data
|
|
|
|
Document
Identifier |
Publication Date |
|
US 20190136284 A1 |
May 9, 2019 |
|
Related U.S. Patent Documents
|
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
Issue Date |
|
|
62321439 |
Apr 12, 2016 |
|
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C12P
35/00 (20130101); C12N 15/76 (20130101); C12N
15/52 (20130101); C07K 14/36 (20130101) |
Current International
Class: |
C12N
1/20 (20060101); C12N 15/52 (20060101); C12N
15/76 (20060101); C07K 14/36 (20060101); C12P
35/00 (20060101) |
Field of
Search: |
;435/118 |
References Cited
[Referenced By]
U.S. Patent Documents
Foreign Patent Documents
|
|
|
|
|
|
|
0393934 |
|
Oct 1990 |
|
EP |
|
0562853 |
|
Sep 1993 |
|
EP |
|
1079859 |
|
Jul 2010 |
|
EP |
|
10-2009-0041971 |
|
Apr 2009 |
|
KR |
|
WO-86/02080 |
|
Apr 1986 |
|
WO |
|
WO-95/32294 |
|
Nov 1995 |
|
WO |
|
WO-96/020216 |
|
Jul 1996 |
|
WO |
|
WO-98/01546 |
|
Jan 1998 |
|
WO |
|
WO-98/07743 |
|
Feb 1998 |
|
WO |
|
WO-98/12217 |
|
Mar 1998 |
|
WO |
|
WO-99/61055 |
|
Dec 1999 |
|
WO |
|
WO-00/47724 |
|
Aug 2000 |
|
WO |
|
WO-01/36460 |
|
May 2001 |
|
WO |
|
WO-01/36612 |
|
May 2001 |
|
WO |
|
WO-01/90070 |
|
Nov 2001 |
|
WO |
|
WO-2008/069824 |
|
Jun 2008 |
|
WO |
|
WO-2010/031185 |
|
Mar 2010 |
|
WO |
|
WO-2010/034243 |
|
Apr 2010 |
|
WO |
|
WO-2010/088573 |
|
Aug 2010 |
|
WO |
|
WO-2012/075048 |
|
Jun 2012 |
|
WO |
|
WO-2012/174489 |
|
Dec 2012 |
|
WO |
|
WO-2014/009774 |
|
Jan 2014 |
|
WO |
|
WO-2014/187959 |
|
Nov 2014 |
|
WO |
|
WO-2015/132784 |
|
Sep 2015 |
|
WO |
|
WO-2016/112279 |
|
Jul 2016 |
|
WO |
|
WO-2016/112295 |
|
Jul 2016 |
|
WO |
|
WO-2016/160362 |
|
Oct 2016 |
|
WO |
|
WO-2017/059207 |
|
Apr 2017 |
|
WO |
|
WO-2018/081592 |
|
May 2018 |
|
WO |
|
Other References
US. Appl. No. 61/418,038, Johns Hopkins University. cited by
applicant .
"Substructure Search Report on Specifically Substituted
Macrocycles--Substances Only", prepared by Science IP, dated Dec.
17, 2014 (6177 pages). cited by applicant .
Allain et al., "Cyclophilin B mediates cyclosporin A incorporation
in human blood T-lymphocytes through the specific binding of
complexed drug to the cell surface," Biochem J. 317 (Pt 2):565-70
(1996). cited by applicant .
Andrei et al., "Stabilization of protein-protein interactions in
drug discovery," Expert Opin Drug Discov. 12(9):925-40 (2017) (17
pages). cited by applicant .
Antunes et al., "A mutational analysis defines Vibrio fischeri LuxR
binding sites," J Bacteriol. 190(13):4392-7 (2008). cited by
applicant .
Archibald et al., "Discovery and Evaluation of Potent,
Cysteine-based alpha4beta1 Integrin Antagonists," Bioorg Med Chem
Lett. 10(9):993-995 (2000). cited by applicant .
Banaszynski et al., "Characterization of the FKBP.rapamycin.FRB
ternary complex," J Am Chem Soc. 127(13):4715-21 (2005). cited by
applicant .
Bayle et al., "Rapamycin analogs with differential binding
specificity permit orthogonal control of protein activity," Chem
Biol. 13(1):99-107 (2006). cited by applicant .
Benjamin et al., "Rapamycin passes the torch: a new generation of
mTOR inhibitors," Nat Rev Drug Discov. 10(11):868-80 (2011). cited
by applicant .
Bhuyan et al., "Antioxidant activity of peptide-based angiotensin
converting enzyme inhibitors," Org. Biomol. Chem. 10(11):2237-47
(2012). cited by applicant .
Blodgett et al., "Unusual transformations in the biosynthesis of
the antibiotic phosphinothricin tripeptide," Nat Chem Biol.
3(8):480-5 (2007). cited by applicant .
Briesewitz et al., "Affinity modulation of small-molecule ligands
by borrowing endogenous protein surfaces," Proc Natl Acad Sci
U.S.A. 96(5):1953-8 (1999). cited by applicant .
Bruce, "In vivo protein complex topologies: sights through a
cross-linking lens," Proteomics. 12(10):1565-75 (2012). cited by
applicant .
Burgess et al., "Controlled translocation of palladium(II) within a
22 ring atom macrocyclic ligand," Dalton Trans. 43(45):17006-16
(2014). cited by applicant .
Chaurasia et al., "Molecular insights into the stabilization of
protein-protein interactions with small molecule: The
FKBP12-rapamycin-FRB case study," Chem Phys Lett. 587:68-74 (2013).
cited by applicant .
Che et al., "Inducing protein-protein interactions with molecular
glues," Bioorganic & Medicinal Chemistry Letters (2018). cited
by applicant .
Chevalier et al., "Straightforward synthesis of bioconjugatable azo
dyes. Part 1: Black Hole Quencher-1 (BHQ-1) scaffold," Tetrahedron
Lett. 55(50):6759-63 (2014). cited by applicant .
Findlay et al., "The structure of demethoxyrapamycin," Can J Chem.
60:2046-7 (1982). cited by applicant .
Guerra et al., "LAL regulators SCO0877 and SCO7173 as pleiotropic
modulators of phosphate starvation response and actinorhodin
biosynthesis in Streptomyces coelicolor," PLoS One. 7(2):e31475
(2012) (11 pages). cited by applicant .
Horton et al., "Engineering hybrid genes without the use of
restriction enzymes: gene splicing by overlap extension," Gene.
77(1):61-8 (1989). cited by applicant .
Hosted et al., "Use of rpsL for dominance selection and gene
replacement in Streptomyces roseosporus," J Bacteriol. 179(1):
180-6 (1997). cited by applicant .
Huang et al., "Enhanced rapamycin production in Streptomyces
hygroscopicus by integrative expression of aveR, a LAL family
transcriptional regulator," World J Microbiol Biotechnol. 27:2103-9
(2011). cited by applicant .
Hubler et al., "Synthetic routes to NEtXaa4-cyclosporin A
derivatives as potential anti-HIV I drugs," Tetrahedron Lett.
41:7193-6 (2000). cited by applicant .
International Preliminary Report on Patentability for International
Application No. PCT/US2017/027215, dated Oct. 25, 2018 (7 pages).
cited by applicant .
International Search Report and Written Opinion for International
Application No. PCT/US2017/027215, dated Jul. 10, 2017 (13 pages).
cited by applicant .
Ishizawa et al., "TRAP display: a high-speed selection method for
the generation of functional polypeptides," J Am Chem.
135(14):5433-40 (2013). cited by applicant .
Kawakami et al., "In vitro selection of multiple libraries created
by genetic code reprogramming to discover macrocyclic peptides that
antagonize VEGFR2 activity in living cells," ACS Chem Biol.
8(6):1205-14 (2013). cited by applicant .
Kendrew et al., "Recombinant strains for the enhanced production of
bioengineered rapalogs," Metab Eng. 15:167-73 (2013). cited by
applicant .
Kuramochi et al., "Idenitifcation of Small Molecule Binding
Molecules by Affinity Purification Using a Specific Ligand
Immobilized on PEGA Resin," Bioconjug. Chem. 19(12):2417-26 (2008).
cited by applicant .
Laureti et al., "Identification of a bioactive 51-membered
macrolide complex by activation of a silent polyketide synthase in
Streptomyces ambofaciens," Proc Natl Acad Sci USA. 108(15):6258-63
(2011). cited by applicant .
Leskiw et al., "TTA codons in some genes prevent their expression
in a class of developmental, antibiotic-negative, Streptomyces
mutants," Proc Natl Acad Sci USA. 88(6):2461-5 (1991). cited by
applicant .
Li et al., "A simple and efficient route to the FKBP-binding domain
from rapamycin," available in PMC Sep. 28, 2012, published in final
edited form as: Tetrahedron Lett. 52(39):5070-2 (2011) (7 pages).
cited by applicant .
Luengo et al., "Structure-activity studies of rapamycin analogs:
evidence that the C-7 methoxy group is part of the effector domain
and positioned at the FKBP12-FRAP interface," Chem Biol.
2(7):471-81 (1995). cited by applicant .
Meyer et al., "Selective palladation of a large (32 ring atom)
macrocyclic ligand at a bis(N-heterocyclic carbene) coordination
pocket through transmetallation of the corresponding mercury(II)
derivative," Dalton Trans. 41(46):14059-67 (2012). cited by
applicant .
Ochi et al., "New strategies for drug discovery: activation of
silent or weakly expressed microbial gene clusters," Appl Microbiol
Biotechnol. 97(1):87-98 (2013). cited by applicant .
Papageorgiou et al., "Improved binding affinity for cyclophilin A
by a cyclosporin derivative singly modified at its effector
domain," J Med Chem. 37(22):3674-6 (1994). cited by applicant .
Pfeifer et al., "Biosynthesis of complex polyketides in a
metabolically engineered strain of E. coli," Science
291(5509):1790-2 (2001). cited by applicant .
Ranganathan et al., "Knowledge-based design of bimodular and
trimodular polyketide synthases based on domain and module swaps: a
route to simple statin analogues," Chem Biol. 6(10):731-41 (1999).
cited by applicant .
Revill et al., "Genetically engineered analogs of ascomycin for
nerve regeneration," J Pharmacol Exp Ther. 302(3):1278-85 (2002).
cited by applicant .
Ruan et al., "Binding of rapamycin analogs to calcium channels and
FKBP52 contributes to their neuroprotective activities," Proc Natl
Acad Sci U.S.A. 105(1):33-8 (2008). cited by applicant .
Schwecke et al., "The biosynthetic gene cluster for the polyketide
immunosuppressant rapamycin," Proc Natl Acad Sci USA.
92(17):7839-43 (1995). cited by applicant .
Sieber et al., "Novel inhibitors of the calcineurin/NFATc
hub--alternatives to CsA and FK506?," Cell Commun Signal. 7:25
(2009) (19 pages). cited by applicant .
STN record of WO 2014/009774, available online Jan. 16, 2014 (4
pages). cited by applicant .
STN record of WO 98/12217, available online Mar. 26, 1998 (6
pages). cited by applicant .
Sweeney et al., "From chemical tools to clinical medicines:
non-immunosuppressive cyclophilin inhibitors derived from the
cyclosporin and sanglifehrin scaffolds," J Med Chem. 57(17):7145-59
(2014) (63 pages). cited by applicant .
Takakusagi et al., "Efficient one-cycle affinity selection of
binding proteins or peptides specific for a small-molecule using a
T7 phage display pool," Bioorg. Med. Chem. 16(22):9837-46 (2008).
cited by applicant .
UniProtKB Accession No. A0A061A6I8, Sep. 3, 2014, available
<http://www.uniprot.org/uniprot/A0A061A6I8>, (12 pages).
cited by applicant .
UniProtKB Accession No. Q54296, Nov. 1, 1996, available
<http://www.uniprot.org/uniprot/Q54296>, (12 pages). cited by
applicant .
UniProtKB Accession No. Q54297, Nov. 1, 1996, available
<https://www.uniprot.org/uniprot/Q54297.txt>, (3 pages).
cited by applicant .
Vignot et al., "mTOR-targeted therapy of cancer with rapamycin
derivatives," Ann Oncol. 16(4):525-37 (2005). cited by applicant
.
Wagner et al., "New naturally occurring amino acids," Angew Chem
Int Ed Engl. 22:816-28 (1983). cited by applicant .
Wang et al., "Thermodynamic analysis of cyclosporin a binding to
cyclophilin a in a lung tumor tissue lysate," Anal Chem.
76(15):4343-8 (2004). cited by applicant .
Wilson et al., "Comparative X-ray structures of the major binding
protein for the immunosuppressant FK506 (tacrolimus) in unliganded
form and in complex with FK506 and rapamycin," Acta Cryst.
D51:511-21 (1995). cited by applicant .
Wright et al., "Multivalent binding in the design of bioactive
compounds," Curr Org Chem. 5(11):1107-31 (2001). cited by applicant
.
Wu et al., "Creating diverse target-binding surfaces on FKBP12:
synthesis and evaluation of a rapamycin analogue library,"
available in PMC Sep. 12, 2012, published in final edited form as:
ACS Comb Sci. 13(5):486-95 (2011) (22 pages). cited by applicant
.
Wu et al., "Inhibition of ras-effector interactions by cyclic
peptides," Med Chem Commun. 4(2):378-82 (2013). cited by applicant
.
Aebi et al., "Synthesis, conformation, and immunosuppressive
activities of three analogues of cyclosporin A modified in the
1-position," J Med Chem. 33(3):999-1009 (1990). cited by applicant
.
Eberle et al., "Preparation of Functionalized Ethers of Cyclosporin
A," Tetrahedron Lett. 35(35):6477-6480 (1994). cited by applicant
.
Lee et al., "Current implications of cyclophilins in human
cancers," J Exp Clin Cancer Res. 29(1):97 (2010) (6 pages). cited
by applicant .
Majumder et al., "Interaction of aryl hydrocarbon
receptor-interacting protein-like 1 with the farnesyl moiety," J
Biol Chem. 288(29):21320-8 (2013). cited by applicant .
Sun et al., "Design and structure-based study of new potential
FKBP12 inhibitors," Biophys J. 85(5):3194-201 (2003). cited by
applicant .
"Streptomyces iranensis regulatory protein LuxR," EBI Database
Accession No. CDR13506 (2014) (2 pages). cited by applicant .
"Streptomyces rapamycinicus NRRL 5491 hypothetical protein," EBI
Database Accession No. AGP59507 (2014) (2 pages). cited by
applicant .
Baranasic et al., "Draft Genome Sequence of Streptomyces
rapamycinicus Strain NRRL 5491, the Producer of the
Immunosuppressant Rapamycin," Genome Announc. 1(4):e000581-13
(2013) (2 pages). cited by applicant .
Extended European Search Report for European Patent Application No.
1778058.5, dated Aug. 22, 2019 (15 pages). cited by applicant .
He et al., "The LuxR family members GdmRI and GdmRII are positive
regulators of geldanamycin biosynthesis in Streptomyces
hygroscopicus 17997," Arch Microbiol. 189(5):501-10 (2008). cited
by applicant .
Horn et al., "Draft Genome Sequence of Streptomyces iranensis,"
Genome Announc. 2(4):e00616-14 (2014) (2 Pages). cited by applicant
.
Laureti et al., Supporting Material for "Identification of a
bioactive 51-membered macrolide complex by activation of a silent
polyketide synthase in Streptomyces ambofaciens," Proc Natl Acad
Sci U.S.A. 108(15):6258-63 (2011), accessed via
<https://www.pnas.org/content/suppl/2011/03/24/1019077108.DCSupplement-
al> (41 pages). cited by applicant .
Mo et al., "Interspecies Complementation of the LuxR Family
Pathway-Specific Regulator Involved in Macrolide Biosynthesis," J
Microbiol Biotechnol. 26(1):66-71 (2016). cited by applicant .
"SMART.TM. Drugs: Engineering Nature's Solution to the Undruggable
Target Challenge," WarpDrive Bio, 2016 (31 pages). cited by
applicant .
Ding et al. "Insights into Bacterial 6-Methylsalicylic Acid
Synthase and Its Engineering to Orsellinic Acid Synthase for
Spirotetronate Generation," Chem Biol. 17(5):495-503 (2010). cited
by applicant .
Garg et al. "Elucidation of the Cryptic Epimerase Activity of
Redox-Inactive Ketoreductase Domains from Modular Polyketide
Synthases by Tandem Equilibrium Isotope Exchange," J. Am. Chem.
Soc. 136(29):10190-10193 (2014). cited by applicant .
Murphy et al. "Isolation and characterisation of amphotericin B
analogues and truncated polyketide intermediates produced by
genetic engineering of Streptomyces nodosus," Org Biomol Chem.
8(16):3758-70 (2010). cited by applicant .
Supplementary Partial European Search Report for European Patent
Application No. 17865512.2, dated May 7, 2020 (20 pages). cited by
applicant .
Power et al. "Engineered Synthesis of 7-Oxo- and
15-Deoxy-15-Oxo-Amphotericins: Insights into Structure-Activity
Relationships in Polyene Antibiotics," Chem Biol. 15:78-86 (2008).
cited by applicant .
Reid et al. "A model of structure and catalysis for ketoreductase
domains in modular polyketide synthases," Biochemistry. 42(1):72-79
(2003). cited by applicant .
Tang et al. "Generation of New Epothilones by Genetic Engineering
of a Polyketide Synthase in Myxococcus xanthus," J Antibiot
(Tokyo). 58(3):178-184 (2005). cited by applicant .
Weissman, "Genetic engineering of modular PKSs: from combinatorial
biosynthesis to synthetic biology," Nat Prod Rep. 33(2):203-230
(2016). cited by applicant .
Weissman et al., "Combinatorial biosynthesis of reduced
polyketides," Nat Rev Microbiol 3(12):925-36 (2005). cited by
applicant .
Hong et al., "Evidence for an iterative module in chain elongation
on the azalomycin polyketide synthase," Beilstein J Org Chem
12:2164-2172 (2016). cited by applicant .
UniProtKB Accession No. Q54296, "Polyketide synthase,"
<https://www.uniprot.org/uniprot/A0A61A618.txt?version=14>,
retrieved May 29, 2020 (12 pages). cited by applicant .
Supplementary Partial European Search Report for European
Application No. 17863519.9, dated Jun. 15, 2020 (16 pages). cited
by applicant .
De Schrijver et al., "A subfamily of MaIT-related ATP-dependent
regulators in the LuxR family," Microbiology. 145(6):1287-8 (1999).
cited by applicant.
|
Primary Examiner: Saidha; Tekchand
Attorney, Agent or Firm: Clark & Elbing LLP
Claims
What is claims is:
1. A genetically modified host cell comprising: (i) a nucleic acid
encoding a recombinant Large ATP-binding regulator of the LuxR
family (LAL) that is heterologous to the host cell; and (ii) a
nucleic acid comprising an LAL binding site that is heterologous to
the host cell.
2. The host cell of claim 1, wherein the host cell naturally lacks
an LAL or the host cell naturally lacks an LAL binding site.
3. The host cell of claim 1, wherein the LAL binding site is
operably linked to an open reading frame.
4. The host cell of claim 3, wherein the open reading frame encodes
a compound-producing protein.
5. The host cell of claim 1, wherein: the recombinant LAL comprises
a portion having at least 90% sequence identity to the amino acid
sequence of SEQ ID NO: 1; the recombinant LAL comprises a portion
having the amino acid sequence of SEQ ID NO: 1; or the recombinant
LAL has the amino acid sequence of SEQ ID NO: 1.
6. The host cell of claim 4, wherein the host cell has been
modified to enhance expression of the compound-producing protein by
(i) deletion of an endogenous gene cluster which expresses an
endogenous compound-producing protein; (ii) insertion of a
heterologous gene cluster which expresses a heterologous
compound-producing protein; (iii) exposure of the host cell to an
antibiotic challenge; and/or (iv) introduction of a heterologous
promoter that results in an at least 2-fold increase in expression
of a compound produced by the compound-producing protein compared
to the expression of the compound when the homologous promoter has
not been replaced.
7. The host cell of claim 1, wherein: the nucleic acid further
comprises one or more additional LAL binding sites; at least one of
the LAL binding sites is in a promoter; or the nucleic acid further
comprises a gene encoding an LAL.
8. The host cell of claim 7, wherein: the gene encoding an LAL is
under the control of a promoter comprising an LAL binding site; or
at least one of the LAL binding sites is in a promoter.
9. The host cell of claim 8, wherein at least one of the LAL
binding sites is in a promoter and the promoter is a bidirectional
promoter.
10. A nucleic acid comprising an LAL binding site and a sequence
encoding an LAL, wherein the LAL binding site comprises a sequence
having no more than one insertion, deletion, or substitution with
respect to the nucleic acid sequence of SEQ ID NO:2 and/or
comprises the nucleic acid sequence of SEQ ID NO: 3, and wherein
the LAL comprises a portion having at least 90% sequence identity
to the amino acid sequence of SEQ ID NO: 1; the LAL comprises a
portion having the amino acid sequence of SEQ ID NO: 1; or the LAL
has the amino acid sequence of SEQ ID NO: 1.
11. The nucleic acid of claim 10, wherein the nucleic acid lacks a
TTA inhibitory codon in at least one open reading frame.
12. The nucleic acid of claim 10, wherein the LAL binding site
comprises the nucleic acid sequence of SEQ ID NO:2.
13. The nucleic acid of claim 10, wherein the nucleic acid further
comprises an open reading frame.
14. The nucleic acid of claim 13, wherein the open reading frame
encodes a compound-producing protein.
15. The nucleic acid of claim 14, wherein the compound-producing
protein is a polyketide synthase, a .beta.-lactam
compound-producing protein, or a non-ribosomal peptide
synthase.
16. The nucleic acid of claim 10, wherein: the nucleic acid further
comprises one or more additional LAL binding sites; or the gene
encoding the LAL is under the control of a promoter comprising an
LAL binding site.
17. The nucleic acid of claim 16, wherein at least one of the LAL
binding sites is in a promoter.
18. The nucleic acid of claim 17, wherein the promoter is a
bidirectional promoter.
19. An expression vector comprising a nucleic acid of claim 10.
20. A host cell comprising the nucleic acid of claim 10.
Description
BACKGROUND
The Large ATP-binding regulators of the LuxR family of
transcriptional activators (LALs) are known transcriptional
regulators of polyketides such as FK506 or rapamycin. The LAL
family has been found to have an active role in the induction of
expression of some types of natural product gene clusters, for
example PikD for pikromycin production and RapH for rapamycin
production. The LAL proteins contain three domains; a
nucleotide-binding domain, an inducer-binding domain, and a
helix-turn-helix (DNA binding) domain. The structure of the
DNA-binding domain is a four helix bundle. The specific protein
residue sequence of Helix 3 in this motif directs the LAL to
specific DNA sequences contained in prokaryal transcriptional
promoter regions (i.e., the LAL binding site). Binding of the LAL
or multiple LALs in a complex to specific sites in the promoters of
genes within a gene cluster that produces a small molecule (e.g., a
polyketide synthase gene cluster or a .beta.-lactam compound
producing protein gene cluster) potentiates expression of the gene
cluster and hence promotes production of the compound (e.g., a
polyketide or a .beta.-lactam compound). Thus, there is an
opportunity for compositions and methods to be developed that lead
to more efficient and/or increased production of compounds (e.g.,
polyketides or .beta.-lactam compounds) by optimizing regulation of
the corresponding gene cluster that produces a small molecule
(e.g., a PKS gene cluster or a .beta.-lactam compound gene
cluster).
SUMMARY OF THE INVENTION
The present disclosure provides nucleic acids encoding a
recombinant LAL, vectors and host cells including recombinant LALs,
and methods of using these nucleic acids, vectors, and host cells
in methods for the production of compounds (e.g., polyketides,
fatty acids, terpenoids, non-ribosomal polypeptides, .beta.-lactam
compounds, and alkaloids). Accordingly, in a first aspect, the
present disclosure provides a host cell (e.g., a host cell
naturally lacking an LAL and/or an LAL binding site) engineered to
express a recombinant LAL (e.g., a heterologous LAL). In some
embodiments, the LAL is constitutively active. In some embodiments,
the host cell is engineered by insertion of a LAL binding site in a
nucleic acid. In some embodiments, the binding of the recombinant
LAL to the LAL binding site promotes transcription of the nucleic
acid (e.g., a nucleic acid encoding a compound-producing protein
such as a polyketide synthase or a .beta.-lactam compound producing
protein). In some embodiments, the LAL binding site is heterologous
to the LAL. In some embodiments, the LAL binding site is endogenous
to the LAL. In some embodiments, the LAL binding site includes the
sequence GGGGGT.
In some embodiments, the host cell includes a nucleic acid
including a heterologous LAL binding site operably linked to an
open reading frame such that binding of an LAL to the heterologous
LAL binding site promotes expression of the open reading frame. In
some embodiments, the heterologous LAL binding site is a synthetic
LAL binding site. In some embodiments, the heterologous LAL binding
site promotes greater expression than the endogenous LAL binding
site operably linked to the open reading frame. In some
embodiments, the heterologous LAL binding site includes at least 8
contiguous nucleotides of
C.sub.1-T.sub.2-A.sub.3-G.sub.4-G.sub.5-G.sub.6-G.sub.7-G.sub.8-T.sub.9-T-
.sub.10-G.sub.11-C.sub.12 (SEQ ID NO: 2), wherein none or up to six
nucleotides other than any three nucleotides of G.sub.4, G.sub.5,
G.sub.6, G.sub.7, G.sub.8, T.sub.9, and T.sub.10 (e.g., G.sub.4,
G.sub.7, and T.sub.9; G.sub.5, G.sub.8, and T.sub.10; or G.sub.6,
G.sub.7, and G.sub.8) are replaced by any other nucleotide.
In some embodiments, the recombinant LAL includes a portion having
at least 70% (e.g., at least 75%, at least 80%, at least 85%, at
least 90%, at least 95%, at least 99%) sequence identity to the
sequence of SEQ ID NO: 1. In some embodiments, the recombinant LAL
includes a portion having the sequence of SEQ ID NO: 1. In some
embodiments, the recombinant LAL has the amino acid sequence of SEQ
ID NO: 1.
TABLE-US-00001 (SEQ ID NO: 1)
MPAVESYELDARDDELRRLEEAVGQAGNGRGVVVTITGPIACGKTELLDA
AAAKSDAITLRAVCSEEERALPYALIGQLIDNPAVASQLPDPVSMALPGE
HLSPEAENRLRGDLTRTLLALAAERPVLIGIDDMHHADTASLNCLLHLAR
RVGPARIAMVLTELRRLTPAHSQFHAELLSLGHHREIALRPLGPKHIAEL
ARAGLGPDVDEDVLTGLYRATGGNLNLGHGLIKDVREAWATGGTGINAGR
AYRLAYLGSLYRCGPVPLRVARVAAVLGQSANTTLVRWISGLNADAVGEA
TEILTEGGLLHDLRFPHPAARSVVLNDLSARERRRLHRSALEVLDDVPVE
VVAHHQAGAGFIHGPKAAEIFAKAGQELHVRGELDAASDYLQLAHHASDD
AVTRAALRVEAVAIERRRNPLASSRHLDELTVAARAGLLSLEHAALMIRW
LALGGRSGEAAEVLAAQRPRAVTDQDRAHLRAAEVSLALVSPGASGVSPG
ASGPDRRPRPLPPDELANLPKAARLCAIADNAVISALHGRPELASAEAEN
VLKQADSAADGATALSALTALLYAENTDTAQLWADKLVSETGASNEEEGA
GYAGPRAETALRRGDLAAAVEAGSAILDHRRGSLLGITAALPLSSAVAAA
IRLGETERAEKWLAEPLPEAIRDSLFGLHLLSARGQYCLATGRHESAYTA
FRTCGERMRNWGVDVPGLSLWRVDAAEALLHGRDRDEGRRLIDEQLTHAM
GPRSRALTLRVQAAYSPQAQRVDLLEEAADLLLSCNDQYERARVLADLSE
AFSALRHHSRARGLLRQARHLAAQCGATPLLRRLGAKPGGPGWLEESGLP
QRIKSLTDAERRVASLAAGGQTNRVIADQLFVTASTVEQHLTNVFRKLGV
KGRQHLPAELANAE.
In some embodiments, the host cell is a bacterium (e.g., an
actinobacterium such as Streptomyces ambofaciens, Streptomyces
hygroscopicus, or Streptomyces malayensis). In some embodiments,
the actinobaceterium is S1391, S1496, or S2441.
In some embodiments, the host cell has been modified to enhance
expression of a compound-producing protein (e.g., a polyketide
synthase or a .beta.-lactam compound producing protein). For
example, in some embodiments, the host cell has been modified to
enhance expression of a compound-producing protein (e.g., a
polyketide synthase or a .beta.-lactam compound producing protein)
by (i) deletion of an endogenous gene cluster which expresses a
compound-producing protein (e.g., a polyketide synthase or a
.beta.-lactam compound producing protein); (ii) insertion of a
heterologous gene cluster which expresses a compound-producing
protein (e.g., a polyketide synthase or a .beta.-lactam compound
producing protein); (iii) exposure of said host cell to an
antibiotic challenge; and/or (iv) introduction of a heterologous
promoter that results in at least a two-fold increase in expression
of a compound compared to the homologous promoter. An additional
method to enhance the expression of a compound (e.g., a polyketide
or a .beta.-lactam compound) is to optimize media conditions for
growth. This includes the specific chemical and nutrient
composition of the media, whether the fermentation is conducted in
liquid or solid media, the time course of the fermentation, and the
volume/scale of the fermentation run.
In another aspect, the disclosure provides a nucleic acid encoding
an LAL, wherein the LAL includes a portion having at least 70%
(e.g., at least 75%, at least 80%, at least 85%, at least 90%, at
least 95%, at least 99%) sequence identity to the amino acid
sequence of SEQ ID NO: 1. In some embodiments, the LAL includes a
portion having the sequence of SEQ ID NO: 1. In some embodiments,
the LAL has the sequence of SEQ ID NO: 1. In some embodiments, the
nucleic acid lacks a TTA regulatory codon in at least one open
reading frame.
In some embodiments, the nucleic acid further comprises an LAL
binding site, e.g., an LAL binding site having at least 80% (e.g.,
at least 85%, at least 90%, at least 95%, at least 99%) identity to
the sequence of SEQ ID NO: 2 (CTAGGGGGTTGC). In some embodiments,
the LAL binding site includes the sequence of SEQ ID NO: 2. In some
embodiments, the LAL binding site has the sequence of SEQ ID NO: 2.
In some embodiments, the LAL binding site includes the sequence SEQ
ID NO: 3 (GGGGGT).
In some embodiments, the nucleic acid further includes an open
reading frame positioned such that binding of the LAL to the LAL
binding site promotes expression of the open reading frame. In some
embodiments, the open reading frame encodes a compound-producing
protein (e.g., a polyketide synthase or a .beta.-lactam compound
producing protein).
In some embodiments, the open reading frame encodes a polyketide
synthase. In some embodiments, the nucleic acid further encodes a
nonribosomal peptide synthase. In some embodiments, the nucleic
acid further encodes a first P450 enzyme. In some embodiments, the
nucleic acid further encodes a second P450 enzyme.
In some embodiments, the open reading frame encodes a .beta.-lactam
compound producing protein. In some embodiments, the open reading
frame encodes two more (e.g., three or more, four or more, five or
more, six or more, seven or more, or eight or more) .beta.-lactam
compound producing proteins. In some embodiments, the nucleic acid
further encodes one or more tailoring proteins.
In another aspect, the disclosure provides an expression vector
including any of the foregoing nucleic acids. In some embodiments,
the expression vector is an artificial chromosome (e.g., a
bacterial artificial chromosome).
In another aspect, the disclosure provides a host cell including
any of the foregoing vectors.
In another aspect, the disclosure provides a method of producing a
compound (e.g., a polyketide, a fatty acid, a terpenoid, a
.beta.-lactam compound, a non-ribosomal polypeptide, or an
alkaloid). This method includes: (a) providing a host cell
engineered to express a recombinant LAL and including an LAL
binding site operably linked to an open reading frame such that
binding of the recombinant LAL to the LAL binding site promotes
expression of the open reading frame, wherein the host cell
includes a nucleic acid encoding a compound-producing protein
(e.g., polyketide synthase or a .beta.-lactam compound producing
protein); and (b) culturing the host cell under conditions suitable
to allow expression of a compound by the compound-producing protein
(e.g., polyketide synthase or a .beta.-lactam compound producing
protein); thereby producing a compound.
In another aspect, the disclosure provides a method of identifying
a synthetic LAL binding site, the method including: (a) providing a
plurality of synthetic nucleic acids including at least eight
nucleotides; (b) contacting one or more of the plurality of
nucleotides including at least eight nucleotides with one or more
LALs; (c) determining the binding affinity between a nucleic acid
of step (a) and an LAL of step (b), wherein a synthetic nucleic
acid is identified as a synthetic LAL binding site if the synthetic
binding site, when linked to a downstream gene, is capable of
inducing transcription of the linked gene, as measured by at least
a 2-fold increase in RNA transcription. In some embodiments,
wherein a synthetic nucleic acid is identified as a synthetic LAL
binding site if the affinity between the synthetic nucleic acid and
an LAL is less than 500 nM (e.g., less than 250 nm, less than 100
nM, less than 50 nM, less than 20 nM or between 1-50 nM, between
5-75 nM, between 50 and 100 nM, between 75 and 250 nM).
Definitions
The term "compound-producing protein," as used herein refers to a
protein such as a polyketide synthase that when expressed in a cell
under suitable conditions produces a small molecule (e.g., a
polyketide, a fatty acid, a terpenoid, a .beta.-lactam compound, a
non-ribosomal polypeptide, or an alkaloid)
A cell that is "engineered to contain" and/or "engineered to
express" refers to a cell that has been modified to contain and/or
express a protein that does not naturally occur in the cell. A cell
may be engineered to contain a protein, e.g., by introducing a
nucleic acid encoding the protein by introduction of a vector
including the nucleic acid.
The term "gene cluster that produces a small molecule," as used
herein refers to a cluster of genes which encodes one or more
compound-producing proteins.
The term "heterologous," as used herein, refers to a relationship
between two or more proteins, nucleic acids, compounds, and/or cell
that is not present in nature. For example, the LAL having the
sequence of SEQ ID NO: 1 is naturally occurring in the S18
Streptomyces strain and is thus homologous to that strain and would
thus be heterologous to the S12 Streptomyces strain.
The term "homologous," as used herein, refers to a relationship
between two or more proteins, nucleic acids, compounds, and/or
cells that is present naturally. For example, the LAL having the
sequence of SEQ ID NO: 1 is naturally occurring in the S18
Streptomyces strain and is thus homologous to that strain.
A "polyketide synthase" refers to an enzyme belonging to the family
of multi-domain enzymes capable of producing a polyketide. A
polyketide synthase may be expressed naturally in bacteria, fungi,
plants, or animals.
A ".beta.-lactam compound" refers to any compound having a
structure that includes a .beta.-lactam ring, including
.beta.-lactam antibiotics and .beta.-lactam inhibitors. The
structure of a .beta.-lactam ring is provided in Formula I.
##STR00001##
.beta.-lactam compounds of the invention are considered to include,
at least, 5-membered unsaturated .beta.-lactam compounds (e.g.,
carbapanems), 5-membered saturated .beta.-lactam compounds (e.g.,
penams, such as penicillin, and clavams, such as clavulanic acid),
monocyclic .beta.-lactam compounds (e.g., nocardicins and
monobactams) and 6-membered unsaturated .beta.-lactam compounds
(e.g., cephems, such as cephalosporin). Exemplary .beta.-lactam
compounds are described in Hamed, R. B., et al., The enzymes of
.beta.-lactam biosynthesis. Nat Prod Rep. 31(9):1127 (2014), the
compounds of which are incorporated herein by reference.
A ".beta.-lactam compound producing protein" refers to any protein
(e.g., enzyme) in a biosynthetic pathway that produces a
.beta.-lactam compound. .beta.-lactam compound producing enzymes
may be considered to include a protein that produces the
biosynthetic precursor to a .beta.-lactam ring (e.g., ACV
synthetase, carboxyethylarginine synthase), a protein that
catalyzes the formation of a beta lactam ring (e.g. isopenicillin N
synthetase, .beta.-lactam synthetase, CarA, CarB, CarC, or ThnM),
or any protein that modifies the .beta.-lactam ring (e.g., a
tailoring enzyme). Exemplary .beta.-lactam producing enzymes are
described in Hamed, R. B., et al., The enzymes of .beta.-lactam
biosynthesis. Nat Prod Rep. 31(9):1127 (2014), the enzymes of which
are incorporated herein by reference.
A ".beta.-lactam compound producing protein gene cluster" refers to
any gene cluster that encodes the production of a .beta.-lactam
compound producing protein. In some embodiments, .beta.-lactam
compound producing protein gene clusters of the invention may
encode a naturally-occurring .beta.-lactam compound. In other
embodiments, .beta.-lactam compound producing protein gene clusters
of the invention may encode an engineered variant of a
naturally-occurring .beta.-lactam compound.
The term "recombinant," as used herein, refers to a protein that is
produced using synthetic methods.
BRIEF DESCRIPTION OF THE DRAWINGS
FIGS. 1A-1C are diagrams showing a strategy for use of LAL
transcriptional regulators for general induction and overexpression
of biosynthetic loci. FIG. 1A shows the design for the X1
biosynthetic locus, including two bidirectional promoter regions
and an LAL-encoding gene. FIG. 1B shows a series of conserved
putative LAL binding domains extracted from FK cluster promoter
regions. FIG. 1C shows a scheme for phage-integrating constitutive
LAL construction.
FIG. 2 is a diagram showing LAL sequence analysis based on a
genomic database. The amino acid sequences of a series of FK LALs
were aligned and used to design a query for clading of the LALs.
Conserved residues in the designed query are indicated (*=100%
conserved in FK LALs; :=strongly similar residues; .=weakly similar
residues).
FIG. 3 is a cladogram showing that FkPhDs cluster together and are
distinct from other PKS-associated LALs, such as pikD.
FIG. 4 is a graph showing S22/LAL exconjugants assayed for
increased Compound 1, Compound 2, and Compound 3 production by
LC/MS.
FIG. 5 is a series of diagrams showing combined LAL and cyp
manipulations for increased production of Compound 1 and Compound 2
in S22.
FIG. 6 is a diagram showing a strategy for replacement of the X15
promoter with an X1 promoter and introduction of a heterologous
LAL-encoding locus.
FIG. 7 is a series of graphs showing that replacement of the X15
promoter with an X1 promoter and heterologous LAL expression leads
to biosynthetic production from the silent X15 cluster.
FIG. 8 is a diagram showing sequence analysis of various FK
bidirectional promoters. Rap and X1 promoters were associated with
good production. X11.1 and X22.1 promoters were associated with
impaired production. X15 and X23.1 promoters were silent.
Deviations from the consensus sequence correlated with reduced
molecule production.
FIG. 9 is a diagram showing X11.1 and X11.2 bidirectional promoter
engineering and sequence alignment of wild-type (i.e., X11.1 and
X11.2) and restored (i.e., Seq1, Seq2, and Seq3) LAL binding
sequences.
FIG. 10 is a series of graphs showing that restoration of sequence
lesions in the LAL sequences yields increased PKS production.
FIG. 11A is a diagram showing the dissection of the two promoter
regions in a biosynthetic locus used to create the four UniLAL
variants (PC.sub.L, PC.sub.R, PT.sub.L, and PT.sub.R).
FIG. 11B is a diagram showing the nucleic acid sequence engineering
strategy applied to generate the four UniLAL variants.
FIG. 12 is a graph showing the level of Compound 1, Compound 2,
Compound 3, and Compound 4 produced in an LAL-negative S22 control
and when one of each of the four UniLAL variants was subcloned in
front of the S18 LAL and used to drive PKS expression in S22.
FIG. 13 is a graph showing activation of polyketide production from
a trancsriptionally silent biosynthetic cluster that does not
naturally include an LAL regulator using a UniLAL.
FIG. 14 is a diagram showing the use of an LAL regulon to create a
positive feedback loop for overexpression from a biosynthetic
cluster.
FIG. 15 is a graph showing the coupled use of a positive feedback
loop and a constitutive S18 LAL.
FIG. 16 is a diagram showing knock in of the X1 promoter into a
FKPHD cluster in the endogenous locus for native strain
expression.
FIGS. 17A-B is a diagram showing the use of the pX1-S18 LAL system
to drive the overexpression of a novel .beta.-lactam gene cluster,
WAC292. FIG. 17A shows the design for the biosynthetic locus,
including three bidirectional X1 promoter regions (P2, P3, and P5)
inserted into the WAC292 .beta.-lactam gene cluster. FIG. 17B is a
table showing the normalized mRNA levels measured by NanoString
displayed as log 2 values. The NanoString analysis shows that
transcripts linked to the P2, P3, and P5 promoters were
significantly upregulated in WAC292-p2p3p5 as compared to
WAC292-WT.
DETAILED DESCRIPTION
The present inventors discovered the amino acid sequence within
helix 3 of the Helix-Turn-Helix DNA-binding motif of LALs
associated with known polyketide synthases is 100% conserved. As a
result of the conservation of helix 3 of the LALs, there are
predictable DNA sequence motifs including likely LAL binding sites
in the promoter-operator regions of genes that encode polyketide
synthases. The conservation of the LAL-DNA interaction motifs at
both the protein and DNA levels enables interchangeable use of the
LALs for the activation of transcription of natural product gene
clusters.
Compounds
Compounds that may be produced with the methods of the invention
include, but are not limited to, polyketides and polyketide
macrolide antibiotics such as erythromycin; hybrid
polyketides/non-ribosomal peptides such as rapamycin and FK506;
carbohydrates including aminoglycoside antibiotics such as
gentamicin, kanamycin, neomycin, tobramycin; benzofuranoids;
benzopyranoids; flavonoids; glycopeptides including vancomycin;
lipopeptides including daptomycin; tannins; lignans; polycyclic
aromatic natural products, terpenoids, steroids, sterols,
oxazolidinones including linezolid; amino acids, peptides and
peptide antibiotics including polymyxins, non-ribosomal peptides,
.beta.-lactam compounds including .beta.-lactam antibiotics and
.beta.-lactamase inhibitors (e.g., carbapenems, cephalosporins,
penicillins, clavulanic acid, monobactams, nocardicins, tabtoxins,
and conjugate .beta.-lactams); purines, pteridines, polypyrroles,
tetracyclines, quinolones and fluoroquinolones; and
sulfonamides.
Proteins
LALs
LALs include three domains, a nucleotide-binding domain, an
inducer-binding domain, and a DNA-binding domain. A defining
characteristic of the structural class of regulatory proteins that
include the LALs is the presence of the AAA+ ATPase domain.
Nucleotide hydrolysis is coupled to large conformational changes in
the proteins and/or multimerization, and nucleotide binding and
hydrolysis represents a "molecular timer" that controls the
activity of the LAL (e.g., the duration of the activity of the
LAL). The LAL is activated by binding of a small-molecule ligand to
the inducer binding site. In most cases the allosteric inducer of
the LAL is unknown. In the case of the related protein MalT, the
allosteric inducer is maltotriose. Possible inducers for LAL
proteins include small molecules found in the environment that
trigger compound (e.g., polyketide or a .beta.-lactam compound)
biosynthesis. The regulation of the LAL controls production of
compound-producing proteins (e.g., polyketide synthases or
.beta.-lactam compound producing proteins) resulting in activation
of compound (e.g., polyketide or a .beta.-lactam compound)
production in the presence of external environmental stimuli.
Therefore, there are gene clusters that produce small molecules
(e.g., PKS gene clusters or .beta.-lactam compound producing
protein gene clusters) which, while present in a strain, do not
produce compound either because (i) the LAL has not been activated,
(ii) the strain has LAL binding sites that differ from consensus,
(iii) the strain lacks an LAL regulator, or (iv) the LAL regulator
may be poorly expressed or not expressed under laboratory
conditions. Since the DNA binding region of the LALs of the known
PKS LALs are highly conserved, the known LALs may be used
interchangeably to activate PKS gene clusters and other compound
producing gene clusters, such as .beta.-lactam compound producing
protein gene clusters, other than those which they naturally
regulate. In some embodiments, the LAL is a fusion protein.
In some embodiments, an LAL may be modified to include a non-LAL
DNA-binding domain, thereby forming a fusion protein including an
LAL nucleotide-binding domain and a non-LAL DNA-binding domain. In
certain embodiments, the non-LAL DNA-binding domain is capable of
binding to a promoter including a protein-binding site positioned
such that binding of the DNA-binding domain to the protein-binding
site of the promoter promotes expression of a gene of interest
(e.g., a gene encoding a compound-producing protein, as described
herein). The non-LAL DNA binding domain may include any DNA binding
domain known in the art. In some instances, the non-LAL DNA binding
domain is a transcription factor DNA binding domain. Examples of
non-LAL DNA binding domains include, without limitation, a basic
helix-loop-helix (bHLH) domain, leucine zipper domain (e.g., a
basic leucine zipper domain), GCC box domain, helix-turn-helix
domain, homeodomain, srf-like domain, paired box domain, winged
helix domain, zinc finger domain, HMG-box domain, Wor3 domain,
OB-fold domain, immunoglobulin domain, B3 domain, TAL effector
domain, Cas9 DNA binding domain, GAL4 DNA binding domain, and any
other DNA binding domain known in the art. In some instances, the
promoter is positioned upstream to the gene of interest, such that
the fusion protein may bind to the promoter and induce or inhibit
expression of the gene of interest. In certain instances, the
promoter is a heterologous promoter introduced to the nucleic acid
(e.g., a chromosome, plasmid, fosmid, or any other nucleic acid
construct known in the art) containing the gene of interest. In
other instances, the promoter is a pre-existing promoter positioned
upstream to the gene of interest. The protein-binding site within
the promoter may, for example, be a non-LAL protein-binding site.
In certain embodiments, the protein-binding site binds to the
non-LAL DNA binding domain, thereby forming a cognate DNA binding
domain/protein-binding site pair.
In some embodiments, the LAL is encoded by a nucleic acid having at
least 70% (e.g., at least 75%, at least 80%, at least 85%, at least
90%, at least 95%, at least 99%) sequence identity to any one of
SEQ ID Nos: 4-25 or has a sequences with at least 70% (e.g., at
least 75%, at least 80%, at least 85%, at least 90%, at least 95%,
at least 99%) sequence identity to any one of SEQ ID Nos:
26-36.
