U.S. patent application number 17/732581 was filed with the patent office on 2022-08-25 for anti-robo1 car-t cell, and preparation and application thereof.
This patent application is currently assigned to ASCLEPIUS (Suzhou) TECHNOLOGY COMPANY GROUP CO., LTD.. The applicant listed for this patent is ASCLEPIUS (Suzhou) TECHNOLOGY COMPANY GROUP CO., LTD.. Invention is credited to Huashun LI.
Application Number | 20220267731 17/732581 |
Document ID | / |
Family ID | |
Filed Date | 2022-08-25 |
United States Patent
Application |
20220267731 |
Kind Code |
A1 |
LI; Huashun |
August 25, 2022 |
ANTI-ROBO1 CAR-T CELL, AND PREPARATION AND APPLICATION THEREOF
Abstract
Provided is a method for modifying a chimeric antigen
receptor-modified T cell (CAR-T cell). The method comprises
expressing an ScFv-CD8-4-1 BB-CD3.zeta. molecule in a T cell. The
CAR-T cell prepared using the method can specifically recognize and
bind to a tumor cell with elevated expression of a ROBO1 protein,
and can be used to prevent and treat a corresponding tumor-related
disease
Inventors: |
LI; Huashun; (Suzhou,
CN) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
ASCLEPIUS (Suzhou) TECHNOLOGY COMPANY GROUP CO., LTD. |
Suzhou City |
|
CN |
|
|
Assignee: |
ASCLEPIUS (Suzhou) TECHNOLOGY
COMPANY GROUP CO., LTD.
Suzhou City
CN
|
Appl. No.: |
17/732581 |
Filed: |
April 29, 2022 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16094247 |
Oct 17, 2018 |
11345893 |
|
|
PCT/CN2016/092577 |
Jul 31, 2016 |
|
|
|
17732581 |
|
|
|
|
International
Class: |
C12N 5/0786 20060101
C12N005/0786; A61P 35/00 20060101 A61P035/00; C12N 15/85 20060101
C12N015/85; C12N 5/0783 20060101 C12N005/0783; C12N 15/62 20060101
C12N015/62; A61K 38/17 20060101 A61K038/17; C12N 5/10 20060101
C12N005/10 |
Foreign Application Data
Date |
Code |
Application Number |
Apr 18, 2016 |
CN |
201610237593.2 |
Claims
1-9. (canceled)
10: A method of making an anti-ROBO1 CAR-T cell, comprising: (1)
cloning a gene encoding an anti-ROBO1-ScFv-CD8-4-1BB-CD3.zeta.
fusion protein into a lentiviral expression vector; (2) packaging
and preparing a lentivirus by expressing a lentiviral envelop
plasmid and the lentiviral expression vector of step (1) in a 293 T
cell; (3) isolating and expanding human peripheral blood T
lymphocytes and infecting the T lymphocytes with the lentivirus of
step (2) to express the ScFv-CD8-4-1 BB-CD3.zeta. fusion protein in
the T lymphocytes; wherein the ScFv portion of the fusion protein
is expressed on a surface of the CAR-T cell and the 4-1
BB-CD3.zeta. portion of the fusion protein is expressed inside the
CAR-T cell.
11: The anti-ROBO1 CAR-T cell of claim 10, wherein the amino acid
sequence of ScFv in the anti-ROBO1-ScFv-CD8-4-1BB-CD3.zeta. fusion
protein is SEQ ID NO:5; and the amino acid sequence of CD8 in the
anti-ROBO1-ScFv-CD8-4-1 BB-CD3.zeta. fusion protein is SEQ ID
NO:1.
12: The anti-ROBO1 CAR-T cell of claim 10, wherein the amino acid
sequence of 4-1BB in the anti-ROBO1-ScFv-CD8-4-1BB-CD3.zeta. fusion
protein is SEQ ID NO:2; wherein the 4-1 BB in the
anti-ROBO1-ScFv-CD8-4-1BB-CD3.zeta. fusion protein can be replaced
by CD28 that has the amino acid sequence of SEQ ID NO:3.
13: The anti-ROBO1-ScFv CAR-T cell of claim 10, wherein the amino
acid sequence of CD3.zeta. in the anti-ROBO1-ScFv-CD8-4-1
BB-CD3.zeta. fusion protein is SEQ ID NO:4.
14: The anti-ROBO1 CAR-T cell of claim 10, wherein the amino acid
sequence of the anti-ROBO1-ScFv-CD8-4-1BB-CD3.zeta. fusion protein
is SEQ ID NO:6.
15: The anti-ROBO1-ScFv CAR-T cell of claim 10, wherein the T cell
is derived from human periphery blood T lymphocytes.
16: A method of treating tumor by administering an anti-ROBO1 CAR-T
cell expressing an anti-ROBO1-ScFv-CD8-4-1BB-CD3.zeta. fusion
protein; wherein the anti-ROBO1 portion of the fusion protein is
expressed on a surface of the CAR-T cell and the 4-1 BB-CD3.zeta.
portion of the fusion protein is expressed inside the CAR-T
cell.
17: The method of claim 16, wherein the amino acid sequence of ScFv
in the anti-ROBO1-ScFv-CD8-4-1BB-CD3.zeta. fusion protein is SEQ ID
NO:5; and the amino acid sequence of CD8 in the
anti-ROBO1-ScFv-CD8-4-1BB-CD3.zeta. fusion protein is SEQ ID
NO:1.
18: The method of claim 16, wherein the amino acid sequence of
4-1BB in the anti-ROBO1-ScFv-CD8-4-1BB-CD3.zeta. fusion protein is
SEQ ID NO:2; wherein the 4-1 BB in the
anti-ROBO1-ScFv-CD8-4-1BB-CD3.zeta. fusion protein can be replaced
by CD28 that has the amino acid sequence of SEQ ID NO:3.
19: The method of claim 16, wherein the amino acid sequence of CD34
in the anti-ROBO1-ScFv-CD8-4-1BB-CD3.zeta. fusion protein is SEQ ID
NO:4.
20: The method of claim 16, wherein the amino acid sequence of the
anti-ROBO1-ScFv-CD8-4-1BB-CD3.zeta. fusion protein is SEQ ID
NO:6.
21: The method of claim 16, wherein the tumor is characterized by
high expression level of ROBO1.
Description
FIELD OF THE INVENTION
[0001] The present invention is related to the field of cellular
drug for tumor therapy, particularly to an Anti-ROBO1 CAR-T cell,
and preparation and application thereof.
BACKGROUND OF THE INVENTION
[0002] Human T lymphocytes recognize target cells through T cell
receptors on their surfaces, this recognition is specific, that is,
a T lymphocyte recognizes only target cells with specific antigens,
and these specific antigens are presented to T lymphocytes through
the action of special molecules after being processed in cells.
These antigen-presenting molecules are either present on the
surfaces of antigen presenting-cells or on the surfaces of target
cells. There are at least two factors that cause T lymphocytes in
vivo to be unable to recognize cancer cells very well: (1) cancer
cells down-regulate the expression of antigen-presenting molecules,
and (2) the binding affinities between the presented antigens and T
cell receptors are weak. Although there are T lymphocytes highly
specific to cancer cells in cancer patients, the number of T
lymphocytes is too small to treat cancer. Based on this situation,
scientists have proposed the concept of constructing a chimeric T
cell receptor (now commonly referred to as a Chimeric antigen
receptor). The Chimeric Antigen Receptor (CAR) is mainly composed
of two parts, one end of which is located outside the cell that can
specifically recognize an antigen on the surface of cancer cells,
the other end of which is located in the cell that contains a
signal activation element (such as a T cell receptor, Zeta chain),
which acts to transmit signals to activate T cells. Therefore, the
T-lymphocytes (CAR-T cells) expressing CAR can avoid the
restrictions in recognition of the target cells by T cell, and
therefore kill the target cancer cells.
[0003] Currently, clinical trials of CAR-T therapy are growing
rapidly, most of which are evaluations of the treatment of B-cell
malignancy. Most malignant B cell and normal B cells express the
CD19 antigen, but other types of cells do not have CD19, so CD19 is
a good therapeutic target. The compositions of CD19 CAR-T cells
used in different clinical trials have been somewhat different, and
clinical designs of CD19 CAR-T cells used in different clinical
trials are also different. However, they were all reported to have
significant effects. The response rates for the treatment of
relapsed or refractory lymphocytic leukemia can reach 60-90%, with
some patients achieving sustained remission, the longest of which
was up to 2 years. Now it is not yet known that how long the
sustained remission of the CD19 CAR-T treatment can achieve, but it
is certain that this kind of immunotherapy has brought effects
which were unattainable previously to some patients.