TABLE-US-00002 SEQ ID NO: 4:
ATGCCTGCCGTGGAGTGCTATGAACTGGACGCCCGCGATGACGAGCTCAGAAAACTGGAGGAGGTTGTGAC
CGGGCGGGCCAACGGCCGGGGTGTGGTGGTCACCATCACCGGACCGATCGCCTGCGGCAAGACCGAACTGC
TCGACGCAGCCGCCGCGAAGGCCGACGCCATCACGTTACGAGCGGTCTGCTCCGCGGAGGAACAGGCACTC
CCGTACGCCCTGATCGGGCAGCTCATCGACAACCCGGCGCTCGCCTCCCACGCGCTGGAGCCGGCCTGCCC
GACCCTCCCGGGCGAGCACCTGTCGCCGGAGGCCGAGAACCGGCTGCGCAGCGACCTCACCCGTACCCTGC
TGGCGCTCGCCGCCGAACGGCCGGTGCTGATCGGCATCGACGAGTCACACGCGAACGCTTTGTGTCTGCTC
CACCTGGCCCGAAGGGTCGGCTCGGCCCGGATCGCCATGGTCCTCACCGAGTTGCGCCGGCTCACCCCGGC
CCACTCACAGTTCCAGGCCGAGCTGCTCAGCCTGGGGCACCACCGCGAGATCGCGCTGCGCCCGCTCAGCC
CGAAGCACACCGCCGAGCTGGTCCGCGCCGGTCTCGGTCCCGACGTCGACGAGGACGTGCTCACGGGGTTG
TACCGGGCGACCGGCGGCAACCTGAACCTCACCCGCGGACTGATCAACGATGTGCGGGAGGCCTGGGAGAC
GGGAGGGACGGGCATCAGCGCGGGCCGCGCGTACCGGCTGGCATACCTCGGTTCCCTCTACCGCTGCGGCC
CGGTCCCGTTGCGGGTCGCACGGGTGGCCGCCGTGCTGGGCCAGAGCGCCAACACCACCCTGGTGCGCTGG
ATCAGCGGGCTCAACGCGGACGCGGTGGGCGAGGCAACCGAGATCCTCACCGAAGGCGGCCTGCTGCACGA
CCTGCGGTTCCCGCACCCGGCGGCCCGTTCGGTGGTACTCAACGACATGTCCGCCCAGGAACGACGCCGCC
TGCACCGGTCCGCTCTGGAAGTGCTGGACGACGTGCCCGTGGAAGTGGTCGCGCACCACCAGGTCGGCGCC
GGTCTCCTGCACGGCCCGAAGGCCGCCGAGATATTCGCCAAGGCCGGCCAGGAGCTGCATGTGCGCGGCGA
GTTGGACACCGCGTCCGACTATCTGCAACTGGCCCACCAGGCCTCCGACGACGCCGTCACCGGGATGCGGG
CCGAGGCCGTGGCGATCGAGCGCCGCCGCAACCCGCTGGCCTCGAGCCGGCACCTCGACGAGCTGACCGTC
GTCGCCCGTGCCGGGCTGCTCTTCCCCGAGCACACGGCGCTGATGATCCGCTGGCTGGGCGTCGGCGGGCG
GTCCGGCGAGGCAGCCGGGCTGCTGGCCTCGCAGCGCCCCCGTGCGGTCACCGACCAGGACAGGGCCCATA
TGCGGGCCGCCGAGGTATCGCTCGCGCTGGTCAGCCCCGGCACGTCCGGCCCGGACCGGCGGCCGCGTCCG
CTCACGCCGGATGAGCTCGCGAACCTGCCGAAGGCGGCCCGGCTCTGCGCGATCGCCGACAATGCCGTCAT
GTCGGCCCTGCGCGGTCGTCCCGAGCTCGCCGCGGCCGAGGCGGAGAACGTCCTGCAGCACGCCGACTCGG
CGGCGGCCGGCACCACCGCCCTCGCCGCGCTGACCGCCTTGCTGTACGCGGAGAACACCGACACCGCTCAG
CTCTGGGCCGACAAGCTGGTCTCCGAGACCGGGGCGTCGAACGAGGAGGAGGCGGGCTACGCGGGGCCGCG
CGCCGAAGCCGCGTTGCGTCGCGGCGACCTGGCCGCGGCGGTCGAGGCAGGCAGCACCGTTCTGGACCACC
GGCGGCTCTCGACGCTCGGCATCACCGCCGCGCTACCGCTGAGCAGCGCGGTGGCCGCCGCCATCCGGCTG
GGCGAGACCGAGCGGGCGGAGAAGTGGCTCGCCCAGCCGCTGCCGCAGGCCATCCAGGACGGCCTGTTCGG
CCTGCACCTGCTCTCGGCGCGCGGCCAGTACAGCCTCGCCACGGGCCAGCACGAGTCGGCGTACACGGCGT
TTCGCACCTGCGGGGAACGTATGCGGAACTGGGGCGTTGACGTGCCGGGTCTGTCCCTGTGGCGCGTCGAC
GCCGCCGAGGCGCTGCTGCACGGCCGCGACCGGGACGAGGGCCGACGGCTCGTCGACGAGCAACTCACCCG
TGCGATGGGACCCCGTTCCCGCGCCTTGACGCTGCGGGTGCAGGCGGCGTACAGCCCGCCGGCGAAGCGGG
TCGACCTGCTCGATGAAGCGGCCGACCTGCTGCTCTCCTGCAACGACCAGTACGAGCGGGCACGGGTGCTC
GCCGACCTGAGCGAGACGTTCAGCGCGCTCCGGCACCACAGCCGGGCGCGGGGACTGCTTCGGCAGGCCCG
GCACCTGGCCGCCCAGCGCGGCGCGATACCGCTGCTGCGCCGACTCGGGGCCAAGCCCGGAGGCCCCGGCT
GGCTGGAGGAATCCGGCCTGCCGCAGCGGATCAAGTCGCTGACCGACGCGGAGCGGCGGGTGGCGTCGCTG
GCCGCCGGCGGACAGACCAACCGCGTGATCGCCGACCAGCTCTTCGTCACGGCCAGCACGGTGGAGCAGCA
CCTCACGGACGTCTCCACTGGGTCAAGGCCGCCAGCACCTGCCGCCGAACTCGTCTAG SEQ ID
NO: 5
ATGCCTGCCGTGGAGTGCTATGAACTGGACGCCCGCGATGACGAGCTCAGAAAACTGGAGGAGGTTGTGAC
CGGGCGGGCCAACGGCCGGGGTGTGGTGGTCACCATCACCGGACCGATCGCCTGCGGCAAGACCGAACTGC
TCGACGCAGCCGCCGCGAAGGCCGACGCCATCACGCTGCGAGCGGTCTGCTCCGCGGAGGAACAGGCACTC
CCGTACGCCCTGATCGGGCAGCTCATCGACAACCCGGCGCTCGCCTCCCACGCGCTGGAGCCGGCCTGCCC
GACCCTCCCGGGCGAGCACCTGTCGCCGGAGGCCGAGAACCGGCTGCGCAGCGACCTCACCCGTACCCTGC
TGGCGCTCGCCGCCGAACGGCCGGTGCTGATCGGCATCGACGAGTCACACGCGAACGCTTTGTGTCTGCTC
CACCTGGCCCGAAGGGTCGGCTCGGCCCGGATCGCCATGGTCCTCACCGAGTTGCGCCGGCTCACCCCGGC
CCACTCACAGTTCCAGGCCGAGCTGCTCAGCCTGGGGCACCACCGCGAGATCGCGCTGCGCCCGCTCAGCC
CGAAGCACACCGCCGAGCTGGTCCGCGCCGGTCTCGGTCCCGACGTCGACGAGGACGTGCTCACGGGGTTG
TACCGGGCGACCGGCGGCAACCTGAACCTCACCCGCGGACTGATCAACGATGTGCGGGAGGCCTGGGAGAC
GGGAGGGACGGGCATCAGCGCGGGCCGCGCGTACCGGCTGGCATACCTCGGTTCCCTCTACCGCTGCGGCC
CGGTCCCGTTGCGGGTCGCACGGGTGGCCGCCGTGCTGGGCCAGAGCGCCAACACCACCCTGGTGCGCTGG
ATCAGCGGGCTCAACGCGGACGCGGTGGGCGAGGCAACCGAGATCCTCACCGAAGGCGGCCTGCTGCACGA
CCTGCGGTTCCCGCACCCGGCGGCCCGTTCGGTGGTACTCAACGACATGTCCGCCCAGGAACGACGCCGCC
TGCACCGGTCCGCTCTGGAAGTGCTGGACGACGTGCCCGTGGAAGTGGTCGCGCACCACCAGGTCGGCGCC
GGTCTCCTGCACGGCCCGAAGGCCGCCGAGATATTCGCCAAGGCCGGCCAGGAGCTGCATGTGCGCGGCGA
GTTGGACACCGCGTCCGACTATCTGCAACTGGCCCACCAGGCCTCCGACGACGCCGTCACCGGGATGCGGG
CCGAGGCCGTGGCGATCGAGCGCCGCCGCAACCCGCTGGCCTCGAGCCGGCACCTCGACGAGCTGACCGTC
GTCGCCCGTGCCGGGCTGCTCTTCCCCGAGCACACGGCGCTGATGATCCGCTGGCTGGGCGTCGGCGGGCG
GTCCGGCGAGGCAGCCGGGCTGCTGGCCTCGCAGCGCCCCCGTGCGGTCACCGACCAGGACAGGGCCCATA
TGCGGGCCGCCGAGGTATCGCTCGCGCTGGTCAGCCCCGGCACGTCCGGCCCGGACCGGCGGCCGCGTCCG
CTCACGCCGGATGAGCTCGCGAACCTGCCGAAGGCGGCCCGGCTCTGCGCGATCGCCGACAATGCCGTCAT
GTCGGCCCTGCGCGGTCGTCCCGAGCTCGCCGCGGCCGAGGCGGAGAACGTCCTGCAGCACGCCGACTCGG
CGGCGGCCGGCACCACCGCCCTCGCCGCGCTGACCGCCTTGCTGTACGCGGAGAACACCGACACCGCTCAG
CTCTGGGCCGACAAGCTGGTCTCCGAGACCGGGGCGTCGAACGAGGAGGAGGCGGGCTACGCGGGGCCGCG
CGCCGAAGCCGCGTTGCGTCGCGGCGACCTGGCCGCGGCGGTCGAGGCAGGCAGCACCGTTCTGGACCACC
GGCGGCTCTCGACGCTCGGCATCACCGCCGCGCTACCGCTGAGCAGCGCGGTGGCCGCCGCCATCCGGCTG
GGCGAGACCGAGCGGGCGGAGAAGTGGCTCGCCCAGCCGCTGCCGCAGGCCATCCAGGACGGCCTGTTCGG
CCTGCACCTGCTCTCGGCGCGCGGCCAGTACAGCCTCGCCACGGGCCAGCACGAGTCGGCGTACACGGCGT
TTCGCACCTGCGGGGAACGTATGCGGAACTGGGGCGTTGACGTGCCGGGTCTGTCCCTGTGGCGCGTCGAC
GCCGCCGAGGCGCTGCTGCACGGCCGCGACCGGGACGAGGGCCGACGGCTCGTCGACGAGCAACTCACCCG
TGCGATGGGACCCCGTTCCCGCGCCTTGACGCTGCGGGTGCAGGCGGCGTACAGCCCGCCGGCGAAGCGGG
TCGACCTGCTCGATGAAGCGGCCGACCTGCTGCTCTCCTGCAACGACCAGTACGAGCGGGCACGGGTGCTC
GCCGACCTGAGCGAGACGTTCAGCGCGCTCCGGCACCACAGCCGGGCGCGGGGACTGCTTCGGCAGGCCCG
GCACCTGGCCGCCCAGCGCGGCGCGATACCGCTGCTGCGCCGACTCGGGGCCAAGCCCGGAGGCCCCGGCT
GGCTGGAGGAATCCGGCCTGCCGCAGCGGATCAAGTCGCTGACCGACGCGGAGCGGCGGGTGGCGTCGCTG
GCCGCCGGCGGACAGACCAACCGCGTGATCGCCGACCAGCTCTTCGTCACGGCCAGCACGGTGGAGCAGCA
CCTCACGGACGTCTCCACTGGGTCAAGGCCGCCAGCACCTGCCGCCGAACTCGTCTAG SEQ ID
NO: 6
GTGGTTCCTGAAGTGCGAGCAGCCCCCGACGAACTGATCGCCCGCGATGACGAGCTGAGCCGCCTCCAACG
GGCACTCACCAGGGCGGGGAGCGGAAGGGGCGGCGTCGTCGCCATCACCGGGCCCATCGCCAGCGGAAAGA
CGGCGCTGCTCGACGCCGGAGCGGCCAAGTCCGGCTTCGTCGCACTCCGTGCGGTGTGCTCCTGGGAAGAG
CGCACTCTGCCGTACGGGATGCTGGGCCAGCTCTTCGACCATCCCGAACTGGCCGCCCAGGCGCCGGACCT
TGCCCACTTCACGGCTTCGTGCGAGAGCCCTCAGGCCGGTACCGACAACCGCCTGCGGGCCGAGTTCACCC
GCACCCTGCTGGCGCTCGCCGCGGACTGGCCCGTCCTGATCGGCATCGACGACGTGCACCACGCCGACGCG
GAATCACTGCGCTGTCTGCTCCACCTCGCCCGCCGCATCGGCCCGGCCCGCATCGCGGTCGTACTGACCGA
GCTGCGCAGACCGACGCCCGCCGACTCCCGCTTCCAGGCGGAACTGCTGAGCCTGCGCTCCTACCAGGAGA
TCGCGCTCAGACCGCTCACCGAGGCGCAGACCGGCGAACTCGTACGTCGGCACCTCGGCGCGGAGACCCAC
GAGGACGTCTCCGCCGATACGTTCCGGGCGACCGGCGGGAACCTGCTCCTCGGGCACGGTTTGATCAATGA
CATCCGGGAGGCGCGGACAGCGGGACGGCCGGGGGTCGTCGCGGGGCGGGCGTACCGGCTCGCGTACCTCA
GCTCGCTCTACCGCTGCGGCCCGAGCGCGCTGCGTGTCGCCCGGGCGTCCGCCGTGCTCGGCGCGAGCGCC
GAAGCCGTGCTCGTCCAGCGGATGACCGGACTGAACAAGGACGCGGTCGAACAGGTCTATGAGCAGCTGAA
CGAGGGACGGCTGCTGCAGGGCGAGCGGTTTCCGCACCCGGCGGCCCGCTCCATCGTCCTTGACGACCTGT
CGGCCCTGGAACGCAGAAACCTGCACGAGTCGGCGCTGGAGCTGCTGCGGGACCACGGCGTGGCCGGCAAC
GTGCTCGCCCGCCACCAGATCGGCGCCGGCCGGGTGCACGGCGAGGAGGCCGTCGAGCTGTTCACCGGGGC
CGCACGGGAGCACCACCTGCGCGGTGAACTGGACGACGCGGCCGGATACCTGGAACTCGCCCACCGTGCCT
CCGACGACCCCGTCACGCGCGCCGCACTACGCGTCGGCGCCGCCGCGATCGAGCGCCTCTGCAATCCGGTA
CGGGCAGGCCGGCATCTGCCCGAGCTGCTCACCGCGTCGCGCGCGGGACTGCTCTCCAGCGAGCACGCCGT
GTCGCTCGCCGACTGGCTGGCGATGGGCGGGCGCCCGGGCGAGGCGGCCGAGGTCCTCGCGACGCAGCGTC
CCGCGGCCGACAGCGAGCAGCACCGCGCACTCCTGCGCAGCGGCGAGTTGTCCCTCGCGCTGGTCCACCCC
GGCGCGTGGGATCCGTTGCGCCGGACCGATCGGTTCGCCGCGGGCGGGCTCGGCTCGCTTCCCGGACCCGC
CCGGCACCGCGCGGTCGCCGACCAAGCCGTCATCGCGGCGCTGCGTGGACGTCTCGACCGGGCGGACGCCA
ACGCGGAGAGCGTTCTCCAGCACACCGACGCCACGGCGGACCGGACCACGGCCATCATGGCGTTGCTGGCC
CTGCTCTACGCGGAGAACACCGATGCTGTCCAGTTCTGGGTCGACAAACTGGCCGGTGACGAGGGCACCAG
GACACCGGCCGACGAGGCGGTCCACGCGGGGTTCAACGCCGAGATCGCGCTGCGCCGCGGCGACTTGATGA
GAGCCGTCGAGTACGGCGAGGCAGCGCTCGGCCACCGGCACCTGCCCACCTGGGGAATGGCCGCCGCTCTG
CCGCTGAGCAGCACCGTGGTTGCCGCGATCCGGCTCGGCGACCTCGACAGGGCCGAGCGGTGGCTCGCCGA
GCCGCTGCCGCAGCAGACGCCGGAGAGCCTCTTCGGGCTGCACCTGCTCTGGGCCCGCGGGCAGCACCACC
TCGCGACCGGGCGGCACGGGGCGGCGTACACGGCGTTCAGGGAATGCGGCGAGCGGATGCGGCGGTGGGCC
GTCGACGTGCCGGGCCTGGCCCTGTGGCGGGTCGACGCCGCCGAATCGCTGCTGCTGCTCGGCCGTGACCG
TGCCGAAGGACTGCGGCTCGTCTCCGAGCAGCTGTCCCGGCCGATGCGCCCTCGCGCGCGCGTGCAGACGT
TACGGGTACAGGCGGCCTACAGTCCGCCGCCCCAACGGATCGACCTGCTCGAAGAGGCCGCCGACCTGCTG
GTCACCTGCAACGACCAGTACGAACTGGCAAACGTACTCAGCGACTTGGCAGAGGCCTCCAGCATGGTCCG
GCAGCACAGCAGGGCGCGGGGTCTGCTCCGCCGGGCACGGCACCTCGCCACCCAGTGCGGCGCCGTGCCGC
TCCTGCGGCGGCTCGGCGCGGAACCCTCGGACATCGGCGGAGCCTGGGACGCGACGCTGGGACAGCGGATC
GCGTCACTGACGGAGTCGGAGCGGCGGGTGGCCGCGCTCGCCGCGGTCGGGCGTACGAACAGGGAGATCGC
CGAGCAGCTGTTCGTCACGGCCAGCACGGTGGAACAGCACCTCACGAACGTGTTCCGCAAACTGGCGGTGA
AGGGCCGCCAGCAGCTTCCGAAGGAACTGGCCGACGTCGGCGAGCCGGCGGACCGCGACCGCCGGTGCGGG
TAG SEQ ID NO: 7
ATGGTTCCTGAAGTGCGAGCAGCCCCCGACGAACTGATCGCCCGCGATGACGAGCTGAGCCGCCTCCAACG
GGCACTCACCAGGGCGGGGAGCGGAAGGGGCGGCGTCGTCGCCATCACCGGGCCCATCGCCAGCGGAAAGA
CGGCGCTGCTCGACGCCGGAGCGGCCAAGTCCGGCTTCGTCGCACTCCGTGCGGTGTGCTCCTGGGAAGAG
CGCACTCTGCCGTACGGGATGCTGGGCCAGCTCTTCGACCATCCCGAACTGGCCGCCCAGGCGCCGGACCT
TGCCCACTTCACGGCTTCGTGCGAGAGCCCTCAGGCCGGTACCGACAACCGCCTGCGGGCCGAGTTCACCC
GCACCCTGCTGGCGCTCGCCGCGGACTGGCCCGTCCTGATCGGCATCGACGACGTGCACCACGCCGACGCG
GAATCACTGCGCTGTCTGCTCCACCTCGCCCGCCGCATCGGCCCGGCCCGCATCGCGGTCGTACTGACCGA
GCTGCGCAGACCGACGCCCGCCGACTCCCGCTTCCAGGCGGAACTGCTGAGCCTGCGCTCCTACCAGGAGA
TCGCGCTCAGACCGCTCACCGAGGCGCAGACCGGCGAACTCGTACGTCGGCACCTCGGCGCGGAGACCCAC
GAGGACGTCTCCGCCGATACGTTCCGGGCGACCGGCGGGAACCTGCTCCTCGGGCACGGTTTGATCAATGA
CATCCGGGAGGCGCGGACAGCGGGACGGCCGGGGGTCGTCGCGGGGCGGGCGTACCGGCTCGCGTACCTCA
GCTCGCTCTACCGCTGCGGCCCGAGCGCGCTGCGTGTCGCCCGGGCGTCCGCCGTGCTCGGCGCGAGCGCC
GAAGCCGTGCTCGTCCAGCGGATGACCGGACTGAACAAGGACGCGGTCGAACAGGTCTATGAGCAGCTGAA
CGAGGGACGGCTGCTGCAGGGCGAGCGGTTTCCGCACCCGGCGGCCCGCTCCATCGTCCTTGACGACCTGT
CGGCCCTGGAACGCAGAAACCTGCACGAGTCGGCGCTGGAGCTGCTGCGGGACCACGGCGTGGCCGGCAAC
GTGCTCGCCCGCCACCAGATCGGCGCCGGCCGGGTGCACGGCGAGGAGGCCGTCGAGCTGTTCACCGGGGC
CGCACGGGAGCACCACCTGCGCGGTGAACTGGACGACGCGGCCGGATACCTGGAACTCGCCCACCGTGCCT
CCGACGACCCCGTCACGCGCGCCGCACTACGCGTCGGCGCCGCCGCGATCGAGCGCCTCTGCAATCCGGTA
CGGGCAGGCCGGCATCTGCCCGAGCTGCTCACCGCGTCGCGCGCGGGACTGCTCTCCAGCGAGCACGCCGT
GTCGCTCGCCGACTGGCTGGCGATGGGCGGGCGCCCGGGCGAGGCGGCCGAGGTCCTCGCGACGCAGCGTC
CCGCGGCCGACAGCGAGCAGCACCGCGCACTCCTGCGCAGCGGCGAGTTGTCCCTCGCGCTGGTCCACCCC
GGCGCGTGGGATCCGTTGCGCCGGACCGATCGGTTCGCCGCGGGCGGGCTCGGCTCGCTTCCCGGACCCGC
CCGGCACCGCGCGGTCGCCGACCAAGCCGTCATCGCGGCGCTGCGTGGACGTCTCGACCGGGCGGACGCCA
ACGCGGAGAGCGTTCTCCAGCACACCGACGCCACGGCGGACCGGACCACGGCCATCATGGCGTTGCTGGCC
CTGCTCTACGCGGAGAACACCGATGCTGTCCAGTTCTGGGTCGACAAACTGGCCGGTGACGAGGGCACCAG
GACACCGGCCGACGAGGCGGTCCACGCGGGGTTCAACGCCGAGATCGCGCTGCGCCGCGGCGACTTGATGA
GAGCCGTCGAGTACGGCGAGGCAGCGCTCGGCCACCGGCACCTGCCCACCTGGGGAATGGCCGCCGCTCTG
CCGCTGAGCAGCACCGTGGTTGCCGCGATCCGGCTCGGCGACCTCGACAGGGCCGAGCGGTGGCTCGCCGA
GCCGCTGCCGCAGCAGACGCCGGAGAGCCTCTTCGGGCTGCACCTGCTCTGGGCCCGCGGGCAGCACCACC
TCGCGACCGGGCGGCACGGGGCGGCGTACACGGCGTTCAGGGAATGCGGCGAGCGGATGCGGCGGTGGGCC
GTCGACGTGCCGGGCCTGGCCCTGTGGCGGGTCGACGCCGCCGAATCGCTGCTGCTGCTCGGCCGTGACCG
TGCCGAAGGACTGCGGCTCGTCTCCGAGCAGCTGTCCCGGCCGATGCGCCCTCGCGCGCGCGTGCAGACGC
TGCGGGTACAGGCGGCCTACAGTCCGCCGCCCCAACGGATCGACCTGCTCGAAGAGGCCGCCGACCTGCTG
GTCACCTGCAACGACCAGTACGAACTGGCAAACGTACTCAGCGACTTGGCAGAGGCCTCCAGCATGGTCCG
GCAGCACAGCAGGGCGCGGGGTCTGCTCCGCCGGGCACGGCACCTCGCCACCCAGTGCGGCGCCGTGCCGC
TCCTGCGGCGGCTCGGCGCGGAACCCTCGGACATCGGCGGAGCCTGGGACGCGACGCTGGGACAGCGGATC
GCGTCACTGACGGAGTCGGAGCGGCGGGTGGCCGCGCTCGCCGCGGTCGGGCGTACGAACAGGGAGATCGC
CGAGCAGCTGTTCGTCACGGCCAGCACGGTGGAACAGCACCTCACGAACGTGTTCCGCAAACTGGCGGTGA
AGGGCCGCCAGCAGCTTCCGAAGGAACTGGCCGACGTCGGCGAGCCGGCGGACCGCGACCGCCGGTGCGGG
TAG SEQ ID NO: 8
GTGATAGCGCGCTTATCTCCCCCAGACCTGATCGCCCGCGATGACGAGTTCGGTTCCCTCCACCGGGCGCT
CACCCGAGCGGGGGGCGGGCGGGGCGTCGTCGCCGCCGTCACCGGGCCGATCGCCTGCGGCAAGACCGAAC
TCCTCGACGCCGCCGCGGCCAAGGCCGGCTTCGTCACCCTTCGCGCGGTGTGCTCCATGGAGGAGCGGGCC
CTGCCGTACGGCATGCTCGGCCAGCTCCTCGACCAGCCCGAGCTGGCCGCCCGGACACCGGAGCTGGTCCG
GCTGACGGCATCGTGCGAAAACCTGCCGGCCGACGTCGACAACCGCCTGGGGACCGAACTCACCCGCACGG
TGCTGACGCTCGCCGCGGAGCGGCCCGTACTGATCGGCATCGACGACGTGCACCACGCCGACGCGCCGTCG
CTGCGCTGCCTGCTCCACCTCGCGCGCCGCATCAGCCGGGCCCGTGTCGCCATCGTGCTGACCGAGCTGCT
CCGGCCGACGCCCGCCCACTCCCAATTCCGGGCGGCACTGCTGAGTCTGCGCCACTACCAGGAGATCGCGC
TGCGCCCGCTCACCGAGGCGCAGACCACCGAACTCGTGCGCCGGCACCTCGGCCAGGACGCGCACGACGAC
GTGGTGGCCCAGGCGTTCCGGGCGACCGGCGGCAACCTGCTCCTCGGCCACGGCCTGATCGACGACATCCG
GGAGGCACGGACACGGACCTCAGGGTGCCTGGAAGTGGTCGCGGGGCGGGCGTACCGGCTCGCCTACCTCG
GGTCGCTCTATCGTTGCGGCCCGGCCGCGCTGAGCGTCGCCCGAGCTTCCGCCGTGCTCGGCGAGAGTGTC
GAACTCACCCTCGTCCAGCGGATGACCGGCCTCGACACCGAGGCGGTCGAGCAGGCCCACGAACAGCTGGT
CGAGGGGCGGCTGCTGCGGGAAGGGCGGTTCCCGCACCCCGCGGCCCGCTCCGTCGTACTCGACGACCTCT
CCGCCGCCGAGCGGCGTGGCCTGCACGAGCTGGCGCTGGAACTGCTGCGGGACCGCGGCGTGGCCAGCAAG
GTGCTCGCCCGCCACCAGATGGGTACCGGCCGGGTGCACGGCGCCGAGGTCGCCGGGCTGTTCACCGACGC
CGCGCGCGAGCACCACCTGCGCGGCGAGCTCGACGAGGCCGTCACCTACCTGGAGTTCGCCTACCGGGCCT
CCGACGACCCCGCCGTCCACGCCGCACTGCGCGTCGACACCGCCGCCATCGAGCGGCTCTGCGATCCCGCC
AGATCCGGCCGGCATGTGCCCGAGCTGCTCACCGCGTCGCGGGAACGGCTCCTCTCCAGCGAGCACGCCGT
GTCGCTCGCCTGCTGGCTGGCGATGGACGGGCGGCCGGGCGAGGCCGCCGAGGTCCTGGCGGCCCAGCGCT
CCGCCGCCCCGAGCGAGCAGGGCCGGGCGCACCTGCGCGTCGCGGACCTGTCCCTCGCGCTGATCTATCCC
GGCGCGGCCGATCCGCCGCGTCCGGCCGATCCGCCGGCCGAGGACGAGGTCGCCTCGTTTTCCGGAGCCGT
CCGGCACCGCGCCGTCGCCGACAAGGCCCTGAGCAACGCGCTGCGCGGCTGGTCCGAACAGGCCGAGGCCA
AAGCCGAGTACGTGCTCCAGCACTCCCGGGTCACGACGGACCGGACCACGACCATGATGGCGTTGCTGGCC
CTGCTCTACGCCGAGGACACCGATGCCGTCCAGTCCTGGGTCGACAAGCTGGCCGGTGACGACAACATGCG
GACCCCGGCCGACGAGGCGGTCCACGCGGGGTTCCGCGCCGAGGCCGCGCTGCGCCGCGGCGACCTGACCG
CCGCCGTCGAATGCGGCGAGGCCGCGCTCGCCCCCCGGGTCGTGCCCTCCTGGGGGATGGCCGCCGCATTG
CCGCTGAGCAGCACCGTGGCCGCCGCGATCCGACTGGGCGACCTGGACCGGGCGGAGCGGTGGCTCGCCGA
GCCGTTGCCGGAGGAGACCTCCGACAGCCTCTTCGGACTGCACATGGTCTGGGCCCGTGGGCAACACCATC
TCGCGGCCGGGCGGTACCGGGCGGCGTACAACGCGTTCCGGGACTGCGGGGAGCGGATGCGACGCTGGTCC
GTCGACGTGCCGGGCCTGGCCCTGTGGCGGGTCGACGCCGCCGAAGCGCTTCTGCTGCTCGGCCGCGGCCG
TGACGAGGGGCTGAGGCTCATCTCCGAGCAGCTGTCCCGGCCGATGGGGTCCCGGGCGCGGGTGATGACGC
TGCGGGTGCAGGCGGCCTACAGTCCGCCGGCCAAGCGGATCGAACTGCTCGACGAGGCCGCCGATCTGCTC
ATCATGTGCCGCGACCAGTACGAGCTGGCCCGCGTCCTCGCCGACATGGGCGAAGCGTGCGGCATGCTCCG
GCGGCACAGCCGTGCGCGGGGACTGTTCCGCCGCGCACGGCACCTCGCGACCCAGTGCGGAGCCGTGCCGC
TCCTCCGGCGGCTCGGTGGGGAGTCCTCGGACGCGGACGGCACCCAGGACGTGACGCCGGCGCAGCGGATC
ACATCGCTGACCGAGGCGGAGCGGCGGGTGGCGTCGCACGCCGCGGTCGGGCGCACCAACAAGGAGATCGC
CAGCCAGCTGTTCGTCACCTCCAGCACGGTGGAACAGCACCTCACCAACGTGTTCCGCAAGCTGGGGGTGA
AGGGCCGTCAGCAACTGCCCAAGGAACTGTCCGACGCCGGCTGA SEQ ID NO: 9
ATGATAGCGCGCCTGTCTCCCCCAGACCTGATCGCCCGCGATGACGAGTTCGGTTCCCTCCACCGGGCGCT
CACCCGAGCGGGGGGCGGGCGGGGCGTCGTCGCCGCCGTCACCGGGCCGATCGCCTGCGGCAAGACCGAAC
TCCTCGACGCCGCCGCGGCCAAGGCCGGCTTCGTCACCCTTCGCGCGGTGTGCTCCATGGAGGAGCGGGCC
CTGCCGTACGGCATGCTCGGCCAGCTCCTCGACCAGCCCGAGCTGGCCGCCCGGACACCGGAGCTGGTCCG
GCTGACGGCATCGTGCGAAAACCTGCCGGCCGACGTCGACAACCGCCTGGGGACCGAACTCACCCGCACGG
TGCTGACGCTCGCCGCGGAGCGGCCCGTACTGATCGGCATCGACGACGTGCACCACGCCGACGCGCCGTCG
CTGCGCTGCCTGCTCCACCTCGCGCGCCGCATCAGCCGGGCCCGTGTCGCCATCGTGCTGACCGAGCTGCT
CCGGCCGACGCCCGCCCACTCCCAATTCCGGGCGGCACTGCTGAGTCTGCGCCACTACCAGGAGATCGCGC
TGCGCCCGCTCACCGAGGCGCAGACCACCGAACTCGTGCGCCGGCACCTCGGCCAGGACGCGCACGACGAC
GTGGTGGCCCAGGCGTTCCGGGCGACCGGCGGCAACCTGCTCCTCGGCCACGGCCTGATCGACGACATCCG
GGAGGCACGGACACGGACCTCAGGGTGCCTGGAAGTGGTCGCGGGGCGGGCGTACCGGCTCGCCTACCTCG
GGTCGCTCTATCGTTGCGGCCCGGCCGCGCTGAGCGTCGCCCGAGCTTCCGCCGTGCTCGGCGAGAGTGTC
GAACTCACCCTCGTCCAGCGGATGACCGGCCTCGACACCGAGGCGGTCGAGCAGGCCCACGAACAGCTGGT
CGAGGGGCGGCTGCTGCGGGAAGGGCGGTTCCCGCACCCCGCGGCCCGCTCCGTCGTACTCGACGACCTCT
CCGCCGCCGAGCGGCGTGGCCTGCACGAGCTGGCGCTGGAACTGCTGCGGGACCGCGGCGTGGCCAGCAAG
GTGCTCGCCCGCCACCAGATGGGTACCGGCCGGGTGCACGGCGCCGAGGTCGCCGGGCTGTTCACCGACGC
CGCGCGCGAGCACCACCTGCGCGGCGAGCTCGACGAGGCCGTCACCTACCTGGAGTTCGCCTACCGGGCCT
CCGACGACCCCGCCGTCCACGCCGCACTGCGCGTCGACACCGCCGCCATCGAGCGGCTCTGCGATCCCGCC
AGATCCGGCCGGCATGTGCCCGAGCTGCTCACCGCGTCGCGGGAACGGCTCCTCTCCAGCGAGCACGCCGT
GTCGCTCGCCTGCTGGCTGGCGATGGACGGGCGGCCGGGCGAGGCCGCCGAGGTCCTGGCGGCCCAGCGCT
CCGCCGCCCCGAGCGAGCAGGGCCGGGCGCACCTGCGCGTCGCGGACCTGTCCCTCGCGCTGATCTATCCC
GGCGCGGCCGATCCGCCGCGTCCGGCCGATCCGCCGGCCGAGGACGAGGTCGCCTCGTTTTCCGGAGCCGT
CCGGCACCGCGCCGTCGCCGACAAGGCCCTGAGCAACGCGCTGCGCGGCTGGTCCGAACAGGCCGAGGCCA
AAGCCGAGTACGTGCTCCAGCACTCCCGGGTCACGACGGACCGGACCACGACCATGATGGCGTTGCTGGCC
CTGCTCTACGCCGAGGACACCGATGCCGTCCAGTCCTGGGTCGACAAGCTGGCCGGTGACGACAACATGCG
GACCCCGGCCGACGAGGCGGTCCACGCGGGGTTCCGCGCCGAGGCCGCGCTGCGCCGCGGCGACCTGACCG
CCGCCGTCGAATGCGGCGAGGCCGCGCTCGCCCCCCGGGTCGTGCCCTCCTGGGGGATGGCCGCCGCATTG
CCGCTGAGCAGCACCGTGGCCGCCGCGATCCGACTGGGCGACCTGGACCGGGCGGAGCGGTGGCTCGCCGA
GCCGTTGCCGGAGGAGACCTCCGACAGCCTCTTCGGACTGCACATGGTCTGGGCCCGTGGGCAACACCATC
TCGCGGCCGGGCGGTACCGGGCGGCGTACAACGCGTTCCGGGACTGCGGGGAGCGGATGCGACGCTGGTCC
GTCGACGTGCCGGGCCTGGCCCTGTGGCGGGTCGACGCCGCCGAAGCGCTTCTGCTGCTCGGCCGCGGCCG
TGACGAGGGGCTGAGGCTCATCTCCGAGCAGCTGTCCCGGCCGATGGGGTCCCGGGCGCGGGTGATGACGC
TGCGGGTGCAGGCGGCCTACAGTCCGCCGGCCAAGCGGATCGAACTGCTCGACGAGGCCGCCGATCTGCTC
ATCATGTGCCGCGACCAGTACGAGCTGGCCCGCGTCCTCGCCGACATGGGCGAAGCGTGCGGCATGCTCCG
GCGGCACAGCCGTGCGCGGGGACTGTTCCGCCGCGCACGGCACCTCGCGACCCAGTGCGGAGCCGTGCCGC
TCCTCCGGCGGCTCGGTGGGGAGTCCTCGGACGCGGACGGCACCCAGGACGTGACGCCGGCGCAGCGGATC
ACATCGCTGACCGAGGCGGAGCGGCGGGTGGCGTCGCACGCCGCGGTCGGGCGCACCAACAAGGAGATCGC
CAGCCAGCTGTTCGTCACCTCCAGCACGGTGGAACAGCACCTCACCAACGTGTTCCGCAAGCTGGGGGTGA
AGGGCCGTCAGCAACTGCCCAAGGAACTGTCCGACGCCGGCTGA SEQ ID NO: 10
GTGGAGTTTTACGACCTGGTCGCCCGCGATGACGAGCTCAGAAGGTTGGACCAGGCCCTCGGCCGCGCCGC
CGGCGGACGGGGTGTCGTGGTCACCGTCACCGGACCGGTCGGCTGCGGCAAGACCGAACTGCTGGACGCGG
CCGCGGCCGAGGAGGAATTCATCACGTTGCGTGCGGTCTGCTCGGCCGAGGAGCGGGCCCTGCCGTACGCC
GTGATCGGCCAACTCCTCGACCATCCCGTACTCTCCGCACGCGCGCCCGACCTGGCCTGCGTGACGGCTCC
GGGCCGGACGCTGCCGGCCGACACCGAGAACCGCCTGCGCCGCGACCTCACCCGGGCCCTGCTGGCCCTGG
CCTCCGAACGACCGGTTCTGATCTGCATCGACGACGTGCACCAGGCCGACACCGCCTCGCTGAACTGCCTG
CTGCACCTGGCCCGGCGGGTCGCCTCGGCCCGGATCGCCATGATCCTCACCGAGTTGCGCCGGCTCACCCC
GGCTCACTCCCGGTTCGAGGCGGAACTGCTCAGCCTGCGGCACCGCCACGAGATCGCGCTGCGTCCCCTCG
GCCCGGCCGACACCGCCGAACTGGCCCGCGCCCGGCTCGGCGCCGGCGTCACCGCCGACGAGCTGGCCCAG
GTCCACGAGGCCACCAGCGGGAACCCCAACCTGGTCGGAGGCCTGGTCAACGACGTGCGAGAGGCCTGGGC
GGCCGGTGGCACGGGCATTGCGGCGGGGCGGGCGTACCGGCTGGCGTACCTCAGCTCCGTGTACCGCTGTG
GTCCGGTCCCGTTGCGGATCGCCCAGGCGGCGGCGGTGCTGGGTCCCAGCGCCACCGTCACGCTGGTGCGC
CGGATCAGCGGGCTCGACGCCGAGACGGTGGACGAGGCGACCGCGATCCTCACCGAGGGCGGCCTGCTCCG
GGACCACCGGTTCCCGCATCCGGCGGCCCGCTCGGTCGTACTCGACGACATGTCCGCGCAGGAACGCCGCC
GCCTGCACCGGTCCACGCTGGACGTGCTGGACGGCGTACCCGTCGACGTGCTCGCGCACCACCAGGCCGGC
GCCGGTCTGCTGCACGGCCCGCAGGCGGCCGAGATGTTCGCCCGGGCCAGCCAGGAGCTGCGGGTACGCGG
CGAGCTGGACGCCGCGACCGAGTACCTGCAACTGGCCTACCGGGCCTCCGACGACGCCGGCGCCCGGGCCG
CCCTGCAGGTGGAGACCGTGGCCGGCGAGCGCCGCCGCAACCCGCTGGCCGCCAGCCGGCACCTGGACGAG
CTGGCCGCCGCCGCCCGGGCCGGCCTGCTGTCGGCCGAGCACGCCGCCCTGGTCGTGCACTGGCTGGCCGA
CGCCGGACGACCCGGCGAGGCCGCCGAGGTGCTGGCGCTGCAGCGGGCGCTGGCCGTCACCGACCACGACC
GGGCCCGCCTGCGGGCGGCCGAGGTGTCGCTCGCGCTGTTCCACCCCGGCGTCCCCGGTTCGGACCCGCGG
CCCCTCGCGCCGGAGGAGCTCGCGAGCCTGTCCCTGTCGGCCCGGCACGGTGTGACCGCCGACAACGCGGT
GCTGGCGGCGCTGCGCGGCCGTCCCGAGTCGGCCGCCGCCGAGGCGGAGAACGTGCTGCGCAACGCCGACG
CCGCCGCGTCCGGCCCGACCGCCCTGGCCGCGCTGACGGCCCTGCTCTACGCCGAGAACACCGACGCCGCC
CAGCTCTGGGCGGACAAGCTGGCCGCGGGCATCGGGGCGGGGGAGGGGGAGGCCGGCTACGCGGGGCCGCG
GACCGTGGCCGCCCTGCGTCGCGGCGACCTGACCACCGCGGTCCAGGCGGCCGGCGCGGTCCTGGACCGCG
GCCGGCCGTCGTCGCTCGGCATCACCGCCGTGTTGCCGTTGAGCGGCGCGGTCGCCGCCGCGATCCGGCTG
GGCGAGCTCGAGCGGGCCGAGAAGTGGCTGGCCGAGCCGCTGCCCGAAGCCGTCCACGACAGCCTGTTCGG
CCTGCACCTGCTGATGGCGCGGGGCCGCTACAGCCTCGCGGTGGGCCGGCACGAGGCGGCGTACGCCGCGT
TCCGGGACTGCGGTGAACGGATGCGCCGGTGGGACGTCGACGTGCCCGGGCTGGCCCTGTGGCGGGTGGAC
GCGGCCGAGGCGCTGCTGCCCGGCGATGACCGGGCGGAGGGCCGGCGGCTGATCGACGAGCAGCTCACCCG
GCCGATGGGGCCCCGGTCACGAGCCCTGACCCTGCGGGTACGAGCGGCCTACGCCCCGCCGGCGAAACGGA
TCGACCTGCTCGACGAAGCGGCCGACCTGCTGCTCTCCAGCAACGACCAGTACGAGCGGGCACGGGTGCTG
GCCGACCTGAGCGAGGCGTTCAGCGCGCTCCGGCAGAACGGCCGGGCGCGCGGCATCCTGCGGCAGGCCCG
GCACCTGGCCGCCCAGTGCGGGGCGGTCCCCCTGCTGCGCCGGCTGGGCGTCAAGGCCGGCCGGTCCGGTC
GGCTCGGCCGGCCGCCGCAGGGAATCCGCTCCCTGACCGAGGCCGAGCGCCGGGTGGCCACGCTGGCCGCC
GCCGGGCAGACCAACCGGGAGATCGCCGACCAGCTCTTCGTCACCGCCAGCACGGTCGAGCAGCACCTCAC
CAACGTGTTCCGCAAGCTCGGCGTGAAGGGCCGCCAGCAATTGCCGGCCGAGCTGGCCGACCTGCGGCCGC
CGGGCTGA SEQ ID NO: 11
ATGGAGTTTTACGACCTGGTCGCCCGCGATGACGAGCTCAGAAGGTTGGACCAGGCCCTCGGCCGCGCCGC
CGGCGGACGGGGTGTCGTGGTCACCGTCACCGGACCGGTCGGCTGCGGCAAGACCGAACTGCTGGACGCGG
CCGCGGCCGAGGAGGAATTCATCACGTTGCGTGCGGTCTGCTCGGCCGAGGAGCGGGCCCTGCCGTACGCC
GTGATCGGCCAACTCCTCGACCATCCCGTACTCTCCGCACGCGCGCCCGACCTGGCCTGCGTGACGGCTCC
GGGCCGGACGCTGCCGGCCGACACCGAGAACCGCCTGCGCCGCGACCTCACCCGGGCCCTGCTGGCCCTGG
CCTCCGAACGACCGGTTCTGATCTGCATCGACGACGTGCACCAGGCCGACACCGCCTCGCTGAACTGCCTG
CTGCACCTGGCCCGGCGGGTCGCCTCGGCCCGGATCGCCATGATCCTCACCGAGTTGCGCCGGCTCACCCC
GGCTCACTCCCGGTTCGAGGCGGAACTGCTCAGCCTGCGGCACCGCCACGAGATCGCGCTGCGTCCCCTCG
GCCCGGCCGACACCGCCGAACTGGCCCGCGCCCGGCTCGGCGCCGGCGTCACCGCCGACGAGCTGGCCCAG
GTCCACGAGGCCACCAGCGGGAACCCCAACCTGGTCGGAGGCCTGGTCAACGACGTGCGAGAGGCCTGGGC
GGCCGGTGGCACGGGCATTGCGGCGGGGCGGGCGTACCGGCTGGCGTACCTCAGCTCCGTGTACCGCTGTG
GTCCGGTCCCGTTGCGGATCGCCCAGGCGGCGGCGGTGCTGGGTCCCAGCGCCACCGTCACGCTGGTGCGC
CGGATCAGCGGGCTCGACGCCGAGACGGTGGACGAGGCGACCGCGATCCTCACCGAGGGCGGCCTGCTCCG
GGACCACCGGTTCCCGCATCCGGCGGCCCGCTCGGTCGTACTCGACGACATGTCCGCGCAGGAACGCCGCC
GCCTGCACCGGTCCACGCTGGACGTGCTGGACGGCGTACCCGTCGACGTGCTCGCGCACCACCAGGCCGGC
GCCGGTCTGCTGCACGGCCCGCAGGCGGCCGAGATGTTCGCCCGGGCCAGCCAGGAGCTGCGGGTACGCGG
CGAGCTGGACGCCGCGACCGAGTACCTGCAACTGGCCTACCGGGCCTCCGACGACGCCGGCGCCCGGGCCG
CCCTGCAGGTGGAGACCGTGGCCGGCGAGCGCCGCCGCAACCCGCTGGCCGCCAGCCGGCACCTGGACGAG
CTGGCCGCCGCCGCCCGGGCCGGCCTGCTGTCGGCCGAGCACGCCGCCCTGGTCGTGCACTGGCTGGCCGA
CGCCGGACGACCCGGCGAGGCCGCCGAGGTGCTGGCGCTGCAGCGGGCGCTGGCCGTCACCGACCACGACC
GGGCCCGCCTGCGGGCGGCCGAGGTGTCGCTCGCGCTGTTCCACCCCGGCGTCCCCGGTTCGGACCCGCGG
CCCCTCGCGCCGGAGGAGCTCGCGAGCCTGTCCCTGTCGGCCCGGCACGGTGTGACCGCCGACAACGCGGT
GCTGGCGGCGCTGCGCGGCCGTCCCGAGTCGGCCGCCGCCGAGGCGGAGAACGTGCTGCGCAACGCCGACG
CCGCCGCGTCCGGCCCGACCGCCCTGGCCGCGCTGACGGCCCTGCTCTACGCCGAGAACACCGACGCCGCC
CAGCTCTGGGCGGACAAGCTGGCCGCGGGCATCGGGGCGGGGGAGGGGGAGGCCGGCTACGCGGGGCCGCG
GACCGTGGCCGCCCTGCGTCGCGGCGACCTGACCACCGCGGTCCAGGCGGCCGGCGCGGTCCTGGACCGCG
GCCGGCCGTCGTCGCTCGGCATCACCGCCGTGTTGCCGTTGAGCGGCGCGGTCGCCGCCGCGATCCGGCTG
GGCGAGCTCGAGCGGGCCGAGAAGTGGCTGGCCGAGCCGCTGCCCGAAGCCGTCCACGACAGCCTGTTCGG
CCTGCACCTGCTGATGGCGCGGGGCCGCTACAGCCTCGCGGTGGGCCGGCACGAGGCGGCGTACGCCGCGT
TCCGGGACTGCGGTGAACGGATGCGCCGGTGGGACGTCGACGTGCCCGGGCTGGCCCTGTGGCGGGTGGAC
GCGGCCGAGGCGCTGCTGCCCGGCGATGACCGGGCGGAGGGCCGGCGGCTGATCGACGAGCAGCTCACCCG
GCCGATGGGGCCCCGGTCACGAGCCCTGACCCTGCGGGTACGAGCGGCCTACGCCCCGCCGGCGAAACGGA
TCGACCTGCTCGACGAAGCGGCCGACCTGCTGCTCTCCAGCAACGACCAGTACGAGCGGGCACGGGTGCTG
GCCGACCTGAGCGAGGCGTTCAGCGCGCTCCGGCAGAACGGCCGGGCGCGCGGCATCCTGCGGCAGGCCCG
GCACCTGGCCGCCCAGTGCGGGGCGGTCCCCCTGCTGCGCCGGCTGGGCGTCAAGGCCGGCCGGTCCGGTC
GGCTCGGCCGGCCGCCGCAGGGAATCCGCTCCCTGACCGAGGCCGAGCGCCGGGTGGCCACGCTGGCCGCC
GCCGGGCAGACCAACCGGGAGATCGCCGACCAGCTCTTCGTCACCGCCAGCACGGTCGAGCAGCACCTCAC
CAACGTGTTCCGCAAGCTCGGCGTGAAGGGCCGCCAGCAATTGCCGGCCGAGCTGGCCGACCTGCGGCCGC
CGGGCTGA SEQ ID NO: 12
GTGGTCACCGTCACCGGCCCAATCGCCTGCGGCAAGACAGAACTGCTTGACGCGGCTGCCGCGAAGGCTGA
GGCCATCATTCTGCGCGCGGTCTGCGCGCCAGAAGAGCGGGCTATGCCGTACGCCATGATCGGGCAGCTCA
TCGACGACCCGGCGCTCGCGCATCGGGCGCCGGGGCTGGCTGATCGGATAGCCCAGGGCGGGCAGCTGTCG
CTGAGGGCCGAGAACCGACTGCGCAGGGATCTCACCCGTGCCCTGCTGGCGCTTGCCGTCGACCGGCCTGT
GCTGATCGGCGTCGACGATGTGCATCACGCCGACACCGCCTCTTTGAACTGTCTGCTGCATTTGGCGCGCC
GGGTCCGTCCGGCCCGGATATCCATGATCTTCACCGAGTTGCGCAGCCTCACCCCTACTCAGTCACGGTTC
AAGGCGGAGCTGCTCAGCCTGCCGTACCACCACGAGATCGCGCTGCGTCCGTTCGGACCGGAGCAATCGGC
GGAGCTGGCCCGCGCCGCCTTCGGCCCGGGCCTCGCCGAGGATGTGCTCGTGGGGTTGTATAAAACGACCA
GGGGCAATCTGAGTCTCAGCCGTGGACTGATCAGCGATGTGCGGGAGGCCCTGGCCAACGGAGAGAGCGCC
TTCGAGGCGGGCCGCGCGTTCCGGCTGGCGTACCTCGGCTCGCTCTACCGCTGTGGCCCGGTCGCGCTGCG
GGTCGCCCGAGTGGCTGCCGTGCTGGGCCCGAGCGCCACCACCACGCTGGTGCGCCGTCTAAGCGGGCTCA
GCGCGGAGACGATAGACCGGGCAACCAAGATCCTCACCGAGGGCGGGCTGCTGCTCGACCAGCAGTTCCCG
CACCCGGCCGCCCGCTCGGTGGTGCTTGATGACATGTCCGCCCAGGAACGACGCGGCCTGCACACTCTCGC
CCTGGAACTGCTGGACGAGGCGCCGGTTGAAGTGCTCGCGCACCACCAGGTCGGCGCCGGTCTCATACACG
GGCCCAAGGCTGCGGAGATGTTCGCCAAGGCCGGCAAGGCTCTGGTCGTACGCAACGAGTTGGGCGACGCG
GCAGAATACCTGCAACTGGCTCACCGGGCCTCCGACGATGTCTCCACCCGGGCCGCCTTACGGGTCGAGGC
CGTGGCGATCGAGCGCCGCCGCAATCCGCTGGCCTCCAGTCGGCACATGGACGAGCTGAGCGCCGCCGGCC
GCGCCGGTCTGCTTTCCCCCAAGCATGCGGCGCTGGCCGTCTTCTGGCTGGCCGACGGCGGGCGATCCGGC
GAGGCAGCCGAGGTGCTGGCGTCGGAACGCCCGCTAGCGACCACCGATCAGAACCGGGCCCACTTGCGATT
TGTCGAGGTGACTCTCGCGCTGTTCTCTCCCGGCGCCTTCGGATCGGACCGGCGCCCACCTCCGCTGACGC
CGGACGAACTCGCCAGCCTGCCGAAGGCGGCCTGGCAATGCGCGGTCGCCGACAACGCGGCCATGACCGCC
TTGCACGGTCATCCAGAACTTGCCACCGCTCAGGCGGAAACAGTTCTGCGGCAGGCTGATTCGGCAGCCGA
CGCGATCCCCGCCGCGCTGATCGCCCTGTTGTACGCGGAGAACACCGAGTCCGCTCATATCTGGGCCGACA
AGCTGGGCAGCACGAATGGCGGGGTATCGAACGAGGCGGAAGCGGGCTACGCCGGCCCGTGCGCCGAGATC
GCCCTGCGGCGCGGCGACCTGGCCACGGCGTTCGAGGCTGGTAGCACCGTCCTGGACGACCGGTCGCTGCC
GTCGCTCGGCATCACCGCCGCATTGCTGTTGAGCAGCAAGACGGCCGCCGCTGTCCGGCTGGGCGAACTCG
AGCGTGCGGAGAAGCTGCTCGCCGAGCCGCTTCCGAACGGCGTCCAGGACAGCCTTTTCGGTCTGCACCTG
CTCTCGGCATACGGCCAGTACAGCCTCGCGATGGGCCGATATGAATCGGCTCTCCGGGCGTTTCACACCTG
CGGAGAACGTATGCGCAGCTGGGATGTTGACGTGCCTGGTCTGGCCCTGTGGCGTGTCGACGCCGCCGAGG
CGCTGCTCAGCCTCGACCGGAACGAGGGCCAGCGGCTCATCGACGAACAACTCACCCGTCCGATGGGGCCT
CGTTCCCGCGCGTTAACGCTGCGGATCAAGGCGGCATACCTCCCGCGGACGAAGCGGATCCCCCTGCTCCA
TGAGGCGGCCGAGCTGCTGCTCCCCTGCCCCGACCCGTACGAGCAAGCGCGGGTGCTCGCCGATCTGGGCG
ACACGCTCAGCGCGCTCAGACGCTATAGCCGGGCGCGGGGAGTTCTCCGGCAGGCTCGTCACCTGGCCGCC
CAGTGCGGTGCTGTCCCGCTGCTGCGCAGGCTCGGGGGCGAGCCCGGCCGGATCGACGACGCCGGCCTGCC
GCAGCGGAGCACATCGTTGACCGATGCGGAGCGGCGGGTGGCGGCGCTGGCCGCGGCCGGACAGACCAACC
GGGAGATCGCCAAACAGCTGTTCGTCACGGCCAGCACAGTGGAACAGCACCTCACAAGCGTCTTCCGCAAA
CTGGGGGTCAAGGGTCGCAAGCAGCTGCCGACCGCGCTGGCCGACGTGGAACAGACCTGA SEQ ID
NO: 13
ATGTATAGCGGTACCTGCCGTGAAGGATACGAACTCGTCGCACGCGAGGACGAACTCGGCATTCTACAGAG
GTCTCTGGAACAAGCGAGCAGCGGCCAGGGCGTCGTGGTCACCGTCACCGGCCCAATCGCCTGCGGCAAGA
CAGAACTGCTTGACGCGGCTGCCGCGAAGGCTGAGGCCATCATTCTGCGCGCGGTCTGCGCGCCAGAAGAG
CGGGCTATGCCGTACGCCATGATCGGGCAGCTCATCGACGACCCGGCGCTCGCGCATCGGGCGCCGGGGCT
GGCTGATCGGATAGCCCAGGGCGGGCAGCTGTCGCTGAGGGCCGAGAACCGACTGCGCAGGGATCTCACCC
GTGCCCTGCTGGCGCTTGCCGTCGACCGGCCTGTGCTGATCGGCGTCGACGATGTGCATCACGCCGACACC
GCCTCTTTGAACTGTCTGCTGCATTTGGCGCGCCGGGTCCGTCCGGCCCGGATATCCATGATCTTCACCGA
GTTGCGCAGCCTCACCCCTACTCAGTCACGGTTCAAGGCGGAGCTGCTCAGCCTGCCGTACCACCACGAGA
TCGCGCTGCGTCCGTTCGGACCGGAGCAATCGGCGGAGCTGGCCCGCGCCGCCTTCGGCCCGGGCCTCGCC
GAGGATGTGCTCGTGGGGTTGTATAAAACGACCAGGGGCAATCTGAGTCTCAGCCGTGGACTGATCAGCGA
TGTGCGGGAGGCCCTGGCCAACGGAGAGAGCGCCTTCGAGGCGGGCCGCGCGTTCCGGCTGGCGTACCTCG
GCTCGCTCTACCGCTGTGGCCCGGTCGCGCTGCGGGTCGCCCGAGTGGCTGCCGTGCTGGGCCCGAGCGCC
ACCACCACGCTGGTGCGCCGTCTAAGCGGGCTCAGCGCGGAGACGATAGACCGGGCAACCAAGATCCTCAC
CGAGGGCGGGCTGCTGCTCGACCAGCAGTTCCCGCACCCGGCCGCCCGCTCGGTGGTGCTTGATGACATGT
CCGCCCAGGAACGACGCGGCCTGCACACTCTCGCCCTGGAACTGCTGGACGAGGCGCCGGTTGAAGTGCTC
GCGCACCACCAGGTCGGCGCCGGTCTCATACACGGGCCCAAGGCTGCGGAGATGTTCGCCAAGGCCGGCAA
GGCTCTGGTCGTACGCAACGAGTTGGGCGACGCGGCAGAATACCTGCAACTGGCTCACCGGGCCTCCGACG
ATGTCTCCACCCGGGCCGCCCTGCGGGTCGAGGCCGTGGCGATCGAGCGCCGCCGCAATCCGCTGGCCTCC
AGTCGGCACATGGACGAGCTGAGCGCCGCCGGCCGCGCCGGTCTGCTTTCCCCCAAGCATGCGGCGCTGGC
CGTCTTCTGGCTGGCCGACGGCGGGCGATCCGGCGAGGCAGCCGAGGTGCTGGCGTCGGAACGCCCGCTAG
CGACCACCGATCAGAACCGGGCCCACTTGCGATTTGTCGAGGTGACTCTCGCGCTGTTCTCTCCCGGCGCC
TTCGGATCGGACCGGCGCCCACCTCCGCTGACGCCGGACGAACTCGCCAGCCTGCCGAAGGCGGCCTGGCA
ATGCGCGGTCGCCGACAACGCGGCCATGACCGCCTTGCACGGTCATCCAGAACTTGCCACCGCTCAGGCGG
AAACAGTTCTGCGGCAGGCTGATTCGGCAGCCGACGCGATCCCCGCCGCGCTGATCGCCCTGTTGTACGCG
GAGAACACCGAGTCCGCTCATATCTGGGCCGACAAGCTGGGCAGCACGAATGGCGGGGTATCGAACGAGGC
GGAAGCGGGCTACGCCGGCCCGTGCGCCGAGATCGCCCTGCGGCGCGGCGACCTGGCCACGGCGTTCGAGG
CTGGTAGCACCGTCCTGGACGACCGGTCGCTGCCGTCGCTCGGCATCACCGCCGCATTGCTGTTGAGCAGC
AAGACGGCCGCCGCTGTCCGGCTGGGCGAACTCGAGCGTGCGGAGAAGCTGCTCGCCGAGCCGCTTCCGAA
CGGCGTCCAGGACAGCCTTTTCGGTCTGCACCTGCTCTCGGCATACGGCCAGTACAGCCTCGCGATGGGCC
GATATGAATCGGCTCTCCGGGCGTTTCACACCTGCGGAGAACGTATGCGCAGCTGGGATGTTGACGTGCCT
GGTCTGGCCCTGTGGCGTGTCGACGCCGCCGAGGCGCTGCTCAGCCTCGACCGGAACGAGGGCCAGCGGCT
CATCGACGAACAACTCACCCGTCCGATGGGGCCTCGTTCCCGCGCGCTGACGCTGCGGATCAAGGCGGCAT
ACCTCCCGCGGACGAAGCGGATCCCCCTGCTCCATGAGGCGGCCGAGCTGCTGCTCCCCTGCCCCGACCCG
TACGAGCAAGCGCGGGTGCTCGCCGATCTGGGCGACACGCTCAGCGCGCTCAGACGCTATAGCCGGGCGCG
GGGAGTTCTCCGGCAGGCTCGTCACCTGGCCGCCCAGTGCGGTGCTGTCCCGCTGCTGCGCAGGCTCGGGG
GCGAGCCCGGCCGGATCGACGACGCCGGCCTGCCGCAGCGGAGCACATCGTTGACCGATGCGGAGCGGCGG
GTGGCGGCGCTGGCCGCGGCCGGACAGACCAACCGGGAGATCGCCAAACAGCTGTTCGTCACGGCCAGCAC
AGTGGAACAGCACCTCACAAGCGTCTTCCGCAAACTGGGGGTCAAGGGTCGCAAGCAGCTGCCGACCGCGC
TGGCCGACGTGGAACAGACCTGA SEQ ID NO: 14
ATGCCTGCCGTGGAGAGCTATGAACTGGACGCCCGCGATGACGAGCTCAGAAGACTGGAGGAGGCGGTAGG
CCAGGCGGGCAACGGCCGGGGTGTGGTGGTCACCATCACCGGGCCGATCGCCTGCGGCAAGACCGAACTGC
TCGACGCGGCCGCCGCGAAGAGCGACGCCATCACATTACGTGCGGTCTGCTCCGAGGAGGAACGGGCCCTC
CCGTACGCCCTGATCGGGCAGCTCATCGACAACCCGGCGGTCGCCTCCCAGCTGCCGGATCCGGTCTCCAT
GGCCCTCCCGGGCGAGCACCTGTCGCCGGAGGCCGAGAACCGGCTGCGCGGCGACCTCACCCGTACCCTGC
TGGCGCTCGCCGCCGAACGGCCGGTGCTGATCGGCATCGACGACATGCACCACGCCGACACCGCCTCTTTG
AACTGCCTGCTCCACCTGGCCCGGAGGGTCGGCCCGGCCCGGATCGCCATGGTCCTCACCGAGCTGCGCCG
GCTCACCCCGGCCCACTCCCAGTTCCACGCCGAGCTGCTCAGCCTGGGGCACCACCGCGAGATCGCGCTGC
GCCCGCTCGGCCCGAAGCACATCGCCGAGCTGGCCCGCGCCGGCCTCGGTCCCGATGTCGACGAGGACGTG
CTCACGGGGTTGTACCGGGCGACCGGCGGCAACCTGAACCTCGGCCACGGACTGATCAAGGATGTGCGGGA
GGCCTGGGCGACGGGCGGGACGGGCATCAACGCGGGCCGCGCGTACCGGCTGGCGTACCTCGGTTCCCTCT
ACCGCTGCGGCCCGGTCCCGTTGCGGGTCGCACGGGTGGCCGCCGTGCTGGGCCAGAGCGCCAACACCACC
CTGGTGCGCTGGATCAGCGGGCTCAACGCGGACGCGGTGGGCGAGGCGACCGAGATCCTCACCGAGGGCGG
CCTGCTGCACGACCTGCGGTTCCCGCATCCGGCGGCCCGTTCGGTCGTACTCAACGACCTGTCCGCCCGGG
AACGCCGCCGACTGCACCGGTCCGCTCTGGAAGTGCTGGATGACGTACCCGTTGAAGTGGTCGCGCACCAC
CAGGCCGGTGCCGGTTTCATCCACGGTCCCAAGGCCGCCGAGATCTTCGCCAAGGCCGGCCAGGAGCTGCA
TGTGCGCGGCGAGCTGGACGCCGCGTCCGACTATCTGCAACTGGCCCACCACGCCTCCGACGACGCCGTCA
CCCGGGCCGCGCTGCGGGTCGAGGCCGTGGCGATCGAGCGCCGCCGCAACCCGCTGGCCTCCAGCCGCCAC
CTCGACGAGCTGACCGTCGCCGCCCGTGCCGGTCTGCTCTCCCTCGAGCACGCCGCGCTGATGATCCGCTG
GCTGGCTCTCGGCGGGCGGTCCGGCGAGGCGGCCGAGGTGCTGGCCGCGCAGCGCCCGCGTGCGGTCACCG
ACCAGGACAGGGCCCACCTGCGGGCCGCCGAGGTATCGCTGGCGCTGGTCAGCCCGGGCGCGTCCGGCGTC
AGCCCGGGTGCGTCCGGCCCGGATCGGCGGCCGCGTCCGCTCCCGCCGGATGAGCTCGCGAACCTGCCGAA
GGCGGCCCGGCTTTGTGCGATCGCCGACAACGCCGTCATATCGGCCCTGCACGGTCGTCCCGAGCTTGCCT
CGGCCGAGGCGGAGAACGTCCTGAAGCAGGCTGACTCGGCGGCGGACGGCGCCACCGCCCTCTCCGCGCTG
ACGGCCTTGCTGTACGCGGAGAACACCGACACCGCTCAGCTCTGGGCCGACAAGCTCGTCTCCGAGACCGG
GGCGTCGAACGAGGAGGAAGGCGCGGGCTACGCGGGGCCGCGCGCCGAGACCGCGTTGCGCCGCGGCGACC
TGGCCGCGGCGGTCGAGGCGGGCAGCGCCATTCTGGACCACCGGCGGGGGTCGTTGCTCGGCATCACCGCC
GCGCTACCGCTGAGCAGCGCGGTAGCCGCCGCCATCCGGCTGGGCGAGACCGAGCGGGCGGAGAAGTGGCT
CGCCGAGCCGCTGCCGGAGGCCATTCGGGACAGCCTGTTCGGGCTGCACCTGCTCTCGGCGCGCGGCCAGT
ACTGCCTCGCGACGGGCCGGCACGAGTCGGCGTACACGGCGTTCCGCACCTGCGGGGAACGGATGCGGAAC
TGGGGCGTCGACGTGCCGGGTCTGTCCCTGTGGCGCGTCGACGCCGCCGAGGCGCTGCTGCACGGCCGCGA
CCGGGACGAGGGCCGACGGCTCATCGACGAGCAGCTCACCCATGCGATGGGACCCCGTTCCCGCGCTTTGA
CGCTGCGGGTGCAGGCGGCGTACAGCCCGCAGGCGCAGCGGGTCGACCTGCTCGAAGAGGCGGCCGACCTG
CTGCTCTCCTGCAACGACCAGTACGAGCGGGCGCGGGTGCTCGCCGATCTGAGCGAGGCGTTCAGCGCGCT
CAGGCACCACAGCCGGGCGCGGGGACTGCTCCGGCAGGCCCGGCACCTGGCCGCCCAGTGCGGCGCGACCC
CGCTGCTGCGCCGGCTCGGGGCCAAGCCCGGAGGCCCCGGCTGGCTGGAGGAATCCGGCCTGCCGCAGCGG
ATCAAGTCGCTGACCGACGCGGAGCGGCGGGTGGCGTCGCTGGCCGCCGGCGGCCAGACCAACCGCGTGAT
CGCCGACCAGCTCTTCGTCACGGCCAGCACGGTGGAGCAGCACCTCACGAACGTCTTCCGCAAGCTGGGCG
TCAAGGGCCGCCAGCACCTGCCGGCCGAACTCGCCAACGCGGAATAG SEQ ID NO: 15
ATGCCTGCCGTGGAGAGCTATGAACTGGACGCCCGCGATGACGAGCTCAGAAGACTGGAGGAGGCGGTAGG
CCAGGCGGGCAACGGCCGGGGTGTGGTGGTCACCATCACCGGGCCGATCGCCTGCGGCAAGACCGAACTGC
TCGACGCGGCCGCCGCGAAGAGCGACGCCATCACACTGCGTGCGGTCTGCTCCGAGGAGGAACGGGCCCTC
CCGTACGCCCTGATCGGGCAGCTCATCGACAACCCGGCGGTCGCCTCCCAGCTGCCGGATCCGGTCTCCAT
GGCCCTCCCGGGCGAGCACCTGTCGCCGGAGGCCGAGAACCGGCTGCGCGGCGACCTCACCCGTACCCTGC
TGGCGCTCGCCGCCGAACGGCCGGTGCTGATCGGCATCGACGACATGCACCACGCCGACACCGCCTCTTTG
AACTGCCTGCTCCACCTGGCCCGGAGGGTCGGCCCGGCCCGGATCGCCATGGTCCTCACCGAGCTGCGCCG
GCTCACCCCGGCCCACTCCCAGTTCCACGCCGAGCTGCTCAGCCTGGGGCACCACCGCGAGATCGCGCTGC
GCCCGCTCGGCCCGAAGCACATCGCCGAGCTGGCCCGCGCCGGCCTCGGTCCCGATGTCGACGAGGACGTG
CTCACGGGGTTGTACCGGGCGACCGGCGGCAACCTGAACCTCGGCCACGGACTGATCAAGGATGTGCGGGA
GGCCTGGGCGACGGGCGGGACGGGCATCAACGCGGGCCGCGCGTACCGGCTGGCGTACCTCGGTTCCCTCT
ACCGCTGCGGCCCGGTCCCGTTGCGGGTCGCACGGGTGGCCGCCGTGCTGGGCCAGAGCGCCAACACCACC
CTGGTGCGCTGGATCAGCGGGCTCAACGCGGACGCGGTGGGCGAGGCGACCGAGATCCTCACCGAGGGCGG
CCTGCTGCACGACCTGCGGTTCCCGCATCCGGCGGCCCGTTCGGTCGTACTCAACGACCTGTCCGCCCGGG
AACGCCGCCGACTGCACCGGTCCGCTCTGGAAGTGCTGGATGACGTACCCGTTGAAGTGGTCGCGCACCAC
CAGGCCGGTGCCGGTTTCATCCACGGTCCCAAGGCCGCCGAGATCTTCGCCAAGGCCGGCCAGGAGCTGCA
TGTGCGCGGCGAGCTGGACGCCGCGTCCGACTATCTGCAACTGGCCCACCACGCCTCCGACGACGCCGTCA
CCCGGGCCGCGCTGCGGGTCGAGGCCGTGGCGATCGAGCGCCGCCGCAACCCGCTGGCCTCCAGCCGCCAC
CTCGACGAGCTGACCGTCGCCGCCCGTGCCGGTCTGCTCTCCCTCGAGCACGCCGCGCTGATGATCCGCTG
GCTGGCTCTCGGCGGGCGGTCCGGCGAGGCGGCCGAGGTGCTGGCCGCGCAGCGCCCGCGTGCGGTCACCG
ACCAGGACAGGGCCCACCTGCGGGCCGCCGAGGTATCGCTGGCGCTGGTCAGCCCGGGCGCGTCCGGCGTC
AGCCCGGGTGCGTCCGGCCCGGATCGGCGGCCGCGTCCGCTCCCGCCGGATGAGCTCGCGAACCTGCCGAA
GGCGGCCCGGCTTTGTGCGATCGCCGACAACGCCGTCATATCGGCCCTGCACGGTCGTCCCGAGCTTGCCT
CGGCCGAGGCGGAGAACGTCCTGAAGCAGGCTGACTCGGCGGCGGACGGCGCCACCGCCCTCTCCGCGCTG
ACGGCCTTGCTGTACGCGGAGAACACCGACACCGCTCAGCTCTGGGCCGACAAGCTCGTCTCCGAGACCGG
GGCGTCGAACGAGGAGGAAGGCGCGGGCTACGCGGGGCCGCGCGCCGAGACCGCGTTGCGCCGCGGCGACC
TGGCCGCGGCGGTCGAGGCGGGCAGCGCCATTCTGGACCACCGGCGGGGGTCGTTGCTCGGCATCACCGCC
GCGCTACCGCTGAGCAGCGCGGTAGCCGCCGCCATCCGGCTGGGCGAGACCGAGCGGGCGGAGAAGTGGCT
CGCCGAGCCGCTGCCGGAGGCCATTCGGGACAGCCTGTTCGGGCTGCACCTGCTCTCGGCGCGCGGCCAGT
ACTGCCTCGCGACGGGCCGGCACGAGTCGGCGTACACGGCGTTCCGCACCTGCGGGGAACGGATGCGGAAC
TGGGGCGTCGACGTGCCGGGTCTGTCCCTGTGGCGCGTCGACGCCGCCGAGGCGCTGCTGCACGGCCGCGA
CCGGGACGAGGGCCGACGGCTCATCGACGAGCAGCTCACCCATGCGATGGGACCCCGTTCCCGCGCTTTGA
CGCTGCGGGTGCAGGCGGCGTACAGCCCGCAGGCGCAGCGGGTCGACCTGCTCGAAGAGGCGGCCGACCTG
CTGCTCTCCTGCAACGACCAGTACGAGCGGGCGCGGGTGCTCGCCGATCTGAGCGAGGCGTTCAGCGCGCT
CAGGCACCACAGCCGGGCGCGGGGACTGCTCCGGCAGGCCCGGCACCTGGCCGCCCAGTGCGGCGCGACCC
CGCTGCTGCGCCGGCTCGGGGCCAAGCCCGGAGGCCCCGGCTGGCTGGAGGAATCCGGCCTGCCGCAGCGG
ATCAAGTCGCTGACCGACGCGGAGCGGCGGGTGGCGTCGCTGGCCGCCGGCGGCCAGACCAACCGCGTGAT
CGCCGACCAGCTCTTCGTCACGGCCAGCACGGTGGAGCAGCACCTCACGAACGTCTTCCGCAAGCTGGGCG
TCAAGGGCCGCCAGCACCTGCCGGCCGAACTCGCCAACGCGGAATAG SEQ ID NO: 16
GTGAAGCGCAACGATCTGGTTGCCCGCGATGGCGAGCTCAGGTGGATGCAAGAGATTCTCAGTCAGGCGAG
CGAGGGCCGGGGGGCCGTGGTCACCATCACGGGGGCGATCGCCTGTGGCAAGACGGTGCTGCTGGACGCCG
CGGCAGCCAGTCAAGACGTGATCCAACTGCGTGCGGTCTGCTCGGCGGAGGAGCAGGAGCTGCCGTACGCG
ATGGTCGGACAACTACTCGACAATCCGGTGCTCGCCGCGCGAGTGCCGGCCCTGGGCAACCTGGCTGCGGC
GGGCGAGCGGCTGCTGCCGGGCACCGAGAACAGGATCCGGCGGGAGCTCACCCGCACCCTGCTGGCTCTCG
CCGACGAACGACCGGTGCTGATCGGCGTCGACGACATGCACCATGCGGACCCCGCCTCGCTGGACTGCCTG
CTGCACCTGGCCCGGCGGGTCGGCCCGGCCCGCATCGCGATCGTTCTGACCGAGTTGCGCCGGCTCACCCC
GGCTCACTCGCGCTTCCAGTCCGAGCTGCTCAGCCTGCGGTACCACCACGAGATCGGGTTGCAGCCGCTCA
CCGCGGAGCACACCGCCGACCTGGCCCGCGTCGGCCTCGGTGCCGAGGTCGACGACGACGTGCTCACCGAG
CTCTACGAGGCGACCGGCGGCAACCCGAGTCTGTGCTGCGGCCTGATCAGGGACGTGCGGCAGGACTGGGA
GGCCGGGGTCACCGGTATCCACGTCGGCCGGGCGTACCGGCTGGCCTATCTCAGTTCGCTCTACCGCTGCG
GCCCGGCGGCGCTGCGGACCGCCCGCGCGGCCGCGGTGCTGGGCGACAGCGCCGACGCCTGCCTGATCCGC
CGGGTCAGCGGCCTCGGTACGGAGGCCGTGGGCCAGGCGATCCAGCAGCTCACCGAGGGCGGCCTGCTGCG
TGACCAGCAGTTCCCGCACCCGGCGGCCCGCTCGGTCGTGCTCGACGACATGTCCGCGCAGGAACGCCACG
CGATGTATCGCAGCGCCCGGGAGGCAGCCGCCGAAGGTCAGGCCGACCCCGGCACCCCGGGCGAGCCGCGG
GCGGCTACGGCGTACGCCGGGTGTGGTGAGCAAGCCGGTGACTACCCGGAGCCGGCCGGCCGGGCCTGCGT
GGACGGTGCCGGTCCGGCCGAGTACTGCGGCGACCCGCACGGCGCCGACGACGACCCGGACGAGCTGGTCG
CCGCGCTGGGCGGGCTGCTGCCGAGCCGGCTCGTGGCGATGAAGATCCGGCGCCTGGCGGTGGCCGGGCGC
CCCGGGGCGGCTGCCGAGCTGCTGACCTCGCAGCGGTTGCACGCGGTGACCAGCGAGGACCGGGCCAGCCT
GCGGGCCGCCGAGGTGGCGCTCGCCACGCTGTGGCCGGGTGCGACCGGCCCGGACCGGCATCCGCTCACGG
AGCAGGAGGCGGCGAGCCTGCCGGAGGGTCCGCGCCTGCTCGCTGCCGCCGACGATGCCGTCGGGGCCGCC
CTGCGCGGTCGCGCCGAGTACGCCGCGGCCGAGGCGGAGAACGTCCTGCGGCACGCCGATCCGGCAGCCGG
TGGTGACGCCTACGCCGCCATGATCGCCCTGCTGTACACGGAGCACCCCGAGAACGTGCTGTTCTGGGCCG
ACAAGCTCGACGCGGGCCGCCCCGACGAGGAGACCAGTTATCCCGGGCTGCGGGCCGAGACCGCGGTGCGG
CTCGGTGACCTGGAAACGGCGATGGAGCTGGGCCGCACGGTGCTGGACCAGCGGCGGCTGCCGTCCCTGGG
TGTCGCCGCGGGCCTGCTCCTGGGCGGCGCGGTGACGGCCGCCATCCGGCTCGGCGACCTCGACCGGGCGG
AGAAGTGGCTCGCCGAGCCGATCCCCGACGCCATCCGTACCAGCCTCTACGGCCTGCACGTGCTGGCCGCG
CGGGGCCGGCTCGACCTGGCCGCGGGCCGCTACGAGGCGGCGTACACGGCGTTCCGGCTGTGTGGCGAGCG
GATGGCAGGCTGGGATGCCGATGTCTCCGGGCTGGCGCTGTGGCGCGTCGACGCCGCCGAGGCCCTGCTGT
CCGCGGGCATCCGCCCGGACGAGGGCCGCAAGCTCATCGACGACCAGCTCACCCGTGAGATGGGGGCCCGC
TCCCGGGCGCTGACGCTGCGGGCGCAAGCGGCGTACAGCCTGCCGGTGCACCGGGTGGGCCTGCTCGACGA
GGCGGCCGGCCTGCTGCTCGCCTGCCATGACGGGTACGAGCGGGCGCGGGTGCTCGCGGACCTGGGGGAGA
CCCTGCGCACGCTGCGGCACACCGACGCGGCCCAGCGGGTGCTCCGGCAGGCCGAGCAGGCGGCCGCGCGG
TGCGGGTCGGTCCCGCTGCTGCGGCGGCTCGGGGCCGAACCCGTACGCATCGGCACCCGGCGTGGTGAACC
CGGCCTGCCGCAGCGGATCAGGCTGCTGACCGATGCCGAGCGGCGGGTTGCCGCGATGGCCGCCGCCGGGC
AGACCAACCGGGAGATCGCCGGTCGGCTCTTCGTCACGGCCAGCACGGTGGAGCAGCACCTGACCAGCGTC
TTCCGCAAGCTGGGCGTCAAGGGCCGCCGGTTCCTGCCGACCGAGCTCGCCCAAGCCGTCTGA SEQ
ID NO: 17
ATGCCTGCCGTGAAGCGCAACGATCTGGTTGCCCGCGATGGCGAGCTCAGGTGGATGCAAGAGATTCTCAG
TCAGGCGAGCGAGGGCCGGGGGGCCGTGGTCACCATCACGGGGGCGATCGCCTGTGGCAAGACGGTGCTGC
TGGACGCCGCGGCAGCCAGTCAAGACGTGATCCAACTGCGTGCGGTCTGCTCGGCGGAGGAGCAGGAGCTG
CCGTACGCGATGGTCGGACAACTACTCGACAATCCGGTGCTCGCCGCGCGAGTGCCGGCCCTGGGCAACCT
GGCTGCGGCGGGCGAGCGGCTGCTGCCGGGCACCGAGAACAGGATCCGGCGGGAGCTCACCCGCACCCTGC
TGGCTCTCGCCGACGAACGACCGGTGCTGATCGGCGTCGACGACATGCACCATGCGGACCCCGCCTCGCTG
GACTGCCTGCTGCACCTGGCCCGGCGGGTCGGCCCGGCCCGCATCGCGATCGTTCTGACCGAGTTGCGCCG
GCTCACCCCGGCTCACTCGCGCTTCCAGTCCGAGCTGCTCAGCCTGCGGTACCACCACGAGATCGGGTTGC
AGCCGCTCACCGCGGAGCACACCGCCGACCTGGCCCGCGTCGGCCTCGGTGCCGAGGTCGACGACGACGTG
CTCACCGAGCTCTACGAGGCGACCGGCGGCAACCCGAGTCTGTGCTGCGGCCTGATCAGGGACGTGCGGCA
GGACTGGGAGGCCGGGGTCACCGGTATCCACGTCGGCCGGGCGTACCGGCTGGCCTATCTCAGTTCGCTCT
ACCGCTGCGGCCCGGCGGCGCTGCGGACCGCCCGCGCGGCCGCGGTGCTGGGCGACAGCGCCGACGCCTGC
CTGATCCGCCGGGTCAGCGGCCTCGGTACGGAGGCCGTGGGCCAGGCGATCCAGCAGCTCACCGAGGGCGG
CCTGCTGCGTGACCAGCAGTTCCCGCACCCGGCGGCCCGCTCGGTCGTGCTCGACGACATGTCCGCGCAGG
AACGCCACGCGATGTATCGCAGCGCCCGGGAGGCAGCCGCCGAAGGTCAGGCCGACCCCGGCACCCCGGGC
GAGCCGCGGGCGGCTACGGCGTACGCCGGGTGTGGTGAGCAAGCCGGTGACTACCCGGAGCCGGCCGGCCG
GGCCTGCGTGGACGGTGCCGGTCCGGCCGAGTACTGCGGCGACCCGCACGGCGCCGACGACGACCCGGACG
AGCTGGTCGCCGCGCTGGGCGGGCTGCTGCCGAGCCGGCTCGTGGCGATGAAGATCCGGCGCCTGGCGGTG
GCCGGGCGCCCCGGGGCGGCTGCCGAGCTGCTGACCTCGCAGCGGTTGCACGCGGTGACCAGCGAGGACCG
GGCCAGCCTGCGGGCCGCCGAGGTGGCGCTCGCCACGCTGTGGCCGGGTGCGACCGGCCCGGACCGGCATC
CGCTCACGGAGCAGGAGGCGGCGAGCCTGCCGGAGGGTCCGCGCCTGCTCGCTGCCGCCGACGATGCCGTC
GGGGCCGCCCTGCGCGGTCGCGCCGAGTACGCCGCGGCCGAGGCGGAGAACGTCCTGCGGCACGCCGATCC
GGCAGCCGGTGGTGACGCCTACGCCGCCATGATCGCCCTGCTGTACACGGAGCACCCCGAGAACGTGCTGT
TCTGGGCCGACAAGCTCGACGCGGGCCGCCCCGACGAGGAGACCAGTTATCCCGGGCTGCGGGCCGAGACC
GCGGTGCGGCTCGGTGACCTGGAAACGGCGATGGAGCTGGGCCGCACGGTGCTGGACCAGCGGCGGCTGCC
GTCCCTGGGTGTCGCCGCGGGCCTGCTCCTGGGCGGCGCGGTGACGGCCGCCATCCGGCTCGGCGACCTCG
ACCGGGCGGAGAAGTGGCTCGCCGAGCCGATCCCCGACGCCATCCGTACCAGCCTCTACGGCCTGCACGTG
CTGGCCGCGCGGGGCCGGCTCGACCTGGCCGCGGGCCGCTACGAGGCGGCGTACACGGCGTTCCGGCTGTG
TGGCGAGCGGATGGCAGGCTGGGATGCCGATGTCTCCGGGCTGGCGCTGTGGCGCGTCGACGCCGCCGAGG
CCCTGCTGTCCGCGGGCATCCGCCCGGACGAGGGCCGCAAGCTCATCGACGACCAGCTCACCCGTGAGATG
GGGGCCCGCTCCCGGGCGCTGACGCTGCGGGCGCAAGCGGCGTACAGCCTGCCGGTGCACCGGGTGGGCCT
GCTCGACGAGGCGGCCGGCCTGCTGCTCGCCTGCCATGACGGGTACGAGCGGGCGCGGGTGCTCGCGGACC
TGGGGGAGACCCTGCGCACGCTGCGGCACACCGACGCGGCCCAGCGGGTGCTCCGGCAGGCCGAGCAGGCG
GCCGCGCGGTGCGGGTCGGTCCCGCTGCTGCGGCGGCTCGGGGCCGAACCCGTACGCATCGGCACCCGGCG