[0004] In addition to focusing on hematologic tumors, researchers
also have been trying to extend CAR-T treatment to solid tumors.
The results of the clinical trials have shown that GD2-specific
CAR-T had certain effects on neuroblastoma, whereas there are no
therapeutic effects of the aFR-specific CAR-T cells on ovarian
cancer, CAIX-specific CAR-T cells on renal cell carcinoma, and
PSMA-specific CAR-T cells on prostatic cancer. Carl H June et al.
from the Pennsylvania University reported the treatment results of
refractory and metastatic pancreatic ductal adenocarcinoma with
mesothelin-specific CAR-T cells at the American Society of Clinical
Oncology's annual meeting in 2015. The results showed that the
patients had good tolerance for CAR-T cells and no cytokine
syndrome occurred, CAR-T cells could be detected in the peripheral
blood for a short period of time, and the conditions of 2 patients
were stabilized. Therefore, the use of CAR-T for the treatment of
solid tumors is still in an early stage, and there are still many
problems to be solved.
[0005] Histopathological examination revealed that Robo1 was over
expressed in various types of cancers, such as hepatocellular
carcinoma, breast cancer, colon cancer, pancreatic cancer, prostate
cancer, glioma, and the like. Studies by Ito et al. showed that
Robo1 was abundantly expressed in hepatocellular carcinoma but only
expressed in a small amount in normal tissues, and 84.7% of liver
cancer tissue samples showed positive expression. Therefore, Robo1
can be used as a new hepatocyte tumor-associated antigen, which is
a potential therapeutic and diagnostic target. Test results of
GRONE et al. showed that the cancerous tissues of 80% of colon
cancer patients had high expression level of Robo1 mRNA, in 45% of
the patients, the expression levels were 4 times over those in
normal tissues, and in 15% of the patients, the expression levels
were 12 times over those in normal tissues. Therefore, Robo1 can
provide a new potential target for the treatment of colon cancer.
Compared with pancreatic ductal carcinoma to its surrounding benign
tissue, He et al. found that Robo1 was up-regulated in cancer
tissues, and this kind of up-regulation may be associated with
lymphatic metastasis of pancreatic cancer cells. Studies by Huang
et al also showed that Robo1 was related to the migration of colon
cancer.
[0006] The extracellular domain of ROBO1 is composed of IG1-IG5 and
FN3 domains, with the FN3 domain being proximal to the cell
membrane. Therefore, the FN3 region is a preferred choice as an
antigen when ROBO1 molecule is used as a target, so that when the
CAR-T cells constructed by this method are in contact with tumor
cells expressing ROBO1 molecule, the cells would be pulled together
the closest to each other, and the killing effect would be better.
The specific structure is shown in FIG. 1.
SUMMARY OF THE INVENTION
[0007] The main technical problem to be solved by the present
invention is to provide an Anti-ROBO1 CAR-T cell, and preparation
and application thereof, which is method for modifying and
transforming T cells, so that the transformed T cells can
specifically recognize and kill tumors, and the T cells prepared by
the method have more efficient tumor killing activity.
[0008] In order to solve the above technical problem, one technical
solution adopted by the present invention is to provide a CAR-T
cell targeting the ROBO1 FN3 domain, wherein an
SCFV-CD8.TM.-4-1BB-CD3.zeta. fusion protein is expressed in the T
cells.
[0009] In a preferred embodiment of the present invention, the
CAR-T cell is manufactured by:
[0010] (1) synthesizing and amplifying the gene encoding the
SCFV-CD8.TM.-4-1BB-CD3.zeta. and cloning the gene encoding the
SCFV-CD8.TM.-4-1BB-CD3.zeta. fusion protein into a lentiviral
expression vector;
[0011] (2) using a lentiviral envelop plasmid and the lentiviral
expression vector of step (1) to infect a 293 T cell, packaging and
preparing the virus; [0012] (3) isolating and expanding human
peripheral blood T lymphocytes and infecting the T lymphocytes with
the lentivirus of step (2) to obtain the CAR-T cells expressing the
ScFv-CD8.TM.-4-1BB-CD3.zeta. fusion protein.
[0013] In a preferred embodiment of the present invention, the SCFV
sequence molecule is expressed on a surface of the T lymphocyte,
and the 4-1BB-CD3.zeta. molecule transmits the activating signal
inside the T cell.
[0014] In a preferred embodiment of the present invention, the
amino acid sequence of SCFV in the SCFV-CD8.TM.-4-1BB-CD3.zeta.
fusion protein is SEQ ID NO:5; and the amino acid sequence of
CD8.sup.11 in the SCFV-CD8.TM.-4-1BB-CD3.zeta. fusion protein is
SEQ ID NO:1.
[0015] In a preferred embodiment of the present invention, the
amino acid sequence of 4-1BB in the SCFV-CD8.TM.-4-1BB-CD3.zeta.
fusion protein is SEQ ID NO:2; wherein the 4-1BB in the
SCFV-CD8.TM.-4-1BB-CD3.zeta. fusion protein can be replaced by CD28
that has the amino acid sequence of SEQ ID NO:3.
[0016] In a preferred embodiment of the invention, the amino acid
sequence of CD3.zeta. in the SCFV-CD8-4-1BB-CD3.zeta. fusion
protein is SEQ ID NO:4; and the T cell is derived from human
periphery blood T lymphocytes.
[0017] In a preferred embodiment of the invention, the amino acid
sequence of the SCFV-CD8.TM.-4-1BB-CD3.zeta. fusion protein is SEQ
ID NO:6.
[0018] In a preferred embodiment of the invention, the CAR-T cell
is used in the preparation anti-tumor drugs.
[0019] In a preferred embodiment of the invention, the CAR-T cell
is used in preparation of the therapeutic drugs that target tumors
with high expression of ROBO1.
[0020] The beneficial effects of the present invention are: in the
Anti ROBO1 CAR-T cells of the present invention, and in the
preparation and application thereof, ROBO1 antibody is used for the
construction of CART cells, and the ROBO1 molecule is proposed as
target antigen, and the Anti ROBO1 CART cells are used to kill
tumor cells. In addition, the Anti ROBO1 CART cells are used as a
cellular drug for the treatment of tumor diseases, which can be
used for the treatment of tumors with high expression levels of
ROBO1 molecules.
BRIEF DESCRIPTION OF THE DRAWINGS
[0021] In order to more clearly illustrate the technical solutions
in the embodiments of the present invention, the figures used in
the description of the embodiments will be briefly described below.
It is obvious that the figures in the following description are
only some embodiments of the present invention. For a person of
ordinary skills in the art, other figures can be obtained based on
these figures without any creative work. The figures include:
[0022] FIG. 1 illustrates a schematic diagram of the structure of
the ROBO1 molecule of the present invention;
[0023] FIG. 2 illustrates a map of the PRRLSIN-SCFV (anti
ROBO1-FN3) lentiviral plasmid vector of the present invention;
[0024] FIG. 3 illustrates a flow cytometry result of the MCF7/ROBO1
engineering cell line with high expression of ROBO1 of the present
invention.
[0025] FIG. 4 illustrates a result of the CAR-T killing experiment
in vitro of the present invention;
[0026] FIG. 5 illustrates a result of the killing effect of CAR-T
cells in vitro under different effect-target ratio conditions of
the present invention.
DETAILED DESCRIPTION OF THE INVENTION
[0027] The technical solutions in the embodiments of the present
invention are clearly and completely described below. It is obvious
that the described embodiments are only a part of the embodiments
of the present invention, not all of the embodiments. Based on the
embodiments of the present invention, all other embodiments are
obtained by a person skilled in the art without any creative work
is within the scope of the protection of the present invention.