TGGTGAACCCGGCCTGCCGCAGCGGATCAGGCTGCTGACCGATGCCGAGCGGCGGGTTGCCGCGATGGCCG
CCGCCGGGCAGACCAACCGGGAGATCGCCGGTCGGCTCTTCGTCACGGCCAGCACGGTGGAGCAGCACCTG
ACCAGCGTCTTCCGCAAGCTGGGCGTCAAGGGCCGCCGGTTCCTGCCGACCGAGCTCGCCCAAGCCGTCTG
A SEQ ID NO: 18
GTGGTCACCGTCACCGGCCCAATCGCCTGCGGCAAGACAGAACTGCTTGACGCGGCTGCCGCGAAGGCTGA
GGCCATCATTCTGCGCGCGGTCTGCGCGCCAGAAGAGCGGGCTATGCCGTACGCCATGATCGGGCAGCTCA
TCGACGACCCGGCGCTCGCGCATCGGGCGCCGGGGCTGGCTGATCGGATAGCCCAGGGCGGGCAGCTGTCG
CTGAGGGCCGAGAACCGACTGCGCAGGGATCTCACCCGTGCCCTGCTGGCGCTTGCCGTGGACCGGCCTGT
GCTGATCGGCGTCGACGATGTGCATCACGCCGACACCGCCTCTTTGAACTGTCTGCTGCATTTGGCCCGCC
GGGTCCGTCCGGCCCGGATATCCATGATCTTCACCGAGTTGCGCAGCCTCACCCCTACTCAGTCACGGTTC
AAGGCGGAGCTGCTCAGCCTGCCATACCACCACGAGATCGCGCTGCGTCCATTCGGACCGGAGCAATCGGC
GGAGCTGGCTCGCGCCGCCTTCGGCCCGGGCCTCGCCGAGGATGTGCTCGCGGGGTTGTATAAAACGACCA
GGGGCAATCTGAGTCTCAGCCGTGGACTGATCAGCGATGTGCGGGAGGCCCTGGCCAACGGAGAGAGCGCT
TTCGAGGCGGGCCGCGCGTTCCGGCTGGCGTACCTCAGCTCGCTCTACCGCTGTGGCCCGGTCGCGCTGCG
GGTCGCCCGAGTGGCTGCCGTGCTGGGCCCAAGCGCCACCACCACGCTGGTGCGCCGGCTAAGCGGGCTCA
GCGCGGAGACGATAGACCGGGCAACCAAGATCCTCACTGAGGGCGGGCTGCTGCTCGACCAGCAGTTCCCG
CACCCGGCCGCCCGCTCGGTGGTGCTCGATGACATGTCCGCCCAGGAACGACGCAGCCTGCACACTCTCGC
CCTGGAACTGCTGGACGAGGCGCCGGTTGAAGTGCTCGCGCACCACCAGGTCGGCGCCGGTCTCATACACG
GGCCCAAGGCTGCGGAGATGTTCGCCAAGGCCGGCAAGGCTCTGGTCGTACGCAACGAGTTGGGCGACGCG
GCCGAATACCTGCAACTGGCTCACCGGGCCTCCGACGATGTCTCCACCCGGGCCGCCTTACGGGTCGAGGC
CGTGGCCATCGAGCGCCGCCGCAATCCGCTGGCCTCCAGTCGGCACATGGACGAACTGAGCGCCGCCGGCC
GCGCCGGTCTGCTTTCCCCCAAGCATGCGGCGCTGGCCGTCTTCTGGCTAGCCGACGGCGGGCGATCCGGC
GAGGCAGCCGAAGTGCTGGCGTCGGAACGCCCGCTCGCGACCACCGATCAGAACCGGGCCCACCTGCGATT
TGTCGAGGTGACTCTCGCGCTGTTCTCTCCCGGCGCCTTCGGATCGGACCGGCGCCCACCTCCGCTGACGC
CGGACGAACTCGCCAGCCTGCCGAAGGCGGCCTGGCAATGCGCGGTCGCCGACAACGCGGCCATGACCGCC
TTGCACGGCCATCCAGAACTTGCCACCGCTCAGGCGGAAACAGTTCTGCGGCAGGCTGATTCGGCAGCCGA
CGCGATCCCCGCCGCGCTGATCGCCCTGTTGTACGCGGAGAACACCGAGTCCGCTCATATCTGGGCCGACA
AGCTGGGCAGCACGAATGCCGGGGTATCGAACGAGGCGGAAGCGGGCTACGCCGGCCCGTGCGCCGAGATC
GCCCTGCGGCGCGGCGACCTGGCCACGGCGTTCGAGGCTGGTAGCGCCGTCCTGGACGACCGGTCGCTGCC
GTCGCTCGGCATCACCGCCGCATTGCTGTTGAGCAGCAAGACGGCCGCCGCTGTCCGGCTGGGCGAACTCG
AGCGTGCGGAGAAGCTGCTCGCCGAGCCGCTTCCGAACGGCGTCCAGGACAGCCTTTTCGGTCTGCACCTG
CTCTCGGCGTACGGCCAGTACAGCCTCGCGATGGGCCGATATGAATCAGCTCACCGGGCGTTTCGCACCTG
CGGAGAACGTATGCGCAGCTGGGATGTTGACGTGCCTGGTCTGGCCCTGTGGCGTGTCGACGCCGCCGAGG
CGCTGCTCAGCCTCGACCGGAACGAGGGCCAGCGGCTCATCGACGAACAACTCACCCGTCCGATGGGGCCT
CGTTCCCACGCGTTAACGCTGCGGATCAAGGCGGCATACCTCCCGCGGACGAAGCGGATCCCCCTGCTCCA
TGAGGCGGCCGAGCTGCTGCTCCCCTGCCCCGACCCGTACGAGCAAGCGCGGGTGCTCGCCGATCTGGGCG
ACACGCTCAGCGCGCTCAGACGCTATAGCCGGGCGCGGGGAGTTCTCCGGCAGGCTCGTCACCTGGCCACC
CAGTGCGGTGCTGTCCCGCTGCTGCGCAGGCTCGGGGGCGAGCCCGGCCGGATCGACGACGCCGGCCTGCC
GCAGCGGAGCACATCGTTGACCGATGCGGAGCGGCGGGTGGCGGCGCTGGCCGCGGCCGGACAGACCAACC
GGGAGATCGCCGAACAGCTGTTCGTCACGGCCAGCACAGTGGAACAGCACCTCACAAGCGTCTTCCGCAAG
CTGGGCGTCAAGGGCCGCAAGCAGCTGCCGACCGCGCTGGCCGACGTGGAACAGACCTGA SEQ ID
NO: 19
ATGTATAGCGGTACCTGCCGTGAAGGATACGAACTCGTCGCACGCGAGGACGAACTCGGTATTCTACAGAG
GTCTCTGGAACAAGCGAGCAGCGGCCAGGGCGTCGTGGTCACCGTCACCGGCCCAATCGCCTGCGGCAAGA
CAGAACTGCTTGACGCGGCTGCCGCGAAGGCTGAGGCCATCATTCTGCGCGCGGTCTGCGCGCCAGAAGAG
CGGGCTATGCCGTACGCCATGATCGGGCAGCTCATCGACGACCCGGCGCTCGCGCATCGGGCGCCGGGGCT
GGCTGATCGGATAGCCCAGGGCGGGCAGCTGTCGCTGAGGGCCGAGAACCGACTGCGCAGGGATCTCACCC
GTGCCCTGCTGGCGCTTGCCGTGGACCGGCCTGTGCTGATCGGCGTCGACGATGTGCATCACGCCGACACC
GCCTCTTTGAACTGTCTGCTGCATTTGGCCCGCCGGGTCCGTCCGGCCCGGATATCCATGATCTTCACCGA
GTTGCGCAGCCTCACCCCTACTCAGTCACGGTTCAAGGCGGAGCTGCTCAGCCTGCCATACCACCACGAGA
TCGCGCTGCGTCCATTCGGACCGGAGCAATCGGCGGAGCTGGCTCGCGCCGCCTTCGGCCCGGGCCTCGCC
GAGGATGTGCTCGCGGGGTTGTATAAAACGACCAGGGGCAATCTGAGTCTCAGCCGTGGACTGATCAGCGA
TGTGCGGGAGGCCCTGGCCAACGGAGAGAGCGCTTTCGAGGCGGGCCGCGCGTTCCGGCTGGCGTACCTCA
GCTCGCTCTACCGCTGTGGCCCGGTCGCGCTGCGGGTCGCCCGAGTGGCTGCCGTGCTGGGCCCAAGCGCC
ACCACCACGCTGGTGCGCCGGCTAAGCGGGCTCAGCGCGGAGACGATAGACCGGGCAACCAAGATCCTCAC
TGAGGGCGGGCTGCTGCTCGACCAGCAGTTCCCGCACCCGGCCGCCCGCTCGGTGGTGCTCGATGACATGT
CCGCCCAGGAACGACGCAGCCTGCACACTCTCGCCCTGGAACTGCTGGACGAGGCGCCGGTTGAAGTGCTC
GCGCACCACCAGGTCGGCGCCGGTCTCATACACGGGCCCAAGGCTGCGGAGATGTTCGCCAAGGCCGGCAA
GGCTCTGGTCGTACGCAACGAGTTGGGCGACGCGGCCGAATACCTGCAACTGGCTCACCGGGCCTCCGACG
ATGTCTCCACCCGGGCCGCCCTGCGGGTCGAGGCCGTGGCCATCGAGCGCCGCCGCAATCCGCTGGCCTCC
AGTCGGCACATGGACGAACTGAGCGCCGCCGGCCGCGCCGGTCTGCTTTCCCCCAAGCATGCGGCGCTGGC
CGTCTTCTGGCTAGCCGACGGCGGGCGATCCGGCGAGGCAGCCGAAGTGCTGGCGTCGGAACGCCCGCTCG
CGACCACCGATCAGAACCGGGCCCACCTGCGATTTGTCGAGGTGACTCTCGCGCTGTTCTCTCCCGGCGCC
TTCGGATCGGACCGGCGCCCACCTCCGCTGACGCCGGACGAACTCGCCAGCCTGCCGAAGGCGGCCTGGCA
ATGCGCGGTCGCCGACAACGCGGCCATGACCGCCTTGCACGGCCATCCAGAACTTGCCACCGCTCAGGCGG
AAACAGTTCTGCGGCAGGCTGATTCGGCAGCCGACGCGATCCCCGCCGCGCTGATCGCCCTGTTGTACGCG
GAGAACACCGAGTCCGCTCATATCTGGGCCGACAAGCTGGGCAGCACGAATGCCGGGGTATCGAACGAGGC
GGAAGCGGGCTACGCCGGCCCGTGCGCCGAGATCGCCCTGCGGCGCGGCGACCTGGCCACGGCGTTCGAGG
CTGGTAGCGCCGTCCTGGACGACCGGTCGCTGCCGTCGCTCGGCATCACCGCCGCATTGCTGTTGAGCAGC
AAGACGGCCGCCGCTGTCCGGCTGGGCGAACTCGAGCGTGCGGAGAAGCTGCTCGCCGAGCCGCTTCCGAA
CGGCGTCCAGGACAGCCTTTTCGGTCTGCACCTGCTCTCGGCGTACGGCCAGTACAGCCTCGCGATGGGCC
GATATGAATCAGCTCACCGGGCGTTTCGCACCTGCGGAGAACGTATGCGCAGCTGGGATGTTGACGTGCCT
GGTCTGGCCCTGTGGCGTGTCGACGCCGCCGAGGCGCTGCTCAGCCTCGACCGGAACGAGGGCCAGCGGCT
CATCGACGAACAACTCACCCGTCCGATGGGGCCTCGTTCCCACGCGCTGACGCTGCGGATCAAGGCGGCAT
ACCTCCCGCGGACGAAGCGGATCCCCCTGCTCCATGAGGCGGCCGAGCTGCTGCTCCCCTGCCCCGACCCG
TACGAGCAAGCGCGGGTGCTCGCCGATCTGGGCGACACGCTCAGCGCGCTCAGACGCTATAGCCGGGCGCG
GGGAGTTCTCCGGCAGGCTCGTCACCTGGCCACCCAGTGCGGTGCTGTCCCGCTGCTGCGCAGGCTCGGGG
GCGAGCCCGGCCGGATCGACGACGCCGGCCTGCCGCAGCGGAGCACATCGTTGACCGATGCGGAGCGGCGG
GTGGCGGCGCTGGCCGCGGCCGGACAGACCAACCGGGAGATCGCCGAACAGCTGTTCGTCACGGCCAGCAC
AGTGGAACAGCACCTCACAAGCGTCTTCCGCAAGCTGGGCGTCAAGGGCCGCAAGCAGCTGCCGACCGCGC
TGGCCGACGTGGAACAGACCTGA SEQ ID NO: 20
GTGTATAGCGGTACCTGCCGTGAAGGATACGAACTCGTCGCCCGCGAGGACGAACTCGGCATTCTGCAGAG
GTCTCTGGAAGAAGCAGGCAGCGGCCAGGGCGCCGTGGTCACCGTCACCGGCCCGATCGCCTGCGGCAAGA
CAGAACTGCTTGACGCGGCTGCCGCGAAGGCTGACGCCATCATTCTGCGCGCGGTCTGCGCGCCCGAAGAG
CGCGCTATGCCGTACGCCATGATCGGGCAGCTCATCGACGACCCGGCGCTCGCGCATCGGGCGCCGGAGCT
GGCTGATCGGATAGCCCAGGGCGGGCATCTGTCGCTGAGGGCCGAGAACCGACTGCGCAGGGATCTCACCC
GTGCCCTGCTGGCGCTTGCCGTCGACCGGCCTGTGCTGATCGGCGTCGACGATGTGCATCACGCCGACACC
GCCTCTTTGAACTGTCTGCTGCATTTAGCCCGCCGGGTCCGTCCGGCCCGGATATCCATGATCTTCACCGA
GTTGCGCAGCCTCACCCCTACTCAGTCACGATTCAAGGCGGAGCTGCTCAGCCTGCCGTACCACCACGAGA
TCGCGCTGCGTCCACTCGGACCGGAGCAATCGGCGGAGCTGGCCCACGCCGCCTTCGGCCCGGGCCTCGCC
GAGGATGTGCTCGCGGGGTTGTATGGGATGACCAGGGGCAACCTGAGTCTCAGCCGTGGACTGATCAGCGA
TGTGCGGGAGGCCCAGGCCAACGGAGAGAGCGCTTTCGAGGTGGGCCGCGCGTTCCGGCTGGCGTACCTCA
GCTCGCTCTACCGCTGTGGCCCGATCGCGCTGCGGGTCGCCCGAGTGGCTGCCGTGCTGGGCCCAAGCGCC
ACCACCACGCTGGTGCGCCGTCTAAGCGGGCTCAGCGCGGAGACGATAGACCGGGCAACCAAGATCCTCAC
TGAGGGCGGGCTGCTGCTCGACCACCAGTTCCCGCACCCGGCCGCCCGCTCGGTGGTGCTCGATGACATGT
CCGCCCAGGAACGACGCAGCCTGCACACTCTCGCCCTGGAACTGCTGGACGAGGCGCCGGTTGAAGTGCTC
GCGCACCACCAGGTCGGCGCCGGTCTCATACACGGGCCCAAGGCTGCGGAGATATTCGCCAGGGCTGGCCA
GGCTCTGGTTGTACGCAACGAGTTGGGCGACGCGGCCGAATACCTGCAACTGGCTCACCGAGCCTCCGACG
ATGTCTCCACCCGGGCCGCCTTACGGGTCGAGGCCGTGGCAATCGAGCGCCGCCGCAATCCGCTGGCCTCC
AGTCGTCACATGGACGAGCTGAGCGCCGCCGGCCGCGCCGGTCTGCTTTCCCCCAAGCATGCAGCGCTGGC
TGTCTTCTGGCTGGCCGACGGCGGGCGATCCGGCGAGGCAGCCGAGGTGCTGGCGTCGGAACACCCGCTCG
CGACCACCGATCAGAACCGAGCACACCTGCGATTTGCCGAGGTGACTCTCGCGCTGTTCTGTCCCGGCGCC
TTCGGGTCGGACCGGCGCCCACCTCCGCTGGCGCCGGACGAGCTCGCCAGCTTGCCGAAGGCGGCCTGGCA
ATGCGCGGTCGCCGACAACGCGGTCATGACAGCGTTGCATGCTCATCCAGAACTTGCCACCGCTCAGGCGG
AAACAGTTCTGCGGCAGGCTGATTCGGCAGCCGACGCAATCCCCGCCGCACTGATCGCCCTGTTGTACGCA
GAGAACACCGAGTCCGCTCAGATCTGGGCCGACAAGCTGGGCAGCACCAATGCCGGGGTATCGAACGAGGC
GGAAGCGGGCTACGCCGGCCCGTGCGCCGAGATCGCCCTGCGGCGCGGCGACCTGGCCACGGCGTTCGAGG
CTGGTGGCACCGTCCTGGACGACCGGCCGCTGCCGTCGCTCGGCATCACCGCCGCATTGCTGTTGAGCAGC
AAGACGGCAGCCGCTGTCCGCCTGGGCGAACTCGAGCGTGCGGAGAAGCTGCTCGCTGAGCCGCTTCCGAA
CGGTGTCCAGGACAGCCTTTTCGGTCTGCACCTGCTCTCGGCGCACGGCCAGTACAGCCTCGCGATGGGCC
GATATGAATCGGCTCACCGGGCGTTTCACACCTGCGGAGAACGTATGCGCAGCTGGGGTGTTGACGTGCCT
GGTCTAGCCCTGTGGCGTGTCGACGCCGCCGAGGCACTGCTCAGCCTCGACCGGAACGAGGGCCAGCGGCT
CATCGACGAACAACTCGCCCGTCCGATGGGACCTCGTTCCCGCGCATTAACGCTGCGGATCAAGGCGGCAT
ACCTCCCGCGGACGAAGCGGATCCCCCTGCTCCATGAGGCAGCTGAGCTGCTGCTCTCCTGCCCCGACCCG
TACGAGCAAGCGCGGGTGCTCGCCGATCTGGGCGACACGCTCAGCGCGCTCAGACGCTATAGCCGGGCGCG
GGGAGTTCTCCGGCAGGCTCGTCACCTGGCCACCCAGTGCGGTGCTGTCCCGCTGCTGCGCCGACTCGGGG
GCGAGCCCGGCCGGATCGACGACGCCGGCCTGCCGCAGCGGAGCACATCGTTGACCGATGCGGAGCGGCGG
GTGTCGGCCCTGGCCGCGGCCGGACAGACCAACCGGGAGATCGCCAAACAGCTATTCGTCACGGCCAGCAC
CGTGGAACAGCACCTCACAAGCGTCTTCCGCAAGCTGGGCGTTAAGGGCCGCAGGCAGCTACCGACCGCGC
TGGCCGACGTGGAATAG SEQ ID NO: 21
ATGTATAGCGGTACCTGCCGTGAAGGATACGAACTCGTCGCCCGCGAGGACGAACTCGGCATTCTGCAGAG
GTCTCTGGAAGAAGCAGGCAGCGGCCAGGGCGCCGTGGTCACCGTCACCGGCCCGATCGCCTGCGGCAAGA
CAGAACTGCTTGACGCGGCTGCCGCGAAGGCTGACGCCATCATTCTGCGCGCGGTCTGCGCGCCCGAAGAG
CGCGCTATGCCGTACGCCATGATCGGGCAGCTCATCGACGACCCGGCGCTCGCGCATCGGGCGCCGGAGCT
GGCTGATCGGATAGCCCAGGGCGGGCATCTGTCGCTGAGGGCCGAGAACCGACTGCGCAGGGATCTCACCC
GTGCCCTGCTGGCGCTTGCCGTCGACCGGCCTGTGCTGATCGGCGTCGACGATGTGCATCACGCCGACACC
GCCTCTTTGAACTGTCTGCTGCATCTGGCCCGCCGGGTCCGTCCGGCCCGGATATCCATGATCTTCACCGA
GTTGCGCAGCCTCACCCCTACTCAGTCACGATTCAAGGCGGAGCTGCTCAGCCTGCCGTACCACCACGAGA
TCGCGCTGCGTCCACTCGGACCGGAGCAATCGGCGGAGCTGGCCCACGCCGCCTTCGGCCCGGGCCTCGCC
GAGGATGTGCTCGCGGGGTTGTATGGGATGACCAGGGGCAACCTGAGTCTCAGCCGTGGACTGATCAGCGA
TGTGCGGGAGGCCCAGGCCAACGGAGAGAGCGCTTTCGAGGTGGGCCGCGCGTTCCGGCTGGCGTACCTCA
GCTCGCTCTACCGCTGTGGCCCGATCGCGCTGCGGGTCGCCCGAGTGGCTGCCGTGCTGGGCCCAAGCGCC
ACCACCACGCTGGTGCGCCGTCTAAGCGGGCTCAGCGCGGAGACGATAGACCGGGCAACCAAGATCCTCAC
TGAGGGCGGGCTGCTGCTCGACCACCAGTTCCCGCACCCGGCCGCCCGCTCGGTGGTGCTCGATGACATGT
CCGCCCAGGAACGACGCAGCCTGCACACTCTCGCCCTGGAACTGCTGGACGAGGCGCCGGTTGAAGTGCTC
GCGCACCACCAGGTCGGCGCCGGTCTCATACACGGGCCCAAGGCTGCGGAGATATTCGCCAGGGCTGGCCA
GGCTCTGGTTGTACGCAACGAGTTGGGCGACGCGGCCGAATACCTGCAACTGGCTCACCGAGCCTCCGACG
ATGTCTCCACCCGGGCCGCCCTGCGGGTCGAGGCCGTGGCAATCGAGCGCCGCCGCAATCCGCTGGCCTCC
AGTCGTCACATGGACGAGCTGAGCGCCGCCGGCCGCGCCGGTCTGCTTTCCCCCAAGCATGCAGCGCTGGC
TGTCTTCTGGCTGGCCGACGGCGGGCGATCCGGCGAGGCAGCCGAGGTGCTGGCGTCGGAACACCCGCTCG
CGACCACCGATCAGAACCGAGCACACCTGCGATTTGCCGAGGTGACTCTCGCGCTGTTCTGTCCCGGCGCC
TTCGGGTCGGACCGGCGCCCACCTCCGCTGGCGCCGGACGAGCTCGCCAGCTTGCCGAAGGCGGCCTGGCA
ATGCGCGGTCGCCGACAACGCGGTCATGACAGCGTTGCATGCTCATCCAGAACTTGCCACCGCTCAGGCGG
AAACAGTTCTGCGGCAGGCTGATTCGGCAGCCGACGCAATCCCCGCCGCACTGATCGCCCTGTTGTACGCA
GAGAACACCGAGTCCGCTCAGATCTGGGCCGACAAGCTGGGCAGCACCAATGCCGGGGTATCGAACGAGGC
GGAAGCGGGCTACGCCGGCCCGTGCGCCGAGATCGCCCTGCGGCGCGGCGACCTGGCCACGGCGTTCGAGG
CTGGTGGCACCGTCCTGGACGACCGGCCGCTGCCGTCGCTCGGCATCACCGCCGCATTGCTGTTGAGCAGC
AAGACGGCAGCCGCTGTCCGCCTGGGCGAACTCGAGCGTGCGGAGAAGCTGCTCGCTGAGCCGCTTCCGAA
CGGTGTCCAGGACAGCCTTTTCGGTCTGCACCTGCTCTCGGCGCACGGCCAGTACAGCCTCGCGATGGGCC
GATATGAATCGGCTCACCGGGCGTTTCACACCTGCGGAGAACGTATGCGCAGCTGGGGTGTTGACGTGCCT
GGTCTAGCCCTGTGGCGTGTCGACGCCGCCGAGGCACTGCTCAGCCTCGACCGGAACGAGGGCCAGCGGCT
CATCGACGAACAACTCGCCCGTCCGATGGGACCTCGTTCCCGCGCACTGACGCTGCGGATCAAGGCGGCAT
ACCTCCCGCGGACGAAGCGGATCCCCCTGCTCCATGAGGCAGCTGAGCTGCTGCTCTCCTGCCCCGACCCG
TACGAGCAAGCGCGGGTGCTCGCCGATCTGGGCGACACGCTCAGCGCGCTCAGACGCTATAGCCGGGCGCG
GGGAGTTCTCCGGCAGGCTCGTCACCTGGCCACCCAGTGCGGTGCTGTCCCGCTGCTGCGCCGACTCGGGG
GCGAGCCCGGCCGGATCGACGACGCCGGCCTGCCGCAGCGGAGCACATCGTTGACCGATGCGGAGCGGCGG
GTGTCGGCCCTGGCCGCGGCCGGACAGACCAACCGGGAGATCGCCAAACAGCTATTCGTCACGGCCAGCAC
CGTGGAACAGCACCTCACAAGCGTCTTCCGCAAGCTGGGCGTTAAGGGCCGCAGGCAGCTACCGACCGCGC
TGGCCGACGTGGAATAG SEQ ID NO: 22
GTGTATAGCGGTACCTGCCGTGAAGGATACGAACTCGTCGCACGCGAGGACGAACTCGGCATTCTACAGAG
GTCTCTGGAACAAGCGAGCAGCGGCCAGGGCGTCGTGGTCACCGTCACCGGCCCAATCGCCTGCGGCAAGA
CAGAACTGCTTGACGCGGCTGCCGCGAAGGCTGAGGCCATCATTCTGCGCGCGGTCTGCGCGCCCGAAGAG
CGGGCTATGCCGTACGCCATGATCGGGCAGCTCATCGACGACCCGGCGCTCGCGCATCGGGCGCCGGGGCT
GGCTGATCGGATAGCCCAGGGCGGGCAGCTGTCGCTGAGGGCCGAGAACCGACTGCGCAGGGATCTCACCC
GTGCCCTGCTGGCGCTTGCCGTGCACCGGCCTGTGCTGATCGGCGTCGATGATGTGCATCACGCCGACACC
GCCTCTTTGAACTGTCTGCTGCATTTGGCGCGCCGGGTCCGTCCGGCCCGGATATCCATGATCTTCACCGA
GTTGCGCAGCCTCACCCCTACTCAGTCACGATTCAAGGCGGAGCTGCTCAGCCTGCCGTACCACCACGAGA
TCGCGCTGCGTCCATTCGGACCGGAGCAATCGGCGGAGCTGGCTCGCGCCGCCTTCGGCCCGGGCCTCGCC
GAGGATGTGCTCGCGGGGTTGTATAAAACGACCAGGGGCAATCTGAGTCTCAGCCGTGGACTGATCAGCGA
TGTGCGGGAGGCCCTGGCCAACGGAGAGAGCGCTTTCGAGGCGGGCCGCGCGTTCCGGCTGGCGTACCTCA
GCTCGCTCTACCGCTGTGGCCCGGTCGCGCTGCGGGTCGCCCGAGTGGCTGCCGTGCTGGGCCCAAGCGCC
ACCACCACGCTGGTGCGCCGGCTAAGCGGGCTCAGCGCGGAGACGATAGACCGGGCAACCAAGATCCTCAC
CGAGGGCGGGCTGCTGCTCGACCAGCAGTTTCCGCACCCGGCCGCCCGCTCGGTGGTGCTCGATGACATGT
CCGCCCAGGAACGACGCGGCCTGCACACTCTCGCCCTGGAACTGCTGGACGAGGCGCCGGTTGAAGTGCTC
GCGCACCACCAGGTCGGCGCCGGTCTCATACACGGGCCCAAGGCTGCGGAGATGTTCGCCAAGGCCGGCAA
GGCTCTGGTCGTACGCAACGAGTTGGGCGACGCGGCCGAATACCTGCAACTGGCTCACCGGGCCTCCGACG
ATGTCTCCACCCGGGCCGCCTTACGGGTCGAGGCCGTGGCGATCGAGCGCCGCCGCAATCCGCTGGCCTCC
AGTCGGCACATGGACGAGCTGAGCGCCGCCGGCCGCGCCGGTCTGCTTTCCCCCAAGCATGCGGCGCTGGC
CGTCTTCTGGCTGGCCGACGGCGGGCGATCCGGCGAGGCAGCCCAGGTGCTGGCGTCGGAACGCCCGCTCG
CGACCACCGATCAGAACCGGGCCCACCTGCGATTTGTCGAGGTGACTCTCGCGCTGTTCTCTCCCGGCGCC
TTCGGATCGGACCGGCGCCCACCTCCGCTGACGCCGGACGAACTCGCCAGCCTGCCGAAGGCGGCCTGGCA
ATGCGCGGTCGCCGACAACGCGGCCATGACCGCCTTGCACGGCCATCCAGAACTTGCCACCGCTCAGGCGG
AAACAGTTCTGCGGCAGGCTGATTCGGCAGCCGACGCGATCCCCGCCGCGCTGATCGCCCTGTTGTACGCG
GAGAACACCGAGTCCGCTCATATCTGGGCCGACAAGCTGGGCAGCATGAATGCCGGGGTATCGAACGAGGC
GGAAGCGGGCTACGCCGGCCCGTGCGCCGAGATCGCCCTGCGGCGCGGCGACCTGGCCACGGCGTTCGAGG
CTGGTAGCACCGTCCTGGACGACCGGTCACTGCCGTCGCTCGGCATCACCGCCGCATTGCTGTTGAGCAGC
AAGACGGCCGCCGCTGTCCGGCTGGGCGAACTCGAGCGTGCGGAGAAGCTGCTCGCCGAGCCGCTTCCGAA
CGGCGTCCAGGACAGCCTTTTCGGTCTGCACCTGCTCTCGGCGTACGGCCAGTACAGCCTCGCGATGGGCC
GATATGAATCGGCTCACCGGGCGTTTCGCACCTGCGGAGAACGTATGCGCAGCTGGGATGTTGACGTGCCT
GGTCTGGCCCTGTGGCGTGTCGACGCCGCCGAGGCGCTGCTCAGCCTCGACCGGAACGAGGGCCAGCGGCT
CATCGACGAACAACTCACCCGTCCGATGGGACCTCGTTCCCGCGCGTTAACGCTGCGGATCAAGGCGGCAT
ACCTCCCGCGGACGAAGCGGATCCCCCTGCTCCATGAGGCGGCCGAGCTGCTGCTCCCCTGCCCCGACCCG
TACGAGCAAGCGCGGGTGCTCGCCGATCTGGGCGACACGCTCAGCGCGCTCAGACGCTATAGCCGGGCGCG
GGGAGTTCTCCGGCAGGCTCGTCACCTGGCCACCCAGTGCGGTGCTGTCCCGCTGCTGCGCCGACTCGGGG
GCGAGCCCGGCCGGATCGACGACGCCGGCCTGCCGCAGCGGAGCACATCGTTGACCGATGCGGAGCGGCGG
GTGGCGGCGCTGGCCGCGGCCGGACAGACCAACCGGGAGATCGCCGAACAGCTGTTCGTCACGGCCAGCAC
AGTGGAACAGCACCTCACAAGCGTCTTCCGCAAGCTGGGCGTCAAGGGCCGCAAGCAGCTGCCGACCGCGC
TGGCCGACGTGGAACAGACCTGA SEQ ID NO: 23
ATGTATAGCGGTACCTGCCGTGAAGGATACGAACTCGTCGCACGCGAGGACGAACTCGGCATTCTACAGAG
GTCTCTGGAACAAGCGAGCAGCGGCCAGGGCGTCGTGGTCACCGTCACCGGCCCAATCGCCTGCGGCAAGA
CAGAACTGCTTGACGCGGCTGCCGCGAAGGCTGAGGCCATCATTCTGCGCGCGGTCTGCGCGCCCGAAGAG
CGGGCTATGCCGTACGCCATGATCGGGCAGCTCATCGACGACCCGGCGCTCGCGCATCGGGCGCCGGGGCT
GGCTGATCGGATAGCCCAGGGCGGGCAGCTGTCGCTGAGGGCCGAGAACCGACTGCGCAGGGATCTCACCC
GTGCCCTGCTGGCGCTTGCCGTGCACCGGCCTGTGCTGATCGGCGTCGATGATGTGCATCACGCCGACACC
GCCTCTTTGAACTGTCTGCTGCATTTGGCGCGCCGGGTCCGTCCGGCCCGGATATCCATGATCTTCACCGA
GTTGCGCAGCCTCACCCCTACTCAGTCACGATTCAAGGCGGAGCTGCTCAGCCTGCCGTACCACCACGAGA
TCGCGCTGCGTCCATTCGGACCGGAGCAATCGGCGGAGCTGGCTCGCGCCGCCTTCGGCCCGGGCCTCGCC
GAGGATGTGCTCGCGGGGTTGTATAAAACGACCAGGGGCAATCTGAGTCTCAGCCGTGGACTGATCAGCGA
TGTGCGGGAGGCCCTGGCCAACGGAGAGAGCGCTTTCGAGGCGGGCCGCGCGTTCCGGCTGGCGTACCTCA
GCTCGCTCTACCGCTGTGGCCCGGTCGCGCTGCGGGTCGCCCGAGTGGCTGCCGTGCTGGGCCCAAGCGCC
ACCACCACGCTGGTGCGCCGGCTAAGCGGGCTCAGCGCGGAGACGATAGACCGGGCAACCAAGATCCTCAC
CGAGGGCGGGCTGCTGCTCGACCAGCAGTTTCCGCACCCGGCCGCCCGCTCGGTGGTGCTCGATGACATGT
CCGCCCAGGAACGACGCGGCCTGCACACTCTCGCCCTGGAACTGCTGGACGAGGCGCCGGTTGAAGTGCTC
GCGCACCACCAGGTCGGCGCCGGTCTCATACACGGGCCCAAGGCTGCGGAGATGTTCGCCAAGGCCGGCAA
GGCTCTGGTCGTACGCAACGAGTTGGGCGACGCGGCCGAATACCTGCAACTGGCTCACCGGGCCTCCGACG
ATGTCTCCACCCGGGCCGCCCTGCGGGTCGAGGCCGTGGCGATCGAGCGCCGCCGCAATCCGCTGGCCTCC
AGTCGGCACATGGACGAGCTGAGCGCCGCCGGCCGCGCCGGTCTGCTTTCCCCCAAGCATGCGGCGCTGGC
CGTCTTCTGGCTGGCCGACGGCGGGCGATCCGGCGAGGCAGCCCAGGTGCTGGCGTCGGAACGCCCGCTCG
CGACCACCGATCAGAACCGGGCCCACCTGCGATTTGTCGAGGTGACTCTCGCGCTGTTCTCTCCCGGCGCC
TTCGGATCGGACCGGCGCCCACCTCCGCTGACGCCGGACGAACTCGCCAGCCTGCCGAAGGCGGCCTGGCA
ATGCGCGGTCGCCGACAACGCGGCCATGACCGCCTTGCACGGCCATCCAGAACTTGCCACCGCTCAGGCGG
AAACAGTTCTGCGGCAGGCTGATTCGGCAGCCGACGCGATCCCCGCCGCGCTGATCGCCCTGTTGTACGCG
GAGAACACCGAGTCCGCTCATATCTGGGCCGACAAGCTGGGCAGCATGAATGCCGGGGTATCGAACGAGGC
GGAAGCGGGCTACGCCGGCCCGTGCGCCGAGATCGCCCTGCGGCGCGGCGACCTGGCCACGGCGTTCGAGG
CTGGTAGCACCGTCCTGGACGACCGGTCACTGCCGTCGCTCGGCATCACCGCCGCATTGCTGTTGAGCAGC
AAGACGGCCGCCGCTGTCCGGCTGGGCGAACTCGAGCGTGCGGAGAAGCTGCTCGCCGAGCCGCTTCCGAA
CGGCGTCCAGGACAGCCTTTTCGGTCTGCACCTGCTCTCGGCGTACGGCCAGTACAGCCTCGCGATGGGCC
GATATGAATCGGCTCACCGGGCGTTTCGCACCTGCGGAGAACGTATGCGCAGCTGGGATGTTGACGTGCCT
GGTCTGGCCCTGTGGCGTGTCGACGCCGCCGAGGCGCTGCTCAGCCTCGACCGGAACGAGGGCCAGCGGCT
CATCGACGAACAACTCACCCGTCCGATGGGACCTCGTTCCCGCGCGCTGACGCTGCGGATCAAGGCGGCAT
ACCTCCCGCGGACGAAGCGGATCCCCCTGCTCCATGAGGCGGCCGAGCTGCTGCTCCCCTGCCCCGACCCG
TACGAGCAAGCGCGGGTGCTCGCCGATCTGGGCGACACGCTCAGCGCGCTCAGACGCTATAGCCGGGCGCG
GGGAGTTCTCCGGCAGGCTCGTCACCTGGCCACCCAGTGCGGTGCTGTCCCGCTGCTGCGCCGACTCGGGG
GCGAGCCCGGCCGGATCGACGACGCCGGCCTGCCGCAGCGGAGCACATCGTTGACCGATGCGGAGCGGCGG
GTGGCGGCGCTGGCCGCGGCCGGACAGACCAACCGGGAGATCGCCGAACAGCTGTTCGTCACGGCCAGCAC
AGTGGAACAGCACCTCACAAGCGTCTTCCGCAAGCTGGGCGTCAAGGGCCGCAAGCAGCTGCCGACCGCGC
TGGCCGACGTGGAACAGACCTGA SEQ ID NO: 24
GTGCGAGCTATTAATGCGTCCGACACCGGTCCTGAACTGGTCGCCCGCGAAGACGAACTGGGACGTGTACG
AAGTGCCCTGAACCGAGCGAACGGCGGCCAAGGTGTCCTGATCTCCATTACCGGTCCGATCGCCTGCGGCA
AGACCGAACTGCTTGAGGCTGCCGCCTCGGAAGTTGACGCCATCACTCTGCGCGCGGTCTGTGCCGCCGAG
GAACGGGCGATACCTTATGCCCTGATCGGGCAGCTTATCGACAACCCCGCGCTCGGCATTCCGGTTCCGGA
TCCGGCCGGCCTGACCGCCCAGGGCGGACGACTGTCATCGAGCGCCGAGAACCGACTGCGTCGCGACCTCA
CCCGTGCCCTGCTGACGCTCGCCACCGACCGGCTGGTGCTGATCTGTGTCGATGACGTGCAGCACGCCGAC
AACGCCTCGTTGAGCTGCCTTCTGTATCTGGCCCGACGGCTTGTCCCGGCTCGAATCGCTCTGGTATTCAC
CGAGTTGCGAGTCCTCACCTCGTCTCAGTTACGGTTCAACGCGGAGCTGCTCAGCTTGCGGAACCACTGCG
AGATCGCGCTGCGCCCACTCGGCCCGGGGCATGCGGCCGAGCTGGCCCGCGCCACCCTCGGCCCCGGCCTC
TCCGACGAAACACTCACGGAGCTGTACCGGGTGACCGGAGGCAACCTGAGTCTCAGCCGCGGGCTGATCGA
CGATGTGCGGGACGCCTGGGCACGAGGGGAAACGGGCGTCCAGGTGGGCCGGGCGTTCCGGCTGGCCTACC
TCGGTTCCCTCCACCGCTGTGGTCCGCTGGCGTTGCGGGTCGCCCGCGTAGCCGCCGTACTGGGCCCGAGC
GCCACCAGCGTCCTGGTGCGCCGGATCAGTGGGCTCAGCGCGGAGGCCATGGCCCAGGCGACCGATATCCT
CGCTGACGGCGGCCTCCTGCGCGACCAGCGGTTCACACATCCAGCGGCCCGCTCGGTGGTGCTCGACGACA
TGTCCGCCGAGGAACGACGCAGCGTGCACAGCCTCGCCCTGGAACTGCTGGACGAGGCACCGGCCGAGATG
CTCGCGCACCACCGGGTCGGCGCCGGTCTCGTGCACGGGCCGAAGGCCGCGGAGACATTCACCGGGGCCGG
CCGGGCACTGGCCGTTCGCGGCATGCTGGGCGAGGCAGCCGACTACCTGCAACTGGCGTACCGGGCCTCCG
GCGACGCCGCTACCAAGGCCGCGATACGCGTCGAGTCCGTGGCGGTCGAGCGCCGACGCAATCCGCTGGTC
GTCAGTCGCCATTGGGACGAGCTGAGCGTCGCGGCCCGCGCCGGTCTGCTCTCCTGCGAGCACGTGTCCAG
GACGGCCCGCTGGCTGACCGTCGGTGGGCGGCCCGGCGAGGCGGCCAGGGTGCTGGCGTCGCAACACCGAC
GGGTCGTCACCGATCAGGACCGGGCCCACCTGCGGGTCGCCGAGTTCTCGCTCGCGCTGCTGTACCCCGGT
ACGTCCGGCTCGGACCGGCGCCCGCACCCGCTCACGTCGGACGAACTCGCGGCCCTACCGACTGCGACCAG
ACACTGCGCGATCGCCGATAACGCTGTCATGGCTGCCTTGCGTGGTCATCCGGAGCTTGCCACCGCCGAGG
CAGAAGCCGTTCTGCAGCAAGCCGACGCGGCGGACGGCGCTGCTCTCACCGCGCTGATGGCCCTGCTGTAC
GCGGAGAGCATCGAGGTCGCTGAAGTCTGGGCGGACAAGCTGGCGGCAGAGGCCGGAGCATCGAACGGGCA
GGACGCGGAGTACGCCGGTATACGCGCCGAAATCGCCCTGCGGCGCGGCGATCTGACCGCGGCCGTCGAGA
CCGCCGGCATGGTCCTGGACGGCCGGCCGCTGCCGTCGCTCGACATCACCGCCACGTTGCTGTTGGCCGGC
AGGGCGTCCGTCGCCGTCCGGCTGGGCGAACTCGACCACGCGGAGGAGCTGTTCGCCGCGCCGCCGGAGGA
CGCCTTCCAGGACAGCCTCTTCGGTCTGCATCTGCTCTCGGCGCACGGCCAGTACAGCCTCGCGACAGGCC
GGCCCGAGTCGGCATACCGGGCCTTTCGTGCCTGCGGCGAACGTATGCGCGATTGGGGCTTCGACGCGCCC
GGTGTGGCCCTGTGGCGCGTCGGCGCCGCCGAGGCGCTGCTCGGCCTCGACCGGAACGAGGGCCGACGGCT
CATCGACGAACAGCTGAGCCGGACGATGGCCCCCCGGTCCCACGCGTTGACGCTGCGGATAAAAGCGGCGT
ACATGCCGGAGCCGAAGCGGGTCGACCTGCTCTACGAAGCGGCTGAGCTGCTGCTCTCCTGCCGGGACCAG
TATGAGCGAGCGCGGGTGCTCGCCGATCTGGGCGAGGCGCTCAGCGCGCTCGGGAACTACCGGCAGGCGCG
AGGTGTGCTCCGGCAGGCTCGGCATCTGGCCATGCGAACCGGCGCGGACCCGCTGCTGCGCCGGCTCGGAA
TCAGGCCCGGCCGGCAGGACGACCCCGACCCGCAGCCGCGGAGCAGATCGCTGACCAACGCTGAGCGGCGT
GCGGCGTCGCTGGCCGCGACCGGACTGACCAACCGGGAGATCGCCGACCGGCTCTTCGTCACCGCCAGCAC
CGTGGAGCAGCACCTCACCAACGTCTTCCGCAAGCTGGGCGTCAAGGGCCGCAAGCAGCTGCCGGCCGAGT
TGGACGACATGGAATAG SEQ ID NO: 25
ATGCGAGCTATTAATGCGTCCGACACCGGTCCTGAACTGGTCGCCCGCGAAGACGAACTGGGACGTGTACG
AAGTGCCCTGAACCGAGCGAACGGCGGCCAAGGTGTCCTGATCTCCATTACCGGTCCGATCGCCTGCGGCA
AGACCGAACTGCTTGAGGCTGCCGCCTCGGAAGTTGACGCCATCACTCTGCGCGCGGTCTGTGCCGCCGAG
GAACGGGCGATACCTTATGCCCTGATCGGGCAGCTTATCGACAACCCCGCGCTCGGCATTCCGGTTCCGGA
TCCGGCCGGCCTGACCGCCCAGGGCGGACGACTGTCATCGAGCGCCGAGAACCGACTGCGTCGCGACCTCA
CCCGTGCCCTGCTGACGCTCGCCACCGACCGGCTGGTGCTGATCTGTGTCGATGACGTGCAGCACGCCGAC
AACGCCTCGTTGAGCTGCCTTCTGTATCTGGCCCGACGGCTTGTCCCGGCTCGAATCGCTCTGGTATTCAC
CGAGTTGCGAGTCCTCACCTCGTCTCAGCTGCGGTTCAACGCGGAGCTGCTCAGCTTGCGGAACCACTGCG
AGATCGCGCTGCGCCCACTCGGCCCGGGGCATGCGGCCGAGCTGGCCCGCGCCACCCTCGGCCCCGGCCTC
TCCGACGAAACACTCACGGAGCTGTACCGGGTGACCGGAGGCAACCTGAGTCTCAGCCGCGGGCTGATCGA
CGATGTGCGGGACGCCTGGGCACGAGGGGAAACGGGCGTCCAGGTGGGCCGGGCGTTCCGGCTGGCCTACC
TCGGTTCCCTCCACCGCTGTGGTCCGCTGGCGTTGCGGGTCGCCCGCGTAGCCGCCGTACTGGGCCCGAGC
GCCACCAGCGTCCTGGTGCGCCGGATCAGTGGGCTCAGCGCGGAGGCCATGGCCCAGGCGACCGATATCCT
CGCTGACGGCGGCCTCCTGCGCGACCAGCGGTTCACACATCCAGCGGCCCGCTCGGTGGTGCTCGACGACA
TGTCCGCCGAGGAACGACGCAGCGTGCACAGCCTCGCCCTGGAACTGCTGGACGAGGCACCGGCCGAGATG
CTCGCGCACCACCGGGTCGGCGCCGGTCTCGTGCACGGGCCGAAGGCCGCGGAGACATTCACCGGGGCCGG
CCGGGCACTGGCCGTTCGCGGCATGCTGGGCGAGGCAGCCGACTACCTGCAACTGGCGTACCGGGCCTCCG
GCGACGCCGCTACCAAGGCCGCGATACGCGTCGAGTCCGTGGCGGTCGAGCGCCGACGCAATCCGCTGGTC
GTCAGTCGCCATTGGGACGAGCTGAGCGTCGCGGCCCGCGCCGGTCTGCTCTCCTGCGAGCACGTGTCCAG
GACGGCCCGCTGGCTGACCGTCGGTGGGCGGCCCGGCGAGGCGGCCAGGGTGCTGGCGTCGCAACACCGAC
GGGTCGTCACCGATCAGGACCGGGCCCACCTGCGGGTCGCCGAGTTCTCGCTCGCGCTGCTGTACCCCGGT
ACGTCCGGCTCGGACCGGCGCCCGCACCCGCTCACGTCGGACGAACTCGCGGCCCTACCGACTGCGACCAG
ACACTGCGCGATCGCCGATAACGCTGTCATGGCTGCCTTGCGTGGTCATCCGGAGCTTGCCACCGCCGAGG
CAGAAGCCGTTCTGCAGCAAGCCGACGCGGCGGACGGCGCTGCTCTCACCGCGCTGATGGCCCTGCTGTAC
GCGGAGAGCATCGAGGTCGCTGAAGTCTGGGCGGACAAGCTGGCGGCAGAGGCCGGAGCATCGAACGGGCA
GGACGCGGAGTACGCCGGTATACGCGCCGAAATCGCCCTGCGGCGCGGCGATCTGACCGCGGCCGTCGAGA
CCGCCGGCATGGTCCTGGACGGCCGGCCGCTGCCGTCGCTCGACATCACCGCCACGTTGCTGTTGGCCGGC
AGGGCGTCCGTCGCCGTCCGGCTGGGCGAACTCGACCACGCGGAGGAGCTGTTCGCCGCGCCGCCGGAGGA
CGCCTTCCAGGACAGCCTCTTCGGTCTGCATCTGCTCTCGGCGCACGGCCAGTACAGCCTCGCGACAGGCC
GGCCCGAGTCGGCATACCGGGCCTTTCGTGCCTGCGGCGAACGTATGCGCGATTGGGGCTTCGACGCGCCC
GGTGTGGCCCTGTGGCGCGTCGGCGCCGCCGAGGCGCTGCTCGGCCTCGACCGGAACGAGGGCCGACGGCT
CATCGACGAACAGCTGAGCCGGACGATGGCCCCCCGGTCCCACGCGTTGACGCTGCGGATAAAAGCGGCGT
ACATGCCGGAGCCGAAGCGGGTCGACCTGCTCTACGAAGCGGCTGAGCTGCTGCTCTCCTGCCGGGACCAG
TATGAGCGAGCGCGGGTGCTCGCCGATCTGGGCGAGGCGCTCAGCGCGCTCGGGAACTACCGGCAGGCGCG
AGGTGTGCTCCGGCAGGCTCGGCATCTGGCCATGCGAACCGGCGCGGACCCGCTGCTGCGCCGGCTCGGAA
TCAGGCCCGGCCGGCAGGACGACCCCGACCCGCAGCCGCGGAGCAGATCGCTGACCAACGCTGAGCGGCGT
GCGGCGTCGCTGGCCGCGACCGGACTGACCAACCGGGAGATCGCCGACCGGCTCTTCGTCACCGCCAGCAC
CGTGGAGCAGCACCTCACCAACGTCTTCCGCAAGCTGGGCGTCAAGGGCCGCAAGCAGCTGCCGGCCGAGT
TGGACGACATGGAATAG SEQ ID NO: 26
MPAVECYELDARDDELRKLEEVVTGRANGRGVVVTITGPIACGKTELLDAAAAKADAITLRAVCSAEEQAL
PYALIGQLIDNPALASHALEPACPTLPGEHLSPEAENRLRSDLTRTLLALAAERPVLIGIDESHANALCLL
HLARRVGSARIAMVLTELRRLTPAHSQFQAELLSLGHHREIALRPLSPKHTAELVRAGLGPDVDEDVLTGL
YRATGGNLNLTRGLINDVREAWETGGTGISAGRAYRLAYLGSLYRCGPVPLRVARVAAVLGQSANTTLVRW
ISGLNADAVGEATEILTEGGLLHDLRFPHPAARSVVLNDMSAQERRRLHRSALEVLDDVPVEVVAHHQVGA
GLLHGPKAAEIFAKAGQELHVRGELDTASDYLQLAHQASDDAVTGMRAEAVAIERRRNPLASSRHLDELTV
VARAGLLFPEHTALMIRWLGVGGRSGEAAGLLASQRPRAVTDQDRAHMRAAEVSLALVSPGTSGPDRRPRP
LTPDELANLPKAARLCAIADNAVMSALRGRPELAAAEAENVLQHADSAAAGTTALAALTALLYAENTDTAQ
LWADKLVSETGASNEEEAGYAGPRAEAALRRGDLAAAVEAGSTVLDHRRLSTLGITAALPLSSAVAAAIRL
GETERAEKWLAQPLPQAIQDGLFGLHLLSARGQYSLATGQHESAYTAFRTCGERMRNWGVDVPGLSLWRVD
AAEALLHGRDRDEGRRLVDEQLTRAMGPRSRALTLRVQAAYSPPAKRVDLLDEAADLLLSCNDQYERARVL
ADLSETFSALRHHSRARGLLRQARHLAAQRGAIPLLRRLGAKPGGPGWLEESGLPQRIKSLTDAERRVASL
AAGGQTNRVIADQLFVTASTVEQHLTDVSTGSRPPAPAAELV SEQ ID NO: 27
MVPEVRAAPDELIARDDELSRLQRALTRAGSGRGGVVAITGPIASGKTALLDAGAAKSGFVALRAVCSWEE
RTLPYGMLGQLFDHPELAAQAPDLAHFTASCESPQAGTDNRLRAEFTRTLLALAADWPVLIGIDDVHHADA
ESLRCLLHLARRIGPARIAVVLTELRRPTPADSRFQAELLSLRSYQEIALRPLTEAQTGELVRRHLGAETH
EDVSADTFRATGGNLLLGHGLINDIREARTAGRPGVVAGRAYRLAYLSSLYRCGPSALRVARASAVLGASA
EAVLVQRMTGLNKDAVEQVYEQLNEGRLLQGERFPHPAARSIVLDDLSALERRNLHESALELLRDHGVAGN
VLARHQIGAGRVHGEEAVELFTGAAREHHLRGELDDAAGYLELAHRASDDPVTRAALRVGAAAIERLCNPV
RAGRHLPELLTASRAGLLSSEHAVSLADWLAMGGRPGEAAEVLATQRPAADSEQHRALLRSGELSLALVHP
GAWDPLRRTDRFAAGGLGSLPGPARHRAVADQAVIAALRGRLDRADANAESVLQHTDATADRTTAIMALLA
LLYAENTDAVQFWVDKLAGDEGTRTPADEAVHAGFNAEIALRRGDLMRAVEYGEAALGHRHLPTWGMAAAL
PLSSTVVAAIRLGDLDRAERWLAEPLPQQTPESLFGLHLLWARGQHHLATGRHGAAYTAFRECGERMRRWA
VDVPGLALWRVDAAESLLLLGRDRAEGLRLVSEQLSRPMRPRARVQTLRVQAAYSPPPQRIDLLEEAADLL
VTCNDQYELANVLSDLAEASSMVRQHSRARGLLRRARHLATQCGAVPLLRRLGAEPSDIGGAWDATLGQRI
ASLTESERRVAALAAVGRTNREIAEQLFVTASTVEQHLTNVFRKLAVKGRQQLPKELADVGEPADRDRRCG
SEQ ID NO: 28
MIARLSPPDLIARDDEFGSLHRALTRAGGGRGVVAAVTGPIACGKTELLDAAAAKAGFVTLRAVCSMEERA
LPYGMLGQLLDQPELAARTPELVRLTASCENLPADVDNRLGTELTRTVLTLAAERPVLIGIDDVHHADAPS
LRCLLHLARRISRARVAIVLTELLRPTPAHSQFRAALLSLRHYQEIALRPLTEAQTTELVRRHLGQDAHDD
VVAQAFRATGGNLLLGHGLIDDIREARTRTSGCLEVVAGRAYRLAYLGSLYRCGPAALSVARASAVLGESV
ELTLVQRMTGLDTEAVEQAHEQLVEGRLLREGRFPHPAARSVVLDDLSAAERRGLHELALELLRDRGVASK
VLARHQMGTGRVHGAEVAGLFTDAAREHHLRGELDEAVTYLEFAYRASDDPAVHAALRVDTAAIERLCDPA
RSGRHVPELLTASRERLLSSEHAVSLACWLAMDGRPGEAAEVLAAQRSAAPSEQGRAHLRVADLSLALIYP
GAADPPRPADPPAEDEVASFSGAVRHRAVADKALSNALRGWSEQAEAKAEYVLQHSRVTTDRTTTMMALLA
LLYAEDTDAVQSWVDKLAGDDNMRTPADEAVHAGFRAEAALRRGDLTAAVECGEAALAPRVVPSWGMAAAL
PLSSTVAAAIRLGDLDRAERWLAEPLPEETSDSLFGLHMVWARGQHHLAAGRYRAAYNAFRDCGERMRRWS
VDVPGLALWRVDAAEALLLLGRGRDEGLRLISEQLSRPMGSRARVMTLRVQAAYSPPAKRIELLDEAADLL
IMCRDQYELARVLADMGEACGMLRRHSRARGLFRRARHLATQCGAVPLLRRLGGESSDADGTQDVTPAQRI
TSLTEAERRVASHAAVGRTNKEIASQLFVTSSTVEQHLTNVFRKLGVKGRQQLPKELSDAG SEQ
ID NO: 29
MEFYDLVARDDELRRLDQALGRAAGGRGVVVTVTGPVGCGKTELLDAAAAEEEFITLRAVCSAEERALPYA
VIGQLLDHPVLSARAPDLACVTAPGRTLPADTENRLRRDLTRALLALASERPVLICIDDVHQADTASLNCL
LHLARRVASARIAMILTELRRLTPAHSRFEAELLSLRHRHEIALRPLGPADTAELARARLGAGVTADELAQ
VHEATSGNPNLVGGLVNDVREAWAAGGTGIAAGRAYRLAYLSSVYRCGPVPLRIAQAAAVLGPSATVTLVR
RISGLDAETVDEATAILTEGGLLRDHRFPHPAARSVVLDDMSAQERRRLHRSTLDVLDGVPVDVLAHHQAG
AGLLHGPQAAEMFARASQELRVRGELDAATEYLQLAYRASDDAGARAALQVETVAGERRRNPLAASRHLDE
LAAAARAGLLSAEHAALVVHWLADAGRPGEAAEVLALQRALAVTDHDRARLRAAEVSLALFHPGVPGSDPR
PLAPEELASLSLSARHGVTADNAVLAALRGRPESAAAEAENVLRNADAAASGPTALAALTALLYAENTDAA
QLWADKLAAGIGAGEGEAGYAGPRTVAALRRGDLTTAVQAAGAVLDRGRPSSLGITAVLPLSGAVAAAIRL
GELERAEKWLAEPLPEAVHDSLFGLHLLMARGRYSLAVGRHEAAYAAFRDCGERMRRWDVDVPGLALWRVD
AAEALLPGDDRAEGRRLIDEQLTRPMGPRSRALTLRVRAAYAPPAKRIDLLDEAADLLLSSNDQYERARVL
ADLSEAFSALRQNGRARGILRQARHLAAQCGAVPLLRRLGVKAGRSGRLGRPPQGIRSLTEAERRVATLAA
AGQTNREIADQLFVTASTVEQHLTNVFRKLGVKGRQQLPAELADLRPPG SEQ ID NO: 30
MYSGTCREGYELVAREDELGILQRSLEQASSGQGVVVTVTGPIACGKTELLDAAAAKAEAIILRAVCAPEE
RAMPYAMIGQLIDDPALAHRAPGLADRIAQGGQLSLRAENRLRRDLTRALLALAVDRPVLIGVDDVHHADT
ASLNCLLHLARRVRPARISMIFTELRSLTPTQSRFKAELLSLPYHHEIALRPFGPEQSAELARAAFGPGLA
EDVLVGLYKTTRGNLSLSRGLISDVREALANGESAFEAGRAFRLAYLGSLYRCGPVALRVARVAAVLGPSA
TTTLVRRLSGLSAETIDRATKILTEGGLLLDQQFPHPAARSVVLDDMSAQERRGLHTLALELLDEAPVEVL
AHHQVGAGLIHGPKAAEMFAKAGKALVVRNELGDAAEYLQLAHRASDDVSTRAALRVEAVAIERRRNPLAS
SRHMDELSAAGRAGLLSPKHAALAVFWLADGGRSGEAAEVLASERPLATTDQNRAHLRFVEVTLALFSPGA
FGSDRRPPPLTPDELASLPKAAWQCAVADNAAMTALHGHPELATAQAETVLRQADSAADAIPAALIALLYA
ENTESAHIWADKLGSTNGGVSNEAEAGYAGPCAEIALRRGDLATAFEAGSTVLDDRSLPSLGITAALLLSS
KTAAAVRLGELERAEKLLAEPLPNGVQDSLFGLHLLSAYGQYSLAMGRYESALRAFHTCGERMRSWDVDVP
GLALWRVDAAEALLSLDRNEGQRLIDEQLTRPMGPRSRALTLRIKAAYLPRTKRIPLLHEAAELLLPCPDP
YEQARVLADLGDTLSALRRYSRARGVLRQARHLAAQCGAVPLLRRLGGEPGRIDDAGLPQRSTSLTDAERR
VAALAAAGQTNREIAKQLFVTASTVEQHLTSVFRKLGVKGRKQLPTALADVEQT SEQ ID NO:
31
MPAVESYELDARDDELRRLEEAVGQAGNGRGVVVTITGPIACGKTELLDAAAAKSDAITLRAVCSEEERAL
PYALIGQLIDNPAVASQLPDPVSMALPGEHLSPEAENRLRGDLTRTLLALAAERPVLIGIDDMHHADTASL
NCLLHLARRVGPARIAMVLTELRRLTPAHSQFHAELLSLGHHREIALRPLGPKHIAELARAGLGPDVDEDV
LTGLYRATGGNLNLGHGLIKDVREAWATGGTGINAGRAYRLAYLGSLYRCGPVPLRVARVAAVLGQSANTT
LVRWISGLNADAVGEATEILTEGGLLHDLRFPHPAARSVVLNDLSARERRRLHRSALEVLDDVPVEVVAHH
QAGAGFIHGPKAAEIFAKAGQELHVRGELDAASDYLQLAHHASDDAVTRAALRVEAVAIERRRNPLASSRH
LDELTVAARAGLLSLEHAALMIRWLALGGRSGEAAEVLAAQRPRAVTDQDRAHLRAAEVSLALVSPGASGV
SPGASGPDRRPRPLPPDELANLPKAARLCAIADNAVISALHGRPELASAEAENVLKQADSAADGATALSAL
TALLYAENTDTAQLWADKLVSETGASNEEEGAGYAGPRAETALRRGDLAAAVEAGSAILDHRRGSLLGITA
ALPLSSAVAAAIRLGETERAEKWLAEPLPEAIRDSLFGLHLLSARGQYCLATGRHESAYTAFRTCGERMRN
WGVDVPGLSLWRVDAAEALLHGRDRDEGRRLIDEQLTHAMGPRSRALTLRVQAAYSPQAQRVDLLEEAADL
LLSCNDQYERARVLADLSEAFSALRHHSRARGLLRQARHLAAQCGATPLLRRLGAKPGGPGWLEESGLPQR
IKSLTDAERRVASLAAGGQTNRVIADQLFVTASTVEQHLTNVFRKLGVKGRQHLPAELANAE SEQ
ID NO: 32
MPAVKRNDLVARDGELRWMQEILSQASEGRGAVVTITGAIACGKTVLLDAAAASQDVIQLRAVCSAEEQEL
PYAMVGQLLDNPVLAARVPALGNLAAAGERLLPGTENRIRRELTRTLLALADERPVLIGVDDMHHADPASL
DCLLHLARRVGPARIAIVLTELRRLTPAHSRFQSELLSLRYHHEIGLQPLTAEHTADLARVGLGAEVDDDV
LTELYEATGGNPSLCCGLIRDVRQDWEAGVTGIHVGRAYRLAYLSSLYRCGPAALRTARAAAVLGDSADAC
LIRRVSGLGTEAVGQAIQQLTEGGLLRDQQFPHPAARSVVLDDMSAQERHAMYRSAREAAAEGQADPGTPG
EPRAATAYAGCGEQAGDYPEPAGRACVDGAGPAEYCGDPHGADDDPDELVAALGGLLPSRLVAMKIRRLAV
AGRPGAAAELLTSQRLHAVTSEDRASLRAAEVALATLWPGATGPDRHPLTEQEAASLPEGPRLLAAADDAV
GAALRGRAEYAAAEAENVLRHADPAAGGDAYAAMIALLYTEHPENVLFWADKLDAGRPDEETSYPGLRAET
AVRLGDLETAMELGRTVLDQRRLPSLGVAAGLLLGGAVTAAIRLGDLDRAEKWLAEPIPDAIRTSLYGLHV
LAARGRLDLAAGRYEAAYTAFRLCGERMAGWDADVSGLALWRVDAAEALLSAGIRPDEGRKLIDDQLTREM
GARSRALTLRAQAAYSLPVHRVGLLDEAAGLLLACHDGYERARVLADLGETLRTLRHTDAAQRVLRQAEQA
AARCGSVPLLRRLGAEPVRIGTRRGEPGLPQRIRLLTDAERRVAAMAAAGQTNREIAGRLFVTASTVEQHL
TSVFRKLGVKGRRFLPTELAQAV SEQ ID NO: 33
MYSGTCREGYELVAREDELGILQRSLEQASSGQGVVVTVTGPIACGKTELLDAAAAKAEAIILRAVCAPEE
RAMPYAMIGQLIDDPALAHRAPGLADRIAQGGQLSLRAENRLRRDLTRALLALAVDRPVLIGVDDVHHADT
ASLNCLLHLARRVRPARISMIFTELRSLTPTQSRFKAELLSLPYHHEIALRPFGPEQSAELARAAFGPGLA
EDVLAGLYKTTRGNLSLSRGLISDVREALANGESAFEAGRAFRLAYLSSLYRCGPVALRVARVAAVLGPSA
TTTLVRRLSGLSAETIDRATKILTEGGLLLDQQFPHPAARSVVLDDMSAQERRSLHTLALELLDEAPVEVL
AHHQVGAGLIHGPKAAEMFAKAGKALVVRNELGDAAEYLQLAHRASDDVSTRAALRVEAVAIERRRNPLAS
SRHMDELSAAGRAGLLSPKHAALAVFWLADGGRSGEAAEVLASERPLATTDQNRAHLRFVEVTLALFSPGA
FGSDRRPPPLTPDELASLPKAAWQCAVADNAAMTALHGHPELATAQAETVLRQADSAADAIPAALIALLYA
ENTESAHIWADKLGSTNAGVSNEAEAGYAGPCAEIALRRGDLATAFEAGSAVLDDRSLPSLGITAALLLSS
KTAAAVRLGELERAEKLLAEPLPNGVQDSLFGLHLLSAYGQYSLAMGRYESAHRAFRTCGERMRSWDVDVP
GLALWRVDAAEALLSLDRNEGQRLIDEQLTRPMGPRSHALTLRIKAAYLPRTKRIPLLHEAAELLLPCPDP
YEQARVLADLGDTLSALRRYSRARGVLRQARHLATQCGAVPLLRRLGGEPGRIDDAGLPQRSTSLTDAERR
VAALAAAGQTNREIAEQLFVTASTVEQHLTSVFRKLGVKGRKQLPTALADVEQT SEQ ID NO:
34
MYSGTCREGYELVAREDELGILQRSLEEAGSGQGAVVTVTGPIACGKTELLDAAAAKADAIILRAVCAPEE
RAMPYAMIGQLIDDPALAHRAPELADRIAQGGHLSLRAENRLRRDLTRALLALAVDRPVLIGVDDVHHADT
ASLNCLLHLARRVRPARISMIFTELRSLTPTQSRFKAELLSLPYHHEIALRPLGPEQSAELAHAAFGPGLA
EDVLAGLYGMTRGNLSLSRGLISDVREAQANGESAFEVGRAFRLAYLSSLYRCGPIALRVARVAAVLGPSA
TTTLVRRLSGLSAETIDRATKILTEGGLLLDHQFPHPAARSVVLDDMSAQERRSLHTLALELLDEAPVEVL
AHHQVGAGLIHGPKAAEIFARAGQALVVRNELGDAAEYLQLAHRASDDVSTRAALRVEAVAIERRRNPLAS
SRHMDELSAAGRAGLLSPKHAALAVFWLADGGRSGEAAEVLASEHPLATTDQNRAHLRFAEVTLALFCPGA
FGSDRRPPPLAPDELASLPKAAWQCAVADNAVMTALHAHPELATAQAETVLRQADSAADAIPAALIALLYA
ENTESAQIWADKLGSTNAGVSNEAEAGYAGPCAEIALRRGDLATAFEAGGTVLDDRPLPSLGITAALLLSS
KTAAAVRLGELERAEKLLAEPLPNGVQDSLFGLHLLSAHGQYSLAMGRYESAHRAFHTCGERMRSWGVDVP
GLALWRVDAAEALLSLDRNEGQRLIDEQLARPMGPRSRALTLRIKAAYLPRTKRIPLLHEAAELLLSCPDP
YEQARVLADLGDTLSALRRYSRARGVLRQARHLATQCGAVPLLRRLGGEPGRIDDAGLPQRSTSLTDAERR
VSALAAAGQTNREIAKQLFVTASTVEQHLTSVFRKLGVKGRRQLPTALADVE SEQ ID NO: 35
MYSGTCREGYELVAREDELGILQRSLEQASSGQGVVVTVTGPIACGKTELLDAAAAKAEAIILRAVCAPEE
RAMPYAMIGQLIDDPALAHRAPGLADRIAQGGQLSLRAENRLRRDLTRALLALAVHRPVLIGVDDVHHADT
ASLNCLLHLARRVRPARISMIFTELRSLTPTQSRFKAELLSLPYHHEIALRPFGPEQSAELARAAFGPGLA
EDVLAGLYKTTRGNLSLSRGLISDVREALANGESAFEAGRAFRLAYLSSLYRCGPVALRVARVAAVLGPSA
TTTLVRRLSGLSAETIDRATKILTEGGLLLDQQFPHPAARSVVLDDMSAQERRGLHTLALELLDEAPVEVL
AHHQVGAGLIHGPKAAEMFAKAGKALVVRNELGDAAEYLQLAHRASDDVSTRAALRVEAVAIERRRNPLAS
SRHMDELSAAGRAGLLSPKHAALAVFWLADGGRSGEAAQVLASERPLATTDQNRAHLRFVEVTLALFSPGA
FGSDRRPPPLTPDELASLPKAAWQCAVADNAAMTALHGHPELATAQAETVLRQADSAADAIPAALIALLYA
ENTESAHIWADKLGSMNAGVSNEAEAGYAGPCAEIALRRGDLATAFEAGSTVLDDRSLPSLGITAALLLSS
KTAAAVRLGELERAEKLLAEPLPNGVQDSLFGLHLLSAYGQYSLAMGRYESAHRAFRTCGERMRSWDVDVP
GLALWRVDAAEALLSLDRNEGQRLIDEQLTRPMGPRSRALTLRIKAAYLPRTKRIPLLHEAAELLLPCPDP
YEQARVLADLGDTLSALRRYSRARGVLRQARHLATQCGAVPLLRRLGGEPGRIDDAGLPQRSTSLTDAERR
VAALAAAGQTNREIAEQLFVTASTVEQHLTSVFRKLGVKGRKQLPTALADVEQT SEQ ID NO:
36
MRAINASDTGPELVAREDELGRVRSALNRANGGQGVLISITGPIACGKTELLEAAASEVDAITLRAVCAAE
ERAIPYALIGQLIDNPALGIPVPDPAGLTAQGGRLSSSAENRLRRDLTRALLTLATDRLVLICVDDVQHAD
NASLSCLLYLARRLVPARIALVFTELRVLTSSQLRFNAELLSLRNHCEIALRPLGPGHAAELARATLGPGL
SDETLTELYRVTGGNLSLSRGLIDDVRDAWARGETGVQVGRAFRLAYLGSLHRCGPLALRVARVAAVLGPS
ATSVLVRRISGLSAEAMAQATDILADGGLLRDQRFTHPAARSVVLDDMSAEERRSVHSLALELLDEAPAEM
LAHHRVGAGLVHGPKAAETFTGAGRALAVRGMLGEAADYLQLAYRASGDAATKAAIRVESVAVERRRNPLV
VSRHWDELSVAARAGLLSCEHVSRTARWLTVGGRPGEAARVLASQHRRVVTDQDRAHLRVAEFSLALLYPG
TSGSDRRPHPLTSDELAALPTATRHCAIADNAVMAALRGHPELATAEAEAVLQQADAADGAALTALMALLY
AESIEVAEVWADKLAAEAGASNGQDAEYAGIRAEIALRRGDLTAAVETAGMVLDGRPLPSLDITATLLLAG
RASVAVRLGELDHAEELFAAPPEDAFQDSLFGLHLLSAHGQYSLATGRPESAYRAFRACGERMRDWGFDAP
GVALWRVGAAEALLGLDRNEGRRLIDEQLSRTMAPRSHALTLRIKAAYMPEPKRVDLLYEAAELLLSCRDQ
YERARVLADLGEALSALGNYRQARGVLRQARHLAMRTGADPLLRRLGIRPGRQDDPDPQPRSRSLTNAERR
AASLAATGLTNREIADRLFVTASTVEQHLTNVFRKLGVKGRKQLPAELDDME
LAL Binding Sites
In some embodiments, a gene cluster (e.g., a PKS gene cluster or a
.beta.-lactam compound gene cluster) includes one or more promoters
that include one or more LAL binding sites. The LAL binding sites
may include a polynucleotide consensus LAL binding site sequence
(e.g., as described herein). In some instances, the LAL binding
site includes a core AGGGGG motif. In certain instances, the LAL
binding site includes a sequence having at least 80% (e.g., 80%,
85%, 90%, 95%, 97%, 98%, 99%, or 100%) homology to SEQ ID NO: 2.
The LAL binding site may include mutation sites that have been
restored to match the sequence of a consensus or optimized LAL
binding site. In some embodiments, the LAL binding site is a
synthetic LAL binding site. In some embodiments, a synthetic LAL
binding sites may be identified by (a) providing a plurality of
synthetic nucleic acids including at least eight nucleotides; (b)
contacting one or more of the plurality of nucleotides including at
least eight nucleotides with one or more LALs; (c) determining the
binding affinity between a nucleic acid of step (a) and an LAL of
step (b), wherein a synthetic nucleic acid is identified as a
synthetic LAL binding site if the affinity between the synthetic
nucleic acid and an LAL is greater than X. The identified synthetic
LAL binding sites may then be introduced into a host cell in a
compound-producing cluster (e.g., a PKS cluster or a .beta.-lactam
compound producing protein gene cluster).
In some embodiments, a pair of LAL binding site and a heterologous
LAL or a heterologous LAL binding site and an LAL that have
increased expression compared a natural pair may be identified by
(a) providing one or more LAL binding sites; (b) contacting one or
more of the LAL binding sites with one or more LALs; (c)
determining the binding affinity between a LAL binding site and an
LAL, wherein a pair having increased expression is identified if
the affinity between the LAL binding site and the LAL is greater
than the affinity between the LAL binding site and its homologous
LAL and/or the LAL at its homologous LAL binding site. In some
embodiments, the binding affinity between the LAL binding site and
the LAL is determined by determining the expression of a protein or
compound by a cell which includes both the LAL and the LAL binding
site.
Constitutively Active LALs
In some embodiments, the recombinant LAL is a constitutively active
LAL. For example, the amino acid sequence of the LAL has been
modified in such a way that it does not require the presence of an
inducer compound for the altered LAL to engage its cognate binding
site and activate transcription of a compound producing protein
(e.g., polyketide synthase or a .beta.-lactam compound producing
protein). Introduction of a constitutively active LAL to a host
cell would likely result in increased expression of the
compound-producing protein (e.g., polyketide synthase or a
.beta.-lactam compound producing protein) and, in turn, increased
production of the corresponding compound (e.g., polyketide or a
.beta.-lactam compound).
Engineering Unidirectional LALs
FkPhD gene clusters are arranged with a multicistronic architecture
driven by multiple bidirectional promoter-operators that harbor
conserved (in single or multiple, and inverted to each other and/or
directly repeating) GGGGGT (SEQ ID NO: 3) motifs presumed to be LAL
binding sites. Bidirectional LAL promoters may be converted to
unidirectional ones (UniLALs) by strategically deleting one of the
opposing promoters, but maintaining the tandem LAL binding sites
(in case binding of LALs in the native promoter is cooperative, as
was demonstrated for MalT). Functionally this is achieved by
removal of all sequences 3' of the conserved GGGGGT (SEQ ID NO: 3)
motif present on the antisense strand (likely containing the -35
and -10 promoter sequences), but leaving intact the entire sequence
on the sense strand. As a consequence of this deletion,
transcription would be activated in one direction only. The
advantages of this feed-forward circuit architecture would be to
tune and/or maximize LAL expression during the complex life cycle
of Streptomyces vegetative and fermentation growth conditions.
Host Cells
In some embodiments, the host cell is a bacteria such as an
Actiobacterium. For example, in some embodiments, the host cell is
a Streptomyces strain. In some embodiments, the host cell is
Streptomyces anulatus, Streptomyces antibioticus, Streptomyces
coelicolor, Streptomyces peucetius, Streptomyces sp. ATCC 700974,
Streptomyces canus, Streptomyces nodosus, Streptomyces (multiple
sp.), Streptoalloteicus hindustanus, Streptomyces hygroscopicus,
Streptomyces avermitilis, Streptomyces viridochromogenes,
Streptomyces verticillus, Streptomyces chartruensis, Streptomyces
(multiple sp.), Saccharothrix mutabilis, Streptomyces halstedii,
Streptomyces clavuligerus, Streptomyces venezuelae, Strteptomyces
roseochromogenes, Amycolatopsis orientalis, Streptomyces
clavuligerus, Streptomyces rishiriensis, Streptomyces lavendulae,
Streptomyces roseosporus, Nonomuraea sp., Streptomyces peucetius,
Saccharopolyspora erythraea, Streptomyces filipinensis,
Streptomyces hygroscopicus, Micromonospora purpurea, Streptomyces
hygroscopicus, Streptomyces narbonensis, Streptomyces
kanamyceticus, Streptomyces collinus, Streptomyces lasaliensis,
Streptomyces lincolnensis, Dactosporangium aurantiacum,
Streptomyces toxitricini, Streptomyces hygroscopicus, Streptomyces
plicatus, Streptomyces lavendulae, Streptomyces ghanaensis,
Streptomyces cinnamonensis, Streptomyces aureofaciens, Streptomyces
natalensis, Streptomyces chattanoogensis L10, Streptomyces lydicus
A02, Streptomyces fradiae, Streptomyces ambofaciens, Streptomyces
tendae, Streptomyces noursei, Streptomyces avermitilis,
Streptomyces rimosus, Streptomyces wedmorensis, Streptomyces
cacaoi, Streptomyces pristinaespiralis, Streptomyces