Example 1: Preparation of a Lentiviral Expression Vector
[0028] Synthesizing the gene encoding the SCFV (Anti
ROBO1-FN3)-CD8-4-1BB-CD3.zeta., wherein the gene sequence is SEQ ID
NO:7, then the gene was ligated into the PRRSLIN vector by
restriction enzyme and transformation, and the upstream of the gene
is EP-1.alpha., promote. The vector was transformed into Stbl3
Escherichia coli strain and screened by ampicillin to obtain
positive clones, then the plasmids were extracted and identified by
restriction enzyme digestion, and PRRLSIN-SCFV (anti ROBO1-FN3)
lentiviral transfection vector was obtain, the structure of which
is as shown in FIG. 2.
Embodiment 2: Preparation of Lentivirus
[0029] (1) Twenty-four hours before transfection, seeding 293T
cells into 15 cm culture dishes at a cell density of approximately
8.times.10.sup.6 cell per dish, which could ensure that the cells
were at about 80% of confluence and evenly distributed in the
culture dish during transfection.
[0030] (2) Prepare solution A and solution B
[0031] Solution A: 6.25 ml of 2.times.HEPES buffer (using 5 large
dishes which are packed together could achieve the best
effects).
[0032] Solution B: adding the following plasmids respectively, and
mixing: 112.5 ug of pRRLSIN-EF-ROBO1 (target plasmid); 39.5 ug of
pMD2.G (VSV-G envelop); 73 ug of pCMVR8.74 (gag, pol, tat, rev);
625 .mu.l of 2M calcium ion solution. Total volume of solution A:
6.25 ml.
[0033] The solution B was mixed completely, and the solution A was
added dropwise when the solution A was gently rocked, then let the
solution sit for 5-15 minutes. The above mixed solution of A and B
was gently rocked and added to the petri dish containing 293T cells
dropwise, then the culture dish was gently shaken back and forth to
distribute the mixture of DNA and calcium ions evenly. The culture
dish was placed in an incubator to incubate for 16-18 hours (do not
rotate the culture dish).
[0034] Fresh medium was replaced and continued incubating, then the
supernatant containing virus was collected after 48 hours and 72
hours, respectively. The supernatant containing virus was observed
by fluorescence microscopy, more than 95% of the cells should show
green fluorescence. The supernatant was centrifuged at 500 g for 10
minutes at 10.degree. C., followed by being filtered with PES
membrane (0.45 .mu.m). Beckman Coulter Ultra-clear SW28 centrifuge
tubes were sterilized with 70% ethanol, and sterilized under UV
light for 30 minutes. The filtered supernatant containing
lentivirus was transferred to a centrifuge tube. A layer of 20%
sucrose was carefully spread on the bottom of the centrifuge tube
(1 ml of sucrose was added per 8 ml of supernatant). The centrifuge
tube was equilibrated with PBS, and centrifuged the supernatant at
25,000 rpm (82,700 g) for 2 hours at 4.degree. C.
[0035] The centrifuge tube was carefully taken out and poured off
the supernatant, followed by being inverted to remove residual
liquid. 100 .mu.l of PBS was added in the centrifuge tube and
sealed, then placed at 4.degree. C. for 2 hours, gently rocked once
per 20 minutes during the time, followed by being centrifuged for 1
minute (25.degree. C.:) at 500 g, and the virus supernatant was
collected. After being cooled on ice, the virus supernatant was
stored at -80.degree. C.
Embodiment 3
[0036] Preparation of Anti ROBO1-FN3-CART Cells:
[0037] 0.5 ml of blood was taken, and tested for pathogenic
microorganisms rapidly to exclude microbial infections such as HBV,
HCV, HDV and HEV, HIV-1/2, Treponema pallidum and parasites; 50 ml
of blood was collected with heparin bottle (heparin
anticoagulation) under sterile conditions, and immediately
(4.degree. C., within 24 hours) sent to the cell preparation
laboratory to ensure that this process was free of pathogenic
microbial contamination. After obtaining the patient's blood, the
surface of the heparin bottle was wiped with an alcohol cotton ball
for disinfection in the GMP preparation room, then the heparin
bottle was placed in a biological safety cabinet. Two 50 ml
centrifuge tubes were opened in advance, and the blood was
transferred into the two 50 ml centrifuge tubes and tightened up.
The above 50 ml centrifuge tubes filled with blood were placed in a
centrifuge and centrifuged at 400 g (2000 rpm) for 10 min at room
temperature, then the supernatant plasma was collected and the
precipitate layer was removed after centrifugation. The collected
autologous plasma was inactivated at 56.degree. C. for 30 minutes.