pristinaespiralis, Actinoplanes sp. ATCC 33076, Streptomyces
hygroscopicus, Lechevalieria aerocolonegenes, Amycolatopsis
mediterranei, Amycolatopsis lurida, Streptomyces albus,
Streptomyces griseolus, Streptomyces spectabilis, Saccharopolyspora
spinosa, Streptomyces ambofaciens, Streptomyces staurosporeus,
Streptomyces griseus, Streptomyces (multiple species), Streptomyces
acromogenes, Streptomyces tsukubaensis, Actinoplanes
teichomyceticus, Streptomyces glaucescens, Streptomyces rimosus,
Streptomyces cattleya, Streptomyces azureus, Streptoalloteicus
hindustanus, Streptomyces chartreusis, Streptomyces fradiae,
Streptomyces coelicolor, Streptomyces hygroscopicus, Streptomyces
sp. 11861, Streptomyces virginiae, Amycolatopsis japonicum,
Amycolatopsis balhimycini, Streptomyces albus J1074, Streptomyces
coelicolor M1146, Streptomyces lividans, Streptomyces incarnates,
Streptomyces violaceoruber, or Streptomyces griseofuscus. In some
embodiments, the host cell is an Escherichia strain such as
Escherichia coli. In some embodiments, the host cell is a Bacillus
strain such as Bacillus subtilis. In some embodiments, the host
cell is a Pseudomonas strain such as Pseudomonas putitda. In some
embodiments, the host cell is a Myxococcus strain such as
Myxococcus xanthus.
Methods
The nucleic acids, vectors, and host cells of the invention may be
used for increased and/or more efficient production of compounds
(e.g., polyketides or .beta.-lactam compounds). Introduction of
recombinant and/or heterologous LALs to host cells or the
introduction of heterologous binding sites to the gene clusters
that produce a small molecule (e.g., PKS gene clusters or
.beta.-lactam compound producing protein gene clusters) allow for
greater control of the regulations of the genes which encode the
compound-producing proteins (e.g., polyketide synthases or
.beta.-lactam compound producing proteins) responsible for the
production of compounds (e.g., polyketides or .beta.-lactam
compounds) of interest.
Introduction of Heterologous LAL
In some embodiments, compounds (e.g., polyketides or .beta.-lactam
compounds) are produced by introduction of a heterologous LAL to a
host cell (e.g., the LAL may be introduced with an expression
vector, such as an artificial chromosome, including a nucleic acid
encoding the LAL). In some embodiments, the host cell naturally
lacks an LAL. In some embodiments, the host cell naturally produces
an LAL that is different from the introduced LAL. The introduced
LAL may be any LAL with the conserved four helix bundle DNA binding
region of the PKS regulating LALs. In some embodiments, the
introduced LAL is a natural LAL. In some embodiments, the
introduced LAL is a modified LAL, e.g., a constitutively active
LAL. In some embodiments, the introduced LAL has at least 70%
sequence identity to SEQ ID NO: 1. In some embodiments, the
introduced LAL includes or consists of the sequence of SEQ ID NO:
1. In some embodiments in which the host cell naturally produces an
LAL, the nucleic acid which expresses the natural LAL is deleted
prior to introduction of the heterologous LAL. In certain
embodiments, the introduced LAL is expressed from an expression
vector in which the polynucleotide sequence encoding the LAL is
codon optimized. For example, TTA codons, which are known to exert
translational control of genes having such codons in a Streptomyces
host cell, may be removed and/or replaced in the LAL coding
sequence. In some embodiments, the host cell may be modified, for
example, to remove a cytochrome P450 oxygenase.
Introduction of a Heterologous LAL Binding Site
In some embodiments, compounds (e.g., polyketides or .beta.-lactam
compounds) are produced by introduction of a heterologous LAL
binding site to a host cell (e.g., the LAL binding site may be
introduced with an expression vector, such as an artificial
chromosome, including a nucleic acid having the LAL binding site or
insertion via homologous recombination). In some embodiments, the
host cell naturally lacks an LAL binding site. In some embodiments,
the host cell naturally includes an LAL binding site that is
different from the introduced LAL binding site. In some
embodiments, the introduced LAL binding site has at least 80%
identity to SEQ ID NO: 2. In some embodiments, the introduced LAL
binding site includes or consists of the sequence of SEQ ID NO: 2.
In some embodiments, the introduced LAL binding site includes the
sequence GGGGGT (SEQ ID NO: 3). In some embodiments, the introduced
LAL binding site results in increased production of a compound
(e.g., a polyketide or a .beta.-lactam compound). In some
embodiments, the open reading frame encoding the compound-producing
protein (e.g., a polyketide synthase or a .beta.-lactam compound
producing protein) is positioned such that binding of an LAL to the
LAL binding site promotes expression of the biosynthetic protein(s)
(e.g., a polyketide synthase or a .beta.-lactam compound producing
protein) and thus the compound (e.g., a polyketide or a
.beta.-lactam compound). In some embodiments, the LAL binding site
has the sequence of SEQ ID NO: 2 and the LAL has the sequence of
SEQ ID NO: 1.
In some instances, a construct may include one or more promoters
including a heterologous LAL binding site. For example, a construct
may include a unidirectional promoter driving the expression of one
or more genes (e.g., genes in a gene cluster that produces a small
molecule, such as a PKS gene cluster or a .beta.-lactam compound
producing protein gene cluster). In some instances, a construct may
include a bidirectional promoter located between two sets of genes
to be expressed, with one portion of the bidirectional promoter
including a first LAL binding site and driving expression of one
set of genes, and a second portion of the bidirectional promoter
including a second LAL binding site and driving expression of the
second set of genes. The two sets of genes may be oriented
antiparallel relative to each other. In certain instances, a host
cell may include a gene cluster under the control of a
unidirectional or bidirectional promoter, as well as at least one
gene encoding a heterologous LAL that is under the control of a
promoter containing an LAL binding site. The gene cluster and the
heterologous LAL-encoding gene may be located on the same
construct, or may be located on different constructs. Expression of
an LAL (e.g., an endogenous LAL or a heterologous LAL) results in
expression of the heterologous LAL as well as the genes in the gene
cluster. The expressed heterologous LAL may in turn further drive
expression of the genes in the gene cluster and the heterologous
LAL in a positive feedback loop.
Introduction of a Heterologous PKS Gene Cluster
In some embodiments, polyketides are produced by introduction of a
nucleic acid encoding a heterologous PKS gene cluster to a host
cell (e.g., the nucleic acid may be introduced with an expression
vector, such as an artificial chromosome). In some embodiments, the
nucleic acid further includes an LAL binding site. In some
embodiments, the LAL binding site is heterologous to the PKS gene
cluster. In some embodiments, the LAL binding site is homologous to
the PKS gene cluster. In some embodiments, a heterologous LAL is
also introduced to the host cell (e.g., the LAL may be introduced
with an expression vector, such as an artificial chromosome,
including a nucleic acid encoding the LAL). In some embodiments,
the LAL is encoded by the same nucleic acid which encodes the
heterologous PKS gene cluster. In some embodiments, the LAL is
heterologous to the LAL binding site and/or the PKS gene cluster.
In some embodiments, the LAL is homologous to the LAL binding site
and/or the PKS gene cluster. In some embodiments, the polyketide
synthase is not expressed in the absence of either an LAL or an LAL
binding site.
A host cell may be modified to optimize production from the
heterologous PKS gene cluster. In some embodiments, one or more
tailoring enzymes (e.g., the cytochrome P450 oxygenase, cypB) is
deleted. In some embodiments, a host cell may be modified to
include a particular allele that confers resistance to an
antibiotic (e.g., resistance alleles against streptomycin (e.g.,
rpsL), rifampicin (e.g., rpoB), and gentamicin), which may result
in the production of higher secondary metabolite titers.
Introduction of a Heterologous .beta.-Lactam Compound Producing
Protein Gene Cluster
In some embodiments, .beta.-lactam compounds are produced by
introduction of a nucleic acid encoding a heterologous
.beta.-lactam compound producing protein gene cluster to a host
cell (e.g., the nucleic acid may be introduced with an expression
vector, such as an artificial chromosome). In some embodiments, the
nucleic acid further includes an LAL binding site. In some
embodiments, the LAL binding site is heterologous to the
.beta.-lactam compound producing protein gene cluster. In some
embodiments, the LAL binding site is homologous to the
.beta.-lactam compound producing protein gene cluster. In some
embodiments, a heterologous LAL is also introduced to the host cell
(e.g., the LAL may be introduced with an expression vector, such as
an artificial chromosome, including a nucleic acid encoding the
LAL). In some embodiments, the LAL is encoded by the same nucleic
acid which encodes the heterologous .beta.-lactam compound
producing protein gene cluster. In some embodiments, the LAL is
heterologous to the LAL binding site and/or the .beta.-lactam
compound producing protein gene cluster. In some embodiments, the
LAL is homologous to the LAL binding site and/or the .beta.-lactam
compound producing protein gene cluster. In some embodiments, the
.beta.-lactam compound is not expressed in the absence of either an
LAL or an LAL binding site.
A host cell may be modified to optimize production from the
heterologous .beta.-lactam compound producing protein gene cluster.
In some embodiments, one or more tailoring enzymes is deleted. In
some embodiments, a host cell may be modified to include a
particular allele that confers resistance to an antibiotic (e.g.,
resistance alleles against streptomycin (e.g., rpsL), rifampicin
(e.g., rpoB), and gentamicin), which may result in the production
of higher secondary metabolite titers.
Quantification of mRNA Transcripts by NanoString Analysis
In some embodiments, gene expression (e.g., expression of one or
more genes regulated by a heterologous LAL binding site) may be
quantified using the NanoString nCounter Analysis System.RTM.
(Nanostring). The NanoString nCounter assay involves direct digital
detection of mRNA molecules using target-specific, color-coded
probe pairs. It does not require the conversion of mRNA to cDNA by
reverse transcription or the amplification of the resulting cDNA by
PCR. Each target gene of interest is detected using a pair of
reporter and capture probes carrying 35- to 50-base target-specific
sequences. In addition, each reporter probe carries a unique color
code at the 5' end that enables the molecular barcoding of the
genes of interest, while the capture probes all carry a biotin
label at the 3' end that provides a molecular handle for attachment
of target genes to facilitate downstream digital detection. After
solution-phase hybridization between target mRNA and
reporter-capture probe pairs, excess probes are removed and the
probe/target complexes are aligned and immobilized in the nCounter
cartridge, which is then placed in a digital analyzer for image
acquisition and data processing. Hundreds of thousands of color
codes designating mRNA targets of interest are directly imaged on
the surface of the cartridge. The expression level of a gene is
measured by counting the number of times the color-coded barcode
for that gene is detected, and the barcode counts are then
tabulated. The methodology and uses of NanoString are further
described in Kulkarni, M. Curr. Protoc. Mol. Biol.
94:256.10.1-256.10.17 (2011).
In some embodiments, Nanostring analysis is used to determine if
the expression of a locus of a gene cluster (e.g., a PKS gene
cluster or a .beta.-lactam compound producing protein gene
cluster), which is located in proximity to a heterologous LAL
binding site, is upregulated relative to the same locus when the
locus is not located in proximity to a heterologous LAL binding
site.
EXAMPLES
Methods
LAL Cloning:
LAL gene sequences from FKPHD gene clusters were obtained from the
WarpDrive genome database or from public sources such as GenBank.
LAL genes were modified from wild-type to remove single or multiple
TTA codons, which are known to exert translational control of genes
having these codons in Streptomyces. Synthetic EcoRI/Xbal bounded
cassettes composed of the strong constitutive ermE* promoter, the
TTA-less LALs, and the transcriptional terminator from phage fd
were cloned into pSET152 having a PhiC31 integrase and attP site,
an apramycin resistance gene, and an oriT for conjugal transfer
from conjugation-proficient Escherichia coli. The TTA-less LAL
genes were also inserted into other integrative vectors (example
pWFE1), or functional equivalents, remaining under the
transcriptional control of the strong constitutive promoter
PermE*.
LAL gene panels cloned into pWFE1 were introduced into Actinomycete
bacteria harboring genomic FKPHD gene clusters, and also having
predicted LAL binding sites in the promoter-operator regions of
their FKPHD biosynthetic loci, by intergeneric conjugation using
donor strain JV36. Intergeneric conjugations were carried out as
using standard methods on R2NSY media at 30.degree. C. or
37.degree. C., and conjugation plates were overlaid after 18-48
hours with 0.3-2.0 mg apramycin and 0.5-1.0 mg nalidixic acid.
Actinomycete exconjugants harboring the pWFE1-LAL plasmids were
streaked to fresh plates containing apramycin (30-50 mg/L) and
nalidixic acid (25-30 mg/L) to remove residual E. coli donor and
confirm stable apramycin resistance.
Recombinant Actinomycetes carrying integrated LAL plasmids were
tested for FKPHD production as follows: Starter cultures of
Actinomycetes were grown in 15 ml Maltose-Yeast extract-Glucose
broth containing apramycin (25-50 mg/L). After 2-3 days at
29-30.degree. C., the starter cultures plated for confluence to
solid media suitable for production (e.g., Medium 2 or 8430 or
others). After 6-7 days of growth at 30.degree. C., two agar plates
having confluent actinomycete growth were harvested for extraction.
Briefly, agar with adherent actinomycete growth was removed from
petri plates and extracted with 100% methanol. After soaking
overnight in methanol, the agar was removed, and the methanol was
diluted with water to 15-30% final concentration. FKPHD compounds
were captured from the aqueous extract using Phenomenex C18-U SPE
columns (0.5 g, 6 mL capacity). After washing columns with bound
extract with 30% Methanol, remaining molecules including FKPHDs
were eluted with 100% methanol.
Methanol was removed from eluates in vacuo, and resulting crudes
were dissolved in DMSO. The dissolved samples were then diluted as
necessary in methanol (generally 10 .mu.l into 490 .mu.l neat
methanol), and analyzed by LC/MS. (Agilent HPLC with diode array in
line with Agilent 6120 single quad mass spectrometer). Screens for
improved strains were determined on a semi-quantitative using
conventional analyses using Agilent MassHunter or Agilent
ChemStation software, measuring area-under-curve (AUC) of
ion-extracted mass chromatograms. Final assessment of strain
improvement was done by scaled liquid growths, molecule
purification, and measurement by weight and NMR using internal
standards as compared to wild-type strains lacking pWFE1-LAL
constructs.
Deletion of Biosynthetic Enzymes:
Deletion of biosynthetic enzymes to increase the titer of specific
FKPHD compounds were made in the following way: First, .about.1 kb
regions of homology flanking the start and stop codons of genes
selected for deletion were amplified by PCR. These homology arms
were assembled into a single deletion cassette using
overlap-extension PCR, and cloned to the E. coli-Streptomyces
shuttle vector pJVD52.1. Deletions were carried out as known in the
art, with vectors carrying deletion cassettes being delivered into
target strains using conjugation, as detailed above. Of note,
pJVD52.1--based deletion strategies can make use of streptomycin
counterselection, and utilize parent strains with rpsL mutations.
Bacteria spontaneously mutated in the rpsL allele are known to be
isolable when strains are plated in the presence of streptomycin
(10 to 100 .mu.g/mL) on suitable media (e.g., ISP2, Becton
Dickinson Co.). Putative mutant actinobacterial deletion hosts were
confirmed to have desired lesions in rpsL by amplification by PCR
and comparison to wild-type rpsL DNA sequences.
Resulting deletion strains in an rpsL background were then
fermented as above, and fermentation extracts containing FKPHD
compounds were analyzed against wild-type and rpsL parent strain
extracts, confirming increased titers of specific FKPHDs are
attributable to specific gene deletions (e.g., genes encoding
predicted cytochrome P450 oxygenases) and not to rpsL mutations
required for the gene deletion process.
Inducing rpoB/rpsL:
Actinobacteria harboring specific alleles conferring resistance to
certain antibiotics can sometimes produce higher secondary
metabolite titers than strains lacking these alleles. Spontaneous
bacterial mutants harboring these alleles can be selected for using
antibiotics including streptomycin (rpsL), rifampicin (rpoB),
gentamicin, and others. These antibiotic resistance phenotypes can
be useful singly, or in combination (double, triple mutants, or
more). Isolation of improved FKPHD producers, in combination with
LAL gene cluster activation, illustrates the utility and
compatibility of combining both recombinant strategies for strain
enhancement over wild-type. To isolate spontaneous rpoB mutants
(rpsL described above), vegetative mycelia or spores of desired
strains were spread to ISP2 plates containing rifampicin, and
resulting individual colonies were cultivated in the presence of
rifampicin to confirm resistance. Nucleotide lesions in rpoB
leading to antibiotic resistance were confirmed by PCR
amplification of the rpoB locus from resistant isolates in parallel
with sensitive parent strains, and the DNA sequences of both were
compared. Sequence-confirmed rpoB mutants were then compared in
fermentation panels, screening for increased production against
wild-type and LAL-enhanced recombinant strains without resistance
alleles.
Promoter Swap and Promoter Repair:
A PAC library was prepared from the genomic DNA of the Streptomyces
strain harboring the wild-type X15 gene cluster and cloned into the
pESAC13 backbone by BioSandT (Montreal, Canada). Molecular clones
with intact wild-type X15 gene clusters were identified from the
library by colony PCR. The X1.1-S12 promoter was PCR amplified with
the following primers (see below) from the S12 gene cluster and
cloned into the X15 gene cluster.
TABLE-US-00003 X15_LAL_F SEQ ID NO: 37
5'-CAAAGCGATTCGGAGAGCGGCCGGATCAGATCCAGGCGTGACATTCA
TACCCTTCCGGCGAAGTGCAGTTCACCC-3' X15_LAL_R SEQ ID NO: 38
5'-CGATCTTCTCGAAACTGCACTGAGGAGGTTCGTCGGAGACTGCCATT
CACCTCTCCCGGAAAGGTATTGCTCG-3'
To introduce the S18 LAL transcription factor, a Gateway acceptor
vector (ThermoFisher, Grand Island, N.Y.) was first cloned into the
pESAC13 backbone. The S18 LAL was transferred to the X15 PAC
backbone using LR Clonase. The same approach was used to repair the
non-canonical LAL promoter sequences in the X11.2 PAC. The X11.1
and X11.2 promoters with repaired LAL sites were generated by
synthetic gene construction design with the DNAWorks webserver
(mc11.ncifcrf.gov/dnaworks/).
TABLE-US-00004 >PAC_HA_X11.1_promoter_G SEQ ID NO: 39
5'-GCGTTCGGCATTGACGCGAAGCAAGTCATGAATCGGCTGAATCAAT
TCCGCGCGCGACATTCGCACCCTTCCGGTGAAGTGCGGTATTGCTCAGA
CATAACCCGGATCGCAATCCAACGACCAGCCATGCACTACCGATAATCG
AATCGGAACAATAGCAAGCTCGTTGAGCATATTTTCCATGCGGCACCAC
CTCGGCGCCACCCCCTAGTTTTGCCGACCCCCTATGTGTATTTCGGCAG
GCAGACTAGGGGGTTGCGTGGGCCGCACCCGAGGCATTCGATTGGCGCA
CGGCGCACTCGGGCCATGTCACCGACCGTGAATGTTTCATCGCTACGGG
TAGCAATAGTCCTTTCTCGGGAGAAGTGAATGGCTTCCAAAAGTCCCCG
CCCAGGGTCCGAGAGAGCGGGTTCTGCGATTTCCCGGGCA-3'
>PAC_HA_X11.1_promoter_G_4bp SEQ ID NO: 40
5'-GCGTTCGGCATTGACGCGAAGCAAGTCATGAATCGGCTGAATCAAT
TCCGCGCGCGACATTCGCACCCTTCCGGTGAAGTGCGGTATTGCTCAGA
CATAACCCGGATCGCAATCCAACGACCAGCCATGCACTACCGATAATCG
AATCGGAACAATAGCAAGCTCGTTGAGCATATTTTCCATGCGGCACCAC
CTCGGCGCCACCCCCTAGTTTTGCCGACCCCCTATGTGTATTTCGGCAG
GCAGAACACCTAGGGGGTTGCGTGGGCCGCACCCGAGGCATTCGATTGG
CGCACGGCGCACTCGGGCCATGTCACCGACCGTGAATGTTTCATCGCTA
CGGGTAGCAATAGTCCTTTCTCGGGAGAAGTGAATGGCTTCCAAAAGTC
CCCGCCCAGGGTCCGAGAGAGCGGGTTCTGCGATTTCCCGGGCA-3'
>PAC_HA_X11.2_promoter_A SEQ ID NO: 41
5'-GCGTTCGGCATTGACGCGAAGCAAGTCATGAATCGGCTGAATCAAT
TCCGCGCGCGACATTCGCATCCTTCTGGTGAGGTGCAGTATTGCTGAGA
CATAATCCGGGCCGTAATCCAACGACCAGCCATGCGCCGCCGATAGTCG
AATCCGATAGTCGAATCTGAACGCTAGCAGCTCGTCGCAGGGGCTCCGG
GGAGCCCAACCCCCTAATTTTTCCGCCCCCCTATACATATCCACTGCAG
GCAGAACACCTAGGGGGTTGCGCGAACCGGGCGCGCGGTATCGGATTTA
CCGCACGGCACACTCGGGCGACGTCACCGACCGTGAATCCTTCATCGCT
ACGGGTAGCACAGTCCTTTCCGGGAGAAGTGAATGGCTTCCAAAAGTCC
CCGCCCAGGGTCCGAGAGAGCGGGTTCTGCGATTTCCCGGGCA-3'
>PAC_HA_X11.2_S12_promoter SEQ ID NO: 42:
5'-GCGTTCGGCATTGACGCGAAGCAAGTCATGAATCGGCTGAATCAAT
TCCGCGCGCGACATTCATACCCTTCCGGCGAAGTGCAGTTCACCCGGTA
ATGCATTCCGGACCGTAGCAGTCCGATACAGACGTCCGCCATGCCGTGC
CACCCTTGTTTTTCACCCCCCTACGCCCGTTTCGCCTGGCCGGAAACCT
AGGGGGTTGCGTGGAAAGCACCGGCGGGTGTTCGCTTGCACAGCGCCAC
CTCGGGCATTTTCTGGATGCGCGAGCAATACCTTTCCGGGAGAGGTGAA
TGGCTTCCAAAAGTCCCCGCCCAGGGTCCGAGAGAGCGGGTTCTGCGAT TTCCCGGGCA-3'
The wild-type X2 gene cluster was prepared from Streptomyces
genomic DNA and cloned into the modified pCC1 backbone by Intact
Genomics, Inc. (St. Louis, Mo.). The UniLAL promoter was PCR
amplified from the UniLAL-S18-LAL expression vector and cloned into
the X2 gene cluster.
Example 1. Use of LAL Transcriptional Regulators as General
Induction and Overexpression Strategy
Gene clusters under the control of one or more bidirectional
promoters were constructed. In particular, a set of FkPhD gene
clusters was generated (FIG. 1A), each including two bidirectional
promoters, shown as Promoter Region 1 and Promoter Region 2. Each
promoter contained one or more LAL binding domains selected from
those shown in FIG. 1B. Alignment of a set of such putative LAL
binding domains extracted from FK gene cluster promoter regions
revealed conserved regions. As shown in FIG. 1C, the general
experimental approach involved subcloning of a codon-optimized LAL
panel into an integrating vector driven by, e.g., a strong ermE*
promoter.
LALs were selected for these experiments by clading all LALs in a
high pass genomic database including publication-quality assembled
genomes (FIG. 2). These LALs were claded using the helix-turn-helix
motif of the rapamycin LAL (S9), yielding a design query. FkPhD
LALs were shown to clade together and were dissimilar on a sequence
level from other Type I PKS-associated LALs, such as pikD (FIG.
3).
Example 2. Expression of LALs Drives Polyketide Production from
Biosynthetic Gene Clusters
As presented in FIG. 4, a large panel of LALs was expressed in a
native Streptomyces producer of the X1 family of molecules
(Compound 1, Compound 2, and Compound 3). Specifically, the X1
FkPhD gene cluster was observed in the S22 native strain, and a
panel of LALs were then conjugated into the S22. The resulting
strains were assayed for enhanced expression of polyketides.
Production of the X1 gene cluster family of products (i.e.,
Compound 1, Compound 2, and Compound 3) was assessed by LC/MS. The
results indicated that some LALs acted as repressors and suppressed
polyketide expression compared to wild-type (i.e., in the absence
of LAL). In some cases, the LAL significantly increased the
expression of the polyketide compared to wild-type. These results,
therefore, indicated that certain LALs are constitutively active in
this context. S363, the exconjugate with the integrated vector
constitutively expressing the S18 LAL, produced the highest levels
of Compound 1, Compound 2, and Compound 3. The production of the
desired product, Compound 2, was further optimized by combining S18
overexpression with other modifications to the biosynthetic locus,
including ribosomal protein rpsL mutations (e.g., induced by
streptomycin) and P450 deletion (FIG. 5). The resultant strain,
S583, yielded increased production of Compound 2.
Example 3. Promoter Engineering to Replace a Silent LAL Promoter in
a Biosynthetic Gene Cluster
The X15 gene cluster includes a silent promoter containing no
canonical LAL binding sites. This promoter was replaced with the X1
promoter, which includes LAL binding sites to produce a refactored
X15 gene cluster under the control of the X1 promoter (FIG. 6). A
pESAC13 expression vector including the refactored X15 gene cluster
was then modified by Gateway cloning to introduce a cassette where
expression of the S18 LAL is under the control of the ermE*
promoter. The resultant expression vector was then conjugated into
S942 cells (a derivative of Streptomyces ambofaciens) for
heterologous expression of the S18 LAL and biosynthetic genes in
the X15 gene cluster.
As shown in FIG. 7, re-engineering of the X15 gene cluster to
replace the X15 promoter with the X1 promoter resulted in
expression of X15 gene cluster genes and downstream production of
X15 biosynthesis products at high levels. The top row of panels
shows S942 alone as a control. The middle panel shows a strain
generated by conjugating S942 to the X1 gene cluster (encoding
Compound 1 and Compound 2) with the S18 LAL expressed from the
vector backbone. Compound 2 expression is observed by Top-Down
proteomics analysis. This data confirms that LAL expression can
induce PKS expression of a strain with an intact promoter, as
defined the by presence of functional LAL binding sites, in a
heterologous producer strain. The bottom panels show the
above-described strain generated by conjugating S942 to the X15
gene cluster with the endogenous promoter swapped with the X1
promoter and with the S18 LAL expressed from the vector backbone.
These data showed that X15 production matched or exceeded that of
S942 cells engineered to produce Compound 2 from an X1.1 locus.
Thus, the data confirms that promoter replacement and LAL
expression can induce PKS expression from a silent gene cluster in
a heterologous producer.
Example 4. FK Bi-Directional Promoters
The sequences of the promoters from rapamycin, X1, X11.1, X22.1,
X15, and X23.1 biosynthetic gene clusters were analyzed to
correlate conserved sequence elements to native and/or heterologous
production (FIG. 8). Three general classes of bidirectional FkPhD
promoters were identified: (1) highly active promoters with intact
promoter sequences including the functional LAL binding sites
(e.g., rapamycin and X1), (2) less active promoters with impaired
production in which mutations are observed in the core LAL binding
sites (e.g., X11.1 and X22.1), and (3) silent promoters with severe
deviations from the consensus sequence (e.g., X15 and X23.1).
Generally, deviations from the consensus promoter sequence
correlated with reduced compound production.
Sequence alignments of the LAL binding sites within the primary
bi-directional promoters of two novel and related FkPhD gene
clusters, X11.1 and X11.2, showed several mutations (deviations
from the consensus LAL binding site) that appeared to modulate
promoter strength and resultant production. For example, mutations
were identified that reduced promoter strength and led to poor
FkPhD expression (FIG. 9). In the case of X11.1, the wild-type
promoter lacked the conserved ACAC motif and a G from a core LAL
operator sequence (AGGGGG). In the case of X11.2, the wild-type
promoter lacked an A from the core LAL operator sequence. We
restored the X11.1 and X11.2 sequences to the consensus sequence to
generate the sequences shown as Seq1, Seq2, and Seq3, and examined
whether repairing these mutations impacted expression in the X11.2
gene cluster.
The restored sequence lesions in the LAL binding sequence yielded
increased polyketide synthase production. FIG. 10 shows a
comparison of X11.2 FkPhD expression with the X1.1 promoter swap,
the X11.1 promoter with the core G and ACAC motif restored (Seq2),
and the X11.2 promoter with the A from the core LAL binding
sequence restored (Seq3). In contrast to the wild-type (WT) 11.2,
the Seq2 promoter yielded a significant increase in FkPhD
production. Restoration of the A from the core LAL binding sequence
(Seq3) increased FkPhD production more than the Seq2 promoter. The
total X1 promoter swap yielded the greatest FkPhD production. These
data show that restoring mutated conserved promoter sequences is a
reliable approach for increasing FkPhD production. These data also
provide support experiment support for our definition of the core
LAL binding site sequence.
Example 5. UniLAL Variants
Promoter Region 1 and Region 2 bidirectional promoters were
strategically dissected to yield four promoter designs (i.e.,
PC.sub.L, PC.sub.R, PT.sub.L, PT.sub.R) for subsequent functional
testing (FIG. 11A) Each UniLAL variant included a -10 and -35 site
as well as an LAL binding site. FIG. 11B captures the logic of
UniLAL dissection. The UniLAL promoter was defined as the ribosome
binding site (RBS), LAL binding sites and/or key prokaryotic
promoter elements such as -10 and -35 sites. In some instances, the
LAL binding site overlapped or replaced the -10 or -35 sites. In
addition to the composition and sequence of these key elements, the
spacing and orientation (sense/antisense) may be essential to the
function of a particular design.
The promoter strength of each of the UniLAL variants was assessed.
In order to rank order the 4 UniLAL designs (PC.sub.L, PC.sub.R,
PT.sub.L, PT.sub.R), each UniLAL promoter was subcloned in front of
the S18 LAL. The resulting integrative expression plasmid was
conjugated to S22, which produces the Compound 2 family of
compounds. As such, the UniLAL promoter in a particular conjugant
was expected to be activated by the S18 LAL to create a
feed-forward circuit to maximize LAL expression, gene cluster
activation and produce an increase in Compound 2 production.
Production of Compound 4, Compound 1, Compound 2, and Compound 3
induced by each of the UniLAL promoters is shown in FIG. 12. These
data show that the Promoter Region 1 designs (i.e., PCL, PCR) are
most effective for driving LAL expression and gene cluster
production.
This approach was also tested for ability to drive polyketide
production in an ordinarily silent biosynthetic gene cluster that
does not naturally include an LAL regulator (FIG. 13). When the
modified X2 gene cluster was expressed in the presence of the S18
LAL, robust expression of X2 was observed by the Top-Down
assay.
Example 6. Positive Feedback Overexpression Strategy
The LAL regulon was designed to create a positive feedback loop
(FIG. 14). This approach involved placement of LAL binding sites in
the bi-directional promoters as well as upstream of a gene encoding
an S18 LAL. As such, expression of an LAL (e.g., a wild-type LAL)
could induce expression from each of the LAL binding sites: in the
PKS biosynthetic gene cluster as well as those in the promoter of
the S18 LAL, which can in turn further activate expression from the
LAL binding sites, thereby resulting in a positive feedback loop.
This may result in strong overexpression (e.g., stronger than
expression driven by a PermE* promoter). Further, this strategy may
permit idiophase timing according to precursor flux and/or
post-translational modifications. FIG. 15 shows that the feedback
loop can be used to enhance polyketide production. These data
indicate that the feedback loop and/or constitutive LAL expression
via the ErmE* promoter can induce PKS expression more than the
native strain alone (S22). Constitutive and forward-feedback
expression may yield additional PKS expression.
In one example, transcription of the single mega-cistron of the X2
biosynthetic gene cluster and the S18 LAL were placed under the
control of the X1 UniLAL promoter, the latter effectively
establishing an auto-regulatory operon. Transcription of the LAL
would be further augmented by expression of the LAL itself. The
UniLAL promoter regulated S18 LAL and X2 PKS constructs were
sequentially conjugated into S1496 along with the native X2 gene
cluster, to serve as a control.
Example 7. Knock-In of the X1 Promoter into a FKPHD Gene
Cluster
Instead of inserting the X1 promoter to replace the wild-type
promoter on a BAC or PAC harboring the FkPhD gene cluster for
heterologous expression (e.g., as described in Example 4 above),
the X1 promoter was knocked into the endogenous locus of the native
strain (S61), which encodes the novel FkPhD gene cluster X11 (FIG.
16). pJVD possesses a temperature-sensitive origin of replication,
an apramycin selection marker and a rpsLrplS counter-selection
gene. The X1 promoter appended with 1000 bp of DNA sequence
flanking the start codons of the opposing PKS mega orfs of X11 was
cloned into pJVD52.1pJVD, and this vector was conjugated into S61
and selected for apramycin resistance at the permissive temperature
of 30.degree. C. Chromosomal integration was forced by growth at
39.degree. C. and the maintenance of the apramycin selection. Cells
were then passaged in the absence of apramycin, then challenged
with streptomycin to bias for clones with selection for the desired
resolution double crossover event, resulting in the scarless
insertion of the X1 promoter precisely into the host chromosome to
replace the WT X11 promoter. Colonies were confirmed as genuine pX1
knock-ins by replica plating to confirm susceptibility to apramycin
and by junction PCR checking for the 5' and 3' amplicons of the
expected sizes.
Example 8. Feed-Forward/UniLAL (Unidirectional LAL Sensitive)
Promoter Methods
Feed-Forward Configuration of the S18 LAL
Initially the (TTA minus, synthetic) S18-derived LAL gene was put
under the transcriptional control of the S12-derived "core"
UniLAL-left and right promoters. The S18 LAL was substituted at the
initiation codons for the left and right PKS transcripts of the S12
biosynthetic gene cluster via a two-step subcloning procedure.
First, a BamHI to Spel fragment containing all but the 5' 269 bases
of the S18 LAL gene was subcloned into BamHI/Xbal digested pWFE1
cTR expression vector (which possesses the following features for
conjugal delivery into Actinobacteria: the phage TG1 integrase gene
and attP, an E. coli origin of transfer [oriT], and a gene that
confers resistance to thiostrepton). Then the intermediate plasmid
was digested with Aarl and BamHI restriction endonucleases, and PCR
amplicons composing either the left or right UniLAL promoter plus
the missing .about.269 bases of the S18 LAL from the initiation
codon to the BamHI site in the gene were stitched together via a
3-part isothermal Gibson assembly using 2.times. Master Mix from
New England Biolabs according to their instructions. To obtain the
first amplicon, the UniLAL left promoter was PCR amplified and
appended with the 5' end of the S18 LAL gene using the pWarp Factor
1.times.1 genomic TAR clone as template with the following primer
pair:
TABLE-US-00005 FFcoreL_Aar_F SEQ ID NO: 43
gcgcccaccttaatcgcaggtgTCCACGCAACCCCCTAGGTTTCC GGCCAGG C-L_S18_R SEQ
ID NO: 44 gttcatagctctccacggcaggcatTCATACCCTTCCGGCGAAGTG
CAGTTCACCCGGT
Similarly, the UniLAL right promoter was amplified and appended
with the 5' end of the S18 LAL gene with the following primer
pair:
TABLE-US-00006 FFcoreR_Aar_F SEQ ID NO: 45
gcgcccaccttaatcgcagGTGCCACCCTTGTTTTTCACCCCCCT ACGCCCGT C-R_S18_R
SEQ ID NO: 46 gttcatagctctccacggcaggcatTCACCTCTCCCGGAAAGGTATT
GCTCGTGCATCCA
For the second amplicon, 5' end of the S18 LAL gene was amplified
and appended at the 5' end with either UniLAL-left or UniLAL-right
sequence using pSET152 S18 LAL (TTA minus) as template with the
following primer pairs:
TABLE-US-00007 C-L_Bam_F SEQ ID NO: 47
actgcacttcgccggaagggtatgaATGCCTGCCGTGGAGAGCTAT GAACTGGACGC
S18LAL_Bam_R SEQ ID NO: 48 CCGGGAGGGCCATGGAGACCGGA C-R_Bam_F SEQ ID
NO: 49 agcaatacctttccgggagaggtgaATGCCTGCCGTGGAGAGCTAT GAACTGGACGC
S18LAL_Bam_R SEQ ID NO: 50 CCGGGAGGGCCATGGAGACCGGA
or
All PCR amplifications were carried out using Q5 Hot Start DNA
polymerase from New England Biolabs according to their
specifications (with inclusion of the GC Enhancer supplement).
Aarl/BamHI digested vector as well as amplicons were isolated by
standard agarose electrophoresis and purified from the agarose
using the Zymoclean.TM. Gel DNA Recovery Kit. One tenth of the
Gibson assembly reaction was transformed into chemically competent
NEB 10.beta. E. coli and spread onto chloramphenicol (25 .mu.g/mL)
LB plates. After overnight incubation at 37.degree. C., the
chloramphenicol resistant colonies were picked into 5 mL cultures
of Luria Bertani broth supplemented with 25 .mu.g/mL
chloramphenicol and shaken overnight at 37.degree. C. Plasmid was
isolated using the QIAprep Spin Miniprep Kit and then sent off for
Sanger sequence verification at GeneWiz, Inc.
Example 9. Swapping of the "Core-Left" UniLAL Promoter for Native
Promoter of the X2.1 Biosynthetic Gene Cluster
Next generation sequencing (NGS) of genomic DNA from the
actinomycete S17 had revealed a biosynthetic gene cluster with a
polyketide synthase similar to but distinct from that of the
biosynthetic gene cluster known to encode the information for the
natural product meridamycin. This gene cluster was designated X2
(and later X2.1 when a second, near identical gene cluster (X2.2)
was identified by NGS of S55). To obtain a molecular clone of the
X2.1 biosynthetic gene cluster, S17 was liquid cultured in the
presence of 0.5% w/v glycine. The mycelial biomass was frozen and
sent to Lucigen Corporation who extracted and randomly sheared the
genomic DNA, then used it to construct a BAC library in their
shuttle vector pSMART BAC-S (which is a conventional BAC vector
enabled for conjugation and integration into Streptomyces by the
addition of the integrase gene and attP of phage .PHI.C31, an E.
coli oriT, and a gene that confers resistance to apramycin) in
their host E. coli strain Replicator v2.0 (whose genotype is rpsL).