After being stood for 15 minutes at 4'C, the collected autologous
plasma was centrifuged at 900 g for 30 min at 4.degree. C. to take
the supernatant for use. The enriched blood cells above were
diluted to 30 ml/tube with physiological saline, and two new 50 ml
centrifuge tubes were opened, then 15 ml of human lymphocyte
separation liquid was added to each centrifuge tube. The diluted
blood cell solution was slowly added to the centrifuge tube which
contains the human lymphatic separation solution with a pipette,
and tightened up. It was noted that the blood should be added to
the upper layer of the lymphatic separation solution, and the
interface of the human lymphatic separation solution should not be
broken. The added blood cell solution was placed in a centrifuge
which was adjusted to a minimum rate of rise and fall, then the
added blood cell solution was centrifuged at 400 g (2000 rpm) for
20 min at room temperature. The middle white blood cell layer of
two tubes was collected in a 15 ml sterile centrifuge tube, and 5
ml of physiological saline was added, and then washed twice
(Centrifuging the collected middle white blood cell layer at 400 g
for 10 minutes) to obtain peripheral blood mononuclear cells
(PBMC). Complete growth medium was made, the concentration of
V-VIVO15 added autologous AB (FBS) was 5%, the concentration of
IL-2 was 40 ng/ml, and the isolated PBMC was diluted to
2.times.10.sup.6/ml with medium, then 50 ul was taken, and the T
cells purity of PBMC was detected by flow cytometer on 0 day,
Buffer1 was made that, 1% FBS was added to PBS and the beads were
rocked for 30 s or manually shaken up and down for 5 min. CD3/CD28
beads were taken out according to the ratio of beads to T cells of
3-1, and the beads were put in 1.5 ml EP tube, followed by adding 1
ml buffer1 to clean the beads. After that, The beads were suck from
the EP tube for 1 min with magnet and washing solution was
discarded, which was repeated twice, Then the beads were
re-suspended to the original volume using the medium, and the cells
and beads were mixed, followed by being added in a suitable culture
bottle in 2.times.10.sup.6 PBMC/ML. On the second day, the density
of the cell was adjusted to 3-5.times.10.sup.6/ml, and the virus
vector was added in the proportion of virus vector:cell of 1:5,
meanwhile, 4 ug/ml and 40 ng/ml IL.sup.-2 polybrene were added.
After 4 hours, fresh complete medium was added, and the density of
the cell was adjusted to 1.times.10.sup.6/ml to continuous culture.
All the cells were centrifuged, and fresh medium was added to
continuous culture. Half a volume change replaced per 2-3 days to
maintain the density of the cell in 0.5-1.times.10.sup.6/ml. When
the number of cells reached 10' in the period of 10-12 days, the
cells were centrifuged at 400 g for 5 min to get inunue cells,
followed by being washed twice with pre-cooled PBS (400 g, 5 min).
The cells were count by a hemocytometer, and the cell group and the
proportion of CART cells were detected by flow cytometer. The color
change, cell density, and cell morphology of the medium were
observed daily and recorded accordingly. The interleukin 2 which is
required by total volume was added in the process of gradually
expanding cultivation.
Embodiment 4
[0038] Construction and Detection of Engineering Cell Lines:
[0039] (1) Preparation of engineering cell line lentivirus with
high expression Robo1 FN3 (the specific preparing method is also
the method in the second embodiment);
[0040] (2) Infection of MCF cells: 500,000 MCF7 cells were
inoculated in 6-well plates the day before infection. When the
cells grow to 80% on the next day, 500 .mu.l of packaged ROBO1
virus was added in a 6-well plate, meanwhile control cell (no virus
added) was set, culture medium was changed after 12-16 hours, and
then the positive cells of Robo1 were sorted by flow cytometer 3
days after infection;
[0041] (3) Detection of engineered cell lines: 20,000 cells were
taken from the sorted positive cells of Robo1, followed by being
centrifuged at 400 g for 5 min, then washed twice with pre-cooled
PBS, and 2.5 .mu.l of Robo1 antibody (Biolegend) was added and
incubated in the dark for 20 min, after that, centrifuged and
washed once with pre-cooled PBS, then the cells was re-suspended in
100 .mu.l PBS, and the expression of Robo1 was detected by flow
cytometer (see FIG. 3). The experimental results confirmed that the
engineered cell lines were successfully constructed, which can be
used as a target cell for subsequent killing experiments.
Embodiment 5
[0042] Activity Assay of Anti ROBO1-FN3-CART Cells In Vitro:
[0043] LDH release assay was used to detect the killing effect of
Anti ROBO1-FN3-CART cells on engineered cell line MCF-1/ROBO1 and
hepatoma cell line SMCC7721 with high Robo1-expressing. ELISA was
used to detect LDH release.
[0044] (1) Adjusting the target cells to 5.times.10.sup.4/ml with
RPMI-1640 medium containing 5% calf serum.
[0045] (2) Adding target cells to 96-well cell culture plates, and
adding 100 .mu.l to each well. Three effector cells naturally
released control wells were only added 100 .mu.l of culture
solution without adding target cells.
[0046] (3) Adding 100 .mu.l of effector cells to each well, and the
ratio of effector cells to target cells was 50:1; 25:1; 10:1; 5:1;
or 1:1. Natural release wells were only added 100 .mu.l of culture
medium without effector cells, and incubating the effector cells
with the target cells for 6 hours, meanwhile, setting up three
replicate wells for each experiment.
[0047] (4) Adding 10 .mu.l Lysis Solution (10.times.) to the
largest release well (positive control), and incubating for 45
min-60 min. Meanwhile, placing three replicate wells each
experiment.
[0048] (5) Taking out 50 ul of the test sample and the control
sample in the above 3 and 4 steps, respectively, and adding in the
fresh 96-well microtiter plate, then adding the assay buffer and
the substance mix, followed by being protected from light for 30
minutes.
[0049] (6) Adding 50 .mu.l stop solution.
[0050] (7) Absorbance values were measured at 490 nm or 492 nm in
an hour.
[0051] (8) Killing rate=experimental group LDH (OD)/Max LDH release
group (OD).
[0052] (9) Calculation formula: Killing
efficiency=(experimental-effector spontaneous-target
spontaneous)/(target maximum-target spontaneous).times.100%.
[0053] The results showed that the prepared Anti ROBO1-FN3-CART
cells could significantly kill the target cell lines MCF-7/ROBO1
and SMCC7721 with high expression of ROBO1, and the different
proportions of ROBO1 CAR-T and target cells were incubated for 4
hours, followed by being detected by ELISA experiment, which shown
that the cell killing efficiency also increased (see FIG. 5), and
microscopic imaging showed significant death of tumor cells (FIG.
4) with the increasing of the E:T ratio.
[0054] The above is only the embodiment of the present invention,
and thus does not limit the scope of the patent of the present
invention. Any equivalent structure or equivalent process
transformation made by using the content of the description of the
present invention, or other related technical fields were directly
or indirectly applied, all the same was included in the scope of
patent protection of the present invention.
TABLE-US-00001 SEQUENCE LISTING The amino acid sequence of CD8.TM.