The library was supplied as glycerol stocks of E. coli arrayed in
384-well plates. Clones harboring the intact X2.1 locus were
identified by dual color TaqMan assays using probes designed from
proximal 5'- or 3'-flanking regions of the X2.1 gene cluster that
were labeled with HEX and FAM fluors respectively. Primers and
probes were designed using IDT's software and then ordered from
them. To identify double positive clones, 1 .mu.L of glycerol stock
was used as template in conjunction with the primer pairs and
probes and TaqMan.RTM. Fast Advanced Master Mix. Cycling and
real-time fluorescence monitoring took place in a Bio Rad CFX384
Touch.TM. Real-Time PCR Detection System. BAC DNA prepped from
double positive clones was confirmed to be correct by Sanger end
sequencing at Tacgen, and ultimately exhaustively checked by
Illumina and PacBio NGS at the Yale YOGA.
The X1.1 UniLAL left promoter was PCR amplified (using Q5 DNA
polymerase and the pWF1 X1.1 plasmid as template) and appended at
the 5' and 3' ends with 60 bp of sequence upstream of and precisely
downstream of the initiation codon, respectively, of the X2.1 KCDA
gene. The primer pair (flanking sequences denoted as capital
letters/lower case letters denote regions that anneal to the X1
Core-Left UniLAL promoter; start anticodon in bold) used was:
TABLE-US-00008 X2.1_ULL-Run_F SEQ ID NO: 51
CTACCCGAATACATCGCCTTCTGGGGCCCAGCCCAAACCAGC
GCCCTCATCCACACtccacgcaaccccctaggtttccggc X2.1_ULL-Run_R SEQ ID NO:
52 gCGGCCCACAACGTGCACGAGCGTGGCGATATCGGACGCG
GAAAGAACCAGCGTGCTCATtcatacccttccggcgaagtgcagttcaccc
Confirmation of insertion of the X1 Core-Left promoter precisely at
the X2.1 KCDA initiation codon was obtained by performing 10 .mu.L
PCR amplifications using 0.5 .mu.L of culture as template in
conjunction with the following primer pair flanking the expected
insertion site:
TABLE-US-00009 X2.1_HandR_cPCR_2F SEQ ID NO: 53
CGCCGTCTACCCAGCCCAAAGCCAGC X2.1_HandR_cPCR_2R SEQ ID NO: 54
CGGGTTCGTGGTGCGGCATCCATTCG
Amplicons of the expected 476 bp in length were treated with
ExoSAP-IT to degrade excess primer and dNTPs according to the
manufacturer's conditions and sent off for Sanger sequence
verification (each primer used separately for two individual reads)
at GeneWiz Inc. A 250 ml LB broth culture derived from one of the
clones with the exact anticipated sequence (X1 Core-Left UniLAL
promoter fused to X2.1 KCDA gene at the initiation codon) was fed
into the BAC XTRA purification system (according to the
manufacturer's conditions) to isolate intact X2.1/Core-Left UniLAL
BAC DNA. This DNA prep was used to electrotransform S181 E. coli
that were allowed to recover, then selected on choramphenicol (25
.mu.g/mL) and apramycin (100 .mu.g/mL) LB agar plates at 37.degree.
C. overnight. Colonies were picked into 5 ml of LB broth
supplemented with choramphenicol and apramycin, grown overnight,
and then used for conjugation into various heterologous production
strains.
Example 10. Promoter Replacement via dsDNA Recombineering
To replace the endogenous promoter of X15, the X15 PAC is first
engineered using dsDNA recombineering to harbor a positive/negative
selection cassette, thus enabling a second round of seamless DNA
insertion. E. coli harboring the PAC with the complete X15 promoter
are rendered electrocompetent, transformed with pKD46 as known in
the art (e.g., as described in Wanner and Datsenko; Proc Natl Acad
Sci USA. (2000) 97:6640-5) and co-selected on kanamycin (50
.mu.g/mL) and carbenicillin (100 .mu.g/mL) LB agar plates at
30.degree. C. A positive/negative selection cassette is generated
by PCR amplifying the plasmid template pKDCR (for the bicistronic
expression of rpsL and a chloramphenicol resistance gene) using
Phusion polymerase (NEB Biosystems, Beverly, Mass.) with DNA
oligonucleotides containing 50 bp overhangs homologous to the X15
NRPS gene and PKS-A.
TABLE-US-00010 X15_rpSL_cm_F SEQ ID NO: 55
CAAAGCGATTCGGAGAGCGGCCGGATCAGATCCAGGCGTGACATGGCCTG
GTGATGATGGCGGGATCGT X15_rpsL_cm_R SEQ ID NO: 56
CGATCTTCTCGAAACTGCACTGAGGAGGTTCGTCGGAGACTGCCATTCAT
CGCAGTACTGTTGTATTCATTAAG
The amplicon from the PCR reaction is agarose gel-purified and
extracted. A saturated culture of E. coli harboring the X15 PAC and
pKD46 is diluted 1:100 into LB Lenox broth supplemented with
kanamycin and carbenicillin and 1% w/v L-arabinose. The culture is
shaken at 250 rpm at 30.degree. C. until OD600 reached 0.5, at
which point the cells are made electrocompetent with cold distilled
dH.sub.2O washes as described by Datsenko et al. 100 ng of the
purified selection cassette is electroporated into E. coli using a
Bio RAD MicroPulser.TM. electroporator on the "EC" setting. E. coli
are allowed to recover in 1 mL of SOC at 30.degree. C. for 1 hour,
spread onto chloramphenicol (25 .mu.g/mL) and carbenicillin (100
.mu.g/mL) LB agar plates and selected overnight at 30.degree. C.
Colonies are picked into 1 mL cultures of LB broth supplemented
with kanamycin, chloramphenicol, and carbenicillin and grown at
30.degree. C. overnight. Confirmation of insertion of the
positive/conditional negative selection cassette at the X15 major
promoter locus is confirmed by junction PCR.
Cultures that are double positive for the expected 5' junction and
3' junction amplicons (as judge by agarose electrophoresis) are
grown as above in LB Lenox with kanamycin, carbenicillin and
arabinose and made electrocompetent. The S12 promoter is PCR
amplified (using Q5 DNA polymerase and the pWF1.1X1.1 plasmid as
template) and appended at the 5' and 3' ends with 50 bp homology
arms to the X15 NRPS gene and PKS-A.
TABLE-US-00011 X15_LAL_F SEQ ID NO: 57
5'-CAAAGCGATTCGGAGAGCGGCCGGATCAGATCCAGGCGTGACATTCA
TACCCTTCCGGCGAAGTGCAGTTCACCC-3' X15_LAL_R SEQ ID NO: 58
5'-CGATCTTCTCGAAACTGCACTGAGGAGGTTCGTCGGAGACTGCCATT
CACCTCTCCCGGAAAGGTATTGCTCG-3'
Electroporated cells are allowed to recover in 1 mL of SOC for 1
hour at 37.degree. C. with shaking and then selected on kanamycin
(50 .mu.g/mL)+streptomycin (250 .mu.g/mL) LB agar plates overnight
at 37.degree. C. Colonies are picked into 1 mL cultures of LB broth
supplemented with kanamycin (50 .mu.g/mL) and apramycin (100
.mu.g/mL) and grown at 37.degree. C. overnight with shaking.
Confirmation of insertion of the S12 promoter at the X15 major
promoter locus is confirmed by junction PCR.
Example 11. Promoter Replacement Via ssDNA Recombineering and
Gibson Cloning
In another technique, to replace the endogenous promoter of X15,
the X15 PAC is first engineered using ssDNA recombineering to
introduce AT-rich Pmel restriction sites (5'-GTTTAAAC-3') flanking
the endogenous X15 major promoter locus. E. coli harboring the PAC
with the complete X15 promoter are rendered electrocompetent,
transformed with pKD466, a variant of pKD46 (Wanner and Datsenko;
Proc Natl Acad Sci USA. (2000) 97:6640-5) in which the exo and
gamma genes had been deleted, and co-selected on kanamycin (50
.mu.g/mL) and carbenicillin (10 .mu.g/mL) LB agar plates at
30.degree. C. A saturated culture of E. coli harboring the X15 PAC
and pKD466 is diluted 1:100 into LB Lenox broth supplemented with
kanamycin and carbenicillin and 1% w/v L-arabinose. The culture is
shaken at 250 rpm at 30.degree. C. until OD600 reached 0.5, at
which point the cells were made electrocompetent with cold
distilled dH.sub.2O washes as described by Datsenko et al. Cells
are resuspended in 50 .mu.L of a 1 .mu.M ssDNA oligonucleotide
solution and electroporated into E. coli using a Bio RAD
MicroPulser.TM. electroporator on the "EC" setting. E. coli are
allowed to recover in 1 mL of SOC at 30.degree. C. for 1 hour,
spread onto kanamycin (25 .mu.g/mL) LB Lennox overnight to
saturation. Confirmation of insertion of the Pmel site at the X15
major promoter locus is confirmed by allele-specific PCR combined
with two serial rounds of a limited dilution cloning protocol that
allowed the clonal selection of a successfully modified X15 PAC
with a single Pmel site. This protocol is then repeated to
introduce a second flanking Pmel site. Both "sense" and "antisense"
oligonucleotides, which are synthesized with 5' phosphothiorate
caps, are tested to define the lagging strand of the PAC.
ssDNA Oligonucleotides (Pmel Site underlined)
TABLE-US-00012 5'_X15_PmeI_sense SEQ ID NO: 59
GCAAAGCGATTCGGAGAGCGGCCGGATCAGATCCAGGCGTGACATGTTTA
AACACAACGTACCTTTCGGACAAGAGTGCCGCGGTGCACAGCCTGACC
5'_X15_PmeI_antisense SEQ ID NO: 60
GGTCAGGCTGTGCACCGCGGCACTCTTGTCCGAAAGGTACGTTGTGTTTA
AACATGTCACGCCTGGATCTGATCCGGCCGCTCTCCGAATCGCTTTGC 3'_X15_PmeI_sense
SEQ ID NO: 61 TCCACACCTCTCGGTTCACAAACGTCCGAGCATAAGGGAGGTAAAGTTTA
AACATGGCAGTCTCCGACGAACCTCCTCAGTGCAGTTTCGAGAAGATC
3'_X15_PmeI_antisense SEQ ID NO: 62
GATCTTCTCGAAACTGCACTGAGGAGGTTCGTCGGAGACTGCCATGTTTA
AACTTTACCTCCCTTATGCTCGGACGTTTGTGAACCGAGAGGTGTGGA
The X15 PAC, now modified with Pmel sites, is linearized with Pmel.
The S12 promoter is PCR amplified (using PQ5 DNA polymerase and the
pWF1.1.times.1.1 plasmid as template; primers listed below) and
appended at the 5' and 3' ends with 50 bp homology arms to the X15
NRPS gene and PKS-A.
TABLE-US-00013 X15_LAL_F SEQ ID NO: 63
5'-CAAAGCGATTCGGAGAGCGGCCGGATCAGATCCAGGCGTGACATTCA
TACCCTTCCGGCGAAGTGCAGTTCACCC-3' X15_LAL_R SEQ ID NO: 64
5'-CGATCTTCTCGAAACTGCACTGAGGAGGTTCGTCGGAGACTGCCATT
CACCTCTCCCGGAAAGGTATTGCTCG-3'
S12 promoter and the Pmel linearized X15 PAC is seamlessly cloned
by Gibson cloning using the Gibson Assembly Ultra Kit (SGI-DNA,
Inc.) using the recommended protocol. After electroporation,
correct clones are identified as above.
Example 12. Expression of LALs Drives .beta.-Lactam Compound
Production from a .beta.-Lactam Gene Cluster
The previously described pX1-S18 LAL system was used to drive the
overexpression of a novel beta-lactam gene cluster, WAC292 (FIG.
17A). Three copies of the pX1 promoter were subcloned into WAC292
to drive the predicted core biosynthetic operons at 3 of the 5
promoter sites to generate WAC292-p2p3p5. The S18 LAL was cloned
onto the backbone of WAC292-p2p3p5, and the resulting engineered
BAC was conjugated to S5627, a known beta-lactam producing strain
with the endogenous beta-lactam cluster deleted, thus removing any
endogenous beta-lactam activity. After fermentation, WT and
WAC292-p2p3p5 S5627 strains were compared to Nanostring analysis
mRNA using a custom probe set designed against 19 sites of the
cluster. Transcripts linked to the P2, P3, and P5 promoters were
significantly upregulated in WAC292-p2p3p5 as compared to WAC292-WT
(FIG. 17B).
Cloning Protocol to Generate WAC292-p2p3p5
The YAC/BAC conjugative vector pWF10 harboring the .beta.-lactam
gene cluster was linearized at the unique Pacl and Swal (NEB)
sites. The S18LAL expression cassette (ermE* promoter/synthetic TTA
codon minus S18 LAL gene/phage fd transcriptional terminator) was
PCR amplified using pWFE1 S18LAL as template and appended at each
end with .about.40 bp of vector sequence 5' proximal to the Pacl
site and 3' proximal to the Swal site using Q5 HotStart DNA
polymerase.
TABLE-US-00014 LAL_N2_292_F SEQ ID NO: 65
5'-CCCGAACCACGATGAGCACTTGCCTATGCGGTGTAGGGATAACAGGG
TAATTAATTAATGACCTGCGCCCACCTTAATCGCAGGTGC-3' LAL_N2_292_F SEQ ID NO:
66 5'-TACTTTCTATTTTTAATTTATATATTTATATTAAAAAATTTAAAATA
TAATTATTTTTATAGCACGTGATGGAGCCTATGGAAAAACGCCAGCAACG C-3'
The restriction digested BAC and the PCR amplicon were mixed in a
total of 5 .mu.l and an equal volume of NEBuilder HiFi DNA Assembly
2.times. Master Mix added, after which the reaction proceeded for
one hour at 50.degree. C. 1.5 .mu.l of the completed reaction was
added to 70 .mu.l of electrocompetent NEB 10-beta E. coli, mixed,
the contents deposited in a Bulldog Bio 0.1 cm gap electrocuvette
and transformed using a BioRad Micropulser electroporator set to
the "EC1" parameters. 930 .mu.l of SOC media was used to resuspend
the electroporated cells and the entire volume pipetted into a 50
ml Falcon tube. The tube was placed in a shaking incubator set at
37.degree. C. and the electroporated E. coli allowed to recover for
1 hour. 200 .mu.ls of recovered bacteria were spread onto five LB
agar-100 .mu.g/ml apramycin Petri dishes. The dishes were inverted
and incubated overnight @ 37.degree. C. Colonies were picked into 1
ml cultures of LB broth supplemented with 100 .mu.g/ml apramycin
and incubated with shaking @ 37.degree. C. overnight. 1 .mu.l of
saturated bacterial culture was used as template in PCR reactions
to amplify the entire S18 LAL expression cassette.
TABLE-US-00015 pWF10_Swa_cPCR_R SEQ ID NO: 67
5'-GGTAGTATTTGTTGGCGATCCCCCTAGAGTCTTTTACATCTTCG G-3'
pWF10_Swa_cPCR_F SEQ ID NO: 68 5'-AGCCTGCCCCTCATCTGTCAAC-3'
The resulting amplicons were diluted and 1:144 with dH.sub.2O, 14.5
.mu.ls of the diluted amplicons were added to 0.5 .mu.l of a series
of 100 .mu.M sequencing primers and sent off for Sanger
verification to ensure no errors had been introduced into the S18
LAL expression cassette during the cloning process. A sequence
perfect clone was grown at scale (300 ml culture prep) and the
YAC/BAC purified using a Macherey Nagel Nucleobond Xtra BAC
kit.
The purified YAC/BAC was concomitantly digested with three Alt-R
guide crRNAs complexed with Alt-R CRISPR-Cas9 tracRNA and
recombinant S. pyogenes Cas9 protein (all from Integrated DNA
Technologies) for one hour @ 37.degree. C. The guide cRNAs were
designed to cut within bidirectional promoters 2, 3, & 5 of the
.beta.lactam biosynthetic gene cluster. The triply Cas9 digested
BAC vector was ethanol precipitated and resuspended in 20 .mu.l of
10 mM Tris pH 8.0. Meanwhile, three PCR amplicons, two yeast
auxotrophic markers and a single X1 bidirectional core promoter,
were generated for "gap repair" insertion at the three sites of
cas9 digestion upon cotransformation into S. cerevisiae.
TABLE-US-00016 292_bi2_TRP-BstZ_F SEQ ID NO: 69
5'-GTTGATCGTGTGGGGCGGCCTGCCGAGCAGCTGGTGGACCCCTGGGG
CGAGCTGGCGCATTCACCTGTATACTGAGAGTGCACCATAAACGACATTA CT-3'
292_bi2_TRP-BstZ_R SEQ ID NO: 70
5'-GACGACCGCGGTCCCCACGAGGACAGCGGCCGACGCAACAGCTTTGC
GAAGACGAGTCATTCATACGTATACAGGCAAGTGCACAAACAATACT-3'
292_bi3_LEU-Hpa_F SEQ ID NO: 71
5'-CGCCGGTGAGGCCAGACCCATGAGGGTCAGTGCTGCGACCACCGCGT
ACCTGATCCGCATTCACCTGTTAACTCCTGATGCGGTATTTTCTCCTTAC GCA-3
292_bi3_LEU-Hpa_R SEQ ID NO: 72
5'-CTCGGCCGGCAGCAAGGTCTGCTCGATCGCGATGATCCGGCCGTTCC
CCCAGTCGATCGTGTTAACCGACTACGTCGTAAGGCCGTTTCT-3' 292_bi5_F SEQ ID NO:
73 5'-GACGAACGCGAAGTCGTCGCCGCCCTCCTTCATGCCCAGTCCGGTGG
TCCAGCCGCGGAAGCCGTGCGGATGCATTCACCTCTCCCGGAAAGGTATT GCTCG-3'
292_bi5_R SEQ ID NO: 74
5'-TCGCCACGGGCGGTCGAGGAACTCGTCGCGGACCGCCGCGACCCGTG
TTCGCGCGCCGTCACCGCCGACGCGCATTCATACCCTTCCGGCGAAGTGC AGTTC-3'
Using the above primer pairs, Q5 HotStart DNA polymerase and
pRS414, pRS415, and pWF1 X1 as template, the amplicons were
obtained and gel purified (using the Zymo Research Gel DNA Recovery
Kit).
The three amplicons added in >10.times. molar excess to the
triple digested .beta.lactam YAC/BAC and transformed into BY4727 S.
cerevisiae (ATCC 200889) using the lithium acetate/PEG method from
the Geitz lab. Following heat shock, the transformed yeast out of
the lithium/PEG/DNA mix, the yeast were pelleted @ 10,000.times. g
for 30 seconds and resuspended in 1 ml of SD TRP, LEU minus broth.
The yeast were then spread onto four SD TRP, LEU minus agar plates
(Teknova), the plates inverted, and incubated at 30.degree. C.
until colonies were visible (.about.four days). The YAC/BAC
residing in the cells of the yeast colonies were rescued and
transformed into E. coli as follows: colonies were picked into a
microcentrifuge tube with 20 .mu.l of 200 mM lithium acetate/1%
SDS, five or six 100 .mu.m diameter acid washed ceramic beads (OPS
Diagnostics) added and the contents vortexed for 5 minutes at
maximum rpm. 1 .mu.l of the lysate was electroporated into
electrocompetent NEB10-beta E. coli and selected on LB agar 100
.mu.g/ml apramycin Petri dishes. Colonies were used to inoculate 1
ml cultures in LB broth supplemented with 100 .mu.g/ml apramycin,
and 1 .mu.l from these cultures used as template in PCR (Bioline
MyTaq Hotstart Red 2.times. master mix) to verify the presence of
the expected 5' & 3' junctions for the X1 bidirectional core
(P5) and TRP (P2) and LEU (P3) marker insertions.
TABLE-US-00017 292_Bi2_Hit_5'F SEQ ID NO: 75
5'-GGCGTGGCTGGAGCCGAAGTGGTC-3' TRP_5'jPCR_R SEQ ID NO: 76
5'-TCTTCCACTACTGCCATCTGGCGTCATAACTGC-3' TRP_3'jPCR_F SEQ ID NO: 77
5'-AGGTTATTACTGAGTAGTATTTATTTAAGTATTGTTTGTGCACTTGC CT-3
292_Bi2_Hit_3'R SEQ ID NO: 78 5'-ACTCGGCGGCGTTGGCGTGGC-3'
292_Bi3_Hit_5'F SEQ ID NO: 79 5'-ACCGTCGCCCCGCCGCAGC-3'
LEU_5'jPCR_R SEQ ID NO: 80
5'-CGCACAGATTCGTAAGGAGAAAATACCGCATCAGGA-3' LEU_3'jPCR_F SEQ ID NO:
81 5'-ACTCTGTCAGAAACGGCCTTACGACGTAGTCG-3' 292_Bi3_Hit_3'R SEQ ID
NO: 82 5'-CGGGCGGCACGCAACCGAAGTG-3' 292_Bi5_Hit_5'F SEQ ID NO: 83
5'-GTGAAGACCGCCGATACCGCCGC-3' X1_pro_cPCR_3' SEQ ID NO: 84
5'-GGGTGAAAAACAAGGGTGGCACGGCA-3' X1_pro_cPCR_5' SEQ ID NO: 85
5'-TGCCGTGCCACCCTTGTTTTTCACCC-3' 292_Bi5_Hit_3'R SEQ ID NO: 86
5'-ACGCCAGGCCCGTTCACGACGACCGC-3'
One clone positive for the six junctions was grown at scale (300 ml
culture prep) and the YAC/BAC purified, digested with an excess of
BstZ171 and Hpal restriction enzymes (NEB), ethanol precipitated,
and resuspended in 50 .mu.l of 10 mM Tris pH 8.0. For multiplex
insertion of X1 bidirectional core promoters, in two separate
reactions the promoter was amplified and appended with .about.30 bp
5' & 3' sequence proximal to the sites of BstZ171 and Hpal
digestion, and gel purified.
TABLE-US-00018 292_bi2_Run F SEQ ID NO: 87
5'-GCTGGTGGACCCCTGGGGCGAGCTGGCGCATTCACCTCTCCCGGAAA GGTATTGCTCGC-3'
292_bi2_Run_R SEQ ID NO: 88
5'-AACAGCTTTGCGAAGACGAGTCATTCATACCATTCATACCCTTCCGG
CGAAGTGCAGTTCACCCG-3' 292_bi3_Run_F SEQ ID NO: 89
5'-TCAGTGCTGCGACCACCGCGTACCTGATCCGCATTCACCTCTCCCGG
AAAGGTATTGCTCGC-3' 292_bi3_Run_R SEQ ID NO: 90
5'ATCGCGATGATCCGGCCGTTCCCCCAGTCGATCGTCCGCATTCATACC
CTTCCGGCGAAGTGCAGTTCACCCG-3'
The X1 bidirectional promoter amplicons were added in tenfold molar
excess to the BstZ171/Hpal digested BAC, the mixture ethanol
precipitated and resuspended in 5 .mu.l 10 mM Tris pH 8.0. 5 .mu.l
of SGI Gibson Assembly Ultra Kit "A mix" was added, mixed, and
incubated @ 37.degree. C. for 5 minutes, heat killed @ 75.degree.
C. for 20 minutes, stepped down to 60.degree. C. and the
temperature dropped at a rate of 0.1.degree. C./second to 4.degree.
C. 10 .mu.l of "B mix" was then added and the reaction allowed to
proceed @ 45.degree. C. for 15 minutes. 1.5 .mu.l of the completed
reaction was electroporated into 70 .mu.l of electrocompetent
NEB10-beta E. coli and selected on 100 .mu.g/ml apramycin LB agar
Petri dishes. Colonies were used to inoculate 1 ml cultures in LB
broth supplemented with 100 .mu.g/ml apramycin and 1 .mu.l used as
template in PCR to confirm the presence of four new junctions
indicative of insertion of the X1 bidirectional promoter in place
of the native .beta.lactam's bidirectional promoters 2 & 3.
The loci surrounding the X1 bidirectional core promoters inserted
at P2, P3, and P5 were PCR amplified and used as template for
Sanger sequence QC to ensure no errors had been introduced during
the cloning process.
Strain Construction and Nanostring Methods
The construct WAC292-p2p3p5 was mobilized by conjugation from an E.
coli donor into Streptomyces sp. S5627, a carbapenem-producing
strain in which the endogenous carbapenem cluster had been deleted
by homologous recombination. The resulting ex-conjugants were
selected on medium containing 50 .mu.g/ml apramycin. The resulting
strain WAC292-p2p3p5-S5627 was grown in seed culture in 25 ml WDSM1
medium in a baffled 125 ml flask for 48 h before being sub-cultured
(5% inoculum) into 25 ml fermentation medium FMKN1 in an unbaffled
125 ml flask for a further 48 h. A 1 ml sample was removed on ice
and centrifuged to pellet the mycelium (wet weight approx. 150 mg).
The pellet was resuspended in lysis buffer RA1 (Macherey-Nagal
740955.50) and transferred to a FastPrep lysing matrix B tube (MP
Biomedical 116911050). The mycelium was disrupted by bead beating
in a Qiagen TissueLyser II at speed 30 for 5 min. The cell debris
was pelleted by centrifugation and 1 .mu.l of the cell lysate
utilized for hybridization for Nanostring analysis (following
manufacturer's instructions). Nanostring probe pools were prepared
and used as per manufacturer's instructions.
Nanostring Data Analysis and Normalization
RCC files were imported into nSolver 3.0 (Nanostring Inc). Raw
count data was then exported to Excel. One of the following genes
or the median of a set of these genes were used as the
normalization factor: GAPDH, HrdB, phiC31 int, AprR. Normalization
was performed by dividing the measurement of interest by the
normalization factor, taking the base two log of that value and
adding a scaling constant of 10.
Other Embodiments
It is to be understood that while the present disclosure has been
described in conjunction with the detailed description thereof, the
foregoing description is intended to illustrate and not limit the
scope of the present disclosure, which is defined by the scope of
the appended claims. Other aspects, advantages, and alterations are
within the scope of the following claims.
Those skilled in the art will recognize, or be able to ascertain
using no more than routine experimentation, many equivalents to the
specific embodiments in accordance with the invention described
herein. The scope of the present invention is not intended to be
limited to the above Description, but rather is as set forth in the
appended claims.
In the claims, articles such as "a," "an," and "the" may mean one
or more than one unless indicated to the contrary or otherwise
evident from the context. Claims or descriptions that include "or"
between one or more members of a group are considered satisfied if
one, more than one, or all of the group members are present in,
employed in, or otherwise relevant to a given product or process
unless indicated to the contrary or otherwise evident from the
context. The invention includes embodiments in which exactly one
member of the group is present in, employed in, or otherwise
relevant to a given product or process. The invention includes
embodiments in which more than one, or all of the group members are
present in, employed in, or otherwise relevant to a given product
or process.
It is also noted that the term "comprising" is intended to be open
and permits but does not require the inclusion of additional
elements or steps. When the term "comprising" is used herein, the
term "consisting of" is thus also encompassed and disclosed.
Where ranges are given, endpoints are included. Furthermore, it is
to be understood that unless otherwise indicated or otherwise
evident from the context and understanding of one of ordinary skill
in the art, values that are expressed as ranges can assume any
specific value or subrange within the stated ranges in different
embodiments of the invention, to the tenth of the unit of the lower
limit of the range, unless the context clearly dictates
otherwise.
In addition, it is to be understood that any particular embodiment
of the present invention that falls within the prior art may be
explicitly excluded from any one or more of the claims. Since such
embodiments are deemed to be known to one of ordinary skill in the
art, they may be excluded even if the exclusion is not set forth
explicitly herein. Any particular embodiment of the compositions of
the invention (e.g., any polynucleotide or protein encoded thereby;
any method of production; any method of use) can be excluded from
any one or more claims, for any reason, whether or not related to
the existence of prior art.
SEQUENCE LISTINGS
1
1121914PRTStreptomyces hygroscopicus 1Met Pro Ala Val Glu Ser Tyr
Glu Leu Asp Ala Arg Asp Asp Glu Leu1 5 10 15Arg Arg Leu Glu Glu Ala
Val Gly Gln Ala Gly Asn Gly Arg Gly Val 20 25 30Val Val Thr Ile Thr
Gly Pro Ile Ala Cys Gly Lys Thr Glu Leu Leu 35 40 45Asp Ala Ala Ala
Ala Lys Ser Asp Ala Ile Thr Leu Arg Ala Val Cys 50 55 60Ser Glu Glu
Glu Arg Ala Leu Pro Tyr Ala Leu Ile Gly Gln Leu Ile65 70 75 80Asp
Asn Pro Ala Val Ala Ser Gln Leu Pro Asp Pro Val Ser Met Ala 85 90
95Leu Pro Gly Glu His Leu Ser Pro Glu Ala Glu Asn Arg Leu Arg Gly
100 105 110Asp Leu Thr Arg Thr Leu Leu Ala Leu Ala Ala Glu Arg Pro
Val Leu 115 120 125Ile Gly Ile Asp Asp Met His His Ala Asp Thr Ala
Ser Leu Asn Cys 130 135 140Leu Leu His Leu Ala Arg Arg Val Gly Pro
Ala Arg Ile Ala Met Val145 150 155 160Leu Thr Glu Leu Arg Arg Leu
Thr Pro Ala His Ser Gln Phe His Ala 165 170 175Glu Leu Leu Ser Leu
Gly His His Arg Glu Ile Ala Leu Arg Pro Leu 180 185 190Gly Pro Lys
His Ile Ala Glu Leu Ala Arg Ala Gly Leu Gly Pro Asp 195 200 205Val
Asp Glu Asp Val Leu Thr Gly Leu Tyr Arg Ala Thr Gly Gly Asn 210 215
220Leu Asn Leu Gly His Gly Leu Ile Lys Asp Val Arg Glu Ala Trp
Ala225 230 235 240Thr Gly Gly Thr Gly Ile Asn Ala Gly Arg Ala Tyr
Arg Leu Ala Tyr 245 250 255Leu Gly Ser Leu Tyr Arg Cys Gly Pro Val
Pro Leu Arg Val Ala Arg 260 265 270Val Ala Ala Val Leu Gly Gln Ser
Ala Asn Thr Thr Leu Val Arg Trp 275 280 285Ile Ser Gly Leu Asn Ala
Asp Ala Val Gly Glu Ala Thr Glu Ile Leu 290 295 300Thr Glu Gly Gly
Leu Leu His Asp Leu Arg Phe Pro His Pro Ala Ala305 310 315 320Arg
Ser Val Val Leu Asn Asp Leu Ser Ala Arg Glu Arg Arg Arg Leu 325 330
335His Arg Ser Ala Leu Glu Val Leu Asp Asp Val Pro Val Glu Val Val
340 345 350Ala His His Gln Ala Gly Ala Gly Phe Ile His Gly Pro Lys
Ala Ala 355 360 365Glu Ile Phe Ala Lys Ala Gly Gln Glu Leu His Val
Arg Gly Glu Leu 370 375 380Asp Ala Ala Ser Asp Tyr Leu Gln Leu Ala
His His Ala Ser Asp Asp385 390 395 400Ala Val Thr Arg Ala Ala Leu
Arg Val Glu Ala Val Ala Ile Glu Arg 405 410 415Arg Arg Asn Pro Leu
Ala Ser Ser Arg His Leu Asp Glu Leu Thr Val 420 425 430Ala Ala Arg
Ala Gly Leu Leu Ser Leu Glu His Ala Ala Leu Met Ile 435 440 445Arg
Trp Leu Ala Leu Gly Gly Arg Ser Gly Glu Ala Ala Glu Val Leu 450 455
460Ala Ala Gln Arg Pro Arg Ala Val Thr Asp Gln Asp Arg Ala His
Leu465 470 475 480Arg Ala Ala Glu Val Ser Leu Ala Leu Val Ser Pro
Gly Ala Ser Gly 485 490 495Val Ser Pro Gly Ala Ser Gly Pro Asp Arg
Arg Pro Arg Pro Leu Pro 500 505 510Pro Asp Glu Leu Ala Asn Leu Pro
Lys Ala Ala Arg Leu Cys Ala Ile 515 520 525Ala Asp Asn Ala Val Ile
Ser Ala Leu His Gly Arg Pro Glu Leu Ala 530 535 540Ser Ala Glu Ala
Glu Asn Val Leu Lys Gln Ala Asp Ser Ala Ala Asp545 550 555 560Gly
Ala Thr Ala Leu Ser Ala Leu Thr Ala Leu Leu Tyr Ala Glu Asn 565 570
575Thr Asp Thr Ala Gln Leu Trp Ala Asp Lys Leu Val Ser Glu Thr Gly
580 585 590Ala Ser Asn Glu Glu Glu Gly Ala Gly Tyr Ala Gly Pro Arg
Ala Glu 595 600 605Thr Ala Leu Arg Arg Gly Asp Leu Ala Ala Ala Val
Glu Ala Gly Ser 610 615 620Ala Ile Leu Asp His Arg Arg Gly Ser Leu
Leu Gly Ile Thr Ala Ala625 630 635 640Leu Pro Leu Ser Ser Ala Val
Ala Ala Ala Ile Arg Leu Gly Glu Thr 645 650 655Glu Arg Ala Glu Lys
Trp Leu Ala Glu Pro Leu Pro Glu Ala Ile Arg 660 665 670Asp Ser Leu
Phe Gly Leu His Leu Leu Ser Ala Arg Gly Gln Tyr Cys 675 680 685Leu
Ala Thr Gly Arg His Glu Ser Ala Tyr Thr Ala Phe Arg Thr Cys 690 695
700Gly Glu Arg Met Arg Asn Trp Gly Val Asp Val Pro Gly Leu Ser
Leu705 710 715 720Trp Arg Val Asp Ala Ala Glu Ala Leu Leu His Gly
Arg Asp Arg Asp 725 730 735Glu Gly Arg Arg Leu Ile Asp Glu Gln Leu
Thr His Ala Met Gly Pro 740 745 750Arg Ser Arg Ala Leu Thr Leu Arg
Val Gln Ala Ala Tyr Ser Pro Gln 755 760 765Ala Gln Arg Val Asp Leu
Leu Glu Glu Ala Ala Asp Leu Leu Leu Ser 770 775 780Cys Asn Asp Gln
Tyr Glu Arg Ala Arg Val Leu Ala Asp Leu Ser Glu785 790 795 800Ala
Phe Ser Ala Leu Arg His His Ser Arg Ala Arg Gly Leu Leu Arg 805 810
815Gln Ala Arg His Leu Ala Ala Gln Cys Gly Ala Thr Pro Leu Leu Arg
820 825 830Arg Leu Gly Ala Lys Pro Gly Gly Pro Gly Trp Leu Glu Glu
Ser Gly 835 840 845Leu Pro Gln Arg Ile Lys Ser Leu Thr Asp Ala Glu
Arg Arg Val Ala 850 855 860Ser Leu Ala Ala Gly Gly Gln Thr Asn Arg
Val Ile Ala Asp Gln Leu865 870 875 880Phe Val Thr Ala Ser Thr Val
Glu Gln His Leu Thr Asn Val Phe Arg 885 890 895Lys Leu Gly Val Lys
Gly Arg Gln His Leu Pro Ala Glu Leu Ala Asn 900 905 910Ala
Glu212DNAArtificial Sequencesynthetic construct 2ctagggggtt gc
1236DNAArtificial Sequencesynthetic construct 3gggggt
642685DNAStreptomyces hygroscopicus 4atgcctgccg tggagtgcta
tgaactggac gcccgcgatg acgagctcag aaaactggag 60gaggttgtga ccgggcgggc
caacggccgg ggtgtggtgg tcaccatcac cggaccgatc 120gcctgcggca
agaccgaact gctcgacgca gccgccgcga aggccgacgc catcacgtta
180cgagcggtct gctccgcgga ggaacaggca ctcccgtacg ccctgatcgg
gcagctcatc 240gacaacccgg cgctcgcctc ccacgcgctg gagccggcct
gcccgaccct cccgggcgag 300cacctgtcgc cggaggccga gaaccggctg
cgcagcgacc tcacccgtac cctgctggcg 360ctcgccgccg aacggccggt
gctgatcggc atcgacgagt cacacgcgaa cgctttgtgt 420ctgctccacc
tggcccgaag ggtcggctcg gcccggatcg ccatggtcct caccgagttg
480cgccggctca ccccggccca ctcacagttc caggccgagc tgctcagcct
ggggcaccac 540cgcgagatcg cgctgcgccc gctcagcccg aagcacaccg
ccgagctggt ccgcgccggt 600ctcggtcccg acgtcgacga ggacgtgctc
acggggttgt accgggcgac cggcggcaac 660ctgaacctca cccgcggact
gatcaacgat gtgcgggagg cctgggagac gggagggacg 720ggcatcagcg
cgggccgcgc gtaccggctg gcatacctcg gttccctcta ccgctgcggc
780ccggtcccgt tgcgggtcgc acgggtggcc gccgtgctgg gccagagcgc
caacaccacc 840ctggtgcgct ggatcagcgg gctcaacgcg gacgcggtgg
gcgaggcaac cgagatcctc 900accgaaggcg gcctgctgca cgacctgcgg
ttcccgcacc cggcggcccg ttcggtggta 960ctcaacgaca tgtccgccca
ggaacgacgc cgcctgcacc ggtccgctct ggaagtgctg 1020gacgacgtgc
ccgtggaagt ggtcgcgcac caccaggtcg gcgccggtct cctgcacggc
1080ccgaaggccg ccgagatatt cgccaaggcc ggccaggagc tgcatgtgcg
cggcgagttg 1140gacaccgcgt ccgactatct gcaactggcc caccaggcct
ccgacgacgc cgtcaccggg 1200atgcgggccg aggccgtggc gatcgagcgc
cgccgcaacc cgctggcctc gagccggcac 1260ctcgacgagc tgaccgtcgt
cgcccgtgcc gggctgctct tccccgagca cacggcgctg 1320atgatccgct
ggctgggcgt cggcgggcgg tccggcgagg cagccgggct gctggcctcg
1380cagcgccccc gtgcggtcac cgaccaggac agggcccata tgcgggccgc
cgaggtatcg 1440ctcgcgctgg tcagccccgg cacgtccggc ccggaccggc
ggccgcgtcc gctcacgccg 1500gatgagctcg cgaacctgcc gaaggcggcc
cggctctgcg cgatcgccga caatgccgtc 1560atgtcggccc tgcgcggtcg
tcccgagctc gccgcggccg aggcggagaa cgtcctgcag 1620cacgccgact
cggcggcggc cggcaccacc gccctcgccg cgctgaccgc cttgctgtac
1680gcggagaaca ccgacaccgc tcagctctgg gccgacaagc tggtctccga
gaccggggcg 1740tcgaacgagg aggaggcggg ctacgcgggg ccgcgcgccg
aagccgcgtt gcgtcgcggc 1800gacctggccg cggcggtcga ggcaggcagc
accgttctgg accaccggcg gctctcgacg 1860ctcggcatca ccgccgcgct
accgctgagc agcgcggtgg ccgccgccat ccggctgggc 1920gagaccgagc
gggcggagaa gtggctcgcc cagccgctgc cgcaggccat ccaggacggc
1980ctgttcggcc tgcacctgct ctcggcgcgc ggccagtaca gcctcgccac
gggccagcac 2040gagtcggcgt acacggcgtt tcgcacctgc ggggaacgta
tgcggaactg gggcgttgac 2100gtgccgggtc tgtccctgtg gcgcgtcgac
gccgccgagg cgctgctgca cggccgcgac 2160cgggacgagg gccgacggct
cgtcgacgag caactcaccc gtgcgatggg accccgttcc 2220cgcgccttga
cgctgcgggt gcaggcggcg tacagcccgc cggcgaagcg ggtcgacctg
2280ctcgatgaag cggccgacct gctgctctcc tgcaacgacc agtacgagcg
ggcacgggtg 2340ctcgccgacc tgagcgagac gttcagcgcg ctccggcacc
acagccgggc gcggggactg 2400cttcggcagg cccggcacct ggccgcccag
cgcggcgcga taccgctgct gcgccgactc 2460ggggccaagc ccggaggccc
cggctggctg gaggaatccg gcctgccgca gcggatcaag 2520tcgctgaccg
acgcggagcg gcgggtggcg tcgctggccg ccggcggaca gaccaaccgc
2580gtgatcgccg accagctctt cgtcacggcc agcacggtgg agcagcacct
cacggacgtc 2640tccactgggt caaggccgcc agcacctgcc gccgaactcg tctag
268552685DNAStreptomyces hygroscopicus 5atgcctgccg tggagtgcta
tgaactggac gcccgcgatg acgagctcag aaaactggag 60gaggttgtga ccgggcgggc
caacggccgg ggtgtggtgg tcaccatcac cggaccgatc 120gcctgcggca
agaccgaact gctcgacgca gccgccgcga aggccgacgc catcacgctg
180cgagcggtct gctccgcgga ggaacaggca ctcccgtacg ccctgatcgg
gcagctcatc 240gacaacccgg cgctcgcctc ccacgcgctg gagccggcct
gcccgaccct cccgggcgag 300cacctgtcgc cggaggccga gaaccggctg
cgcagcgacc tcacccgtac cctgctggcg 360ctcgccgccg aacggccggt
gctgatcggc atcgacgagt cacacgcgaa cgctttgtgt 420ctgctccacc
tggcccgaag ggtcggctcg gcccggatcg ccatggtcct caccgagttg
480cgccggctca ccccggccca ctcacagttc caggccgagc tgctcagcct
ggggcaccac 540cgcgagatcg cgctgcgccc gctcagcccg aagcacaccg
ccgagctggt ccgcgccggt 600ctcggtcccg acgtcgacga ggacgtgctc
acggggttgt accgggcgac cggcggcaac 660ctgaacctca cccgcggact
gatcaacgat gtgcgggagg cctgggagac gggagggacg 720ggcatcagcg
cgggccgcgc gtaccggctg gcatacctcg gttccctcta ccgctgcggc
780ccggtcccgt tgcgggtcgc acgggtggcc gccgtgctgg gccagagcgc
caacaccacc 840ctggtgcgct ggatcagcgg gctcaacgcg gacgcggtgg
gcgaggcaac cgagatcctc 900accgaaggcg gcctgctgca cgacctgcgg
ttcccgcacc cggcggcccg ttcggtggta 960ctcaacgaca tgtccgccca
ggaacgacgc cgcctgcacc ggtccgctct ggaagtgctg 1020gacgacgtgc
ccgtggaagt ggtcgcgcac caccaggtcg gcgccggtct cctgcacggc
1080ccgaaggccg ccgagatatt cgccaaggcc ggccaggagc tgcatgtgcg
cggcgagttg 1140gacaccgcgt ccgactatct gcaactggcc caccaggcct
ccgacgacgc cgtcaccggg 1200atgcgggccg aggccgtggc gatcgagcgc
cgccgcaacc cgctggcctc gagccggcac 1260ctcgacgagc tgaccgtcgt
cgcccgtgcc gggctgctct tccccgagca cacggcgctg 1320atgatccgct
ggctgggcgt cggcgggcgg tccggcgagg cagccgggct gctggcctcg
1380cagcgccccc gtgcggtcac cgaccaggac agggcccata tgcgggccgc
cgaggtatcg 1440ctcgcgctgg tcagccccgg cacgtccggc ccggaccggc
ggccgcgtcc gctcacgccg 1500gatgagctcg cgaacctgcc gaaggcggcc
cggctctgcg cgatcgccga caatgccgtc 1560atgtcggccc tgcgcggtcg
tcccgagctc gccgcggccg aggcggagaa cgtcctgcag 1620cacgccgact
cggcggcggc cggcaccacc gccctcgccg cgctgaccgc cttgctgtac
1680gcggagaaca ccgacaccgc tcagctctgg gccgacaagc tggtctccga
gaccggggcg 1740tcgaacgagg aggaggcggg ctacgcgggg ccgcgcgccg
aagccgcgtt gcgtcgcggc 1800gacctggccg cggcggtcga ggcaggcagc
accgttctgg accaccggcg gctctcgacg 1860ctcggcatca ccgccgcgct
accgctgagc agcgcggtgg ccgccgccat ccggctgggc 1920gagaccgagc
gggcggagaa gtggctcgcc cagccgctgc cgcaggccat ccaggacggc
1980ctgttcggcc tgcacctgct ctcggcgcgc ggccagtaca gcctcgccac
gggccagcac 2040gagtcggcgt acacggcgtt tcgcacctgc ggggaacgta
tgcggaactg gggcgttgac 2100gtgccgggtc tgtccctgtg gcgcgtcgac
gccgccgagg cgctgctgca cggccgcgac 2160cgggacgagg gccgacggct
cgtcgacgag caactcaccc gtgcgatggg accccgttcc 2220cgcgccttga
cgctgcgggt gcaggcggcg tacagcccgc cggcgaagcg ggtcgacctg
2280ctcgatgaag cggccgacct gctgctctcc tgcaacgacc agtacgagcg
ggcacgggtg 2340ctcgccgacc tgagcgagac gttcagcgcg ctccggcacc
acagccgggc gcggggactg 2400cttcggcagg cccggcacct ggccgcccag
cgcggcgcga taccgctgct gcgccgactc 2460ggggccaagc ccggaggccc
cggctggctg gaggaatccg gcctgccgca gcggatcaag 2520tcgctgaccg
acgcggagcg gcgggtggcg tcgctggccg ccggcggaca gaccaaccgc
2580gtgatcgccg accagctctt cgtcacggcc agcacggtgg agcagcacct
cacggacgtc 2640tccactgggt caaggccgcc agcacctgcc gccgaactcg tctag
268562772DNAStreptomyces kanamyceticus 6gtggttcctg aagtgcgagc
agcccccgac gaactgatcg cccgcgatga cgagctgagc 60cgcctccaac gggcactcac
cagggcgggg agcggaaggg gcggcgtcgt cgccatcacc 120gggcccatcg
ccagcggaaa gacggcgctg ctcgacgccg gagcggccaa gtccggcttc
180gtcgcactcc gtgcggtgtg ctcctgggaa gagcgcactc tgccgtacgg
gatgctgggc 240cagctcttcg accatcccga actggccgcc caggcgccgg
accttgccca cttcacggct 300tcgtgcgaga gccctcaggc cggtaccgac
aaccgcctgc gggccgagtt cacccgcacc 360ctgctggcgc tcgccgcgga
ctggcccgtc ctgatcggca tcgacgacgt gcaccacgcc 420gacgcggaat
cactgcgctg tctgctccac ctcgcccgcc gcatcggccc ggcccgcatc
480gcggtcgtac tgaccgagct gcgcagaccg acgcccgccg actcccgctt
ccaggcggaa 540ctgctgagcc tgcgctccta ccaggagatc gcgctcagac
cgctcaccga ggcgcagacc 600ggcgaactcg tacgtcggca cctcggcgcg
gagacccacg aggacgtctc cgccgatacg 660ttccgggcga ccggcgggaa
cctgctcctc gggcacggtt tgatcaatga catccgggag 720gcgcggacag
cgggacggcc gggggtcgtc gcggggcggg cgtaccggct cgcgtacctc
780agctcgctct accgctgcgg cccgagcgcg ctgcgtgtcg cccgggcgtc
cgccgtgctc 840ggcgcgagcg ccgaagccgt gctcgtccag cggatgaccg
gactgaacaa ggacgcggtc 900gaacaggtct atgagcagct gaacgaggga
cggctgctgc agggcgagcg gtttccgcac 960ccggcggccc gctccatcgt
ccttgacgac ctgtcggccc tggaacgcag aaacctgcac 1020gagtcggcgc
tggagctgct gcgggaccac ggcgtggccg gcaacgtgct cgcccgccac
1080cagatcggcg ccggccgggt gcacggcgag gaggccgtcg agctgttcac
cggggccgca 1140cgggagcacc acctgcgcgg tgaactggac gacgcggccg
gatacctgga actcgcccac 1200cgtgcctccg acgaccccgt cacgcgcgcc
gcactacgcg tcggcgccgc cgcgatcgag 1260cgcctctgca atccggtacg
ggcaggccgg catctgcccg agctgctcac cgcgtcgcgc 1320gcgggactgc
tctccagcga gcacgccgtg tcgctcgccg actggctggc gatgggcggg
1380cgcccgggcg aggcggccga ggtcctcgcg acgcagcgtc ccgcggccga
cagcgagcag 1440caccgcgcac tcctgcgcag cggcgagttg tccctcgcgc
tggtccaccc cggcgcgtgg 1500gatccgttgc gccggaccga tcggttcgcc
gcgggcgggc tcggctcgct tcccggaccc 1560gcccggcacc gcgcggtcgc
cgaccaagcc gtcatcgcgg cgctgcgtgg acgtctcgac 1620cgggcggacg
ccaacgcgga gagcgttctc cagcacaccg acgccacggc ggaccggacc
1680acggccatca tggcgttgct ggccctgctc tacgcggaga acaccgatgc
tgtccagttc 1740tgggtcgaca aactggccgg tgacgagggc accaggacac
cggccgacga ggcggtccac 1800gcggggttca acgccgagat cgcgctgcgc
cgcggcgact tgatgagagc cgtcgagtac 1860ggcgaggcag cgctcggcca
ccggcacctg cccacctggg gaatggccgc cgctctgccg 1920ctgagcagca
ccgtggttgc cgcgatccgg ctcggcgacc tcgacagggc cgagcggtgg
1980ctcgccgagc cgctgccgca gcagacgccg gagagcctct tcgggctgca
cctgctctgg 2040gcccgcgggc agcaccacct cgcgaccggg cggcacgggg
cggcgtacac ggcgttcagg 2100gaatgcggcg agcggatgcg gcggtgggcc
gtcgacgtgc cgggcctggc cctgtggcgg 2160gtcgacgccg ccgaatcgct
gctgctgctc ggccgtgacc gtgccgaagg actgcggctc 2220gtctccgagc
agctgtcccg gccgatgcgc cctcgcgcgc gcgtgcagac gttacgggta
2280caggcggcct acagtccgcc gccccaacgg atcgacctgc tcgaagaggc
cgccgacctg 2340ctggtcacct gcaacgacca gtacgaactg gcaaacgtac
tcagcgactt ggcagaggcc 2400tccagcatgg tccggcagca cagcagggcg
cggggtctgc tccgccgggc acggcacctc 2460gccacccagt gcggcgccgt
gccgctcctg cggcggctcg gcgcggaacc ctcggacatc 2520ggcggagcct
gggacgcgac gctgggacag cggatcgcgt cactgacgga gtcggagcgg
2580cgggtggccg cgctcgccgc ggtcgggcgt acgaacaggg agatcgccga
gcagctgttc 2640gtcacggcca gcacggtgga acagcacctc acgaacgtgt
tccgcaaact ggcggtgaag 2700ggccgccagc agcttccgaa ggaactggcc
gacgtcggcg agccggcgga ccgcgaccgc 2760cggtgcgggt ag
277272772DNAStreptomyces kanamyceticus 7atggttcctg aagtgcgagc
agcccccgac gaactgatcg cccgcgatga cgagctgagc 60cgcctccaac gggcactcac
cagggcgggg agcggaaggg gcggcgtcgt cgccatcacc 120gggcccatcg
ccagcggaaa gacggcgctg ctcgacgccg gagcggccaa gtccggcttc
180gtcgcactcc gtgcggtgtg ctcctgggaa gagcgcactc tgccgtacgg
gatgctgggc 240cagctcttcg accatcccga actggccgcc caggcgccgg
accttgccca cttcacggct 300tcgtgcgaga gccctcaggc cggtaccgac
aaccgcctgc gggccgagtt cacccgcacc 360ctgctggcgc tcgccgcgga
ctggcccgtc ctgatcggca tcgacgacgt gcaccacgcc 420gacgcggaat
cactgcgctg tctgctccac ctcgcccgcc gcatcggccc ggcccgcatc
480gcggtcgtac tgaccgagct gcgcagaccg acgcccgccg actcccgctt
ccaggcggaa 540ctgctgagcc tgcgctccta ccaggagatc gcgctcagac
cgctcaccga ggcgcagacc 600ggcgaactcg tacgtcggca cctcggcgcg
gagacccacg aggacgtctc cgccgatacg 660ttccgggcga ccggcgggaa
cctgctcctc gggcacggtt tgatcaatga catccgggag 720gcgcggacag
cgggacggcc gggggtcgtc gcggggcggg cgtaccggct cgcgtacctc
780agctcgctct accgctgcgg cccgagcgcg ctgcgtgtcg cccgggcgtc
cgccgtgctc 840ggcgcgagcg ccgaagccgt gctcgtccag cggatgaccg
gactgaacaa ggacgcggtc 900gaacaggtct atgagcagct gaacgaggga
cggctgctgc agggcgagcg gtttccgcac 960ccggcggccc gctccatcgt
ccttgacgac ctgtcggccc tggaacgcag aaacctgcac 1020gagtcggcgc
tggagctgct gcgggaccac ggcgtggccg gcaacgtgct cgcccgccac
1080cagatcggcg ccggccgggt gcacggcgag gaggccgtcg agctgttcac
cggggccgca 1140cgggagcacc acctgcgcgg tgaactggac gacgcggccg
gatacctgga actcgcccac 1200cgtgcctccg acgaccccgt cacgcgcgcc
gcactacgcg tcggcgccgc cgcgatcgag 1260cgcctctgca atccggtacg
ggcaggccgg catctgcccg agctgctcac cgcgtcgcgc 1320gcgggactgc
tctccagcga gcacgccgtg tcgctcgccg actggctggc gatgggcggg
1380cgcccgggcg aggcggccga ggtcctcgcg acgcagcgtc ccgcggccga
cagcgagcag 1440caccgcgcac tcctgcgcag cggcgagttg tccctcgcgc
tggtccaccc cggcgcgtgg 1500gatccgttgc gccggaccga tcggttcgcc
gcgggcgggc tcggctcgct tcccggaccc 1560gcccggcacc gcgcggtcgc
cgaccaagcc gtcatcgcgg cgctgcgtgg acgtctcgac 1620cgggcggacg
ccaacgcgga gagcgttctc cagcacaccg acgccacggc ggaccggacc
1680acggccatca tggcgttgct ggccctgctc tacgcggaga acaccgatgc
tgtccagttc 1740tgggtcgaca aactggccgg tgacgagggc accaggacac
cggccgacga ggcggtccac 1800gcggggttca acgccgagat cgcgctgcgc
cgcggcgact tgatgagagc cgtcgagtac 1860ggcgaggcag cgctcggcca
ccggcacctg cccacctggg gaatggccgc cgctctgccg 1920ctgagcagca
ccgtggttgc cgcgatccgg ctcggcgacc tcgacagggc cgagcggtgg
1980ctcgccgagc cgctgccgca gcagacgccg gagagcctct tcgggctgca
cctgctctgg 2040gcccgcgggc agcaccacct cgcgaccggg cggcacgggg
cggcgtacac ggcgttcagg 2100gaatgcggcg agcggatgcg gcggtgggcc
gtcgacgtgc cgggcctggc cctgtggcgg 2160gtcgacgccg ccgaatcgct
gctgctgctc ggccgtgacc gtgccgaagg actgcggctc 2220gtctccgagc
agctgtcccg gccgatgcgc cctcgcgcgc gcgtgcagac gctgcgggta
2280caggcggcct acagtccgcc gccccaacgg atcgacctgc tcgaagaggc
cgccgacctg 2340ctggtcacct gcaacgacca gtacgaactg gcaaacgtac
tcagcgactt ggcagaggcc 2400tccagcatgg tccggcagca cagcagggcg
cggggtctgc tccgccgggc acggcacctc 2460gccacccagt gcggcgccgt
gccgctcctg cggcggctcg gcgcggaacc ctcggacatc 2520ggcggagcct
gggacgcgac gctgggacag cggatcgcgt cactgacgga gtcggagcgg
2580cgggtggccg cgctcgccgc ggtcgggcgt acgaacaggg agatcgccga
gcagctgttc 2640gtcacggcca gcacggtgga acagcacctc acgaacgtgt
tccgcaaact ggcggtgaag 2700ggccgccagc agcttccgaa ggaactggcc
gacgtcggcg agccggcgga ccgcgaccgc 2760cggtgcgggt ag
277282742DNAStreptomyces ascomyceticus 8gtgatagcgc gcttatctcc
cccagacctg atcgcccgcg atgacgagtt cggttccctc 60caccgggcgc tcacccgagc
ggggggcggg cggggcgtcg tcgccgccgt caccgggccg 120atcgcctgcg
gcaagaccga actcctcgac gccgccgcgg ccaaggccgg cttcgtcacc
180cttcgcgcgg tgtgctccat ggaggagcgg gccctgccgt acggcatgct
cggccagctc 240ctcgaccagc ccgagctggc cgcccggaca ccggagctgg
tccggctgac ggcatcgtgc 300gaaaacctgc cggccgacgt cgacaaccgc
ctggggaccg aactcacccg cacggtgctg 360acgctcgccg cggagcggcc
cgtactgatc ggcatcgacg acgtgcacca cgccgacgcg 420ccgtcgctgc
gctgcctgct ccacctcgcg cgccgcatca gccgggcccg tgtcgccatc
480gtgctgaccg agctgctccg gccgacgccc gcccactccc aattccgggc
ggcactgctg 540agtctgcgcc actaccagga gatcgcgctg cgcccgctca
ccgaggcgca gaccaccgaa 600ctcgtgcgcc ggcacctcgg ccaggacgcg
cacgacgacg tggtggccca ggcgttccgg 660gcgaccggcg gcaacctgct
cctcggccac ggcctgatcg acgacatccg ggaggcacgg 720acacggacct
cagggtgcct ggaagtggtc gcggggcggg cgtaccggct cgcctacctc
780gggtcgctct atcgttgcgg cccggccgcg ctgagcgtcg cccgagcttc
cgccgtgctc 840ggcgagagtg tcgaactcac cctcgtccag cggatgaccg
gcctcgacac cgaggcggtc 900gagcaggccc acgaacagct ggtcgagggg
cggctgctgc gggaagggcg gttcccgcac 960cccgcggccc gctccgtcgt
actcgacgac ctctccgccg ccgagcggcg tggcctgcac 1020gagctggcgc
tggaactgct gcgggaccgc ggcgtggcca gcaaggtgct cgcccgccac
1080cagatgggta ccggccgggt gcacggcgcc gaggtcgccg ggctgttcac
cgacgccgcg 1140cgcgagcacc acctgcgcgg cgagctcgac gaggccgtca
cctacctgga gttcgcctac 1200cgggcctccg acgaccccgc cgtccacgcc
gcactgcgcg tcgacaccgc cgccatcgag 1260cggctctgcg atcccgccag
atccggccgg catgtgcccg agctgctcac cgcgtcgcgg 1320gaacggctcc
tctccagcga gcacgccgtg tcgctcgcct gctggctggc gatggacggg
1380cggccgggcg aggccgccga ggtcctggcg gcccagcgct ccgccgcccc
gagcgagcag 1440ggccgggcgc acctgcgcgt cgcggacctg tccctcgcgc
tgatctatcc cggcgcggcc 1500gatccgccgc gtccggccga tccgccggcc
gaggacgagg tcgcctcgtt ttccggagcc 1560gtccggcacc gcgccgtcgc
cgacaaggcc ctgagcaacg cgctgcgcgg ctggtccgaa 1620caggccgagg
ccaaagccga gtacgtgctc cagcactccc gggtcacgac ggaccggacc
1680acgaccatga tggcgttgct ggccctgctc tacgccgagg acaccgatgc
cgtccagtcc 1740tgggtcgaca agctggccgg tgacgacaac atgcggaccc
cggccgacga ggcggtccac 1800gcggggttcc gcgccgaggc cgcgctgcgc
cgcggcgacc tgaccgccgc cgtcgaatgc 1860ggcgaggccg cgctcgcccc
ccgggtcgtg ccctcctggg ggatggccgc cgcattgccg 1920ctgagcagca
ccgtggccgc cgcgatccga ctgggcgacc tggaccgggc ggagcggtgg
1980ctcgccgagc cgttgccgga ggagacctcc gacagcctct tcggactgca
catggtctgg 2040gcccgtgggc aacaccatct cgcggccggg cggtaccggg
cggcgtacaa cgcgttccgg 2100gactgcgggg agcggatgcg acgctggtcc
gtcgacgtgc cgggcctggc cctgtggcgg 2160gtcgacgccg ccgaagcgct
tctgctgctc ggccgcggcc gtgacgaggg gctgaggctc 2220atctccgagc
agctgtcccg gccgatgggg tcccgggcgc gggtgatgac gctgcgggtg
2280caggcggcct acagtccgcc ggccaagcgg atcgaactgc tcgacgaggc
cgccgatctg 2340ctcatcatgt gccgcgacca gtacgagctg gcccgcgtcc
tcgccgacat gggcgaagcg 2400tgcggcatgc tccggcggca cagccgtgcg
cggggactgt tccgccgcgc acggcacctc 2460gcgacccagt gcggagccgt
gccgctcctc cggcggctcg gtggggagtc ctcggacgcg 2520gacggcaccc
aggacgtgac gccggcgcag cggatcacat cgctgaccga ggcggagcgg
2580cgggtggcgt cgcacgccgc ggtcgggcgc accaacaagg agatcgccag
ccagctgttc 2640gtcacctcca gcacggtgga acagcacctc accaacgtgt
tccgcaagct gggggtgaag 2700ggccgtcagc aactgcccaa ggaactgtcc
gacgccggct ga 274292742DNAStreptomyces ascomyceticus 9atgatagcgc
gcctgtctcc cccagacctg atcgcccgcg atgacgagtt cggttccctc 60caccgggcgc
tcacccgagc ggggggcggg cggggcgtcg tcgccgccgt caccgggccg
120atcgcctgcg gcaagaccga actcctcgac gccgccgcgg ccaaggccgg
cttcgtcacc 180cttcgcgcgg tgtgctccat ggaggagcgg gccctgccgt
acggcatgct cggccagctc 240ctcgaccagc ccgagctggc cgcccggaca
ccggagctgg tccggctgac ggcatcgtgc 300gaaaacctgc cggccgacgt
cgacaaccgc ctggggaccg aactcacccg cacggtgctg 360acgctcgccg
cggagcggcc cgtactgatc ggcatcgacg acgtgcacca cgccgacgcg
420ccgtcgctgc gctgcctgct ccacctcgcg cgccgcatca gccgggcccg
tgtcgccatc 480gtgctgaccg agctgctccg gccgacgccc gcccactccc
aattccgggc ggcactgctg 540agtctgcgcc actaccagga gatcgcgctg
cgcccgctca ccgaggcgca gaccaccgaa 600ctcgtgcgcc ggcacctcgg
ccaggacgcg cacgacgacg tggtggccca ggcgttccgg 660gcgaccggcg
gcaacctgct cctcggccac ggcctgatcg acgacatccg ggaggcacgg
720acacggacct cagggtgcct ggaagtggtc gcggggcggg cgtaccggct
cgcctacctc 780gggtcgctct atcgttgcgg cccggccgcg ctgagcgtcg
cccgagcttc cgccgtgctc 840ggcgagagtg tcgaactcac cctcgtccag
cggatgaccg gcctcgacac cgaggcggtc 900gagcaggccc acgaacagct
ggtcgagggg cggctgctgc gggaagggcg gttcccgcac 960cccgcggccc
gctccgtcgt actcgacgac ctctccgccg ccgagcggcg tggcctgcac
1020gagctggcgc tggaactgct gcgggaccgc ggcgtggcca gcaaggtgct
cgcccgccac 1080cagatgggta ccggccgggt gcacggcgcc gaggtcgccg
ggctgttcac cgacgccgcg 1140cgcgagcacc acctgcgcgg cgagctcgac
gaggccgtca cctacctgga gttcgcctac 1200cgggcctccg acgaccccgc
cgtccacgcc gcactgcgcg tcgacaccgc cgccatcgag 1260cggctctgcg
atcccgccag atccggccgg catgtgcccg agctgctcac cgcgtcgcgg
1320gaacggctcc tctccagcga gcacgccgtg tcgctcgcct gctggctggc
gatggacggg 1380cggccgggcg aggccgccga ggtcctggcg gcccagcgct
ccgccgcccc gagcgagcag 1440ggccgggcgc acctgcgcgt cgcggacctg
tccctcgcgc tgatctatcc cggcgcggcc 1500gatccgccgc gtccggccga
tccgccggcc gaggacgagg tcgcctcgtt ttccggagcc 1560gtccggcacc
gcgccgtcgc cgacaaggcc ctgagcaacg cgctgcgcgg ctggtccgaa
1620caggccgagg ccaaagccga gtacgtgctc cagcactccc gggtcacgac
ggaccggacc 1680acgaccatga tggcgttgct ggccctgctc tacgccgagg
acaccgatgc cgtccagtcc 1740tgggtcgaca agctggccgg tgacgacaac
atgcggaccc cggccgacga ggcggtccac 1800gcggggttcc gcgccgaggc
cgcgctgcgc cgcggcgacc tgaccgccgc cgtcgaatgc 1860ggcgaggccg
cgctcgcccc ccgggtcgtg ccctcctggg ggatggccgc cgcattgccg
1920ctgagcagca ccgtggccgc cgcgatccga ctgggcgacc tggaccgggc
ggagcggtgg 1980ctcgccgagc cgttgccgga ggagacctcc gacagcctct
tcggactgca catggtctgg 2040gcccgtgggc aacaccatct cgcggccggg
cggtaccggg cggcgtacaa cgcgttccgg 2100gactgcgggg agcggatgcg
acgctggtcc gtcgacgtgc cgggcctggc cctgtggcgg 2160gtcgacgccg
ccgaagcgct tctgctgctc ggccgcggcc gtgacgaggg gctgaggctc
2220atctccgagc agctgtcccg gccgatgggg tcccgggcgc gggtgatgac
gctgcgggtg 2280caggcggcct acagtccgcc ggccaagcgg atcgaactgc
tcgacgaggc cgccgatctg 2340ctcatcatgt gccgcgacca gtacgagctg
gcccgcgtcc tcgccgacat gggcgaagcg 2400tgcggcatgc tccggcggca
cagccgtgcg cggggactgt tccgccgcgc acggcacctc 2460gcgacccagt
gcggagccgt gccgctcctc cggcggctcg gtggggagtc ctcggacgcg
2520gacggcaccc aggacgtgac gccggcgcag cggatcacat cgctgaccga
ggcggagcgg 2580cgggtggcgt cgcacgccgc ggtcgggcgc accaacaagg
agatcgccag ccagctgttc 2640gtcacctcca gcacggtgga acagcacctc
accaacgtgt tccgcaagct gggggtgaag 2700ggccgtcagc aactgcccaa
ggaactgtcc gacgccggct ga 2742102706DNAMicromonospora sp. S92-306401
10gtggagtttt acgacctggt cgcccgcgat gacgagctca gaaggttgga ccaggccctc
60ggccgcgccg ccggcggacg gggtgtcgtg gtcaccgtca ccggaccggt cggctgcggc
120aagaccgaac tgctggacgc ggccgcggcc gaggaggaat tcatcacgtt
gcgtgcggtc 180tgctcggccg aggagcgggc cctgccgtac gccgtgatcg
gccaactcct cgaccatccc 240gtactctccg cacgcgcgcc cgacctggcc
tgcgtgacgg ctccgggccg gacgctgccg 300gccgacaccg agaaccgcct
gcgccgcgac ctcacccggg ccctgctggc cctggcctcc 360gaacgaccgg
ttctgatctg catcgacgac gtgcaccagg ccgacaccgc ctcgctgaac
420tgcctgctgc acctggcccg gcgggtcgcc tcggcccgga tcgccatgat
cctcaccgag 480ttgcgccggc tcaccccggc tcactcccgg ttcgaggcgg
aactgctcag cctgcggcac 540cgccacgaga tcgcgctgcg tcccctcggc
ccggccgaca ccgccgaact ggcccgcgcc 600cggctcggcg ccggcgtcac
cgccgacgag ctggcccagg tccacgaggc caccagcggg 660aaccccaacc
tggtcggagg cctggtcaac gacgtgcgag aggcctgggc ggccggtggc
720acgggcattg cggcggggcg ggcgtaccgg ctggcgtacc tcagctccgt
gtaccgctgt 780ggtccggtcc cgttgcggat cgcccaggcg gcggcggtgc
tgggtcccag cgccaccgtc 840acgctggtgc gccggatcag cgggctcgac
gccgagacgg tggacgaggc gaccgcgatc 900ctcaccgagg gcggcctgct
ccgggaccac cggttcccgc atccggcggc ccgctcggtc 960gtactcgacg
acatgtccgc gcaggaacgc cgccgcctgc accggtccac gctggacgtg
1020ctggacggcg tacccgtcga cgtgctcgcg caccaccagg ccggcgccgg
tctgctgcac 1080ggcccgcagg cggccgagat gttcgcccgg gccagccagg
agctgcgggt acgcggcgag 1140ctggacgccg cgaccgagta cctgcaactg
gcctaccggg cctccgacga cgccggcgcc 1200cgggccgccc tgcaggtgga
gaccgtggcc ggcgagcgcc gccgcaaccc gctggccgcc 1260agccggcacc
tggacgagct ggccgccgcc gcccgggccg gcctgctgtc ggccgagcac
1320gccgccctgg tcgtgcactg gctggccgac gccggacgac ccggcgaggc
cgccgaggtg 1380ctggcgctgc agcgggcgct ggccgtcacc gaccacgacc
gggcccgcct gcgggcggcc 1440gaggtgtcgc tcgcgctgtt ccaccccggc
gtccccggtt cggacccgcg gcccctcgcg 1500ccggaggagc tcgcgagcct
gtccctgtcg gcccggcacg gtgtgaccgc cgacaacgcg 1560gtgctggcgg
cgctgcgcgg ccgtcccgag tcggccgccg ccgaggcgga gaacgtgctg
1620cgcaacgccg acgccgccgc gtccggcccg accgccctgg ccgcgctgac
ggccctgctc 1680tacgccgaga acaccgacgc cgcccagctc tgggcggaca
agctggccgc gggcatcggg 1740gcgggggagg gggaggccgg ctacgcgggg
ccgcggaccg tggccgccct gcgtcgcggc 1800gacctgacca ccgcggtcca
ggcggccggc gcggtcctgg accgcggccg gccgtcgtcg 1860ctcggcatca
ccgccgtgtt gccgttgagc ggcgcggtcg ccgccgcgat ccggctgggc
1920gagctcgagc gggccgagaa gtggctggcc gagccgctgc ccgaagccgt
ccacgacagc 1980ctgttcggcc tgcacctgct gatggcgcgg ggccgctaca
gcctcgcggt gggccggcac 2040gaggcggcgt acgccgcgtt ccgggactgc
ggtgaacgga tgcgccggtg ggacgtcgac 2100gtgcccgggc tggccctgtg
gcgggtggac gcggccgagg cgctgctgcc cggcgatgac 2160cgggcggagg
gccggcggct gatcgacgag cagctcaccc ggccgatggg gccccggtca
2220cgagccctga ccctgcgggt acgagcggcc tacgccccgc cggcgaaacg
gatcgacctg 2280ctcgacgaag cggccgacct gctgctctcc agcaacgacc
agtacgagcg ggcacgggtg 2340ctggccgacc tgagcgaggc gttcagcgcg
ctccggcaga acggccgggc gcgcggcatc 2400ctgcggcagg cccggcacct
ggccgcccag tgcggggcgg tccccctgct gcgccggctg 2460ggcgtcaagg
ccggccggtc cggtcggctc ggccggccgc cgcagggaat ccgctccctg
2520accgaggccg agcgccgggt ggccacgctg gccgccgccg ggcagaccaa
ccgggagatc 2580gccgaccagc tcttcgtcac cgccagcacg gtcgagcagc
acctcaccaa cgtgttccgc 2640aagctcggcg tgaagggccg ccagcaattg
ccggccgagc tggccgacct gcggccgccg 2700ggctga
2706112706DNAMicromonospora sp. S92-306401 11atggagtttt acgacctggt
cgcccgcgat gacgagctca gaaggttgga ccaggccctc 60ggccgcgccg ccggcggacg
gggtgtcgtg gtcaccgtca ccggaccggt cggctgcggc 120aagaccgaac
tgctggacgc ggccgcggcc gaggaggaat tcatcacgtt gcgtgcggtc
180tgctcggccg aggagcgggc cctgccgtac gccgtgatcg gccaactcct
cgaccatccc 240gtactctccg cacgcgcgcc cgacctggcc tgcgtgacgg
ctccgggccg gacgctgccg 300gccgacaccg agaaccgcct gcgccgcgac
ctcacccggg ccctgctggc cctggcctcc 360gaacgaccgg ttctgatctg
catcgacgac gtgcaccagg ccgacaccgc ctcgctgaac 420tgcctgctgc
acctggcccg gcgggtcgcc tcggcccgga tcgccatgat cctcaccgag
480ttgcgccggc tcaccccggc tcactcccgg ttcgaggcgg aactgctcag
cctgcggcac 540cgccacgaga tcgcgctgcg tcccctcggc ccggccgaca
ccgccgaact ggcccgcgcc 600cggctcggcg ccggcgtcac cgccgacgag
ctggcccagg tccacgaggc caccagcggg 660aaccccaacc tggtcggagg
cctggtcaac gacgtgcgag aggcctgggc ggccggtggc 720acgggcattg
cggcggggcg ggcgtaccgg ctggcgtacc tcagctccgt gtaccgctgt
780ggtccggtcc cgttgcggat cgcccaggcg gcggcggtgc tgggtcccag
cgccaccgtc 840acgctggtgc gccggatcag cgggctcgac gccgagacgg
tggacgaggc gaccgcgatc 900ctcaccgagg gcggcctgct ccgggaccac
cggttcccgc atccggcggc ccgctcggtc 960gtactcgacg acatgtccgc
gcaggaacgc cgccgcctgc accggtccac gctggacgtg 1020ctggacggcg
tacccgtcga cgtgctcgcg caccaccagg ccggcgccgg tctgctgcac
1080ggcccgcagg cggccgagat gttcgcccgg gccagccagg agctgcgggt
acgcggcgag 1140ctggacgccg cgaccgagta cctgcaactg gcctaccggg
cctccgacga cgccggcgcc 1200cgggccgccc tgcaggtgga gaccgtggcc
ggcgagcgcc gccgcaaccc gctggccgcc 1260agccggcacc tggacgagct
ggccgccgcc gcccgggccg gcctgctgtc ggccgagcac 1320gccgccctgg
tcgtgcactg gctggccgac gccggacgac ccggcgaggc cgccgaggtg
1380ctggcgctgc agcgggcgct ggccgtcacc gaccacgacc gggcccgcct
gcgggcggcc 1440gaggtgtcgc tcgcgctgtt ccaccccggc gtccccggtt
cggacccgcg gcccctcgcg 1500ccggaggagc tcgcgagcct gtccctgtcg
gcccggcacg gtgtgaccgc cgacaacgcg 1560gtgctggcgg cgctgcgcgg
ccgtcccgag tcggccgccg ccgaggcgga gaacgtgctg 1620cgcaacgccg
acgccgccgc gtccggcccg accgccctgg ccgcgctgac ggccctgctc
1680tacgccgaga acaccgacgc cgcccagctc tgggcggaca agctggccgc
gggcatcggg 1740gcgggggagg gggaggccgg ctacgcgggg ccgcggaccg
tggccgccct gcgtcgcggc 1800gacctgacca ccgcggtcca ggcggccggc
gcggtcctgg accgcggccg gccgtcgtcg 1860ctcggcatca ccgccgtgtt
gccgttgagc ggcgcggtcg ccgccgcgat ccggctgggc 1920gagctcgagc
gggccgagaa gtggctggcc gagccgctgc ccgaagccgt ccacgacagc
1980ctgttcggcc tgcacctgct gatggcgcgg ggccgctaca gcctcgcggt
gggccggcac 2040gaggcggcgt acgccgcgtt ccgggactgc ggtgaacgga
tgcgccggtg ggacgtcgac 2100gtgcccgggc tggccctgtg gcgggtggac
gcggccgagg cgctgctgcc cggcgatgac 2160cgggcggagg gccggcggct
gatcgacgag cagctcaccc ggccgatggg gccccggtca 2220cgagccctga
ccctgcgggt acgagcggcc tacgccccgc cggcgaaacg gatcgacctg
2280ctcgacgaag cggccgacct gctgctctcc agcaacgacc agtacgagcg
ggcacgggtg 2340ctggccgacc tgagcgaggc gttcagcgcg ctccggcaga
acggccgggc gcgcggcatc 2400ctgcggcagg cccggcacct ggccgcccag
tgcggggcgg tccccctgct gcgccggctg 2460ggcgtcaagg ccggccggtc
cggtcggctc ggccggccgc cgcagggaat ccgctccctg 2520accgaggccg
agcgccgggt ggccacgctg gccgccgccg ggcagaccaa ccgggagatc
2580gccgaccagc tcttcgtcac cgccagcacg gtcgagcagc acctcaccaa
cgtgttccgc 2640aagctcggcg tgaagggccg ccagcaattg ccggccgagc
tggccgacct gcggccgccg 2700ggctga 2706122616DNAStreptomyces
violaceusniger 12gtggtcaccg tcaccggccc aatcgcctgc ggcaagacag
aactgcttga cgcggctgcc 60gcgaaggctg aggccatcat tctgcgcgcg gtctgcgcgc
cagaagagcg ggctatgccg 120tacgccatga tcgggcagct catcgacgac
ccggcgctcg cgcatcgggc gccggggctg 180gctgatcgga tagcccaggg
cgggcagctg tcgctgaggg ccgagaaccg actgcgcagg 240gatctcaccc
gtgccctgct ggcgcttgcc gtcgaccggc ctgtgctgat cggcgtcgac
300gatgtgcatc acgccgacac cgcctctttg aactgtctgc tgcatttggc
gcgccgggtc 360cgtccggccc ggatatccat gatcttcacc gagttgcgca
gcctcacccc tactcagtca 420cggttcaagg cggagctgct cagcctgccg
taccaccacg agatcgcgct gcgtccgttc 480ggaccggagc aatcggcgga
gctggcccgc gccgccttcg gcccgggcct cgccgaggat 540gtgctcgtgg
ggttgtataa aacgaccagg ggcaatctga gtctcagccg tggactgatc
600agcgatgtgc gggaggccct ggccaacgga gagagcgcct tcgaggcggg
ccgcgcgttc 660cggctggcgt acctcggctc gctctaccgc tgtggcccgg
tcgcgctgcg ggtcgcccga 720gtggctgccg tgctgggccc gagcgccacc
accacgctgg tgcgccgtct aagcgggctc 780agcgcggaga cgatagaccg
ggcaaccaag atcctcaccg agggcgggct gctgctcgac 840cagcagttcc
cgcacccggc cgcccgctcg gtggtgcttg atgacatgtc cgcccaggaa
900cgacgcggcc tgcacactct cgccctggaa ctgctggacg aggcgccggt
tgaagtgctc 960gcgcaccacc aggtcggcgc cggtctcata cacgggccca
aggctgcgga gatgttcgcc 1020aaggccggca aggctctggt cgtacgcaac
gagttgggcg acgcggcaga atacctgcaa 1080ctggctcacc gggcctccga
cgatgtctcc acccgggccg ccttacgggt cgaggccgtg 1140gcgatcgagc
gccgccgcaa tccgctggcc tccagtcggc acatggacga gctgagcgcc
1200gccggccgcg ccggtctgct ttcccccaag catgcggcgc tggccgtctt
ctggctggcc 1260gacggcgggc gatccggcga ggcagccgag gtgctggcgt
cggaacgccc gctagcgacc 1320accgatcaga accgggccca cttgcgattt
gtcgaggtga ctctcgcgct gttctctccc 1380ggcgccttcg gatcggaccg
gcgcccacct ccgctgacgc cggacgaact cgccagcctg 1440ccgaaggcgg
cctggcaatg cgcggtcgcc gacaacgcgg ccatgaccgc cttgcacggt
1500catccagaac ttgccaccgc tcaggcggaa acagttctgc ggcaggctga
ttcggcagcc 1560gacgcgatcc ccgccgcgct gatcgccctg ttgtacgcgg
agaacaccga gtccgctcat 1620atctgggccg acaagctggg cagcacgaat
ggcggggtat cgaacgaggc ggaagcgggc 1680tacgccggcc cgtgcgccga
gatcgccctg cggcgcggcg acctggccac ggcgttcgag 1740gctggtagca
ccgtcctgga cgaccggtcg ctgccgtcgc tcggcatcac cgccgcattg
1800ctgttgagca gcaagacggc cgccgctgtc cggctgggcg aactcgagcg
tgcggagaag 1860ctgctcgccg agccgcttcc gaacggcgtc caggacagcc
ttttcggtct gcacctgctc 1920tcggcatacg gccagtacag
cctcgcgatg ggccgatatg aatcggctct ccgggcgttt 1980cacacctgcg
gagaacgtat gcgcagctgg gatgttgacg tgcctggtct ggccctgtgg
2040cgtgtcgacg ccgccgaggc gctgctcagc ctcgaccgga acgagggcca
gcggctcatc 2100gacgaacaac tcacccgtcc gatggggcct cgttcccgcg
cgttaacgct gcggatcaag 2160gcggcatacc tcccgcggac gaagcggatc
cccctgctcc atgaggcggc cgagctgctg 2220ctcccctgcc ccgacccgta
cgagcaagcg cgggtgctcg ccgatctggg cgacacgctc 2280agcgcgctca
gacgctatag ccgggcgcgg ggagttctcc ggcaggctcg tcacctggcc
2340gcccagtgcg gtgctgtccc gctgctgcgc aggctcgggg gcgagcccgg
ccggatcgac 2400gacgccggcc tgccgcagcg gagcacatcg ttgaccgatg
cggagcggcg ggtggcggcg 2460ctggccgcgg ccggacagac caaccgggag
atcgccaaac agctgttcgt cacggccagc 2520acagtggaac agcacctcac
aagcgtcttc cgcaaactgg gggtcaaggg tcgcaagcag 2580ctgccgaccg
cgctggccga cgtggaacag acctga 2616132721DNAStreptomyces
violaceusniger 13atgtatagcg gtacctgccg tgaaggatac gaactcgtcg
cacgcgagga cgaactcggc 60attctacaga ggtctctgga acaagcgagc agcggccagg
gcgtcgtggt caccgtcacc 120ggcccaatcg cctgcggcaa gacagaactg
cttgacgcgg ctgccgcgaa ggctgaggcc 180atcattctgc gcgcggtctg
cgcgccagaa gagcgggcta tgccgtacgc catgatcggg 240cagctcatcg
acgacccggc gctcgcgcat cgggcgccgg ggctggctga tcggatagcc
300cagggcgggc agctgtcgct gagggccgag aaccgactgc gcagggatct
cacccgtgcc 360ctgctggcgc ttgccgtcga ccggcctgtg ctgatcggcg
tcgacgatgt gcatcacgcc 420gacaccgcct ctttgaactg tctgctgcat
ttggcgcgcc gggtccgtcc ggcccggata 480tccatgatct tcaccgagtt
gcgcagcctc acccctactc agtcacggtt caaggcggag 540ctgctcagcc
tgccgtacca ccacgagatc gcgctgcgtc cgttcggacc ggagcaatcg
600gcggagctgg cccgcgccgc cttcggcccg ggcctcgccg aggatgtgct
cgtggggttg 660tataaaacga ccaggggcaa tctgagtctc agccgtggac
tgatcagcga tgtgcgggag 720gccctggcca acggagagag cgccttcgag
gcgggccgcg cgttccggct ggcgtacctc 780ggctcgctct accgctgtgg
cccggtcgcg ctgcgggtcg cccgagtggc tgccgtgctg 840ggcccgagcg
ccaccaccac gctggtgcgc cgtctaagcg ggctcagcgc ggagacgata
900gaccgggcaa ccaagatcct caccgagggc gggctgctgc tcgaccagca
gttcccgcac 960ccggccgccc gctcggtggt gcttgatgac atgtccgccc
aggaacgacg cggcctgcac 1020actctcgccc tggaactgct ggacgaggcg
ccggttgaag tgctcgcgca ccaccaggtc 1080ggcgccggtc tcatacacgg
gcccaaggct gcggagatgt tcgccaaggc cggcaaggct 1140ctggtcgtac
gcaacgagtt gggcgacgcg gcagaatacc tgcaactggc tcaccgggcc
1200tccgacgatg tctccacccg ggccgccctg cgggtcgagg ccgtggcgat
cgagcgccgc 1260cgcaatccgc tggcctccag tcggcacatg gacgagctga
gcgccgccgg ccgcgccggt 1320ctgctttccc ccaagcatgc ggcgctggcc
gtcttctggc tggccgacgg cgggcgatcc 1380ggcgaggcag ccgaggtgct
ggcgtcggaa cgcccgctag cgaccaccga tcagaaccgg 1440gcccacttgc
gatttgtcga ggtgactctc gcgctgttct ctcccggcgc cttcggatcg
1500gaccggcgcc cacctccgct gacgccggac gaactcgcca gcctgccgaa
ggcggcctgg 1560caatgcgcgg tcgccgacaa cgcggccatg accgccttgc
acggtcatcc agaacttgcc 1620accgctcagg cggaaacagt tctgcggcag
gctgattcgg cagccgacgc gatccccgcc 1680gcgctgatcg ccctgttgta
cgcggagaac accgagtccg ctcatatctg ggccgacaag 1740ctgggcagca
cgaatggcgg ggtatcgaac gaggcggaag cgggctacgc cggcccgtgc
1800gccgagatcg ccctgcggcg cggcgacctg gccacggcgt tcgaggctgg
tagcaccgtc 1860ctggacgacc ggtcgctgcc gtcgctcggc atcaccgccg
cattgctgtt gagcagcaag 1920acggccgccg ctgtccggct gggcgaactc
gagcgtgcgg agaagctgct cgccgagccg 1980cttccgaacg gcgtccagga
cagccttttc ggtctgcacc tgctctcggc atacggccag 2040tacagcctcg
cgatgggccg atatgaatcg gctctccggg cgtttcacac ctgcggagaa
2100cgtatgcgca gctgggatgt tgacgtgcct ggtctggccc tgtggcgtgt
cgacgccgcc 2160gaggcgctgc tcagcctcga ccggaacgag ggccagcggc
tcatcgacga acaactcacc 2220cgtccgatgg ggcctcgttc ccgcgcgctg
acgctgcgga tcaaggcggc atacctcccg 2280cggacgaagc ggatccccct
gctccatgag gcggccgagc tgctgctccc ctgccccgac 2340ccgtacgagc
aagcgcgggt gctcgccgat ctgggcgaca cgctcagcgc gctcagacgc
2400tatagccggg cgcggggagt tctccggcag gctcgtcacc tggccgccca
gtgcggtgct 2460gtcccgctgc tgcgcaggct cgggggcgag cccggccgga
tcgacgacgc cggcctgccg 2520cagcggagca catcgttgac cgatgcggag
cggcgggtgg cggcgctggc cgcggccgga 2580cagaccaacc gggagatcgc
caaacagctg ttcgtcacgg ccagcacagt ggaacagcac 2640ctcacaagcg
tcttccgcaa actgggggtc aagggtcgca agcagctgcc gaccgcgctg
2700gccgacgtgg aacagacctg a 2721142745DNAStreptomyces hygroscopicus
14atgcctgccg tggagagcta tgaactggac gcccgcgatg acgagctcag aagactggag
60gaggcggtag gccaggcggg caacggccgg ggtgtggtgg tcaccatcac cgggccgatc
120gcctgcggca agaccgaact gctcgacgcg gccgccgcga agagcgacgc
catcacatta 180cgtgcggtct gctccgagga ggaacgggcc ctcccgtacg
ccctgatcgg gcagctcatc 240gacaacccgg cggtcgcctc ccagctgccg
gatccggtct ccatggccct cccgggcgag 300cacctgtcgc cggaggccga
gaaccggctg cgcggcgacc tcacccgtac cctgctggcg 360ctcgccgccg
aacggccggt gctgatcggc atcgacgaca tgcaccacgc cgacaccgcc
420tctttgaact gcctgctcca cctggcccgg agggtcggcc cggcccggat
cgccatggtc 480ctcaccgagc tgcgccggct caccccggcc cactcccagt
tccacgccga gctgctcagc 540ctggggcacc accgcgagat cgcgctgcgc
ccgctcggcc cgaagcacat cgccgagctg 600gcccgcgccg gcctcggtcc
cgatgtcgac gaggacgtgc tcacggggtt gtaccgggcg 660accggcggca
acctgaacct cggccacgga ctgatcaagg atgtgcggga ggcctgggcg
720acgggcggga cgggcatcaa cgcgggccgc gcgtaccggc tggcgtacct
cggttccctc 780taccgctgcg gcccggtccc gttgcgggtc gcacgggtgg
ccgccgtgct gggccagagc 840gccaacacca ccctggtgcg ctggatcagc
gggctcaacg cggacgcggt gggcgaggcg 900accgagatcc tcaccgaggg
cggcctgctg cacgacctgc ggttcccgca tccggcggcc 960cgttcggtcg
tactcaacga cctgtccgcc cgggaacgcc gccgactgca ccggtccgct
1020ctggaagtgc tggatgacgt acccgttgaa gtggtcgcgc accaccaggc
cggtgccggt 1080ttcatccacg gtcccaaggc cgccgagatc ttcgccaagg
ccggccagga gctgcatgtg 1140cgcggcgagc tggacgccgc gtccgactat
ctgcaactgg cccaccacgc ctccgacgac 1200gccgtcaccc gggccgcgct
gcgggtcgag gccgtggcga tcgagcgccg ccgcaacccg 1260ctggcctcca
gccgccacct cgacgagctg accgtcgccg cccgtgccgg tctgctctcc
1320ctcgagcacg ccgcgctgat gatccgctgg ctggctctcg gcgggcggtc
cggcgaggcg 1380gccgaggtgc tggccgcgca gcgcccgcgt gcggtcaccg
accaggacag ggcccacctg 1440cgggccgccg aggtatcgct ggcgctggtc
agcccgggcg cgtccggcgt cagcccgggt 1500gcgtccggcc cggatcggcg
gccgcgtccg ctcccgccgg atgagctcgc gaacctgccg 1560aaggcggccc
ggctttgtgc gatcgccgac aacgccgtca tatcggccct gcacggtcgt
1620cccgagcttg cctcggccga ggcggagaac gtcctgaagc aggctgactc
ggcggcggac 1680ggcgccaccg ccctctccgc gctgacggcc ttgctgtacg
cggagaacac cgacaccgct 1740cagctctggg ccgacaagct cgtctccgag
accggggcgt cgaacgagga ggaaggcgcg 1800ggctacgcgg ggccgcgcgc
cgagaccgcg ttgcgccgcg gcgacctggc cgcggcggtc 1860gaggcgggca
gcgccattct ggaccaccgg cgggggtcgt tgctcggcat caccgccgcg
1920ctaccgctga gcagcgcggt agccgccgcc atccggctgg gcgagaccga
gcgggcggag 1980aagtggctcg ccgagccgct gccggaggcc attcgggaca
gcctgttcgg gctgcacctg 2040ctctcggcgc gcggccagta ctgcctcgcg
acgggccggc acgagtcggc gtacacggcg 2100ttccgcacct gcggggaacg
gatgcggaac tggggcgtcg acgtgccggg tctgtccctg 2160tggcgcgtcg
acgccgccga ggcgctgctg cacggccgcg accgggacga gggccgacgg
2220ctcatcgacg agcagctcac ccatgcgatg ggaccccgtt cccgcgcttt
gacgctgcgg 2280gtgcaggcgg cgtacagccc gcaggcgcag cgggtcgacc
tgctcgaaga ggcggccgac 2340ctgctgctct cctgcaacga ccagtacgag
cgggcgcggg tgctcgccga tctgagcgag 2400gcgttcagcg cgctcaggca
ccacagccgg gcgcggggac tgctccggca ggcccggcac 2460ctggccgccc
agtgcggcgc gaccccgctg ctgcgccggc tcggggccaa gcccggaggc
2520cccggctggc tggaggaatc cggcctgccg cagcggatca agtcgctgac
cgacgcggag 2580cggcgggtgg cgtcgctggc cgccggcggc cagaccaacc
gcgtgatcgc cgaccagctc 2640ttcgtcacgg ccagcacggt ggagcagcac
ctcacgaacg tcttccgcaa gctgggcgtc 2700aagggccgcc agcacctgcc
ggccgaactc gccaacgcgg aatag 2745152745DNAStreptomyces hygroscopicus
15atgcctgccg tggagagcta tgaactggac gcccgcgatg acgagctcag aagactggag
60gaggcggtag gccaggcggg caacggccgg ggtgtggtgg tcaccatcac cgggccgatc
120gcctgcggca agaccgaact gctcgacgcg gccgccgcga agagcgacgc
catcacactg 180cgtgcggtct gctccgagga ggaacgggcc ctcccgtacg
ccctgatcgg gcagctcatc 240gacaacccgg cggtcgcctc ccagctgccg
gatccggtct ccatggccct cccgggcgag 300cacctgtcgc cggaggccga
gaaccggctg cgcggcgacc tcacccgtac cctgctggcg 360ctcgccgccg
aacggccggt gctgatcggc atcgacgaca tgcaccacgc cgacaccgcc
420tctttgaact gcctgctcca cctggcccgg agggtcggcc cggcccggat
cgccatggtc 480ctcaccgagc tgcgccggct caccccggcc cactcccagt
tccacgccga gctgctcagc 540ctggggcacc accgcgagat cgcgctgcgc
ccgctcggcc cgaagcacat cgccgagctg 600gcccgcgccg gcctcggtcc
cgatgtcgac gaggacgtgc tcacggggtt gtaccgggcg 660accggcggca
acctgaacct cggccacgga ctgatcaagg atgtgcggga ggcctgggcg
720acgggcggga cgggcatcaa cgcgggccgc gcgtaccggc tggcgtacct
cggttccctc 780taccgctgcg gcccggtccc gttgcgggtc gcacgggtgg
ccgccgtgct gggccagagc 840gccaacacca ccctggtgcg ctggatcagc
gggctcaacg cggacgcggt gggcgaggcg 900accgagatcc tcaccgaggg
cggcctgctg cacgacctgc ggttcccgca tccggcggcc 960cgttcggtcg
tactcaacga cctgtccgcc cgggaacgcc gccgactgca ccggtccgct
1020ctggaagtgc tggatgacgt acccgttgaa gtggtcgcgc accaccaggc
cggtgccggt 1080ttcatccacg gtcccaaggc cgccgagatc ttcgccaagg
ccggccagga gctgcatgtg 1140cgcggcgagc tggacgccgc gtccgactat
ctgcaactgg cccaccacgc ctccgacgac 1200gccgtcaccc gggccgcgct
gcgggtcgag gccgtggcga tcgagcgccg ccgcaacccg 1260ctggcctcca
gccgccacct cgacgagctg accgtcgccg cccgtgccgg tctgctctcc
1320ctcgagcacg ccgcgctgat gatccgctgg ctggctctcg gcgggcggtc
cggcgaggcg 1380gccgaggtgc tggccgcgca gcgcccgcgt gcggtcaccg
accaggacag ggcccacctg 1440cgggccgccg aggtatcgct ggcgctggtc
agcccgggcg cgtccggcgt cagcccgggt 1500gcgtccggcc cggatcggcg
gccgcgtccg ctcccgccgg atgagctcgc gaacctgccg 1560aaggcggccc
ggctttgtgc gatcgccgac aacgccgtca tatcggccct gcacggtcgt
1620cccgagcttg cctcggccga ggcggagaac gtcctgaagc aggctgactc
ggcggcggac 1680ggcgccaccg ccctctccgc gctgacggcc ttgctgtacg
cggagaacac cgacaccgct 1740cagctctggg ccgacaagct cgtctccgag
accggggcgt cgaacgagga ggaaggcgcg 1800ggctacgcgg ggccgcgcgc
cgagaccgcg ttgcgccgcg gcgacctggc cgcggcggtc 1860gaggcgggca
gcgccattct ggaccaccgg cgggggtcgt tgctcggcat caccgccgcg
1920ctaccgctga gcagcgcggt agccgccgcc atccggctgg gcgagaccga
gcgggcggag 1980aagtggctcg ccgagccgct gccggaggcc attcgggaca
gcctgttcgg gctgcacctg 2040ctctcggcgc gcggccagta ctgcctcgcg
acgggccggc acgagtcggc gtacacggcg 2100ttccgcacct gcggggaacg
gatgcggaac tggggcgtcg acgtgccggg tctgtccctg 2160tggcgcgtcg
acgccgccga ggcgctgctg cacggccgcg accgggacga gggccgacgg
2220ctcatcgacg agcagctcac ccatgcgatg ggaccccgtt cccgcgcttt
gacgctgcgg 2280gtgcaggcgg cgtacagccc gcaggcgcag cgggtcgacc
tgctcgaaga ggcggccgac 2340ctgctgctct cctgcaacga ccagtacgag
cgggcgcggg tgctcgccga tctgagcgag 2400gcgttcagcg cgctcaggca
ccacagccgg gcgcggggac tgctccggca ggcccggcac 2460ctggccgccc
agtgcggcgc gaccccgctg ctgcgccggc tcggggccaa gcccggaggc
2520cccggctggc tggaggaatc cggcctgccg cagcggatca agtcgctgac
cgacgcggag 2580cggcgggtgg cgtcgctggc cgccggcggc cagaccaacc
gcgtgatcgc cgaccagctc 2640ttcgtcacgg ccagcacggt ggagcagcac
ctcacgaacg tcttccgcaa gctgggcgtc 2700aagggccgcc agcacctgcc
ggccgaactc gccaacgcgg aatag 2745162619DNAActinoplanes sp. N01-109
16gtgaagcgca acgatctggt tgcccgcgat ggcgagctca ggtggatgca agagattctc
60agtcaggcga gcgagggccg gggggccgtg gtcaccatca cgggggcgat cgcctgtggc
120aagacggtgc tgctggacgc cgcggcagcc agtcaagacg tgatccaact
gcgtgcggtc 180tgctcggcgg aggagcagga gctgccgtac gcgatggtcg
gacaactact cgacaatccg 240gtgctcgccg cgcgagtgcc ggccctgggc
aacctggctg cggcgggcga gcggctgctg 300ccgggcaccg agaacaggat
ccggcgggag ctcacccgca ccctgctggc tctcgccgac 360gaacgaccgg
tgctgatcgg cgtcgacgac atgcaccatg cggaccccgc ctcgctggac
420tgcctgctgc acctggcccg gcgggtcggc ccggcccgca tcgcgatcgt
tctgaccgag 480ttgcgccggc tcaccccggc tcactcgcgc ttccagtccg
agctgctcag cctgcggtac 540caccacgaga tcgggttgca gccgctcacc
gcggagcaca ccgccgacct ggcccgcgtc 600ggcctcggtg ccgaggtcga
cgacgacgtg ctcaccgagc tctacgaggc gaccggcggc 660aacccgagtc
tgtgctgcgg cctgatcagg gacgtgcggc aggactggga ggccggggtc
720accggtatcc acgtcggccg ggcgtaccgg ctggcctatc tcagttcgct
ctaccgctgc 780ggcccggcgg cgctgcggac cgcccgcgcg gccgcggtgc
tgggcgacag cgccgacgcc 840tgcctgatcc gccgggtcag cggcctcggt
acggaggccg tgggccaggc gatccagcag 900ctcaccgagg gcggcctgct
gcgtgaccag cagttcccgc acccggcggc ccgctcggtc 960gtgctcgacg
acatgtccgc gcaggaacgc cacgcgatgt atcgcagcgc ccgggaggca
1020gccgccgaag gtcaggccga ccccggcacc ccgggcgagc cgcgggcggc
tacggcgtac 1080gccgggtgtg gtgagcaagc cggtgactac ccggagccgg
ccggccgggc ctgcgtggac 1140ggtgccggtc cggccgagta ctgcggcgac
ccgcacggcg ccgacgacga cccggacgag 1200ctggtcgccg cgctgggcgg
gctgctgccg agccggctcg tggcgatgaa gatccggcgc 1260ctggcggtgg
ccgggcgccc cggggcggct gccgagctgc tgacctcgca gcggttgcac
1320gcggtgacca gcgaggaccg ggccagcctg cgggccgccg aggtggcgct
cgccacgctg 1380tggccgggtg cgaccggccc ggaccggcat ccgctcacgg
agcaggaggc ggcgagcctg 1440ccggagggtc cgcgcctgct cgctgccgcc
gacgatgccg tcggggccgc cctgcgcggt 1500cgcgccgagt acgccgcggc
cgaggcggag aacgtcctgc ggcacgccga tccggcagcc 1560ggtggtgacg
cctacgccgc catgatcgcc ctgctgtaca cggagcaccc cgagaacgtg
1620ctgttctggg ccgacaagct cgacgcgggc cgccccgacg aggagaccag
ttatcccggg 1680ctgcgggccg agaccgcggt gcggctcggt gacctggaaa
cggcgatgga gctgggccgc 1740acggtgctgg accagcggcg gctgccgtcc
ctgggtgtcg ccgcgggcct gctcctgggc 1800ggcgcggtga cggccgccat
ccggctcggc gacctcgacc gggcggagaa gtggctcgcc 1860gagccgatcc
ccgacgccat ccgtaccagc ctctacggcc tgcacgtgct ggccgcgcgg
1920ggccggctcg acctggccgc gggccgctac gaggcggcgt acacggcgtt
ccggctgtgt 1980ggcgagcgga tggcaggctg ggatgccgat gtctccgggc
tggcgctgtg gcgcgtcgac 2040gccgccgagg ccctgctgtc cgcgggcatc
cgcccggacg agggccgcaa gctcatcgac 2100gaccagctca cccgtgagat
gggggcccgc tcccgggcgc tgacgctgcg ggcgcaagcg 2160gcgtacagcc
tgccggtgca ccgggtgggc ctgctcgacg aggcggccgg cctgctgctc
2220gcctgccatg acgggtacga gcgggcgcgg gtgctcgcgg acctggggga
gaccctgcgc 2280acgctgcggc acaccgacgc ggcccagcgg gtgctccggc
aggccgagca ggcggccgcg 2340cggtgcgggt cggtcccgct gctgcggcgg
ctcggggccg aacccgtacg catcggcacc 2400cggcgtggtg aacccggcct
gccgcagcgg atcaggctgc tgaccgatgc cgagcggcgg 2460gttgccgcga
tggccgccgc cgggcagacc aaccgggaga tcgccggtcg gctcttcgtc
2520acggccagca cggtggagca gcacctgacc agcgtcttcc gcaagctggg
cgtcaagggc 2580cgccggttcc tgccgaccga gctcgcccaa gccgtctga
2619172628DNAActinoplanes sp. N01-109 17atgcctgccg tgaagcgcaa
cgatctggtt gcccgcgatg gcgagctcag gtggatgcaa 60gagattctca gtcaggcgag
cgagggccgg ggggccgtgg tcaccatcac gggggcgatc 120gcctgtggca
agacggtgct gctggacgcc gcggcagcca gtcaagacgt gatccaactg
180cgtgcggtct gctcggcgga ggagcaggag ctgccgtacg cgatggtcgg
acaactactc 240gacaatccgg tgctcgccgc gcgagtgccg gccctgggca
acctggctgc ggcgggcgag 300cggctgctgc cgggcaccga gaacaggatc
cggcgggagc tcacccgcac cctgctggct 360ctcgccgacg aacgaccggt
gctgatcggc gtcgacgaca tgcaccatgc ggaccccgcc 420tcgctggact
gcctgctgca cctggcccgg cgggtcggcc cggcccgcat cgcgatcgtt
480ctgaccgagt tgcgccggct caccccggct cactcgcgct tccagtccga
gctgctcagc 540ctgcggtacc accacgagat cgggttgcag ccgctcaccg
cggagcacac cgccgacctg 600gcccgcgtcg gcctcggtgc cgaggtcgac
gacgacgtgc tcaccgagct ctacgaggcg 660accggcggca acccgagtct
gtgctgcggc ctgatcaggg acgtgcggca ggactgggag 720gccggggtca
ccggtatcca cgtcggccgg gcgtaccggc tggcctatct cagttcgctc
780taccgctgcg gcccggcggc gctgcggacc gcccgcgcgg ccgcggtgct
gggcgacagc 840gccgacgcct gcctgatccg ccgggtcagc ggcctcggta
cggaggccgt gggccaggcg 900atccagcagc tcaccgaggg cggcctgctg
cgtgaccagc agttcccgca cccggcggcc 960cgctcggtcg tgctcgacga
catgtccgcg caggaacgcc acgcgatgta tcgcagcgcc 1020cgggaggcag
ccgccgaagg tcaggccgac cccggcaccc cgggcgagcc gcgggcggct
1080acggcgtacg ccgggtgtgg tgagcaagcc ggtgactacc cggagccggc
cggccgggcc 1140tgcgtggacg gtgccggtcc ggccgagtac tgcggcgacc
cgcacggcgc cgacgacgac 1200ccggacgagc tggtcgccgc gctgggcggg
ctgctgccga gccggctcgt ggcgatgaag 1260atccggcgcc tggcggtggc
cgggcgcccc ggggcggctg ccgagctgct gacctcgcag 1320cggttgcacg
cggtgaccag cgaggaccgg gccagcctgc gggccgccga ggtggcgctc
1380gccacgctgt ggccgggtgc gaccggcccg gaccggcatc cgctcacgga
gcaggaggcg 1440gcgagcctgc cggagggtcc gcgcctgctc gctgccgccg
acgatgccgt cggggccgcc 1500ctgcgcggtc gcgccgagta cgccgcggcc
gaggcggaga acgtcctgcg gcacgccgat 1560ccggcagccg gtggtgacgc
ctacgccgcc atgatcgccc tgctgtacac ggagcacccc 1620gagaacgtgc
tgttctgggc cgacaagctc gacgcgggcc gccccgacga ggagaccagt
1680tatcccgggc tgcgggccga gaccgcggtg cggctcggtg acctggaaac
ggcgatggag 1740ctgggccgca cggtgctgga ccagcggcgg ctgccgtccc
tgggtgtcgc cgcgggcctg 1800ctcctgggcg gcgcggtgac ggccgccatc
cggctcggcg acctcgaccg ggcggagaag 1860tggctcgccg agccgatccc
cgacgccatc cgtaccagcc tctacggcct gcacgtgctg 1920gccgcgcggg
gccggctcga cctggccgcg ggccgctacg aggcggcgta cacggcgttc
1980cggctgtgtg gcgagcggat ggcaggctgg gatgccgatg tctccgggct
ggcgctgtgg 2040cgcgtcgacg ccgccgaggc cctgctgtcc gcgggcatcc
gcccggacga gggccgcaag 2100ctcatcgacg accagctcac ccgtgagatg
ggggcccgct cccgggcgct gacgctgcgg 2160gcgcaagcgg cgtacagcct
gccggtgcac cgggtgggcc tgctcgacga ggcggccggc 2220ctgctgctcg
cctgccatga cgggtacgag cgggcgcggg tgctcgcgga cctgggggag
2280accctgcgca cgctgcggca caccgacgcg gcccagcggg tgctccggca
ggccgagcag 2340gcggccgcgc ggtgcgggtc ggtcccgctg ctgcggcggc
tcggggccga acccgtacgc 2400atcggcaccc ggcgtggtga acccggcctg
ccgcagcgga tcaggctgct gaccgatgcc 2460gagcggcggg ttgccgcgat
ggccgccgcc gggcagacca accgggagat cgccggtcgg 2520ctcttcgtca
cggccagcac ggtggagcag cacctgacca gcgtcttccg caagctgggc
2580gtcaagggcc gccggttcct gccgaccgag ctcgcccaag ccgtctga
2628182616DNAStreptomyces malaysiensis 18gtggtcaccg tcaccggccc
aatcgcctgc ggcaagacag aactgcttga cgcggctgcc 60gcgaaggctg aggccatcat
tctgcgcgcg gtctgcgcgc cagaagagcg ggctatgccg 120tacgccatga
tcgggcagct catcgacgac ccggcgctcg cgcatcgggc gccggggctg
180gctgatcgga tagcccaggg cgggcagctg tcgctgaggg ccgagaaccg
actgcgcagg 240gatctcaccc gtgccctgct ggcgcttgcc gtggaccggc
ctgtgctgat cggcgtcgac 300gatgtgcatc acgccgacac cgcctctttg
aactgtctgc tgcatttggc ccgccgggtc 360cgtccggccc ggatatccat
gatcttcacc gagttgcgca gcctcacccc tactcagtca 420cggttcaagg
cggagctgct cagcctgcca taccaccacg agatcgcgct gcgtccattc
480ggaccggagc aatcggcgga gctggctcgc gccgccttcg gcccgggcct
cgccgaggat 540gtgctcgcgg ggttgtataa aacgaccagg ggcaatctga
gtctcagccg
tggactgatc 600agcgatgtgc gggaggccct ggccaacgga gagagcgctt
tcgaggcggg ccgcgcgttc 660cggctggcgt acctcagctc gctctaccgc
tgtggcccgg tcgcgctgcg ggtcgcccga 720gtggctgccg tgctgggccc
aagcgccacc accacgctgg tgcgccggct aagcgggctc 780agcgcggaga
cgatagaccg ggcaaccaag atcctcactg agggcgggct gctgctcgac
840cagcagttcc cgcacccggc cgcccgctcg gtggtgctcg atgacatgtc
cgcccaggaa 900cgacgcagcc tgcacactct cgccctggaa ctgctggacg
aggcgccggt tgaagtgctc 960gcgcaccacc aggtcggcgc cggtctcata
cacgggccca aggctgcgga gatgttcgcc 1020aaggccggca aggctctggt
cgtacgcaac gagttgggcg acgcggccga atacctgcaa 1080ctggctcacc
gggcctccga cgatgtctcc acccgggccg ccttacgggt cgaggccgtg
1140gccatcgagc gccgccgcaa tccgctggcc tccagtcggc acatggacga
actgagcgcc 1200gccggccgcg ccggtctgct ttcccccaag catgcggcgc
tggccgtctt ctggctagcc 1260gacggcgggc gatccggcga ggcagccgaa
gtgctggcgt cggaacgccc gctcgcgacc 1320accgatcaga accgggccca
cctgcgattt gtcgaggtga ctctcgcgct gttctctccc 1380ggcgccttcg
gatcggaccg gcgcccacct ccgctgacgc cggacgaact cgccagcctg
1440ccgaaggcgg cctggcaatg cgcggtcgcc gacaacgcgg ccatgaccgc
cttgcacggc 1500catccagaac ttgccaccgc tcaggcggaa acagttctgc
ggcaggctga ttcggcagcc 1560gacgcgatcc ccgccgcgct gatcgccctg
ttgtacgcgg agaacaccga gtccgctcat 1620atctgggccg acaagctggg
cagcacgaat gccggggtat cgaacgaggc ggaagcgggc 1680tacgccggcc
cgtgcgccga gatcgccctg cggcgcggcg acctggccac ggcgttcgag
1740gctggtagcg ccgtcctgga cgaccggtcg ctgccgtcgc tcggcatcac
cgccgcattg 1800ctgttgagca gcaagacggc cgccgctgtc cggctgggcg
aactcgagcg tgcggagaag 1860ctgctcgccg agccgcttcc gaacggcgtc
caggacagcc ttttcggtct gcacctgctc 1920tcggcgtacg gccagtacag
cctcgcgatg ggccgatatg aatcagctca ccgggcgttt 1980cgcacctgcg
gagaacgtat gcgcagctgg gatgttgacg tgcctggtct ggccctgtgg
2040cgtgtcgacg ccgccgaggc gctgctcagc ctcgaccgga acgagggcca
gcggctcatc 2100gacgaacaac tcacccgtcc gatggggcct cgttcccacg
cgttaacgct gcggatcaag 2160gcggcatacc tcccgcggac gaagcggatc
cccctgctcc atgaggcggc cgagctgctg 2220ctcccctgcc ccgacccgta
cgagcaagcg cgggtgctcg ccgatctggg cgacacgctc 2280agcgcgctca
gacgctatag ccgggcgcgg ggagttctcc ggcaggctcg tcacctggcc
2340acccagtgcg gtgctgtccc gctgctgcgc aggctcgggg gcgagcccgg
ccggatcgac 2400gacgccggcc tgccgcagcg gagcacatcg ttgaccgatg
cggagcggcg ggtggcggcg 2460ctggccgcgg ccggacagac caaccgggag
atcgccgaac agctgttcgt cacggccagc 2520acagtggaac agcacctcac
aagcgtcttc cgcaagctgg gcgtcaaggg ccgcaagcag 2580ctgccgaccg
cgctggccga cgtggaacag acctga 2616192721DNAStreptomyces malaysiensis
19atgtatagcg gtacctgccg tgaaggatac gaactcgtcg cacgcgagga cgaactcggt
60attctacaga ggtctctgga acaagcgagc agcggccagg gcgtcgtggt caccgtcacc
120ggcccaatcg cctgcggcaa gacagaactg cttgacgcgg ctgccgcgaa
ggctgaggcc 180atcattctgc gcgcggtctg cgcgccagaa gagcgggcta
tgccgtacgc catgatcggg 240cagctcatcg acgacccggc gctcgcgcat
cgggcgccgg ggctggctga tcggatagcc 300cagggcgggc agctgtcgct
gagggccgag aaccgactgc gcagggatct cacccgtgcc 360ctgctggcgc
ttgccgtgga ccggcctgtg ctgatcggcg tcgacgatgt gcatcacgcc
420gacaccgcct ctttgaactg tctgctgcat ttggcccgcc gggtccgtcc
ggcccggata 480tccatgatct tcaccgagtt gcgcagcctc acccctactc
agtcacggtt caaggcggag 540ctgctcagcc tgccatacca ccacgagatc
gcgctgcgtc cattcggacc ggagcaatcg 600gcggagctgg ctcgcgccgc
cttcggcccg ggcctcgccg aggatgtgct cgcggggttg 660tataaaacga
ccaggggcaa tctgagtctc agccgtggac tgatcagcga tgtgcgggag
720gccctggcca acggagagag cgctttcgag gcgggccgcg cgttccggct
ggcgtacctc 780agctcgctct accgctgtgg cccggtcgcg ctgcgggtcg
cccgagtggc tgccgtgctg 840ggcccaagcg ccaccaccac gctggtgcgc
cggctaagcg ggctcagcgc ggagacgata 900gaccgggcaa ccaagatcct
cactgagggc gggctgctgc tcgaccagca gttcccgcac 960ccggccgccc
gctcggtggt gctcgatgac atgtccgccc aggaacgacg cagcctgcac
1020actctcgccc tggaactgct ggacgaggcg ccggttgaag tgctcgcgca
ccaccaggtc 1080ggcgccggtc tcatacacgg gcccaaggct gcggagatgt
tcgccaaggc cggcaaggct 1140ctggtcgtac gcaacgagtt gggcgacgcg
gccgaatacc tgcaactggc tcaccgggcc 1200tccgacgatg tctccacccg
ggccgccctg cgggtcgagg ccgtggccat cgagcgccgc 1260cgcaatccgc
tggcctccag tcggcacatg gacgaactga gcgccgccgg ccgcgccggt
1320ctgctttccc ccaagcatgc ggcgctggcc gtcttctggc tagccgacgg
cgggcgatcc 1380ggcgaggcag ccgaagtgct ggcgtcggaa cgcccgctcg
cgaccaccga tcagaaccgg 1440gcccacctgc gatttgtcga ggtgactctc
gcgctgttct ctcccggcgc cttcggatcg 1500gaccggcgcc cacctccgct
gacgccggac gaactcgcca gcctgccgaa ggcggcctgg 1560caatgcgcgg
tcgccgacaa cgcggccatg accgccttgc acggccatcc agaacttgcc
1620accgctcagg cggaaacagt tctgcggcag gctgattcgg cagccgacgc
gatccccgcc 1680gcgctgatcg ccctgttgta cgcggagaac accgagtccg
ctcatatctg ggccgacaag 1740ctgggcagca cgaatgccgg ggtatcgaac
gaggcggaag cgggctacgc cggcccgtgc 1800gccgagatcg ccctgcggcg
cggcgacctg gccacggcgt tcgaggctgg tagcgccgtc 1860ctggacgacc
ggtcgctgcc gtcgctcggc atcaccgccg cattgctgtt gagcagcaag
1920acggccgccg ctgtccggct gggcgaactc gagcgtgcgg agaagctgct
cgccgagccg 1980cttccgaacg gcgtccagga cagccttttc ggtctgcacc
tgctctcggc gtacggccag 2040tacagcctcg cgatgggccg atatgaatca
gctcaccggg cgtttcgcac ctgcggagaa 2100cgtatgcgca gctgggatgt
tgacgtgcct ggtctggccc tgtggcgtgt cgacgccgcc 2160gaggcgctgc
tcagcctcga ccggaacgag ggccagcggc tcatcgacga acaactcacc
2220cgtccgatgg ggcctcgttc ccacgcgctg acgctgcgga tcaaggcggc
atacctcccg 2280cggacgaagc ggatccccct gctccatgag gcggccgagc
tgctgctccc ctgccccgac 2340ccgtacgagc aagcgcgggt gctcgccgat
ctgggcgaca cgctcagcgc gctcagacgc 2400tatagccggg cgcggggagt
tctccggcag gctcgtcacc tggccaccca gtgcggtgct 2460gtcccgctgc
tgcgcaggct cgggggcgag cccggccgga tcgacgacgc cggcctgccg
2520cagcggagca catcgttgac cgatgcggag cggcgggtgg cggcgctggc
cgcggccgga 2580cagaccaacc gggagatcgc cgaacagctg ttcgtcacgg
ccagcacagt ggaacagcac 2640ctcacaagcg tcttccgcaa gctgggcgtc
aagggccgca agcagctgcc gaccgcgctg 2700gccgacgtgg aacagacctg a
2721202715DNAStreptomyces violaceusniger 20gtgtatagcg gtacctgccg
tgaaggatac gaactcgtcg cccgcgagga cgaactcggc 60attctgcaga ggtctctgga
agaagcaggc agcggccagg gcgccgtggt caccgtcacc 120ggcccgatcg
cctgcggcaa gacagaactg cttgacgcgg ctgccgcgaa ggctgacgcc
180atcattctgc gcgcggtctg cgcgcccgaa gagcgcgcta tgccgtacgc
catgatcggg 240cagctcatcg acgacccggc gctcgcgcat cgggcgccgg
agctggctga tcggatagcc 300cagggcgggc atctgtcgct gagggccgag
aaccgactgc gcagggatct cacccgtgcc 360ctgctggcgc ttgccgtcga
ccggcctgtg ctgatcggcg tcgacgatgt gcatcacgcc 420gacaccgcct
ctttgaactg tctgctgcat ttagcccgcc gggtccgtcc ggcccggata
480tccatgatct tcaccgagtt gcgcagcctc acccctactc agtcacgatt
caaggcggag 540ctgctcagcc tgccgtacca ccacgagatc gcgctgcgtc
cactcggacc ggagcaatcg 600gcggagctgg cccacgccgc cttcggcccg
ggcctcgccg aggatgtgct cgcggggttg 660tatgggatga ccaggggcaa
cctgagtctc agccgtggac tgatcagcga tgtgcgggag 720gcccaggcca
acggagagag cgctttcgag gtgggccgcg cgttccggct ggcgtacctc
780agctcgctct accgctgtgg cccgatcgcg ctgcgggtcg cccgagtggc
tgccgtgctg 840ggcccaagcg ccaccaccac gctggtgcgc cgtctaagcg
ggctcagcgc ggagacgata 900gaccgggcaa ccaagatcct cactgagggc
gggctgctgc tcgaccacca gttcccgcac 960ccggccgccc gctcggtggt
gctcgatgac atgtccgccc aggaacgacg cagcctgcac 1020actctcgccc
tggaactgct ggacgaggcg ccggttgaag tgctcgcgca ccaccaggtc
1080ggcgccggtc tcatacacgg gcccaaggct gcggagatat tcgccagggc
tggccaggct 1140ctggttgtac gcaacgagtt gggcgacgcg gccgaatacc
tgcaactggc tcaccgagcc 1200tccgacgatg tctccacccg ggccgcctta
cgggtcgagg ccgtggcaat cgagcgccgc 1260cgcaatccgc tggcctccag
tcgtcacatg gacgagctga gcgccgccgg ccgcgccggt 1320ctgctttccc
ccaagcatgc agcgctggct gtcttctggc tggccgacgg cgggcgatcc
1380ggcgaggcag ccgaggtgct ggcgtcggaa cacccgctcg cgaccaccga
tcagaaccga 1440gcacacctgc gatttgccga ggtgactctc gcgctgttct
gtcccggcgc cttcgggtcg 1500gaccggcgcc cacctccgct ggcgccggac
gagctcgcca gcttgccgaa ggcggcctgg 1560caatgcgcgg tcgccgacaa
cgcggtcatg acagcgttgc atgctcatcc agaacttgcc 1620accgctcagg
cggaaacagt tctgcggcag gctgattcgg cagccgacgc aatccccgcc
1680gcactgatcg ccctgttgta cgcagagaac accgagtccg ctcagatctg
ggccgacaag 1740ctgggcagca ccaatgccgg ggtatcgaac gaggcggaag
cgggctacgc cggcccgtgc 1800gccgagatcg ccctgcggcg cggcgacctg
gccacggcgt tcgaggctgg tggcaccgtc 1860ctggacgacc ggccgctgcc
gtcgctcggc atcaccgccg cattgctgtt gagcagcaag 1920acggcagccg
ctgtccgcct gggcgaactc gagcgtgcgg agaagctgct cgctgagccg
1980cttccgaacg gtgtccagga cagccttttc ggtctgcacc tgctctcggc
gcacggccag 2040tacagcctcg cgatgggccg atatgaatcg gctcaccggg
cgtttcacac ctgcggagaa 2100cgtatgcgca gctggggtgt tgacgtgcct
ggtctagccc tgtggcgtgt cgacgccgcc 2160gaggcactgc tcagcctcga
ccggaacgag ggccagcggc tcatcgacga acaactcgcc 2220cgtccgatgg
gacctcgttc ccgcgcatta acgctgcgga tcaaggcggc atacctcccg
2280cggacgaagc ggatccccct gctccatgag gcagctgagc tgctgctctc
ctgccccgac 2340ccgtacgagc aagcgcgggt gctcgccgat ctgggcgaca
cgctcagcgc gctcagacgc 2400tatagccggg cgcggggagt tctccggcag
gctcgtcacc tggccaccca gtgcggtgct 2460gtcccgctgc tgcgccgact
cgggggcgag cccggccgga tcgacgacgc cggcctgccg 2520cagcggagca
catcgttgac cgatgcggag cggcgggtgt cggccctggc cgcggccgga
2580cagaccaacc gggagatcgc caaacagcta ttcgtcacgg ccagcaccgt
ggaacagcac 2640ctcacaagcg tcttccgcaa gctgggcgtt aagggccgca
ggcagctacc gaccgcgctg 2700gccgacgtgg aatag
2715212715DNAStreptomyces violaceusniger 21atgtatagcg gtacctgccg
tgaaggatac gaactcgtcg cccgcgagga cgaactcggc 60attctgcaga ggtctctgga
agaagcaggc agcggccagg gcgccgtggt caccgtcacc 120ggcccgatcg
cctgcggcaa gacagaactg cttgacgcgg ctgccgcgaa ggctgacgcc
180atcattctgc gcgcggtctg cgcgcccgaa gagcgcgcta tgccgtacgc
catgatcggg 240cagctcatcg acgacccggc gctcgcgcat cgggcgccgg
agctggctga tcggatagcc 300cagggcgggc atctgtcgct gagggccgag
aaccgactgc gcagggatct cacccgtgcc 360ctgctggcgc ttgccgtcga
ccggcctgtg ctgatcggcg tcgacgatgt gcatcacgcc 420gacaccgcct
ctttgaactg tctgctgcat ctggcccgcc gggtccgtcc ggcccggata
480tccatgatct tcaccgagtt gcgcagcctc acccctactc agtcacgatt
caaggcggag 540ctgctcagcc tgccgtacca ccacgagatc gcgctgcgtc
cactcggacc ggagcaatcg 600gcggagctgg cccacgccgc cttcggcccg
ggcctcgccg aggatgtgct cgcggggttg 660tatgggatga ccaggggcaa
cctgagtctc agccgtggac tgatcagcga tgtgcgggag 720gcccaggcca
acggagagag cgctttcgag gtgggccgcg cgttccggct ggcgtacctc
780agctcgctct accgctgtgg cccgatcgcg ctgcgggtcg cccgagtggc
tgccgtgctg 840ggcccaagcg ccaccaccac gctggtgcgc cgtctaagcg
ggctcagcgc ggagacgata 900gaccgggcaa ccaagatcct cactgagggc
gggctgctgc tcgaccacca gttcccgcac 960ccggccgccc gctcggtggt
gctcgatgac atgtccgccc aggaacgacg cagcctgcac 1020actctcgccc
tggaactgct ggacgaggcg ccggttgaag tgctcgcgca ccaccaggtc
1080ggcgccggtc tcatacacgg gcccaaggct gcggagatat tcgccagggc
tggccaggct 1140ctggttgtac gcaacgagtt gggcgacgcg gccgaatacc
tgcaactggc tcaccgagcc 1200tccgacgatg tctccacccg ggccgccctg
cgggtcgagg ccgtggcaat cgagcgccgc 1260cgcaatccgc tggcctccag
tcgtcacatg gacgagctga gcgccgccgg ccgcgccggt 1320ctgctttccc
ccaagcatgc agcgctggct gtcttctggc tggccgacgg cgggcgatcc
1380ggcgaggcag ccgaggtgct ggcgtcggaa cacccgctcg cgaccaccga
tcagaaccga 1440gcacacctgc gatttgccga ggtgactctc gcgctgttct
gtcccggcgc cttcgggtcg 1500gaccggcgcc cacctccgct ggcgccggac
gagctcgcca gcttgccgaa ggcggcctgg 1560caatgcgcgg tcgccgacaa
cgcggtcatg acagcgttgc atgctcatcc agaacttgcc 1620accgctcagg
cggaaacagt tctgcggcag gctgattcgg cagccgacgc aatccccgcc
1680gcactgatcg ccctgttgta cgcagagaac accgagtccg ctcagatctg
ggccgacaag 1740ctgggcagca ccaatgccgg ggtatcgaac gaggcggaag
cgggctacgc cggcccgtgc 1800gccgagatcg ccctgcggcg cggcgacctg
gccacggcgt tcgaggctgg tggcaccgtc 1860ctggacgacc ggccgctgcc
gtcgctcggc atcaccgccg cattgctgtt gagcagcaag 1920acggcagccg
ctgtccgcct gggcgaactc gagcgtgcgg agaagctgct cgctgagccg
1980cttccgaacg gtgtccagga cagccttttc ggtctgcacc tgctctcggc
gcacggccag 2040tacagcctcg cgatgggccg atatgaatcg gctcaccggg
cgtttcacac ctgcggagaa 2100cgtatgcgca gctggggtgt tgacgtgcct
ggtctagccc tgtggcgtgt cgacgccgcc 2160gaggcactgc tcagcctcga
ccggaacgag ggccagcggc tcatcgacga acaactcgcc 2220cgtccgatgg
gacctcgttc ccgcgcactg acgctgcgga tcaaggcggc atacctcccg
2280cggacgaagc ggatccccct gctccatgag gcagctgagc tgctgctctc
ctgccccgac 2340ccgtacgagc aagcgcgggt gctcgccgat ctgggcgaca
cgctcagcgc gctcagacgc 2400tatagccggg cgcggggagt tctccggcag
gctcgtcacc tggccaccca gtgcggtgct 2460gtcccgctgc tgcgccgact
cgggggcgag cccggccgga tcgacgacgc cggcctgccg 2520cagcggagca
catcgttgac cgatgcggag cggcgggtgt cggccctggc cgcggccgga
2580cagaccaacc gggagatcgc caaacagcta ttcgtcacgg ccagcaccgt
ggaacagcac 2640ctcacaagcg tcttccgcaa gctgggcgtt aagggccgca
ggcagctacc gaccgcgctg 2700gccgacgtgg aatag
2715222721DNAStreptomyces Sp. NRRL F-4729 22gtgtatagcg gtacctgccg
tgaaggatac gaactcgtcg cacgcgagga cgaactcggc 60attctacaga ggtctctgga
acaagcgagc agcggccagg gcgtcgtggt caccgtcacc 120ggcccaatcg
cctgcggcaa gacagaactg cttgacgcgg ctgccgcgaa ggctgaggcc
180atcattctgc gcgcggtctg cgcgcccgaa gagcgggcta tgccgtacgc
catgatcggg 240cagctcatcg acgacccggc gctcgcgcat cgggcgccgg
ggctggctga tcggatagcc 300cagggcgggc agctgtcgct gagggccgag
aaccgactgc gcagggatct cacccgtgcc 360ctgctggcgc ttgccgtgca
ccggcctgtg ctgatcggcg tcgatgatgt gcatcacgcc 420gacaccgcct
ctttgaactg tctgctgcat ttggcgcgcc gggtccgtcc ggcccggata
480tccatgatct tcaccgagtt gcgcagcctc acccctactc agtcacgatt
caaggcggag 540ctgctcagcc tgccgtacca ccacgagatc gcgctgcgtc
cattcggacc ggagcaatcg 600gcggagctgg ctcgcgccgc cttcggcccg
ggcctcgccg aggatgtgct cgcggggttg 660tataaaacga ccaggggcaa
tctgagtctc agccgtggac tgatcagcga tgtgcgggag 720gccctggcca
acggagagag cgctttcgag gcgggccgcg cgttccggct ggcgtacctc
780agctcgctct accgctgtgg cccggtcgcg ctgcgggtcg cccgagtggc
tgccgtgctg 840ggcccaagcg ccaccaccac gctggtgcgc cggctaagcg
ggctcagcgc ggagacgata 900gaccgggcaa ccaagatcct caccgagggc
gggctgctgc tcgaccagca gtttccgcac 960ccggccgccc gctcggtggt
gctcgatgac atgtccgccc aggaacgacg cggcctgcac 1020actctcgccc
tggaactgct ggacgaggcg ccggttgaag tgctcgcgca ccaccaggtc
1080ggcgccggtc tcatacacgg gcccaaggct gcggagatgt tcgccaaggc
cggcaaggct 1140ctggtcgtac gcaacgagtt gggcgacgcg gccgaatacc
tgcaactggc tcaccgggcc 1200tccgacgatg tctccacccg ggccgcctta
cgggtcgagg ccgtggcgat cgagcgccgc 1260cgcaatccgc tggcctccag
tcggcacatg gacgagctga gcgccgccgg ccgcgccggt 1320ctgctttccc
ccaagcatgc ggcgctggcc gtcttctggc tggccgacgg cgggcgatcc
1380ggcgaggcag cccaggtgct ggcgtcggaa cgcccgctcg cgaccaccga
tcagaaccgg 1440gcccacctgc gatttgtcga ggtgactctc gcgctgttct
ctcccggcgc cttcggatcg 1500gaccggcgcc cacctccgct gacgccggac
gaactcgcca gcctgccgaa ggcggcctgg 1560caatgcgcgg tcgccgacaa
cgcggccatg accgccttgc acggccatcc agaacttgcc 1620accgctcagg
cggaaacagt tctgcggcag gctgattcgg cagccgacgc gatccccgcc
1680gcgctgatcg ccctgttgta cgcggagaac accgagtccg ctcatatctg
ggccgacaag 1740ctgggcagca tgaatgccgg ggtatcgaac gaggcggaag
cgggctacgc cggcccgtgc 1800gccgagatcg ccctgcggcg cggcgacctg
gccacggcgt tcgaggctgg tagcaccgtc 1860ctggacgacc ggtcactgcc
gtcgctcggc atcaccgccg cattgctgtt gagcagcaag 1920acggccgccg
ctgtccggct gggcgaactc gagcgtgcgg agaagctgct cgccgagccg
1980cttccgaacg gcgtccagga cagccttttc ggtctgcacc tgctctcggc
gtacggccag 2040tacagcctcg cgatgggccg atatgaatcg gctcaccggg
cgtttcgcac ctgcggagaa 2100cgtatgcgca gctgggatgt tgacgtgcct
ggtctggccc tgtggcgtgt cgacgccgcc 2160gaggcgctgc tcagcctcga
ccggaacgag ggccagcggc tcatcgacga acaactcacc 2220cgtccgatgg
gacctcgttc ccgcgcgtta acgctgcgga tcaaggcggc atacctcccg
2280cggacgaagc ggatccccct gctccatgag gcggccgagc tgctgctccc
ctgccccgac 2340ccgtacgagc aagcgcgggt gctcgccgat ctgggcgaca
cgctcagcgc gctcagacgc 2400tatagccggg cgcggggagt tctccggcag
gctcgtcacc tggccaccca gtgcggtgct 2460gtcccgctgc tgcgccgact
cgggggcgag cccggccgga tcgacgacgc cggcctgccg 2520cagcggagca
catcgttgac cgatgcggag cggcgggtgg cggcgctggc cgcggccgga
2580cagaccaacc gggagatcgc cgaacagctg ttcgtcacgg ccagcacagt
ggaacagcac 2640ctcacaagcg tcttccgcaa gctgggcgtc aagggccgca
agcagctgcc gaccgcgctg 2700gccgacgtgg aacagacctg a
2721232721DNAStreptomyces Sp. NRRL F-4729 23atgtatagcg gtacctgccg
tgaaggatac gaactcgtcg cacgcgagga cgaactcggc 60attctacaga ggtctctgga
acaagcgagc agcggccagg gcgtcgtggt caccgtcacc 120ggcccaatcg
cctgcggcaa gacagaactg cttgacgcgg ctgccgcgaa ggctgaggcc
180atcattctgc gcgcggtctg cgcgcccgaa gagcgggcta tgccgtacgc
catgatcggg 240cagctcatcg acgacccggc gctcgcgcat cgggcgccgg
ggctggctga tcggatagcc 300cagggcgggc agctgtcgct gagggccgag
aaccgactgc gcagggatct cacccgtgcc 360ctgctggcgc ttgccgtgca
ccggcctgtg ctgatcggcg tcgatgatgt gcatcacgcc 420gacaccgcct
ctttgaactg tctgctgcat ttggcgcgcc gggtccgtcc ggcccggata
480tccatgatct tcaccgagtt gcgcagcctc acccctactc agtcacgatt
caaggcggag 540ctgctcagcc tgccgtacca ccacgagatc gcgctgcgtc
cattcggacc ggagcaatcg 600gcggagctgg ctcgcgccgc cttcggcccg
ggcctcgccg aggatgtgct cgcggggttg 660tataaaacga ccaggggcaa
tctgagtctc agccgtggac tgatcagcga tgtgcgggag 720gccctggcca
acggagagag cgctttcgag gcgggccgcg cgttccggct ggcgtacctc
780agctcgctct accgctgtgg cccggtcgcg ctgcgggtcg cccgagtggc
tgccgtgctg 840ggcccaagcg ccaccaccac gctggtgcgc cggctaagcg
ggctcagcgc ggagacgata 900gaccgggcaa ccaagatcct caccgagggc
gggctgctgc tcgaccagca gtttccgcac 960ccggccgccc gctcggtggt
gctcgatgac atgtccgccc aggaacgacg cggcctgcac 1020actctcgccc
tggaactgct ggacgaggcg ccggttgaag tgctcgcgca ccaccaggtc
1080ggcgccggtc tcatacacgg gcccaaggct gcggagatgt tcgccaaggc
cggcaaggct 1140ctggtcgtac gcaacgagtt gggcgacgcg gccgaatacc
tgcaactggc tcaccgggcc 1200tccgacgatg tctccacccg ggccgccctg
cgggtcgagg ccgtggcgat cgagcgccgc 1260cgcaatccgc tggcctccag
tcggcacatg gacgagctga gcgccgccgg ccgcgccggt 1320ctgctttccc
ccaagcatgc ggcgctggcc gtcttctggc tggccgacgg cgggcgatcc
1380ggcgaggcag cccaggtgct ggcgtcggaa cgcccgctcg cgaccaccga
tcagaaccgg 1440gcccacctgc gatttgtcga ggtgactctc gcgctgttct
ctcccggcgc cttcggatcg 1500gaccggcgcc cacctccgct gacgccggac
gaactcgcca gcctgccgaa ggcggcctgg 1560caatgcgcgg tcgccgacaa
cgcggccatg accgccttgc acggccatcc agaacttgcc 1620accgctcagg
cggaaacagt tctgcggcag gctgattcgg cagccgacgc gatccccgcc
1680gcgctgatcg ccctgttgta cgcggagaac accgagtccg ctcatatctg
ggccgacaag 1740ctgggcagca tgaatgccgg ggtatcgaac gaggcggaag
cgggctacgc
cggcccgtgc 1800gccgagatcg ccctgcggcg cggcgacctg gccacggcgt
tcgaggctgg tagcaccgtc 1860ctggacgacc ggtcactgcc gtcgctcggc
atcaccgccg cattgctgtt gagcagcaag 1920acggccgccg ctgtccggct
gggcgaactc gagcgtgcgg agaagctgct cgccgagccg 1980cttccgaacg
gcgtccagga cagccttttc ggtctgcacc tgctctcggc gtacggccag
2040tacagcctcg cgatgggccg atatgaatcg gctcaccggg cgtttcgcac
ctgcggagaa 2100cgtatgcgca gctgggatgt tgacgtgcct ggtctggccc
tgtggcgtgt cgacgccgcc 2160gaggcgctgc tcagcctcga ccggaacgag
ggccagcggc tcatcgacga acaactcacc 2220cgtccgatgg gacctcgttc
ccgcgcgctg acgctgcgga tcaaggcggc atacctcccg 2280cggacgaagc
ggatccccct gctccatgag gcggccgagc tgctgctccc ctgccccgac
2340ccgtacgagc aagcgcgggt gctcgccgat ctgggcgaca cgctcagcgc
gctcagacgc 2400tatagccggg cgcggggagt tctccggcag gctcgtcacc
tggccaccca gtgcggtgct 2460gtcccgctgc tgcgccgact cgggggcgag
cccggccgga tcgacgacgc cggcctgccg 2520cagcggagca catcgttgac
cgatgcggag cggcgggtgg cggcgctggc cgcggccgga 2580cagaccaacc
gggagatcgc cgaacagctg ttcgtcacgg ccagcacagt ggaacagcac
2640ctcacaagcg tcttccgcaa gctgggcgtc aagggccgca agcagctgcc
gaccgcgctg 2700gccgacgtgg aacagacctg a 2721242715DNAStreptomyces
filamentosus 24gtgcgagcta ttaatgcgtc cgacaccggt cctgaactgg
tcgcccgcga agacgaactg 60ggacgtgtac gaagtgccct gaaccgagcg aacggcggcc
aaggtgtcct gatctccatt 120accggtccga tcgcctgcgg caagaccgaa
ctgcttgagg ctgccgcctc ggaagttgac 180gccatcactc tgcgcgcggt
ctgtgccgcc gaggaacggg cgatacctta tgccctgatc 240gggcagctta
tcgacaaccc cgcgctcggc attccggttc cggatccggc cggcctgacc
300gcccagggcg gacgactgtc atcgagcgcc gagaaccgac tgcgtcgcga
cctcacccgt 360gccctgctga cgctcgccac cgaccggctg gtgctgatct
gtgtcgatga cgtgcagcac 420gccgacaacg cctcgttgag ctgccttctg
tatctggccc gacggcttgt cccggctcga 480atcgctctgg tattcaccga
gttgcgagtc ctcacctcgt ctcagttacg gttcaacgcg 540gagctgctca
gcttgcggaa ccactgcgag atcgcgctgc gcccactcgg cccggggcat
600gcggccgagc tggcccgcgc caccctcggc cccggcctct ccgacgaaac
actcacggag 660ctgtaccggg tgaccggagg caacctgagt ctcagccgcg
ggctgatcga cgatgtgcgg 720gacgcctggg cacgagggga aacgggcgtc
caggtgggcc gggcgttccg gctggcctac 780ctcggttccc tccaccgctg
tggtccgctg gcgttgcggg tcgcccgcgt agccgccgta 840ctgggcccga
gcgccaccag cgtcctggtg cgccggatca gtgggctcag cgcggaggcc
900atggcccagg cgaccgatat cctcgctgac ggcggcctcc tgcgcgacca
gcggttcaca 960catccagcgg cccgctcggt ggtgctcgac gacatgtccg
ccgaggaacg acgcagcgtg 1020cacagcctcg ccctggaact gctggacgag
gcaccggccg agatgctcgc gcaccaccgg 1080gtcggcgccg gtctcgtgca
cgggccgaag gccgcggaga cattcaccgg ggccggccgg 1140gcactggccg
ttcgcggcat gctgggcgag gcagccgact acctgcaact ggcgtaccgg
1200gcctccggcg acgccgctac caaggccgcg atacgcgtcg agtccgtggc
ggtcgagcgc 1260cgacgcaatc cgctggtcgt cagtcgccat tgggacgagc
tgagcgtcgc ggcccgcgcc 1320ggtctgctct cctgcgagca cgtgtccagg
acggcccgct ggctgaccgt cggtgggcgg 1380cccggcgagg cggccagggt
gctggcgtcg caacaccgac gggtcgtcac cgatcaggac 1440cgggcccacc
tgcgggtcgc cgagttctcg ctcgcgctgc tgtaccccgg tacgtccggc
1500tcggaccggc gcccgcaccc gctcacgtcg gacgaactcg cggccctacc
gactgcgacc 1560agacactgcg cgatcgccga taacgctgtc atggctgcct
tgcgtggtca tccggagctt 1620gccaccgccg aggcagaagc cgttctgcag
caagccgacg cggcggacgg cgctgctctc 1680accgcgctga tggccctgct
gtacgcggag agcatcgagg tcgctgaagt ctgggcggac 1740aagctggcgg
cagaggccgg agcatcgaac gggcaggacg cggagtacgc cggtatacgc
1800gccgaaatcg ccctgcggcg cggcgatctg accgcggccg tcgagaccgc
cggcatggtc 1860ctggacggcc ggccgctgcc gtcgctcgac atcaccgcca
cgttgctgtt ggccggcagg 1920gcgtccgtcg ccgtccggct gggcgaactc
gaccacgcgg aggagctgtt cgccgcgccg 1980ccggaggacg ccttccagga
cagcctcttc ggtctgcatc tgctctcggc gcacggccag 2040tacagcctcg
cgacaggccg gcccgagtcg gcataccggg cctttcgtgc ctgcggcgaa
2100cgtatgcgcg attggggctt cgacgcgccc ggtgtggccc tgtggcgcgt
cggcgccgcc 2160gaggcgctgc tcggcctcga ccggaacgag ggccgacggc
tcatcgacga acagctgagc 2220cggacgatgg ccccccggtc ccacgcgttg
acgctgcgga taaaagcggc gtacatgccg 2280gagccgaagc gggtcgacct
gctctacgaa gcggctgagc tgctgctctc ctgccgggac 2340cagtatgagc
gagcgcgggt gctcgccgat ctgggcgagg cgctcagcgc gctcgggaac
2400taccggcagg cgcgaggtgt gctccggcag gctcggcatc tggccatgcg
aaccggcgcg 2460gacccgctgc tgcgccggct cggaatcagg cccggccggc
aggacgaccc cgacccgcag 2520ccgcggagca gatcgctgac caacgctgag
cggcgtgcgg cgtcgctggc cgcgaccgga 2580ctgaccaacc gggagatcgc
cgaccggctc ttcgtcaccg ccagcaccgt ggagcagcac 2640ctcaccaacg
tcttccgcaa gctgggcgtc aagggccgca agcagctgcc ggccgagttg
2700gacgacatgg aatag 2715252715DNAStreptomyces filamentosus
25atgcgagcta ttaatgcgtc cgacaccggt cctgaactgg tcgcccgcga agacgaactg
60ggacgtgtac gaagtgccct gaaccgagcg aacggcggcc aaggtgtcct gatctccatt
120accggtccga tcgcctgcgg caagaccgaa ctgcttgagg ctgccgcctc
ggaagttgac 180gccatcactc tgcgcgcggt ctgtgccgcc gaggaacggg
cgatacctta tgccctgatc 240gggcagctta tcgacaaccc cgcgctcggc
attccggttc cggatccggc cggcctgacc 300gcccagggcg gacgactgtc
atcgagcgcc gagaaccgac tgcgtcgcga cctcacccgt 360gccctgctga
cgctcgccac cgaccggctg gtgctgatct gtgtcgatga cgtgcagcac
420gccgacaacg cctcgttgag ctgccttctg tatctggccc gacggcttgt
cccggctcga 480atcgctctgg tattcaccga gttgcgagtc ctcacctcgt
ctcagctgcg gttcaacgcg 540gagctgctca gcttgcggaa ccactgcgag
atcgcgctgc gcccactcgg cccggggcat 600gcggccgagc tggcccgcgc
caccctcggc cccggcctct ccgacgaaac actcacggag 660ctgtaccggg
tgaccggagg caacctgagt ctcagccgcg ggctgatcga cgatgtgcgg
720gacgcctggg cacgagggga aacgggcgtc caggtgggcc gggcgttccg
gctggcctac 780ctcggttccc tccaccgctg tggtccgctg gcgttgcggg
tcgcccgcgt agccgccgta 840ctgggcccga gcgccaccag cgtcctggtg
cgccggatca gtgggctcag cgcggaggcc 900atggcccagg cgaccgatat
cctcgctgac ggcggcctcc tgcgcgacca gcggttcaca 960catccagcgg
cccgctcggt ggtgctcgac gacatgtccg ccgaggaacg acgcagcgtg
1020cacagcctcg ccctggaact gctggacgag gcaccggccg agatgctcgc
gcaccaccgg 1080gtcggcgccg gtctcgtgca cgggccgaag gccgcggaga
cattcaccgg ggccggccgg 1140gcactggccg ttcgcggcat gctgggcgag
gcagccgact acctgcaact ggcgtaccgg 1200gcctccggcg acgccgctac
caaggccgcg atacgcgtcg agtccgtggc ggtcgagcgc 1260cgacgcaatc
cgctggtcgt cagtcgccat tgggacgagc tgagcgtcgc ggcccgcgcc
1320ggtctgctct cctgcgagca cgtgtccagg acggcccgct ggctgaccgt
cggtgggcgg 1380cccggcgagg cggccagggt gctggcgtcg caacaccgac
gggtcgtcac cgatcaggac 1440cgggcccacc tgcgggtcgc cgagttctcg
ctcgcgctgc tgtaccccgg tacgtccggc 1500tcggaccggc gcccgcaccc
gctcacgtcg gacgaactcg cggccctacc gactgcgacc 1560agacactgcg
cgatcgccga taacgctgtc atggctgcct tgcgtggtca tccggagctt
1620gccaccgccg aggcagaagc cgttctgcag caagccgacg cggcggacgg
cgctgctctc 1680accgcgctga tggccctgct gtacgcggag agcatcgagg
tcgctgaagt ctgggcggac 1740aagctggcgg cagaggccgg agcatcgaac
gggcaggacg cggagtacgc cggtatacgc 1800gccgaaatcg ccctgcggcg
cggcgatctg accgcggccg tcgagaccgc cggcatggtc 1860ctggacggcc
ggccgctgcc gtcgctcgac atcaccgcca cgttgctgtt ggccggcagg
1920gcgtccgtcg ccgtccggct gggcgaactc gaccacgcgg aggagctgtt
cgccgcgccg 1980ccggaggacg ccttccagga cagcctcttc ggtctgcatc
tgctctcggc gcacggccag 2040tacagcctcg cgacaggccg gcccgagtcg
gcataccggg cctttcgtgc ctgcggcgaa 2100cgtatgcgcg attggggctt
cgacgcgccc ggtgtggccc tgtggcgcgt cggcgccgcc 2160gaggcgctgc
tcggcctcga ccggaacgag ggccgacggc tcatcgacga acagctgagc
2220cggacgatgg ccccccggtc ccacgcgttg acgctgcgga taaaagcggc
gtacatgccg 2280gagccgaagc gggtcgacct gctctacgaa gcggctgagc
tgctgctctc ctgccgggac 2340cagtatgagc gagcgcgggt gctcgccgat
ctgggcgagg cgctcagcgc gctcgggaac 2400taccggcagg cgcgaggtgt
gctccggcag gctcggcatc tggccatgcg aaccggcgcg 2460gacccgctgc
tgcgccggct cggaatcagg cccggccggc aggacgaccc cgacccgcag
2520ccgcggagca gatcgctgac caacgctgag cggcgtgcgg cgtcgctggc
cgcgaccgga 2580ctgaccaacc gggagatcgc cgaccggctc ttcgtcaccg
ccagcaccgt ggagcagcac 2640ctcaccaacg tcttccgcaa gctgggcgtc
aagggccgca agcagctgcc ggccgagttg 2700gacgacatgg aatag
271526894PRTStreptomyces hygroscopicus 26Met Pro Ala Val Glu Cys
Tyr Glu Leu Asp Ala Arg Asp Asp Glu Leu1 5 10 15Arg Lys Leu Glu Glu
Val Val Thr Gly Arg Ala Asn Gly Arg Gly Val 20 25 30Val Val Thr Ile
Thr Gly Pro Ile Ala Cys Gly Lys Thr Glu Leu Leu 35 40 45Asp Ala Ala
Ala Ala Lys Ala Asp Ala Ile Thr Leu Arg Ala Val Cys 50 55 60Ser Ala
Glu Glu Gln Ala Leu Pro Tyr Ala Leu Ile Gly Gln Leu Ile65 70 75
80Asp Asn Pro Ala Leu Ala Ser His Ala Leu Glu Pro Ala Cys Pro Thr
85 90 95Leu Pro Gly Glu His Leu Ser Pro Glu Ala Glu Asn Arg Leu Arg
Ser 100 105 110Asp Leu Thr Arg Thr Leu Leu Ala Leu Ala Ala Glu Arg
Pro Val Leu 115 120 125Ile Gly Ile Asp Glu Ser His Ala Asn Ala Leu
Cys Leu Leu His Leu 130 135 140Ala Arg Arg Val Gly Ser Ala Arg Ile
Ala Met Val Leu Thr Glu Leu145 150 155 160Arg Arg Leu Thr Pro Ala
His Ser Gln Phe Gln Ala Glu Leu Leu Ser 165 170 175Leu Gly His His
Arg Glu Ile Ala Leu Arg Pro Leu Ser Pro Lys His 180 185 190Thr Ala
Glu Leu Val Arg Ala Gly Leu Gly Pro Asp Val Asp Glu Asp 195 200
205Val Leu Thr Gly Leu Tyr Arg Ala Thr Gly Gly Asn Leu Asn Leu Thr
210 215 220Arg Gly Leu Ile Asn Asp Val Arg Glu Ala Trp Glu Thr Gly
Gly Thr225 230 235 240Gly Ile Ser Ala Gly Arg Ala Tyr Arg Leu Ala
Tyr Leu Gly Ser Leu 245 250 255Tyr Arg Cys Gly Pro Val Pro Leu Arg
Val Ala Arg Val Ala Ala Val 260 265 270Leu Gly Gln Ser Ala Asn Thr
Thr Leu Val Arg Trp Ile Ser Gly Leu 275 280 285Asn Ala Asp Ala Val
Gly Glu Ala Thr Glu Ile Leu Thr Glu Gly Gly 290 295 300Leu Leu His
Asp Leu Arg Phe Pro His Pro Ala Ala Arg Ser Val Val305 310 315
320Leu Asn Asp Met Ser Ala Gln Glu Arg Arg Arg Leu His Arg Ser Ala
325 330 335Leu Glu Val Leu Asp Asp Val Pro Val Glu Val Val Ala His
His Gln 340 345 350Val Gly Ala Gly Leu Leu His Gly Pro Lys Ala Ala
Glu Ile Phe Ala 355 360 365Lys Ala Gly Gln Glu Leu His Val Arg Gly
Glu Leu Asp Thr Ala Ser 370 375 380Asp Tyr Leu Gln Leu Ala His Gln
Ala Ser Asp Asp Ala Val Thr Gly385 390 395 400Met Arg Ala Glu Ala
Val Ala Ile Glu Arg Arg Arg Asn Pro Leu Ala 405 410 415Ser Ser Arg
His Leu Asp Glu Leu Thr Val Val Ala Arg Ala Gly Leu 420 425 430Leu
Phe Pro Glu His Thr Ala Leu Met Ile Arg Trp Leu Gly Val Gly 435 440
445Gly Arg Ser Gly Glu Ala Ala Gly Leu Leu Ala Ser Gln Arg Pro Arg
450 455 460Ala Val Thr Asp Gln Asp Arg Ala His Met Arg Ala Ala Glu
Val Ser465 470 475 480Leu Ala Leu Val Ser Pro Gly Thr Ser Gly Pro
Asp Arg Arg Pro Arg 485 490 495Pro Leu Thr Pro Asp Glu Leu Ala Asn
Leu Pro Lys Ala Ala Arg Leu 500 505 510Cys Ala Ile Ala Asp Asn Ala
Val Met Ser Ala Leu Arg Gly Arg Pro 515 520 525Glu Leu Ala Ala Ala
Glu Ala Glu Asn Val Leu Gln His Ala Asp Ser 530 535 540Ala Ala Ala
Gly Thr Thr Ala Leu Ala Ala Leu Thr Ala Leu Leu Tyr545 550 555
560Ala Glu Asn Thr Asp Thr Ala Gln Leu Trp Ala Asp Lys Leu Val Ser
565 570 575Glu Thr Gly Ala Ser Asn Glu Glu Glu Ala Gly Tyr Ala Gly
Pro Arg 580 585 590Ala Glu Ala Ala Leu Arg Arg Gly Asp Leu Ala Ala
Ala Val Glu Ala 595 600 605Gly Ser Thr Val Leu Asp His Arg Arg Leu
Ser Thr Leu Gly Ile Thr 610 615 620Ala Ala Leu Pro Leu Ser Ser Ala
Val Ala Ala Ala Ile Arg Leu Gly625 630 635 640Glu Thr Glu Arg Ala
Glu Lys Trp Leu Ala Gln Pro Leu Pro Gln Ala 645 650 655Ile Gln Asp
Gly Leu Phe Gly Leu His Leu Leu Ser Ala Arg Gly Gln 660 665 670Tyr
Ser Leu Ala Thr Gly Gln His Glu Ser Ala Tyr Thr Ala Phe Arg 675 680
685Thr Cys Gly Glu Arg Met Arg Asn Trp Gly Val Asp Val Pro Gly Leu
690 695 700Ser Leu Trp Arg Val Asp Ala Ala Glu Ala Leu Leu His Gly
Arg Asp705 710 715 720Arg Asp Glu Gly Arg Arg Leu Val Asp Glu Gln
Leu Thr Arg Ala Met 725 730 735Gly Pro Arg Ser Arg Ala Leu Thr Leu
Arg Val Gln Ala Ala Tyr Ser 740 745 750Pro Pro Ala Lys Arg Val Asp
Leu Leu Asp Glu Ala Ala Asp Leu Leu 755 760 765Leu Ser Cys Asn Asp
Gln Tyr Glu Arg Ala Arg Val Leu Ala Asp Leu 770 775 780Ser Glu Thr
Phe Ser Ala Leu Arg His His Ser Arg Ala Arg Gly Leu785 790 795
800Leu Arg Gln Ala Arg His Leu Ala Ala Gln Arg Gly Ala Ile Pro Leu
805 810 815Leu Arg Arg Leu Gly Ala Lys Pro Gly Gly Pro Gly Trp Leu
Glu Glu 820 825 830Ser Gly Leu Pro Gln Arg Ile Lys Ser Leu Thr Asp
Ala Glu Arg Arg 835 840 845Val Ala Ser Leu Ala Ala Gly Gly Gln Thr
Asn Arg Val Ile Ala Asp 850 855 860Gln Leu Phe Val Thr Ala Ser Thr
Val Glu Gln His Leu Thr Asp Val865 870 875 880Ser Thr Gly Ser Arg
Pro Pro Ala Pro Ala Ala Glu Leu Val 885 89027923PRTStreptomyces
kanamyceticus 27Met Val Pro Glu Val Arg Ala Ala Pro Asp Glu Leu Ile
Ala Arg Asp1 5 10 15Asp Glu Leu Ser Arg Leu Gln Arg Ala Leu Thr Arg
Ala Gly Ser Gly 20 25 30Arg Gly Gly Val Val Ala Ile Thr Gly Pro Ile
Ala Ser Gly Lys Thr 35 40 45Ala Leu Leu Asp Ala Gly Ala Ala Lys Ser
Gly Phe Val Ala Leu Arg 50 55 60Ala Val Cys Ser Trp Glu Glu Arg Thr
Leu Pro Tyr Gly Met Leu Gly65 70 75 80Gln Leu Phe Asp His Pro Glu
Leu Ala Ala Gln Ala Pro Asp Leu Ala 85 90 95His Phe Thr Ala Ser Cys
Glu Ser Pro Gln Ala Gly Thr Asp Asn Arg 100 105 110Leu Arg Ala Glu
Phe Thr Arg Thr Leu Leu Ala Leu Ala Ala Asp Trp 115 120 125Pro Val
Leu Ile Gly Ile Asp Asp Val His His Ala Asp Ala Glu Ser 130 135
140Leu Arg Cys Leu Leu His Leu Ala Arg Arg Ile Gly Pro Ala Arg
Ile145 150 155 160Ala Val Val Leu Thr Glu Leu Arg Arg Pro Thr Pro
Ala Asp Ser Arg 165 170 175Phe Gln Ala Glu Leu Leu Ser Leu Arg Ser
Tyr Gln Glu Ile Ala Leu 180 185 190Arg Pro Leu Thr Glu Ala Gln Thr
Gly Glu Leu Val Arg Arg His Leu 195 200 205Gly Ala Glu Thr His Glu
Asp Val Ser Ala Asp Thr Phe Arg Ala Thr 210 215 220Gly Gly Asn Leu
Leu Leu Gly His Gly Leu Ile Asn Asp Ile Arg Glu225 230 235 240Ala
Arg Thr Ala Gly Arg Pro Gly Val Val Ala Gly Arg Ala Tyr Arg 245 250
255Leu Ala Tyr Leu Ser Ser Leu Tyr Arg Cys Gly Pro Ser Ala Leu Arg
260 265 270Val Ala Arg Ala Ser Ala Val Leu Gly Ala Ser Ala Glu Ala
Val Leu 275 280 285Val Gln Arg Met Thr Gly Leu Asn Lys Asp Ala Val
Glu Gln Val Tyr 290 295 300Glu Gln Leu Asn Glu Gly Arg Leu Leu Gln
Gly Glu Arg Phe Pro His305 310 315 320Pro Ala Ala Arg Ser Ile Val
Leu Asp Asp Leu Ser Ala Leu Glu Arg 325 330 335Arg Asn Leu His Glu
Ser Ala Leu Glu Leu Leu Arg Asp His Gly Val 340 345 350Ala Gly Asn
Val Leu Ala Arg His Gln Ile Gly Ala Gly Arg Val His 355 360 365Gly
Glu Glu Ala Val Glu Leu Phe Thr Gly Ala Ala Arg Glu His His 370 375
380Leu Arg Gly Glu Leu Asp Asp Ala Ala Gly Tyr Leu Glu Leu Ala
His385 390 395 400Arg Ala Ser Asp Asp Pro Val Thr Arg Ala Ala Leu
Arg Val Gly Ala 405 410 415Ala Ala Ile Glu Arg Leu Cys Asn Pro Val
Arg Ala Gly Arg His Leu 420 425 430Pro Glu Leu Leu Thr Ala Ser Arg
Ala Gly Leu Leu Ser Ser Glu His 435 440 445Ala Val Ser Leu Ala Asp
Trp Leu Ala Met Gly Gly Arg Pro Gly Glu 450 455 460Ala Ala Glu Val
Leu Ala Thr Gln Arg Pro Ala Ala Asp Ser Glu Gln465 470 475 480His
Arg Ala Leu Leu Arg Ser Gly Glu Leu Ser Leu Ala Leu Val His 485
490
495Pro Gly Ala Trp Asp Pro Leu Arg Arg Thr Asp Arg Phe Ala Ala Gly
500 505 510Gly Leu Gly Ser Leu Pro Gly Pro Ala Arg His Arg Ala Val
Ala Asp 515 520 525Gln Ala Val Ile Ala Ala Leu Arg Gly Arg Leu Asp
Arg Ala Asp Ala 530 535 540Asn Ala Glu Ser Val Leu Gln His Thr Asp
Ala Thr Ala Asp Arg Thr545 550 555 560Thr Ala Ile Met Ala Leu Leu
Ala Leu Leu Tyr Ala Glu Asn Thr Asp 565 570 575Ala Val Gln Phe Trp
Val Asp Lys Leu Ala Gly Asp Glu Gly Thr Arg 580 585 590Thr Pro Ala
Asp Glu Ala Val His Ala Gly Phe Asn Ala Glu Ile Ala 595 600 605Leu
Arg Arg Gly Asp Leu Met Arg Ala Val Glu Tyr Gly Glu Ala Ala 610 615
620Leu Gly His Arg His Leu Pro Thr Trp Gly Met Ala Ala Ala Leu
Pro625 630 635 640Leu Ser Ser Thr Val Val Ala Ala Ile Arg Leu Gly
Asp Leu Asp Arg 645 650 655Ala Glu Arg Trp Leu Ala Glu Pro Leu Pro
Gln Gln Thr Pro Glu Ser 660 665 670Leu Phe Gly Leu His Leu Leu Trp
Ala Arg Gly Gln His His Leu Ala 675 680 685Thr Gly Arg His Gly Ala
Ala Tyr Thr Ala Phe Arg Glu Cys Gly Glu 690 695 700Arg Met Arg Arg
Trp Ala Val Asp Val Pro Gly Leu Ala Leu Trp Arg705 710 715 720Val
Asp Ala Ala Glu Ser Leu Leu Leu Leu Gly Arg Asp Arg Ala Glu 725 730
735Gly Leu Arg Leu Val Ser Glu Gln Leu Ser Arg Pro Met Arg Pro Arg
740 745 750Ala Arg Val Gln Thr Leu Arg Val Gln Ala Ala Tyr Ser Pro
Pro Pro 755 760 765Gln Arg Ile Asp Leu Leu Glu Glu Ala Ala Asp Leu
Leu Val Thr Cys 770 775 780Asn Asp Gln Tyr Glu Leu Ala Asn Val Leu
Ser Asp Leu Ala Glu Ala785 790 795 800Ser Ser Met Val Arg Gln His
Ser Arg Ala Arg Gly Leu Leu Arg Arg 805 810 815Ala Arg His Leu Ala
Thr Gln Cys Gly Ala Val Pro Leu Leu Arg Arg 820 825 830Leu Gly Ala
Glu Pro Ser Asp Ile Gly Gly Ala Trp Asp Ala Thr Leu 835 840 845Gly
Gln Arg Ile Ala Ser Leu Thr Glu Ser Glu Arg Arg Val Ala Ala 850 855
860Leu Ala Ala Val Gly Arg Thr Asn Arg Glu Ile Ala Glu Gln Leu
Phe865 870 875 880Val Thr Ala Ser Thr Val Glu Gln His Leu Thr Asn
Val Phe Arg Lys 885 890 895Leu Ala Val Lys Gly Arg Gln Gln Leu Pro
Lys Glu Leu Ala Asp Val 900 905 910Gly Glu Pro Ala Asp Arg Asp Arg
Arg Cys Gly 915 92028913PRTStreptomyces ascomyceticus 28Met Ile Ala
Arg Leu Ser Pro Pro Asp Leu Ile Ala Arg Asp Asp Glu1 5 10 15Phe Gly
Ser Leu His Arg Ala Leu Thr Arg Ala Gly Gly Gly Arg Gly 20 25 30Val
Val Ala Ala Val Thr Gly Pro Ile Ala Cys Gly Lys Thr Glu Leu 35 40
45Leu Asp Ala Ala Ala Ala Lys Ala Gly Phe Val Thr Leu Arg Ala Val
50 55 60Cys Ser Met Glu Glu Arg Ala Leu Pro Tyr Gly Met Leu Gly Gln
Leu65 70 75 80Leu Asp Gln Pro Glu Leu Ala Ala Arg Thr Pro Glu Leu
Val Arg Leu 85 90 95Thr Ala Ser Cys Glu Asn Leu Pro Ala Asp Val Asp
Asn Arg Leu Gly 100 105 110Thr Glu Leu Thr Arg Thr Val Leu Thr Leu
Ala Ala Glu Arg Pro Val 115 120 125Leu Ile Gly Ile Asp Asp Val His
His Ala Asp Ala Pro Ser Leu Arg 130 135 140Cys Leu Leu His Leu Ala
Arg Arg Ile Ser Arg Ala Arg Val Ala Ile145 150 155 160Val Leu Thr
Glu Leu Leu Arg Pro Thr Pro Ala His Ser Gln Phe Arg 165 170 175Ala
Ala Leu Leu Ser Leu Arg His Tyr Gln Glu Ile Ala Leu Arg Pro 180 185
190Leu Thr Glu Ala Gln Thr Thr Glu Leu Val Arg Arg His Leu Gly Gln
195 200 205Asp Ala His Asp Asp Val Val Ala Gln Ala Phe Arg Ala Thr
Gly Gly 210 215 220Asn Leu Leu Leu Gly His Gly Leu Ile Asp Asp Ile
Arg Glu Ala Arg225 230 235 240Thr Arg Thr Ser Gly Cys Leu Glu Val
Val Ala Gly Arg Ala Tyr Arg 245 250 255Leu Ala Tyr Leu Gly Ser Leu
Tyr Arg Cys Gly Pro Ala Ala Leu Ser 260 265 270Val Ala Arg Ala Ser
Ala Val Leu Gly Glu Ser Val Glu Leu Thr Leu 275 280 285Val Gln Arg
Met Thr Gly Leu Asp Thr Glu Ala Val Glu Gln Ala His 290 295 300Glu
Gln Leu Val Glu Gly Arg Leu Leu Arg Glu Gly Arg Phe Pro His305 310
315 320Pro Ala Ala Arg Ser Val Val Leu Asp Asp Leu Ser Ala Ala Glu
Arg 325 330 335Arg Gly Leu His Glu Leu Ala Leu Glu Leu Leu Arg Asp
Arg Gly Val 340 345 350Ala Ser Lys Val Leu Ala Arg His Gln Met Gly
Thr Gly Arg Val His 355 360 365Gly Ala Glu Val Ala Gly Leu Phe Thr
Asp Ala Ala Arg Glu His His 370 375 380Leu Arg Gly Glu Leu Asp Glu
Ala Val Thr Tyr Leu Glu Phe Ala Tyr385 390 395 400Arg Ala Ser Asp
Asp Pro Ala Val His Ala Ala Leu Arg Val Asp Thr 405 410 415Ala Ala
Ile Glu Arg Leu Cys Asp Pro Ala Arg Ser Gly Arg His Val 420 425
430Pro Glu Leu Leu Thr Ala Ser Arg Glu Arg Leu Leu Ser Ser Glu His
435 440 445Ala Val Ser Leu Ala Cys Trp Leu Ala Met Asp Gly Arg Pro
Gly Glu 450 455 460Ala Ala Glu Val Leu Ala Ala Gln Arg Ser Ala Ala
Pro Ser Glu Gln465 470 475 480Gly Arg Ala His Leu Arg Val Ala Asp
Leu Ser Leu Ala Leu Ile Tyr 485 490 495Pro Gly Ala Ala Asp Pro Pro
Arg Pro Ala Asp Pro Pro Ala Glu Asp 500 505 510Glu Val Ala Ser Phe
Ser Gly Ala Val Arg His Arg Ala Val Ala Asp 515 520 525Lys Ala Leu
Ser Asn Ala Leu Arg Gly Trp Ser Glu Gln Ala Glu Ala 530 535 540Lys
Ala Glu Tyr Val Leu Gln His Ser Arg Val Thr Thr Asp Arg Thr545 550
555 560Thr Thr Met Met Ala Leu Leu Ala Leu Leu Tyr Ala Glu Asp Thr
Asp 565 570 575Ala Val Gln Ser Trp Val Asp Lys Leu Ala Gly Asp Asp
Asn Met Arg 580 585 590Thr Pro Ala Asp Glu Ala Val His Ala Gly Phe
Arg Ala Glu Ala Ala 595 600 605Leu Arg Arg Gly Asp Leu Thr Ala Ala
Val Glu Cys Gly Glu Ala Ala 610 615 620Leu Ala Pro Arg Val Val Pro
Ser Trp Gly Met Ala Ala Ala Leu Pro625 630 635 640Leu Ser Ser Thr
Val Ala Ala Ala Ile Arg Leu Gly Asp Leu Asp Arg 645 650 655Ala Glu
Arg Trp Leu Ala Glu Pro Leu Pro Glu Glu Thr Ser Asp Ser 660 665
670Leu Phe Gly Leu His Met Val Trp Ala Arg Gly Gln His His Leu Ala
675 680 685Ala Gly Arg Tyr Arg Ala Ala Tyr Asn Ala Phe Arg Asp Cys
Gly Glu 690 695 700Arg Met Arg Arg Trp Ser Val Asp Val Pro Gly Leu
Ala Leu Trp Arg705 710 715 720Val Asp Ala Ala Glu Ala Leu Leu Leu
Leu Gly Arg Gly Arg Asp Glu 725 730 735Gly Leu Arg Leu Ile Ser Glu
Gln Leu Ser Arg Pro Met Gly Ser Arg 740 745 750Ala Arg Val Met Thr
Leu Arg Val Gln Ala Ala Tyr Ser Pro Pro Ala 755 760 765Lys Arg Ile
Glu Leu Leu Asp Glu Ala Ala Asp Leu Leu Ile Met Cys 770 775 780Arg
Asp Gln Tyr Glu Leu Ala Arg Val Leu Ala Asp Met Gly Glu Ala785 790
795 800Cys Gly Met Leu Arg Arg His Ser Arg Ala Arg Gly Leu Phe Arg
Arg 805 810 815Ala Arg His Leu Ala Thr Gln Cys Gly Ala Val Pro Leu
Leu Arg Arg 820 825 830Leu Gly Gly Glu Ser Ser Asp Ala Asp Gly Thr
Gln Asp Val Thr Pro 835 840 845Ala Gln Arg Ile Thr Ser Leu Thr Glu
Ala Glu Arg Arg Val Ala Ser 850 855 860His Ala Ala Val Gly Arg Thr
Asn Lys Glu Ile Ala Ser Gln Leu Phe865 870 875 880Val Thr Ser Ser
Thr Val Glu Gln His Leu Thr Asn Val Phe Arg Lys 885 890 895Leu Gly
Val Lys Gly Arg Gln Gln Leu Pro Lys Glu Leu Ser Asp Ala 900 905
910Gly29901PRTMicromonospora sp. S92-306401 29Met Glu Phe Tyr Asp
Leu Val Ala Arg Asp Asp Glu Leu Arg Arg Leu1 5 10 15Asp Gln Ala Leu
Gly Arg Ala Ala Gly Gly Arg Gly Val Val Val Thr 20 25 30Val Thr Gly
Pro Val Gly Cys Gly Lys Thr Glu Leu Leu Asp Ala Ala 35 40 45Ala Ala
Glu Glu Glu Phe Ile Thr Leu Arg Ala Val Cys Ser Ala Glu 50 55 60Glu
Arg Ala Leu Pro Tyr Ala Val Ile Gly Gln Leu Leu Asp His Pro65 70 75
80Val Leu Ser Ala Arg Ala Pro Asp Leu Ala Cys Val Thr Ala Pro Gly
85 90 95Arg Thr Leu Pro Ala Asp Thr Glu Asn Arg Leu Arg Arg Asp Leu
Thr 100 105 110Arg Ala Leu Leu Ala Leu Ala Ser Glu Arg Pro Val Leu
Ile Cys Ile 115 120 125Asp Asp Val His Gln Ala Asp Thr Ala Ser Leu
Asn Cys Leu Leu His 130 135 140Leu Ala Arg Arg Val Ala Ser Ala Arg
Ile Ala Met Ile Leu Thr Glu145 150 155 160Leu Arg Arg Leu Thr Pro
Ala His Ser Arg Phe Glu Ala Glu Leu Leu 165 170 175Ser Leu Arg His
Arg His Glu Ile Ala Leu Arg Pro Leu Gly Pro Ala 180 185 190Asp Thr
Ala Glu Leu Ala Arg Ala Arg Leu Gly Ala Gly Val Thr Ala 195 200
205Asp Glu Leu Ala Gln Val His Glu Ala Thr Ser Gly Asn Pro Asn Leu
210 215 220Val Gly Gly Leu Val Asn Asp Val Arg Glu Ala Trp Ala Ala
Gly Gly225 230 235 240Thr Gly Ile Ala Ala Gly Arg Ala Tyr Arg Leu
Ala Tyr Leu Ser Ser 245 250 255Val Tyr Arg Cys Gly Pro Val Pro Leu
Arg Ile Ala Gln Ala Ala Ala 260 265 270Val Leu Gly Pro Ser Ala Thr
Val Thr Leu Val Arg Arg Ile Ser Gly 275 280 285Leu Asp Ala Glu Thr
Val Asp Glu Ala Thr Ala Ile Leu Thr Glu Gly 290 295 300Gly Leu Leu
Arg Asp His Arg Phe Pro His Pro Ala Ala Arg Ser Val305 310 315
320Val Leu Asp Asp Met Ser Ala Gln Glu Arg Arg Arg Leu His Arg Ser
325 330 335Thr Leu Asp Val Leu Asp Gly Val Pro Val Asp Val Leu Ala
His His 340 345 350Gln Ala Gly Ala Gly Leu Leu His Gly Pro Gln Ala
Ala Glu Met Phe 355 360 365Ala Arg Ala Ser Gln Glu Leu Arg Val Arg
Gly Glu Leu Asp Ala Ala 370 375 380Thr Glu Tyr Leu Gln Leu Ala Tyr
Arg Ala Ser Asp Asp Ala Gly Ala385 390 395 400Arg Ala Ala Leu Gln
Val Glu Thr Val Ala Gly Glu Arg Arg Arg Asn 405 410 415Pro Leu Ala
Ala Ser Arg His Leu Asp Glu Leu Ala Ala Ala Ala Arg 420 425 430Ala
Gly Leu Leu Ser Ala Glu His Ala Ala Leu Val Val His Trp Leu 435 440
445Ala Asp Ala Gly Arg Pro Gly Glu Ala Ala Glu Val Leu Ala Leu Gln
450 455 460Arg Ala Leu Ala Val Thr Asp His Asp Arg Ala Arg Leu Arg
Ala Ala465 470 475 480Glu Val Ser Leu Ala Leu Phe His Pro Gly Val
Pro Gly Ser Asp Pro 485 490 495Arg Pro Leu Ala Pro Glu Glu Leu Ala
Ser Leu Ser Leu Ser Ala Arg 500 505 510His Gly Val Thr Ala Asp Asn
Ala Val Leu Ala Ala Leu Arg Gly Arg 515 520 525Pro Glu Ser Ala Ala
Ala Glu Ala Glu Asn Val Leu Arg Asn Ala Asp 530 535 540Ala Ala Ala
Ser Gly Pro Thr Ala Leu Ala Ala Leu Thr Ala Leu Leu545 550 555
560Tyr Ala Glu Asn Thr Asp Ala Ala Gln Leu Trp Ala Asp Lys Leu Ala
565 570 575Ala Gly Ile Gly Ala Gly Glu Gly Glu Ala Gly Tyr Ala Gly
Pro Arg 580 585 590Thr Val Ala Ala Leu Arg Arg Gly Asp Leu Thr Thr
Ala Val Gln Ala 595 600 605Ala Gly Ala Val Leu Asp Arg Gly Arg Pro
Ser Ser Leu Gly Ile Thr 610 615 620Ala Val Leu Pro Leu Ser Gly Ala
Val Ala Ala Ala Ile Arg Leu Gly625 630 635 640Glu Leu Glu Arg Ala
Glu Lys Trp Leu Ala Glu Pro Leu Pro Glu Ala 645 650 655Val His Asp
Ser Leu Phe Gly Leu His Leu Leu Met Ala Arg Gly Arg 660 665 670Tyr
Ser Leu Ala Val Gly Arg His Glu Ala Ala Tyr Ala Ala Phe Arg 675 680
685Asp Cys Gly Glu Arg Met Arg Arg Trp Asp Val Asp Val Pro Gly Leu
690 695 700Ala Leu Trp Arg Val Asp Ala Ala Glu Ala Leu Leu Pro Gly
Asp Asp705 710 715 720Arg Ala Glu Gly Arg Arg Leu Ile Asp Glu Gln
Leu Thr Arg Pro Met 725 730 735Gly Pro Arg Ser Arg Ala Leu Thr Leu
Arg Val Arg Ala Ala Tyr Ala 740 745 750Pro Pro Ala Lys Arg Ile Asp
Leu Leu Asp Glu Ala Ala Asp Leu Leu 755 760 765Leu Ser Ser Asn Asp
Gln Tyr Glu Arg Ala Arg Val Leu Ala Asp Leu 770 775 780Ser Glu Ala
Phe Ser Ala Leu Arg Gln Asn Gly Arg Ala Arg Gly Ile785 790 795
800Leu Arg Gln Ala Arg His Leu Ala Ala Gln Cys Gly Ala Val Pro Leu
805 810 815Leu Arg Arg Leu Gly Val Lys Ala Gly Arg Ser Gly Arg Leu
Gly Arg 820 825 830Pro Pro Gln Gly Ile Arg Ser Leu Thr Glu Ala Glu
Arg Arg Val Ala 835 840 845Thr Leu Ala Ala Ala Gly Gln Thr Asn Arg
Glu Ile Ala Asp Gln Leu 850 855 860Phe Val Thr Ala Ser Thr Val Glu
Gln His Leu Thr Asn Val Phe Arg865 870 875 880Lys Leu Gly Val Lys
Gly Arg Gln Gln Leu Pro Ala Glu Leu Ala Asp 885 890 895Leu Arg Pro
Pro Gly 90030906PRTStreptomyces violaceusniger 30Met Tyr Ser Gly
Thr Cys Arg Glu Gly Tyr Glu Leu Val Ala Arg Glu1 5 10 15Asp Glu Leu
Gly Ile Leu Gln Arg Ser Leu Glu Gln Ala Ser Ser Gly 20 25 30Gln Gly
Val Val Val Thr Val Thr Gly Pro Ile Ala Cys Gly Lys Thr 35 40 45Glu
Leu Leu Asp Ala Ala Ala Ala Lys Ala Glu Ala Ile Ile Leu Arg 50 55
60Ala Val Cys Ala Pro Glu Glu Arg Ala Met Pro Tyr Ala Met Ile Gly65
70 75 80Gln Leu Ile Asp Asp Pro Ala Leu Ala His Arg Ala Pro Gly Leu
Ala 85 90 95Asp Arg Ile Ala Gln Gly Gly Gln Leu Ser Leu Arg Ala Glu
Asn Arg 100 105 110Leu Arg Arg Asp Leu Thr Arg Ala Leu Leu Ala Leu
Ala Val Asp Arg 115 120 125Pro Val Leu Ile Gly Val Asp Asp Val His
His Ala Asp Thr Ala Ser 130 135 140Leu Asn Cys Leu Leu His Leu Ala
Arg Arg Val Arg Pro Ala Arg Ile145 150 155 160Ser Met Ile Phe Thr
Glu Leu Arg Ser Leu Thr Pro Thr Gln Ser Arg 165 170 175Phe Lys Ala
Glu Leu Leu Ser Leu Pro Tyr His His Glu Ile Ala Leu 180 185 190Arg
Pro Phe Gly Pro Glu Gln Ser Ala Glu Leu Ala Arg Ala Ala Phe 195 200
205Gly Pro Gly Leu Ala Glu Asp Val Leu Val Gly Leu Tyr Lys Thr Thr
210
215 220Arg Gly Asn Leu Ser Leu Ser Arg Gly Leu Ile Ser Asp Val Arg
Glu225 230 235 240Ala Leu Ala Asn Gly Glu Ser Ala Phe Glu Ala Gly
Arg Ala Phe Arg 245 250 255Leu Ala Tyr Leu Gly Ser Leu Tyr Arg Cys
Gly Pro Val Ala Leu Arg 260 265 270Val Ala Arg Val Ala Ala Val Leu
Gly Pro Ser Ala Thr Thr Thr Leu 275 280 285Val Arg Arg Leu Ser Gly
Leu Ser Ala Glu Thr Ile Asp Arg Ala Thr 290 295 300Lys Ile Leu Thr
Glu Gly Gly Leu Leu Leu Asp Gln Gln Phe Pro His305 310 315 320Pro
Ala Ala Arg Ser Val Val Leu Asp Asp Met Ser Ala Gln Glu Arg 325 330
335Arg Gly Leu His Thr Leu Ala Leu Glu Leu Leu Asp Glu Ala Pro Val
340 345 350Glu Val Leu Ala His His Gln Val Gly Ala Gly Leu Ile His
Gly Pro 355 360 365Lys Ala Ala Glu Met Phe Ala Lys Ala Gly Lys Ala
Leu Val Val Arg 370 375 380Asn Glu Leu Gly Asp Ala Ala Glu Tyr Leu
Gln Leu Ala His Arg Ala385 390 395 400Ser Asp Asp Val Ser Thr Arg
Ala Ala Leu Arg Val Glu Ala Val Ala 405 410 415Ile Glu Arg Arg Arg
Asn Pro Leu Ala Ser Ser Arg His Met Asp Glu 420 425 430Leu Ser Ala
Ala Gly Arg Ala Gly Leu Leu Ser Pro Lys His Ala Ala 435 440 445Leu
Ala Val Phe Trp Leu Ala Asp Gly Gly Arg Ser Gly Glu Ala Ala 450 455
460Glu Val Leu Ala Ser Glu Arg Pro Leu Ala Thr Thr Asp Gln Asn
Arg465 470 475 480Ala His Leu Arg Phe Val Glu Val Thr Leu Ala Leu
Phe Ser Pro Gly 485 490 495Ala Phe Gly Ser Asp Arg Arg Pro Pro Pro
Leu Thr Pro Asp Glu Leu 500 505 510Ala Ser Leu Pro Lys Ala Ala Trp
Gln Cys Ala Val Ala Asp Asn Ala 515 520 525Ala Met Thr Ala Leu His
Gly His Pro Glu Leu Ala Thr Ala Gln Ala 530 535 540Glu Thr Val Leu
Arg Gln Ala Asp Ser Ala Ala Asp Ala Ile Pro Ala545 550 555 560Ala
Leu Ile Ala Leu Leu Tyr Ala Glu Asn Thr Glu Ser Ala His Ile 565 570
575Trp Ala Asp Lys Leu Gly Ser Thr Asn Gly Gly Val Ser Asn Glu Ala
580 585 590Glu Ala Gly Tyr Ala Gly Pro Cys Ala Glu Ile Ala Leu Arg
Arg Gly 595 600 605Asp Leu Ala Thr Ala Phe Glu Ala Gly Ser Thr Val
Leu Asp Asp Arg 610 615 620Ser Leu Pro Ser Leu Gly Ile Thr Ala Ala
Leu Leu Leu Ser Ser Lys625 630 635 640Thr Ala Ala Ala Val Arg Leu
Gly Glu Leu Glu Arg Ala Glu Lys Leu 645 650 655Leu Ala Glu Pro Leu
Pro Asn Gly Val Gln Asp Ser Leu Phe Gly Leu 660 665 670His Leu Leu
Ser Ala Tyr Gly Gln Tyr Ser Leu Ala Met Gly Arg Tyr 675 680 685Glu
Ser Ala Leu Arg Ala Phe His Thr Cys Gly Glu Arg Met Arg Ser 690 695
700Trp Asp Val Asp Val Pro Gly Leu Ala Leu Trp Arg Val Asp Ala
Ala705 710 715 720Glu Ala Leu Leu Ser Leu Asp Arg Asn Glu Gly Gln
Arg Leu Ile Asp 725 730 735Glu Gln Leu Thr Arg Pro Met Gly Pro Arg
Ser Arg Ala Leu Thr Leu 740 745 750Arg Ile Lys Ala Ala Tyr Leu Pro
Arg Thr Lys Arg Ile Pro Leu Leu 755 760 765His Glu Ala Ala Glu Leu
Leu Leu Pro Cys Pro Asp Pro Tyr Glu Gln 770 775 780Ala Arg Val Leu
Ala Asp Leu Gly Asp Thr Leu Ser Ala Leu Arg Arg785 790 795 800Tyr
Ser Arg Ala Arg Gly Val Leu Arg Gln Ala Arg His Leu Ala Ala 805 810
815Gln Cys Gly Ala Val Pro Leu Leu Arg Arg Leu Gly Gly Glu Pro Gly
820 825 830Arg Ile Asp Asp Ala Gly Leu Pro Gln Arg Ser Thr Ser Leu
Thr Asp 835 840 845Ala Glu Arg Arg Val Ala Ala Leu Ala Ala Ala Gly
Gln Thr Asn Arg 850 855 860Glu Ile Ala Lys Gln Leu Phe Val Thr Ala
Ser Thr Val Glu Gln His865 870 875 880Leu Thr Ser Val Phe Arg Lys
Leu Gly Val Lys Gly Arg Lys Gln Leu 885 890 895Pro Thr Ala Leu Ala
Asp Val Glu Gln Thr 900 90531914PRTStreptomyces hygroscopicus 31Met
Pro Ala Val Glu Ser Tyr Glu Leu Asp Ala Arg Asp Asp Glu Leu1 5 10
15Arg Arg Leu Glu Glu Ala Val Gly Gln Ala Gly Asn Gly Arg Gly Val
20 25 30Val Val Thr Ile Thr Gly Pro Ile Ala Cys Gly Lys Thr Glu Leu
Leu 35 40 45Asp Ala Ala Ala Ala Lys Ser Asp Ala Ile Thr Leu Arg Ala
Val Cys 50 55 60Ser Glu Glu Glu Arg Ala Leu Pro Tyr Ala Leu Ile Gly
Gln Leu Ile65 70 75 80Asp Asn Pro Ala Val Ala Ser Gln Leu Pro Asp
Pro Val Ser Met Ala 85 90 95Leu Pro Gly Glu His Leu Ser Pro Glu Ala
Glu Asn Arg Leu Arg Gly 100 105 110Asp Leu Thr Arg Thr Leu Leu Ala
Leu Ala Ala Glu Arg Pro Val Leu 115 120 125Ile Gly Ile Asp Asp Met
His His Ala Asp Thr Ala Ser Leu Asn Cys 130 135 140Leu Leu His Leu
Ala Arg Arg Val Gly Pro Ala Arg Ile Ala Met Val145 150 155 160Leu
Thr Glu Leu Arg Arg Leu Thr Pro Ala His Ser Gln Phe His Ala 165 170
175Glu Leu Leu Ser Leu Gly His His Arg Glu Ile Ala Leu Arg Pro Leu
180 185 190Gly Pro Lys His Ile Ala Glu Leu Ala Arg Ala Gly Leu Gly
Pro Asp 195 200 205Val Asp Glu Asp Val Leu Thr Gly Leu Tyr Arg Ala
Thr Gly Gly Asn 210 215 220Leu Asn Leu Gly His Gly Leu Ile Lys Asp
Val Arg Glu Ala Trp Ala225 230 235 240Thr Gly Gly Thr Gly Ile Asn
Ala Gly Arg Ala Tyr Arg Leu Ala Tyr 245 250 255Leu Gly Ser Leu Tyr
Arg Cys Gly Pro Val Pro Leu Arg Val Ala Arg 260 265 270Val Ala Ala
Val Leu Gly Gln Ser Ala Asn Thr Thr Leu Val Arg Trp 275 280 285Ile
Ser Gly Leu Asn Ala Asp Ala Val Gly Glu Ala Thr Glu Ile Leu 290 295
300Thr Glu Gly Gly Leu Leu His Asp Leu Arg Phe Pro His Pro Ala
Ala305 310 315 320Arg Ser Val Val Leu Asn Asp Leu Ser Ala Arg Glu
Arg Arg Arg Leu 325 330 335His Arg Ser Ala Leu Glu Val Leu Asp Asp
Val Pro Val Glu Val Val 340 345 350Ala His His Gln Ala Gly Ala Gly
Phe Ile His Gly Pro Lys Ala Ala 355 360 365Glu Ile Phe Ala Lys Ala
Gly Gln Glu Leu His Val Arg Gly Glu Leu 370 375 380Asp Ala Ala Ser
Asp Tyr Leu Gln Leu Ala His His Ala Ser Asp Asp385 390 395 400Ala
Val Thr Arg Ala Ala Leu Arg Val Glu Ala Val Ala Ile Glu Arg 405 410
415Arg Arg Asn Pro Leu Ala Ser Ser Arg His Leu Asp Glu Leu Thr Val
420 425 430Ala Ala Arg Ala Gly Leu Leu Ser Leu Glu His Ala Ala Leu
Met Ile 435 440 445Arg Trp Leu Ala Leu Gly Gly Arg Ser Gly Glu Ala
Ala Glu Val Leu 450 455 460Ala Ala Gln Arg Pro Arg Ala Val Thr Asp
Gln Asp Arg Ala His Leu465 470 475 480Arg Ala Ala Glu Val Ser Leu
Ala Leu Val Ser Pro Gly Ala Ser Gly 485 490 495Val Ser Pro Gly Ala
Ser Gly Pro Asp Arg Arg Pro Arg Pro Leu Pro 500 505 510Pro Asp Glu
Leu Ala Asn Leu Pro Lys Ala Ala Arg Leu Cys Ala Ile 515 520 525Ala
Asp Asn Ala Val Ile Ser Ala Leu His Gly Arg Pro Glu Leu Ala 530 535
540Ser Ala Glu Ala Glu Asn Val Leu Lys Gln Ala Asp Ser Ala Ala
Asp545 550 555 560Gly Ala Thr Ala Leu Ser Ala Leu Thr Ala Leu Leu
Tyr Ala Glu Asn 565 570 575Thr Asp Thr Ala Gln Leu Trp Ala Asp Lys
Leu Val Ser Glu Thr Gly 580 585 590Ala Ser Asn Glu Glu Glu Gly Ala
Gly Tyr Ala Gly Pro Arg Ala Glu 595 600 605Thr Ala Leu Arg Arg Gly
Asp Leu Ala Ala Ala Val Glu Ala Gly Ser 610 615 620Ala Ile Leu Asp
His Arg Arg Gly Ser Leu Leu Gly Ile Thr Ala Ala625 630 635 640Leu
Pro Leu Ser Ser Ala Val Ala Ala Ala Ile Arg Leu Gly Glu Thr 645 650
655Glu Arg Ala Glu Lys Trp Leu Ala Glu Pro Leu Pro Glu Ala Ile Arg
660 665 670Asp Ser Leu Phe Gly Leu His Leu Leu Ser Ala Arg Gly Gln
Tyr Cys 675 680 685Leu Ala Thr Gly Arg His Glu Ser Ala Tyr Thr Ala
Phe Arg Thr Cys 690 695 700Gly Glu Arg Met Arg Asn Trp Gly Val Asp
Val Pro Gly Leu Ser Leu705 710 715 720Trp Arg Val Asp Ala Ala Glu
Ala Leu Leu His Gly Arg Asp Arg Asp 725 730 735Glu Gly Arg Arg Leu
Ile Asp Glu Gln Leu Thr His Ala Met Gly Pro 740 745 750Arg Ser Arg
Ala Leu Thr Leu Arg Val Gln Ala Ala Tyr Ser Pro Gln 755 760 765Ala
Gln Arg Val Asp Leu Leu Glu Glu Ala Ala Asp Leu Leu Leu Ser 770 775
780Cys Asn Asp Gln Tyr Glu Arg Ala Arg Val Leu Ala Asp Leu Ser
Glu785 790 795 800Ala Phe Ser Ala Leu Arg His His Ser Arg Ala Arg
Gly Leu Leu Arg 805 810 815Gln Ala Arg His Leu Ala Ala Gln Cys Gly
Ala Thr Pro Leu Leu Arg 820 825 830Arg Leu Gly Ala Lys Pro Gly Gly
Pro Gly Trp Leu Glu Glu Ser Gly 835 840 845Leu Pro Gln Arg Ile Lys
Ser Leu Thr Asp Ala Glu Arg Arg Val Ala 850 855 860Ser Leu Ala Ala
Gly Gly Gln Thr Asn Arg Val Ile Ala Asp Gln Leu865 870 875 880Phe
Val Thr Ala Ser Thr Val Glu Gln His Leu Thr Asn Val Phe Arg 885 890
895Lys Leu Gly Val Lys Gly Arg Gln His Leu Pro Ala Glu Leu Ala Asn
900 905 910Ala Glu32875PRTActinoplanes sp. N01-109 32Met Pro Ala
Val Lys Arg Asn Asp Leu Val Ala Arg Asp Gly Glu Leu1 5 10 15Arg Trp
Met Gln Glu Ile Leu Ser Gln Ala Ser Glu Gly Arg Gly Ala 20 25 30Val
Val Thr Ile Thr Gly Ala Ile Ala Cys Gly Lys Thr Val Leu Leu 35 40
45Asp Ala Ala Ala Ala Ser Gln Asp Val Ile Gln Leu Arg Ala Val Cys
50 55 60Ser Ala Glu Glu Gln Glu Leu Pro Tyr Ala Met Val Gly Gln Leu
Leu65 70 75 80Asp Asn Pro Val Leu Ala Ala Arg Val Pro Ala Leu Gly
Asn Leu Ala 85 90 95Ala Ala Gly Glu Arg Leu Leu Pro Gly Thr Glu Asn
Arg Ile Arg Arg 100 105 110Glu Leu Thr Arg Thr Leu Leu Ala Leu Ala
Asp Glu Arg Pro Val Leu 115 120 125Ile Gly Val Asp Asp Met His His
Ala Asp Pro Ala Ser Leu Asp Cys 130 135 140Leu Leu His Leu Ala Arg
Arg Val Gly Pro Ala Arg Ile Ala Ile Val145 150 155 160Leu Thr Glu
Leu Arg Arg Leu Thr Pro Ala His Ser Arg Phe Gln Ser 165 170 175Glu
Leu Leu Ser Leu Arg Tyr His His Glu Ile Gly Leu Gln Pro Leu 180 185
190Thr Ala Glu His Thr Ala Asp Leu Ala Arg Val Gly Leu Gly Ala Glu
195 200 205Val Asp Asp Asp Val Leu Thr Glu Leu Tyr Glu Ala Thr Gly
Gly Asn 210 215 220Pro Ser Leu Cys Cys Gly Leu Ile Arg Asp Val Arg
Gln Asp Trp Glu225 230 235 240Ala Gly Val Thr Gly Ile His Val Gly
Arg Ala Tyr Arg Leu Ala Tyr 245 250 255Leu Ser Ser Leu Tyr Arg Cys
Gly Pro Ala Ala Leu Arg Thr Ala Arg 260 265 270Ala Ala Ala Val Leu
Gly Asp Ser Ala Asp Ala Cys Leu Ile Arg Arg 275 280 285Val Ser Gly
Leu Gly Thr Glu Ala Val Gly Gln Ala Ile Gln Gln Leu 290 295 300Thr
Glu Gly Gly Leu Leu Arg Asp Gln Gln Phe Pro His Pro Ala Ala305 310
315 320Arg Ser Val Val Leu Asp Asp Met Ser Ala Gln Glu Arg His Ala
Met 325 330 335Tyr Arg Ser Ala Arg Glu Ala Ala Ala Glu Gly Gln Ala
Asp Pro Gly 340 345 350Thr Pro Gly Glu Pro Arg Ala Ala Thr Ala Tyr
Ala Gly Cys Gly Glu 355 360 365Gln Ala Gly Asp Tyr Pro Glu Pro Ala
Gly Arg Ala Cys Val Asp Gly 370 375 380Ala Gly Pro Ala Glu Tyr Cys
Gly Asp Pro His Gly Ala Asp Asp Asp385 390 395 400Pro Asp Glu Leu
Val Ala Ala Leu Gly Gly Leu Leu Pro Ser Arg Leu 405 410 415Val Ala
Met Lys Ile Arg Arg Leu Ala Val Ala Gly Arg Pro Gly Ala 420 425
430Ala Ala Glu Leu Leu Thr Ser Gln Arg Leu His Ala Val Thr Ser Glu
435 440 445Asp Arg Ala Ser Leu Arg Ala Ala Glu Val Ala Leu Ala Thr
Leu Trp 450 455 460Pro Gly Ala Thr Gly Pro Asp Arg His Pro Leu Thr
Glu Gln Glu Ala465 470 475 480Ala Ser Leu Pro Glu Gly Pro Arg Leu
Leu Ala Ala Ala Asp Asp Ala 485 490 495Val Gly Ala Ala Leu Arg Gly
Arg Ala Glu Tyr Ala Ala Ala Glu Ala 500 505 510Glu Asn Val Leu Arg
His Ala Asp Pro Ala Ala Gly Gly Asp Ala Tyr 515 520 525Ala Ala Met
Ile Ala Leu Leu Tyr Thr Glu His Pro Glu Asn Val Leu 530 535 540Phe
Trp Ala Asp Lys Leu Asp Ala Gly Arg Pro Asp Glu Glu Thr Ser545 550
555 560Tyr Pro Gly Leu Arg Ala Glu Thr Ala Val Arg Leu Gly Asp Leu
Glu 565 570 575Thr Ala Met Glu Leu Gly Arg Thr Val Leu Asp Gln Arg
Arg Leu Pro 580 585 590Ser Leu Gly Val Ala Ala Gly Leu Leu Leu Gly
Gly Ala Val Thr Ala 595 600 605Ala Ile Arg Leu Gly Asp Leu Asp Arg
Ala Glu Lys Trp Leu Ala Glu 610 615 620Pro Ile Pro Asp Ala Ile Arg
Thr Ser Leu Tyr Gly Leu His Val Leu625 630 635 640Ala Ala Arg Gly
Arg Leu Asp Leu Ala Ala Gly Arg Tyr Glu Ala Ala 645 650 655Tyr Thr
Ala Phe Arg Leu Cys Gly Glu Arg Met Ala Gly Trp Asp Ala 660 665
670Asp Val Ser Gly Leu Ala Leu Trp Arg Val Asp Ala Ala Glu Ala Leu
675 680 685Leu Ser Ala Gly Ile Arg Pro Asp Glu Gly Arg Lys Leu Ile
Asp Asp 690 695 700Gln Leu Thr Arg Glu Met Gly Ala Arg Ser Arg Ala
Leu Thr Leu Arg705 710 715 720Ala Gln Ala Ala Tyr Ser Leu Pro Val
His Arg Val Gly Leu Leu Asp 725 730 735Glu Ala Ala Gly Leu Leu Leu
Ala Cys His Asp Gly Tyr Glu Arg Ala 740 745 750Arg Val Leu Ala Asp
Leu Gly Glu Thr Leu Arg Thr Leu Arg His Thr 755 760 765Asp Ala Ala
Gln Arg Val Leu Arg Gln Ala Glu Gln Ala Ala Ala Arg 770 775 780Cys
Gly Ser Val Pro Leu Leu Arg Arg Leu Gly Ala Glu Pro Val Arg785 790
795 800Ile Gly Thr Arg Arg Gly Glu Pro Gly Leu Pro Gln Arg Ile Arg
Leu 805 810 815Leu Thr Asp Ala Glu Arg Arg Val Ala Ala Met Ala Ala
Ala Gly Gln 820 825 830Thr Asn Arg Glu Ile Ala Gly Arg Leu Phe Val
Thr Ala Ser Thr Val 835 840 845Glu Gln His Leu Thr Ser Val Phe Arg
Lys Leu Gly Val Lys Gly Arg 850 855
860Arg Phe Leu Pro Thr Glu Leu Ala Gln Ala Val865 870
87533906PRTStreptomyces malaysiensis 33Met Tyr Ser Gly Thr Cys Arg
Glu Gly Tyr Glu Leu Val Ala Arg Glu1 5 10 15Asp Glu Leu Gly Ile Leu
Gln Arg Ser Leu Glu Gln Ala Ser Ser Gly 20 25 30Gln Gly Val Val Val
Thr Val Thr Gly Pro Ile Ala Cys Gly Lys Thr 35 40 45Glu Leu Leu Asp
Ala Ala Ala Ala Lys Ala Glu Ala Ile Ile Leu Arg 50 55 60Ala Val Cys
Ala Pro Glu Glu Arg Ala Met Pro Tyr Ala Met Ile Gly65 70 75 80Gln
Leu Ile Asp Asp Pro Ala Leu Ala His Arg Ala Pro Gly Leu Ala 85 90
95Asp Arg Ile Ala Gln Gly Gly Gln Leu Ser Leu Arg Ala Glu Asn Arg
100 105 110Leu Arg Arg Asp Leu Thr Arg Ala Leu Leu Ala Leu Ala Val
Asp Arg 115 120 125Pro Val Leu Ile Gly Val Asp Asp Val His His Ala
Asp Thr Ala Ser 130 135 140Leu Asn Cys Leu Leu His Leu Ala Arg Arg
Val Arg Pro Ala Arg Ile145 150 155 160Ser Met Ile Phe Thr Glu Leu
Arg Ser Leu Thr Pro Thr Gln Ser Arg 165 170 175Phe Lys Ala Glu Leu
Leu Ser Leu Pro Tyr His His Glu Ile Ala Leu 180 185 190Arg Pro Phe
Gly Pro Glu Gln Ser Ala Glu Leu Ala Arg Ala Ala Phe 195 200 205Gly
Pro Gly Leu Ala Glu Asp Val Leu Ala Gly Leu Tyr Lys Thr Thr 210 215
220Arg Gly Asn Leu Ser Leu Ser Arg Gly Leu Ile Ser Asp Val Arg
Glu225 230 235 240Ala Leu Ala Asn Gly Glu Ser Ala Phe Glu Ala Gly
Arg Ala Phe Arg 245 250 255Leu Ala Tyr Leu Ser Ser Leu Tyr Arg Cys
Gly Pro Val Ala Leu Arg 260 265 270Val Ala Arg Val Ala Ala Val Leu
Gly Pro Ser Ala Thr Thr Thr Leu 275 280 285Val Arg Arg Leu Ser Gly
Leu Ser Ala Glu Thr Ile Asp Arg Ala Thr 290 295 300Lys Ile Leu Thr
Glu Gly Gly Leu Leu Leu Asp Gln Gln Phe Pro His305 310 315 320Pro
Ala Ala Arg Ser Val Val Leu Asp Asp Met Ser Ala Gln Glu Arg 325 330
335Arg Ser Leu His Thr Leu Ala Leu Glu Leu Leu Asp Glu Ala Pro Val
340 345 350Glu Val Leu Ala His His Gln Val Gly Ala Gly Leu Ile His
Gly Pro 355 360 365Lys Ala Ala Glu Met Phe Ala Lys Ala Gly Lys Ala
Leu Val Val Arg 370 375 380Asn Glu Leu Gly Asp Ala Ala Glu Tyr Leu
Gln Leu Ala His Arg Ala385 390 395 400Ser Asp Asp Val Ser Thr Arg
Ala Ala Leu Arg Val Glu Ala Val Ala 405 410 415Ile Glu Arg Arg Arg
Asn Pro Leu Ala Ser Ser Arg His Met Asp Glu 420 425 430Leu Ser Ala
Ala Gly Arg Ala Gly Leu Leu Ser Pro Lys His Ala Ala 435 440 445Leu
Ala Val Phe Trp Leu Ala Asp Gly Gly Arg Ser Gly Glu Ala Ala 450 455
460Glu Val Leu Ala Ser Glu Arg Pro Leu Ala Thr Thr Asp Gln Asn
Arg465 470 475 480Ala His Leu Arg Phe Val Glu Val Thr Leu Ala Leu
Phe Ser Pro Gly 485 490 495Ala Phe Gly Ser Asp Arg Arg Pro Pro Pro
Leu Thr Pro Asp Glu Leu 500 505 510Ala Ser Leu Pro Lys Ala Ala Trp
Gln Cys Ala Val Ala Asp Asn Ala 515 520 525Ala Met Thr Ala Leu His
Gly His Pro Glu Leu Ala Thr Ala Gln Ala 530 535 540Glu Thr Val Leu
Arg Gln Ala Asp Ser Ala Ala Asp Ala Ile Pro Ala545 550 555 560Ala
Leu Ile Ala Leu Leu Tyr Ala Glu Asn Thr Glu Ser Ala His Ile 565 570
575Trp Ala Asp Lys Leu Gly Ser Thr Asn Ala Gly Val Ser Asn Glu Ala
580 585 590Glu Ala Gly Tyr Ala Gly Pro Cys Ala Glu Ile Ala Leu Arg
Arg Gly 595 600 605Asp Leu Ala Thr Ala Phe Glu Ala Gly Ser Ala Val
Leu Asp Asp Arg 610 615 620Ser Leu Pro Ser Leu Gly Ile Thr Ala Ala
Leu Leu Leu Ser Ser Lys625 630 635 640Thr Ala Ala Ala Val Arg Leu
Gly Glu Leu Glu Arg Ala Glu Lys Leu 645 650 655Leu Ala Glu Pro Leu
Pro Asn Gly Val Gln Asp Ser Leu Phe Gly Leu 660 665 670His Leu Leu
Ser Ala Tyr Gly Gln Tyr Ser Leu Ala Met Gly Arg Tyr 675 680 685Glu
Ser Ala His Arg Ala Phe Arg Thr Cys Gly Glu Arg Met Arg Ser 690 695
700Trp Asp Val Asp Val Pro Gly Leu Ala Leu Trp Arg Val Asp Ala
Ala705 710 715 720Glu Ala Leu Leu Ser Leu Asp Arg Asn Glu Gly Gln
Arg Leu Ile Asp 725 730 735Glu Gln Leu Thr Arg Pro Met Gly Pro Arg
Ser His Ala Leu Thr Leu 740 745 750Arg Ile Lys Ala Ala Tyr Leu Pro
Arg Thr Lys Arg Ile Pro Leu Leu 755 760 765His Glu Ala Ala Glu Leu
Leu Leu Pro Cys Pro Asp Pro Tyr Glu Gln 770 775 780Ala Arg Val Leu
Ala Asp Leu Gly Asp Thr Leu Ser Ala Leu Arg Arg785 790 795 800Tyr
Ser Arg Ala Arg Gly Val Leu Arg Gln Ala Arg His Leu Ala Thr 805 810
815Gln Cys Gly Ala Val Pro Leu Leu Arg Arg Leu Gly Gly Glu Pro Gly
820 825 830Arg Ile Asp Asp Ala Gly Leu Pro Gln Arg Ser Thr Ser Leu
Thr Asp 835 840 845Ala Glu Arg Arg Val Ala Ala Leu Ala Ala Ala Gly
Gln Thr Asn Arg 850 855 860Glu Ile Ala Glu Gln Leu Phe Val Thr Ala
Ser Thr Val Glu Gln His865 870 875 880Leu Thr Ser Val Phe Arg Lys
Leu Gly Val Lys Gly Arg Lys Gln Leu 885 890 895Pro Thr Ala Leu Ala
Asp Val Glu Gln Thr 900 90534904PRTStreptomyces violaceusniger
34Met Tyr Ser Gly Thr Cys Arg Glu Gly Tyr Glu Leu Val Ala Arg Glu1
5 10 15Asp Glu Leu Gly Ile Leu Gln Arg Ser Leu Glu Glu Ala Gly Ser
Gly 20 25 30Gln Gly Ala Val Val Thr Val Thr Gly Pro Ile Ala Cys Gly
Lys Thr 35 40 45Glu Leu Leu Asp Ala Ala Ala Ala Lys Ala Asp Ala Ile
Ile Leu Arg 50 55 60Ala Val Cys Ala Pro Glu Glu Arg Ala Met Pro Tyr
Ala Met Ile Gly65 70 75 80Gln Leu Ile Asp Asp Pro Ala Leu Ala His
Arg Ala Pro Glu Leu Ala 85 90 95Asp Arg Ile Ala Gln Gly Gly His Leu
Ser Leu Arg Ala Glu Asn Arg 100 105 110Leu Arg Arg Asp Leu Thr Arg
Ala Leu Leu Ala Leu Ala Val Asp Arg 115 120 125Pro Val Leu Ile Gly
Val Asp Asp Val His His Ala Asp Thr Ala Ser 130 135 140Leu Asn Cys
Leu Leu His Leu Ala Arg Arg Val Arg Pro Ala Arg Ile145 150 155
160Ser Met Ile Phe Thr Glu Leu Arg Ser Leu Thr Pro Thr Gln Ser Arg
165 170 175Phe Lys Ala Glu Leu Leu Ser Leu Pro Tyr His His Glu Ile
Ala Leu 180 185 190Arg Pro Leu Gly Pro Glu Gln Ser Ala Glu Leu Ala
His Ala Ala Phe 195 200 205Gly Pro Gly Leu Ala Glu Asp Val Leu Ala
Gly Leu Tyr Gly Met Thr 210 215 220Arg Gly Asn Leu Ser Leu Ser Arg
Gly Leu Ile Ser Asp Val Arg Glu225 230 235 240Ala Gln Ala Asn Gly
Glu Ser Ala Phe Glu Val Gly Arg Ala Phe Arg 245 250 255Leu Ala Tyr
Leu Ser Ser Leu Tyr Arg Cys Gly Pro Ile Ala Leu Arg 260 265 270Val
Ala Arg Val Ala Ala Val Leu Gly Pro Ser Ala Thr Thr Thr Leu 275 280
285Val Arg Arg Leu Ser Gly Leu Ser Ala Glu Thr Ile Asp Arg Ala Thr
290 295 300Lys Ile Leu Thr Glu Gly Gly Leu Leu Leu Asp His Gln Phe
Pro His305 310 315 320Pro Ala Ala Arg Ser Val Val Leu Asp Asp Met
Ser Ala Gln Glu Arg 325 330 335Arg Ser Leu His Thr Leu Ala Leu Glu
Leu Leu Asp Glu Ala Pro Val 340 345 350Glu Val Leu Ala His His Gln
Val Gly Ala Gly Leu Ile His Gly Pro 355 360 365Lys Ala Ala Glu Ile
Phe Ala Arg Ala Gly Gln Ala Leu Val Val Arg 370 375 380Asn Glu Leu
Gly Asp Ala Ala Glu Tyr Leu Gln Leu Ala His Arg Ala385 390 395
400Ser Asp Asp Val Ser Thr Arg Ala Ala Leu Arg Val Glu Ala Val Ala
405 410 415Ile Glu Arg Arg Arg Asn Pro Leu Ala Ser Ser Arg His Met
Asp Glu 420 425 430Leu Ser Ala Ala Gly Arg Ala Gly Leu Leu Ser Pro
Lys His Ala Ala 435 440 445Leu Ala Val Phe Trp Leu Ala Asp Gly Gly
Arg Ser Gly Glu Ala Ala 450 455 460Glu Val Leu Ala Ser Glu His Pro
Leu Ala Thr Thr Asp Gln Asn Arg465 470 475 480Ala His Leu Arg Phe
Ala Glu Val Thr Leu Ala Leu Phe Cys Pro Gly 485 490 495Ala Phe Gly
Ser Asp Arg Arg Pro Pro Pro Leu Ala Pro Asp Glu Leu 500 505 510Ala
Ser Leu Pro Lys Ala Ala Trp Gln Cys Ala Val Ala Asp Asn Ala 515 520
525Val Met Thr Ala Leu His Ala His Pro Glu Leu Ala Thr Ala Gln Ala
530 535 540Glu Thr Val Leu Arg Gln Ala Asp Ser Ala Ala Asp Ala Ile
Pro Ala545 550 555 560Ala Leu Ile Ala Leu Leu Tyr Ala Glu Asn Thr
Glu Ser Ala Gln Ile 565 570 575Trp Ala Asp Lys Leu Gly Ser Thr Asn
Ala Gly Val Ser Asn Glu Ala 580 585 590Glu Ala Gly Tyr Ala Gly Pro
Cys Ala Glu Ile Ala Leu Arg Arg Gly 595 600 605Asp Leu Ala Thr Ala
Phe Glu Ala Gly Gly Thr Val Leu Asp Asp Arg 610 615 620Pro Leu Pro
Ser Leu Gly Ile Thr Ala Ala Leu Leu Leu Ser Ser Lys625 630 635
640Thr Ala Ala Ala Val Arg Leu Gly Glu Leu Glu Arg Ala Glu Lys Leu
645 650 655Leu Ala Glu Pro Leu Pro Asn Gly Val Gln Asp Ser Leu Phe
Gly Leu 660 665 670His Leu Leu Ser Ala His Gly Gln Tyr Ser Leu Ala
Met Gly Arg Tyr 675 680 685Glu Ser Ala His Arg Ala Phe His Thr Cys
Gly Glu Arg Met Arg Ser 690 695 700Trp Gly Val Asp Val Pro Gly Leu
Ala Leu Trp Arg Val Asp Ala Ala705 710 715 720Glu Ala Leu Leu Ser
Leu Asp Arg Asn Glu Gly Gln Arg Leu Ile Asp 725 730 735Glu Gln Leu
Ala Arg Pro Met Gly Pro Arg Ser Arg Ala Leu Thr Leu 740 745 750Arg
Ile Lys Ala Ala Tyr Leu Pro Arg Thr Lys Arg Ile Pro Leu Leu 755 760
765His Glu Ala Ala Glu Leu Leu Leu Ser Cys Pro Asp Pro Tyr Glu Gln
770 775 780Ala Arg Val Leu Ala Asp Leu Gly Asp Thr Leu Ser Ala Leu
Arg Arg785 790 795 800Tyr Ser Arg Ala Arg Gly Val Leu Arg Gln Ala
Arg His Leu Ala Thr 805 810 815Gln Cys Gly Ala Val Pro Leu Leu Arg
Arg Leu Gly Gly Glu Pro Gly 820 825 830Arg Ile Asp Asp Ala Gly Leu
Pro Gln Arg Ser Thr Ser Leu Thr Asp 835 840 845Ala Glu Arg Arg Val
Ser Ala Leu Ala Ala Ala Gly Gln Thr Asn Arg 850 855 860Glu Ile Ala
Lys Gln Leu Phe Val Thr Ala Ser Thr Val Glu Gln His865 870 875
880Leu Thr Ser Val Phe Arg Lys Leu Gly Val Lys Gly Arg Arg Gln Leu
885 890 895Pro Thr Ala Leu Ala Asp Val Glu 90035906PRTStreptomyces
Sp. NRRL F-4729 35Met Tyr Ser Gly Thr Cys Arg Glu Gly Tyr Glu Leu
Val Ala Arg Glu1 5 10 15Asp Glu Leu Gly Ile Leu Gln Arg Ser Leu Glu
Gln Ala Ser Ser Gly 20 25 30Gln Gly Val Val Val Thr Val Thr Gly Pro
Ile Ala Cys Gly Lys Thr 35 40 45Glu Leu Leu Asp Ala Ala Ala Ala Lys
Ala Glu Ala Ile Ile Leu Arg 50 55 60Ala Val Cys Ala Pro Glu Glu Arg
Ala Met Pro Tyr Ala Met Ile Gly65 70 75 80Gln Leu Ile Asp Asp Pro
Ala Leu Ala His Arg Ala Pro Gly Leu Ala 85 90 95Asp Arg Ile Ala Gln
Gly Gly Gln Leu Ser Leu Arg Ala Glu Asn Arg 100 105 110Leu Arg Arg
Asp Leu Thr Arg Ala Leu Leu Ala Leu Ala Val His Arg 115 120 125Pro
Val Leu Ile Gly Val Asp Asp Val His His Ala Asp Thr Ala Ser 130 135
140Leu Asn Cys Leu Leu His Leu Ala Arg Arg Val Arg Pro Ala Arg
Ile145 150 155 160Ser Met Ile Phe Thr Glu Leu Arg Ser Leu Thr Pro
Thr Gln Ser Arg 165 170 175Phe Lys Ala Glu Leu Leu Ser Leu Pro Tyr
His His Glu Ile Ala Leu 180 185 190Arg Pro Phe Gly Pro Glu Gln Ser
Ala Glu Leu Ala Arg Ala Ala Phe 195 200 205Gly Pro Gly Leu Ala Glu
Asp Val Leu Ala Gly Leu Tyr Lys Thr Thr 210 215 220Arg Gly Asn Leu
Ser Leu Ser Arg Gly Leu Ile Ser Asp Val Arg Glu225 230 235 240Ala
Leu Ala Asn Gly Glu Ser Ala Phe Glu Ala Gly Arg Ala Phe Arg 245 250
255Leu Ala Tyr Leu Ser Ser Leu Tyr Arg Cys Gly Pro Val Ala Leu Arg
260 265 270Val Ala Arg Val Ala Ala Val Leu Gly Pro Ser Ala Thr Thr
Thr Leu 275 280 285Val Arg Arg Leu Ser Gly Leu Ser Ala Glu Thr Ile
Asp Arg Ala Thr 290 295 300Lys Ile Leu Thr Glu Gly Gly Leu Leu Leu
Asp Gln Gln Phe Pro His305 310 315 320Pro Ala Ala Arg Ser Val Val
Leu Asp Asp Met Ser Ala Gln Glu Arg 325 330 335Arg Gly Leu His Thr
Leu Ala Leu Glu Leu Leu Asp Glu Ala Pro Val 340 345 350Glu Val Leu
Ala His His Gln Val Gly Ala Gly Leu Ile His Gly Pro 355 360 365Lys
Ala Ala Glu Met Phe Ala Lys Ala Gly Lys Ala Leu Val Val Arg 370 375
380Asn Glu Leu Gly Asp Ala Ala Glu Tyr Leu Gln Leu Ala His Arg
Ala385 390 395 400Ser Asp Asp Val Ser Thr Arg Ala Ala Leu Arg Val
Glu Ala Val Ala 405 410 415Ile Glu Arg Arg Arg Asn Pro Leu Ala Ser
Ser Arg His Met Asp Glu 420 425 430Leu Ser Ala Ala Gly Arg Ala Gly
Leu Leu Ser Pro Lys His Ala Ala 435 440 445Leu Ala Val Phe Trp Leu
Ala Asp Gly Gly Arg Ser Gly Glu Ala Ala 450 455 460Gln Val Leu Ala
Ser Glu Arg Pro Leu Ala Thr Thr Asp Gln Asn Arg465 470 475 480Ala
His Leu Arg Phe Val Glu Val Thr Leu Ala Leu Phe Ser Pro Gly 485 490
495Ala Phe Gly Ser Asp Arg Arg Pro Pro Pro Leu Thr Pro Asp Glu Leu
500 505 510Ala Ser Leu Pro Lys Ala Ala Trp Gln Cys Ala Val Ala Asp
Asn Ala 515 520 525Ala Met Thr Ala Leu His Gly His Pro Glu Leu Ala
Thr Ala Gln Ala 530 535 540Glu Thr Val Leu Arg Gln Ala Asp Ser Ala
Ala Asp Ala Ile Pro Ala545 550 555 560Ala Leu Ile Ala Leu Leu Tyr
Ala Glu Asn Thr Glu Ser Ala His Ile 565 570 575Trp Ala Asp Lys Leu
Gly Ser Met Asn Ala Gly Val Ser Asn Glu Ala 580 585 590Glu Ala Gly
Tyr Ala Gly Pro Cys Ala Glu Ile Ala Leu Arg Arg Gly 595 600 605Asp
Leu Ala Thr Ala Phe Glu Ala Gly Ser Thr Val Leu Asp Asp Arg 610 615
620Ser Leu Pro Ser Leu Gly Ile Thr Ala Ala Leu Leu Leu Ser Ser
Lys625 630
635 640Thr Ala Ala Ala Val Arg Leu Gly Glu Leu Glu Arg Ala Glu Lys
Leu 645 650 655Leu Ala Glu Pro Leu Pro Asn Gly Val Gln Asp Ser Leu
Phe Gly Leu 660 665 670His Leu Leu Ser Ala Tyr Gly Gln Tyr Ser Leu
Ala Met Gly Arg Tyr 675 680 685Glu Ser Ala His Arg Ala Phe Arg Thr
Cys Gly Glu Arg Met Arg Ser 690 695 700Trp Asp Val Asp Val Pro Gly
Leu Ala Leu Trp Arg Val Asp Ala Ala705 710 715 720Glu Ala Leu Leu
Ser Leu Asp Arg Asn Glu Gly Gln Arg Leu Ile Asp 725 730 735Glu Gln
Leu Thr Arg Pro Met Gly Pro Arg Ser Arg Ala Leu Thr Leu 740 745
750Arg Ile Lys Ala Ala Tyr Leu Pro Arg Thr Lys Arg Ile Pro Leu Leu
755 760 765His Glu Ala Ala Glu Leu Leu Leu Pro Cys Pro Asp Pro Tyr
Glu Gln 770 775 780Ala Arg Val Leu Ala Asp Leu Gly Asp Thr Leu Ser
Ala Leu Arg Arg785 790 795 800Tyr Ser Arg Ala Arg Gly Val Leu Arg
Gln Ala Arg His Leu Ala Thr 805 810 815Gln Cys Gly Ala Val Pro Leu
Leu Arg Arg Leu Gly Gly Glu Pro Gly 820 825 830Arg Ile Asp Asp Ala
Gly Leu Pro Gln Arg Ser Thr Ser Leu Thr Asp 835 840 845Ala Glu Arg
Arg Val Ala Ala Leu Ala Ala Ala Gly Gln Thr Asn Arg 850 855 860Glu
Ile Ala Glu Gln Leu Phe Val Thr Ala Ser Thr Val Glu Gln His865 870
875 880Leu Thr Ser Val Phe Arg Lys Leu Gly Val Lys Gly Arg Lys Gln
Leu 885 890 895Pro Thr Ala Leu Ala Asp Val Glu Gln Thr 900
90536904PRTStreptomyces filamentosus 36Met Arg Ala Ile Asn Ala Ser
Asp Thr Gly Pro Glu Leu Val Ala Arg1 5 10 15Glu Asp Glu Leu Gly Arg
Val Arg Ser Ala Leu Asn Arg Ala Asn Gly 20 25 30Gly Gln Gly Val Leu
Ile Ser Ile Thr Gly Pro Ile Ala Cys Gly Lys 35 40 45Thr Glu Leu Leu
Glu Ala Ala Ala Ser Glu Val Asp Ala Ile Thr Leu 50 55 60Arg Ala Val
Cys Ala Ala Glu Glu Arg Ala Ile Pro Tyr Ala Leu Ile65 70 75 80Gly
Gln Leu Ile Asp Asn Pro Ala Leu Gly Ile Pro Val Pro Asp Pro 85 90
95Ala Gly Leu Thr Ala Gln Gly Gly Arg Leu Ser Ser Ser Ala Glu Asn
100 105 110Arg Leu Arg Arg Asp Leu Thr Arg Ala Leu Leu Thr Leu Ala
Thr Asp 115 120 125Arg Leu Val Leu Ile Cys Val Asp Asp Val Gln His
Ala Asp Asn Ala 130 135 140Ser Leu Ser Cys Leu Leu Tyr Leu Ala Arg
Arg Leu Val Pro Ala Arg145 150 155 160Ile Ala Leu Val Phe Thr Glu
Leu Arg Val Leu Thr Ser Ser Gln Leu 165 170 175Arg Phe Asn Ala Glu
Leu Leu Ser Leu Arg Asn His Cys Glu Ile Ala 180 185 190Leu Arg Pro
Leu Gly Pro Gly His Ala Ala Glu Leu Ala Arg Ala Thr 195 200 205Leu
Gly Pro Gly Leu Ser Asp Glu Thr Leu Thr Glu Leu Tyr Arg Val 210 215
220Thr Gly Gly Asn Leu Ser Leu Ser Arg Gly Leu Ile Asp Asp Val
Arg225 230 235 240Asp Ala Trp Ala Arg Gly Glu Thr Gly Val Gln Val
Gly Arg Ala Phe 245 250 255Arg Leu Ala Tyr Leu Gly Ser Leu His Arg
Cys Gly Pro Leu Ala Leu 260 265 270Arg Val Ala Arg Val Ala Ala Val
Leu Gly Pro Ser Ala Thr Ser Val 275 280 285Leu Val Arg Arg Ile Ser
Gly Leu Ser Ala Glu Ala Met Ala Gln Ala 290 295 300Thr Asp Ile Leu
Ala Asp Gly Gly Leu Leu Arg Asp Gln Arg Phe Thr305 310 315 320His
Pro Ala Ala Arg Ser Val Val Leu Asp Asp Met Ser Ala Glu Glu 325 330
335Arg Arg Ser Val His Ser Leu Ala Leu Glu Leu Leu Asp Glu Ala Pro
340 345 350Ala Glu Met Leu Ala His His Arg Val Gly Ala Gly Leu Val
His Gly 355 360 365Pro Lys Ala Ala Glu Thr Phe Thr Gly Ala Gly Arg
Ala Leu Ala Val 370 375 380Arg Gly Met Leu Gly Glu Ala Ala Asp Tyr
Leu Gln Leu Ala Tyr Arg385 390 395 400Ala Ser Gly Asp Ala Ala Thr
Lys Ala Ala Ile Arg Val Glu Ser Val 405 410 415Ala Val Glu Arg Arg
Arg Asn Pro Leu Val Val Ser Arg His Trp Asp 420 425 430Glu Leu Ser
Val Ala Ala Arg Ala Gly Leu Leu Ser Cys Glu His Val 435 440 445Ser
Arg Thr Ala Arg Trp Leu Thr Val Gly Gly Arg Pro Gly Glu Ala 450 455
460Ala Arg Val Leu Ala Ser Gln His Arg Arg Val Val Thr Asp Gln
Asp465 470 475 480Arg Ala His Leu Arg Val Ala Glu Phe Ser Leu Ala
Leu Leu Tyr Pro 485 490 495Gly Thr Ser Gly Ser Asp Arg Arg Pro His
Pro Leu Thr Ser Asp Glu 500 505 510Leu Ala Ala Leu Pro Thr Ala Thr
Arg His Cys Ala Ile Ala Asp Asn 515 520 525Ala Val Met Ala Ala Leu
Arg Gly His Pro Glu Leu Ala Thr Ala Glu 530 535 540Ala Glu Ala Val
Leu Gln Gln Ala Asp Ala Ala Asp Gly Ala Ala Leu545 550 555 560Thr
Ala Leu Met Ala Leu Leu Tyr Ala Glu Ser Ile Glu Val Ala Glu 565 570
575Val Trp Ala Asp Lys Leu Ala Ala Glu Ala Gly Ala Ser Asn Gly Gln
580 585 590Asp Ala Glu Tyr Ala Gly Ile Arg Ala Glu Ile Ala Leu Arg
Arg Gly 595 600 605Asp Leu Thr Ala Ala Val Glu Thr Ala Gly Met Val
Leu Asp Gly Arg 610 615 620Pro Leu Pro Ser Leu Asp Ile Thr Ala Thr
Leu Leu Leu Ala Gly Arg625 630 635 640Ala Ser Val Ala Val Arg Leu
Gly Glu Leu Asp His Ala Glu Glu Leu 645 650 655Phe Ala Ala Pro Pro
Glu Asp Ala Phe Gln Asp Ser Leu Phe Gly Leu 660 665 670His Leu Leu
Ser Ala His Gly Gln Tyr Ser Leu Ala Thr Gly Arg Pro 675 680 685Glu
Ser Ala Tyr Arg Ala Phe Arg Ala Cys Gly Glu Arg Met Arg Asp 690 695
700Trp Gly Phe Asp Ala Pro Gly Val Ala Leu Trp Arg Val Gly Ala
Ala705 710 715 720Glu Ala Leu Leu Gly Leu Asp Arg Asn Glu Gly Arg
Arg Leu Ile Asp 725 730 735Glu Gln Leu Ser Arg Thr Met Ala Pro Arg
Ser His Ala Leu Thr Leu 740 745 750Arg Ile Lys Ala Ala Tyr Met Pro
Glu Pro Lys Arg Val Asp Leu Leu 755 760 765Tyr Glu Ala Ala Glu Leu
Leu Leu Ser Cys Arg Asp Gln Tyr Glu Arg 770 775 780Ala Arg Val Leu
Ala Asp Leu Gly Glu Ala Leu Ser Ala Leu Gly Asn785 790 795 800Tyr
Arg Gln Ala Arg Gly Val Leu Arg Gln Ala Arg His Leu Ala Met 805 810
815Arg Thr Gly Ala Asp Pro Leu Leu Arg Arg Leu Gly Ile Arg Pro Gly
820 825 830Arg Gln Asp Asp Pro Asp Pro Gln Pro Arg Ser Arg Ser Leu
Thr Asn 835 840 845Ala Glu Arg Arg Ala Ala Ser Leu Ala Ala Thr Gly
Leu Thr Asn Arg 850 855 860Glu Ile Ala Asp Arg Leu Phe Val Thr Ala
Ser Thr Val Glu Gln His865 870 875 880Leu Thr Asn Val Phe Arg Lys
Leu Gly Val Lys Gly Arg Lys Gln Leu 885 890 895Pro Ala Glu Leu Asp
Asp Met Glu 9003775DNAArtificial Sequencesynthetic construct
37caaagcgatt cggagagcgg ccggatcaga tccaggcgtg acattcatac ccttccggcg
60aagtgcagtt caccc 753873DNAArtificial Sequencesynthetic construct
38cgatcttctc gaaactgcac tgaggaggtt cgtcggagac tgccattcac ctctcccgga
60aaggtattgc tcg 7339429DNAStreptomyces filamentosus 39gcgttcggca
ttgacgcgaa gcaagtcatg aatcggctga atcaattccg cgcgcgacat 60tcgcaccctt
ccggtgaagt gcggtattgc tcagacataa cccggatcgc aatccaacga
120ccagccatgc actaccgata atcgaatcgg aacaatagca agctcgttga
gcatattttc 180catgcggcac cacctcggcg ccacccccta gttttgccga
ccccctatgt gtatttcggc 240aggcagacta gggggttgcg tgggccgcac
ccgaggcatt cgattggcgc acggcgcact 300cgggccatgt caccgaccgt
gaatgtttca tcgctacggg tagcaatagt cctttctcgg 360gagaagtgaa
tggcttccaa aagtccccgc ccagggtccg agagagcggg ttctgcgatt 420tcccgggca
42940433DNAStreptomyces filamentosus 40gcgttcggca ttgacgcgaa
gcaagtcatg aatcggctga atcaattccg cgcgcgacat 60tcgcaccctt ccggtgaagt
gcggtattgc tcagacataa cccggatcgc aatccaacga 120ccagccatgc
actaccgata atcgaatcgg aacaatagca agctcgttga gcatattttc
180catgcggcac cacctcggcg ccacccccta gttttgccga ccccctatgt
gtatttcggc 240aggcagaaca cctagggggt tgcgtgggcc gcacccgagg
cattcgattg gcgcacggcg 300cactcgggcc atgtcaccga ccgtgaatgt
ttcatcgcta cgggtagcaa tagtcctttc 360tcgggagaag tgaatggctt
ccaaaagtcc ccgcccaggg tccgagagag cgggttctgc 420gatttcccgg gca
43341432DNAStreptomyces violaceusniger 41gcgttcggca ttgacgcgaa
gcaagtcatg aatcggctga atcaattccg cgcgcgacat 60tcgcatcctt ctggtgaggt
gcagtattgc tgagacataa tccgggccgt aatccaacga 120ccagccatgc
gccgccgata gtcgaatccg atagtcgaat ctgaacgcta gcagctcgtc
180gcaggggctc cggggagccc aaccccctaa tttttccgcc cccctataca
tatccactgc 240aggcagaaca cctagggggt tgcgcgaacc gggcgcgcgg
tatcggattt accgcacggc 300acactcgggc gacgtcaccg accgtgaatc
cttcatcgct acgggtagca cagtcctttc 360cgggagaagt gaatggcttc
caaaagtccc cgcccagggt ccgagagagc gggttctgcg 420atttcccggg ca
43242350DNAStreptomyces violaceusniger 42gcgttcggca ttgacgcgaa
gcaagtcatg aatcggctga atcaattccg cgcgcgacat 60tcataccctt ccggcgaagt
gcagttcacc cggtaatgca ttccggaccg tagcagtccg 120atacagacgt
ccgccatgcc gtgccaccct tgtttttcac ccccctacgc ccgtttcgcc
180tggccggaaa cctagggggt tgcgtggaaa gcaccggcgg gtgttcgctt
gcacagcgcc 240acctcgggca ttttctggat gcgcgagcaa tacctttccg
ggagaggtga atggcttcca 300aaagtccccg cccagggtcc gagagagcgg
gttctgcgat ttcccgggca 3504352DNAArtificial Sequencesynthetic
construct 43gcgcccacct taatcgcagg tgtccacgca accccctagg tttccggcca
gg 524459DNAArtificial Sequencesynthetic construct 44gttcatagct
ctccacggca ggcattcata cccttccggc gaagtgcagt tcacccggt
594553DNAArtificial Sequencesynthetic construct 45gcgcccacct
taatcgcagg tgccaccctt gtttttcacc cccctacgcc cgt 534660DNAArtificial
Sequencesynthetic construct 46gttcatagct ctccacggca ggcattcacc
tctcccggaa aggtattgct cgtgcatcca 604757DNAArtificial
Sequencesynthetic construct 47actgcacttc gccggaaggg tatgaatgcc
tgccgtggag agctatgaac tggacgc 574823DNAArtificial Sequencesynthetic
construct 48ccgggagggc catggagacc gga 234957DNAArtificial
Sequencesynthetic construct 49agcaatacct ttccgggaga ggtgaatgcc
tgccgtggag agctatgaac tggacgc 575023DNAArtificial Sequencesynthetic
construct 50ccgggagggc catggagacc gga 235182DNAArtificial
Sequencesynthetic construct 51ctacccgaat acatcgcctt ctggggccca
gcccaaacca gcgccctcat ccacactcca 60cgcaaccccc taggtttccg gc
825291DNAArtificial Sequencesynthetic construct 52gcggcccaca
acgtgcacga gcgtggcgat atcggacgcg gaaagaacca gcgtgctcat 60tcataccctt
ccggcgaagt gcagttcacc c 915326DNAArtificial Sequencesynthetic
construct 53cgccgtctac ccagcccaaa gccagc 265426DNAArtificial
Sequencesynthetic construct 54cgggttcgtg gtgcggcatc cattcg
265569DNAArtificial Sequencesynthetic construct 55caaagcgatt
cggagagcgg ccggatcaga tccaggcgtg acatggcctg gtgatgatgg 60cgggatcgt
695674DNAArtificial Sequencesynthetic construct 56cgatcttctc
gaaactgcac tgaggaggtt cgtcggagac tgccattcat cgcagtactg 60ttgtattcat
taag 745775DNAArtificial Sequencesynthetic construct 57caaagcgatt
cggagagcgg ccggatcaga tccaggcgtg acattcatac ccttccggcg 60aagtgcagtt
caccc 755873DNAArtificial Sequencesynthetic construct 58cgatcttctc
gaaactgcac tgaggaggtt cgtcggagac tgccattcac ctctcccgga 60aaggtattgc
tcg 735998DNAArtificial Sequencesynthetic construct 59gcaaagcgat
tcggagagcg gccggatcag atccaggcgt gacatgttta aacacaacgt 60acctttcgga
caagagtgcc gcggtgcaca gcctgacc 986098DNAArtificial
Sequencesynthetic construct 60ggtcaggctg tgcaccgcgg cactcttgtc
cgaaaggtac gttgtgttta aacatgtcac 60gcctggatct gatccggccg ctctccgaat
cgctttgc 986198DNAArtificial Sequencesynthetic construct
61tccacacctc tcggttcaca aacgtccgag cataagggag gtaaagttta aacatggcag
60tctccgacga acctcctcag tgcagtttcg agaagatc 986298DNAArtificial
Sequencesynthetic construct 62gatcttctcg aaactgcact gaggaggttc
gtcggagact gccatgttta aactttacct 60cccttatgct cggacgtttg tgaaccgaga
ggtgtgga 986375DNAArtificial Sequencesynthetic construct
63caaagcgatt cggagagcgg ccggatcaga tccaggcgtg acattcatac ccttccggcg
60aagtgcagtt caccc 756473DNAArtificial Sequencesynthetic construct
64cgatcttctc gaaactgcac tgaggaggtt cgtcggagac tgccattcac ctctcccgga
60aaggtattgc tcg 736587DNAArtificial Sequencesynthetic construct
65cccgaaccac gatgagcact tgcctatgcg gtgtagggat aacagggtaa ttaattaatg
60acctgcgccc accttaatcg caggtgc 876698DNAArtificial
Sequencesynthetic construct 66tactttctat ttttaattta tatatttata
ttaaaaaatt taaaatataa ttatttttat 60agcacgtgat ggagcctatg gaaaaacgcc
agcaacgc 986745DNAArtificial Sequencesynthetic construct
67ggtagtattt gttggcgatc cccctagagt cttttacatc ttcgg
456822DNAArtificial Sequencesynthetic construct 68agcctgcccc
tcatctgtca ac 226999DNAArtificial Sequencesynthetic construct
69gttgatcgtg tggggcggcc tgccgagcag ctggtggacc cctggggcga gctggcgcat
60tcacctgtat actgagagtg caccataaac gacattact 997094DNAArtificial
Sequencesynthetic construct 70gacgaccgcg gtccccacga ggacagcggc
cgacgcaaca gctttgcgaa gacgagtcat 60tcatacgtat acaggcaagt gcacaaacaa
tact 9471100DNAArtificial Sequencesynthetic construct 71cgccggtgag
gccagaccca tgagggtcag tgctgcgacc accgcgtacc tgatccgcat 60tcacctgtta
actcctgatg cggtattttc tccttacgca 1007290DNAArtificial
Sequencesynthetic construct 72ctcggccggc agcaaggtct gctcgatcgc
gatgatccgg ccgttccccc agtcgatcgt 60gttaaccgac tacgtcgtaa ggccgtttct
9073102DNAArtificial Sequencesynthetic construct 73gacgaacgcg
aagtcgtcgc cgccctcctt catgcccagt ccggtggtcc agccgcggaa 60gccgtgcgga
tgcattcacc tctcccggaa aggtattgct cg 10274102DNAArtificial
Sequencesynthetic construct 74tcgccacggg cggtcgagga actcgtcgcg
gaccgccgcg acccgtgttc gcgcgccgtc 60accgccgacg cgcattcata cccttccggc
gaagtgcagt tc 1027524DNAArtificial Sequencesynthetic construct
75ggcgtggctg gagccgaagt ggtc 247633DNAArtificial Sequencesynthetic
construct 76tcttccacta ctgccatctg gcgtcataac tgc
337749DNAArtificial Sequencesynthetic construct 77aggttattac
tgagtagtat ttatttaagt attgtttgtg cacttgcct 497821DNAArtificial
Sequencesynthetic construct 78actcggcggc gttggcgtgg c
217919DNAArtificial Sequencesynthetic construct 79accgtcgccc
cgccgcagc 198036DNAArtificial Sequencesynthetic construct
80cgcacagatt cgtaaggaga aaataccgca tcagga 368132DNAArtificial
Sequencesynthetic construct 81actctgtcag aaacggcctt acgacgtagt cg
328222DNAArtificial Sequencesynthetic construct 82cgggcggcac
gcaaccgaag tg 228323DNAArtificial Sequencesynthetic construct
83gtgaagaccg ccgataccgc cgc 238426DNAArtificial Sequencesynthetic
construct 84gggtgaaaaa caagggtggc acggca 268526DNAArtificial
Sequencesynthetic construct 85tgccgtgcca cccttgtttt tcaccc
268626DNAArtificial Sequencesynthetic construct 86acgccaggcc
cgttcacgac gaccgc 268759DNAArtificial Sequencesynthetic
construct
87gctggtggac ccctggggcg agctggcgca ttcacctctc ccggaaaggt attgctcgc
598865DNAArtificial Sequencesynthetic construct 88aacagctttg
cgaagacgag tcattcatac cattcatacc cttccggcga agtgcagttc 60acccg
658962DNAArtificial Sequencesynthetic construct 89tcagtgctgc
gaccaccgcg tacctgatcc gcattcacct ctcccggaaa ggtattgctc 60gc
629073DNAArtificial Sequencesynthetic construct 90atcgcgatga
tccggccgtt cccccagtcg atcgtccgca ttcataccct tccggcgaag 60tgcagttcac
ccg 739149DNAStreptomyces violaceusniger 91tggccggaaa cctagggggt
tgcgtggaaa gcaccggcgg gtgttcgct 499249DNAStreptomyces rapamycinicus
92aggcaggacg tctagggggt tgcgtggact gcggcctgag gtgtcttct
499349DNAStreptomyces hygroscopicus 93aggcaggaag cctagggggt
tgcgtggact gcgacctggg gtgtcttct 499447DNAMicromonospora sp.
S92-306401 94aggtacgaca cctagggggt tgcgtcggct gcgaccccgg tgtctcc
479548DNAActinoplanes sp. N01-109 95agctcggccc cctagggggt
tgcgcccgct gaggcggagg tgtttggc 489643DNAStreptomyces kanamyceticus
96tgttgcccat ctagggggtt gcacgaataa cgtcacacgt act
439743DNAStreptomyces tacrolimicus 97tgtcatatgt ctagggggtt
gcacgaatac cgtcgcgcgt act 439843DNAStreptomyces ascomyceticus
98ggacgctcat ctagggggtt gcacgcatac cgccgtgcgt aat
439939DNAStreptomyces violaceusniger 99ggcgcctgtt ctagggggtt
gcggggagtg gcgcgcaca 3910066PRTMicromonospora sp. S92-306401 100Gln
Gly Ile Arg Ser Leu Thr Glu Ala Glu Arg Arg Val Ala Thr Leu1 5 10
15Ala Ala Ala Gly Gln Thr Asn Arg Glu Ile Ala Asp Gln Leu Phe Val
20 25 30Thr Ala Ser Thr Val Glu Gln His Leu Thr Asn Val Phe Arg Lys
Leu 35 40 45Gly Val Lys Gly Arg Gln Gln Leu Pro Ala Glu Leu Ala Asp
Leu Arg 50 55 60Pro Pro6510166PRTStreptomyces violaceusniger 101Gln
Arg Ser Thr Ser Leu Thr Asp Ala Glu Arg Arg Val Ala Ala Leu1 5 10
15Ala Ala Ala Gly Gln Thr Asn Arg Glu Ile Ala Lys Gln Leu Phe Val
20 25 30Thr Ala Ser Thr Val Glu Gln His Leu Thr Ser Val Phe Arg Lys
Leu 35 40 45Gly Val Lys Gly Arg Lys Gln Leu Pro Thr Ala Leu Ala Asp
Val Glu 50 55 60Gln Thr6510258PRTStreptomyces hygroscopicus 102Gln
Arg Ile Lys Ser Leu Thr Asp Ala Glu Arg Arg Val Ala Ser Leu1 5 10
15Ala Ala Gly Gly Gln Thr Asn Arg Val Ile Ala Asp Gln Leu Phe Val
20 25 30Thr Ala Ser Thr Val Glu Gln His Leu Thr Asp Val Ser Thr Gly
Ser 35 40 45Arg Pro Pro Ala Pro Ala Ala Glu Leu Val 50
5510364PRTStreptomyces ascomyceticus 103Gln Arg Ile Thr Ser Leu Thr
Glu Ala Glu Arg Arg Val Ala Ser His1 5 10 15Ala Ala Val Gly Arg Thr
Asn Lys Glu Ile Ala Ser Gln Leu Phe Val 20 25 30Thr Ser Ser Thr Val
Glu Gln His Leu Thr Asn Val Phe Arg Lys Leu 35 40 45Gly Val Lys Gly
Arg Gln Gln Leu Pro Lys Glu Leu Ser Asp Ala Gly 50 55
6010474PRTStreptomyces kanamyceticus 104Gln Arg Ile Ala Ser Leu Thr
Glu Ser Glu Arg Arg Val Ala Ala Leu1 5 10 15Ala Ala Val Gly Arg Thr
Asn Arg Glu Ile Ala Glu Gln Leu Phe Val 20 25 30Thr Ala Ser Thr Val
Glu Gln His Leu Thr Asn Val Phe Arg Lys Leu 35 40 45Ala Val Lys Gly
Arg Gln Gln Leu Pro Lys Glu Leu Ala Asp Val Gly 50 55 60Glu Pro Ala
Asp Arg Asp Arg Arg Cys Gly65 7010571PRTArtificial
Sequencesynthetic construct 105Ile Arg Thr Ser Pro Leu Thr Gln Arg
Glu Trp Gln Val Leu Gly Leu1 5 10 15Ile Tyr Ser Gly Tyr Ser Asn Glu
Gln Ile Ala Gly Glu Leu Glu Val 20 25 30Ala Ala Thr Thr Ile Lys Thr
His Ile Arg Asn Leu Tyr Gln Lys Leu 35 40 45Gly Val Ala His Arg Gln
Asp Ala Val Gln His Ala Gln Gln Leu Leu 50 55 60Lys Met Met Gly Tyr
Gly Val65 7010645PRTStreptomyces rapamycinicus 106Leu Thr Asp Ala
Glu Arg Arg Val Ala Ser Leu Ala Ala Gly Gly Gln1 5 10 15Thr Asn Arg
Val Ile Ala Asp Gln Leu Phe Val Thr Ala Ser Thr Val 20 25 30Glu Gln
His Leu Thr Asn Val Phe Arg Lys Leu Gly Val 35 40
4510754DNAStreptomyces violaceusniger 107cgcctggccg gaaacctagg
gggttgcgtg gaaagcaccg gcgggtgttc gctt 5410848DNAStreptomyces
filamentosus 108cggcaggcag actaggggtt gcgtgggccg cacccgaggc
attcgatt 4810949DNAStreptomyces filamentosus 109cggcaggcag
actagggggt tgcgtgggcc gcacccgagg cattcgatt 4911053DNAStreptomyces
filamentosus 110cggcaggcag aacacctagg gggttgcgtg ggccgcaccc
gaggcattcg att 5311152DNAStreptomyces violaceusniger 111ctgcaggcag
aacacctggg ggttgcgcga accgggcgcg cggtatcgga tt
5211253DNAStreptomyces violaceusniger 112ctgcaggcag aacacctagg
gggttgcgcg aaccgggcgc gcggtatcgg att 53
* * * * *
References