SEQ ID NO: 1 is: IYIWAPLAGTCGVLLLSLVITLYC The sequence of 4-1BB SEQ
ID NO: 2 is: KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL The
sequence of CD28 SEQ ID NO: 3 is:
RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS The molecular sequence of
CD3.zeta. SEQ ID NO: 4 is:
RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP
RRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATK DTYDALHMQALPPR
The sequence of SCFV (Anti ROBO1-FN3) SEQ ID NO: 5 is:
IQMTQTTSSLSASLGDRVTISCRASQDISNFLNWYQQKPDGTVKLLIYY
TSRLHSGVPSRFSGSGSGTDFSLTISKLEQEDIATYFCQQGNTLPLTFG
AGTKLELKGGGGSGGGGSGGGGSLQQSGPELVKPGASVKISCKASGYTF
TDYYMNWVKLSHGKSLEWIGDIVPNNGDTTYNQNFRGKATLTVDKSSST
AYMELRSLTSEDSAVYYCARFSNYVYPFDYWGQGTTITVS The sequence of SCFV (Anti
ROBO1-FN3)-CD8.TM.- 4-1BB-CD3.zeta. fusion protein SEQ ID NO: 6 is:
MALPVTALLLPLALLLHAARPIQMTQTTSSLSASLGDRVTISCRASQDI
SNFLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDFSLTISKL
EQEDIATYFCQQGNTLPLTFGAGTKLELKGGGGSGGGGSGGGGSLQQSG
PELVKPGASVKISCKASGYTFTDYYMNWVKLSHGKSLEWIGDIVPNNGD
TTYNQNFRGKATLTVDKSSSTAYMELRSLTSEDSAVYYCARFSNYVYPF
DYWGQGTTITVSTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHT
RGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMR
PVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNEL
NLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSE
IGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR The nucleotide sequence
SCFV (Anti ROBO1-FN3)- CD8.TM.-4-1BB-CD3.zeta. fusion protein SEQ
ID NO: 7 is: ATGGCCCTGCCTGTGACAGCCCTGCTGCTGCCTCTGGCTCTGCTGCTGC
ATGCCGCTAGACCCATCCAGATGACACAGACTACATCCTCCCTGTCTGC
CTCTCTGGGAGACAGAGTCACCATCAGTTGCAGGGCAAGTCAGGACATT
AGCAATTTTTTAAACTGGTATCAGCAGAAACCAGATGGAACTGTTAAAC
TCCTGATCTACTACACATCAAGATTACATTCTGGAGTCCCATCAAGGTT
CAGTGGCAGTGGGTCTGGAACAGATTTTTCTCTCACCATTAGCAAACTG
GAGCAAGAAGATATTGCCACTTACTTTTGCCAACAGGGTAATACGCTTC
CACTTACGTTCGGCGCTGGGACAAAGTTGGAACTTAAAGGTGGTGGTGG
TTCTGGCGGCGGCGGCTCCGGAGGAGGAGGATCGCTGCAACAGTCTGGA
CCTGAGTTGGTGAAGCCTGGGGCTTCAGTGAAGATTTCCTGCAAGGCTT
CTGGATACACATTCACTGACTACTACATGAATTGGGTGAAGCTTAGCCA
TGGAAAGAGCCTTGAGTGGATTGGAGATATTGTTCCTAACAATGGTGAT
ACTACTTACAACCAGAATTTCAGAGGCAAGGCCACATTGACTGTAGACA
AGTCCTCCAGCACAGCCTACATGGAGCTCCGCAGCCTGACATCTGAGGA
CTCTGCAGTCTATTACTGTGCAAGATTCAGTAATTACGTTTACCCTTTT
GACTACTGGGGCCAAGGCACCACTATCACAGTCTCCACCACGACGCCAG
CGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTC
CCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACG
AGGGGGCTGGACTTCGCCTGTGATATCTACATCTGGGCGCCCTTGGCCG
GGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCACCCTTTACTGCAA
ACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGA
CCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAG
AAGAAGAAGAAGGAGGATGTGAACTGAGAGTGAAGTTCAGCAGGAGCGC
AGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTC
AATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCC
GGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGG
CCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAG
ATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTT
ACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACAT
GCAGGCCCTGCCCCCTCG
Sequence CWU 1
1
7124PRTHomo SapiensSEQ ID NO1 - Human 1Ile Tyr Ile Trp Ala Pro Leu
Ala Gly Thr Cys Gly Val Leu Leu Leu1 5 10 15Ser Leu Val Ile Thr Leu
Tyr Cys 20242PRTHomo SapiensSEQ ID NO2 - Human 2Lys Arg Gly Arg Lys
Lys Leu Leu Tyr Ile Phe Lys Gln Pro Phe Met1 5 10 15Arg Pro Val Gln
Thr Thr Gln Glu Glu Asp Gly Cys Ser Cys Arg Phe 20 25 30Pro Glu Glu
Glu Glu Gly Gly Cys Glu Leu 35 40341PRTHomo SapiensSEQ ID NO3 -
Human 3Arg Ser Lys Arg Ser Arg Leu Leu His Ser Asp Tyr Met Asn Met
Thr1 5 10 15Pro Arg Arg Pro Gly Pro Thr Arg Lys His Tyr Gln Pro Tyr
Ala Pro 20 25 30Pro Arg Asp Phe Ala Ala Tyr Arg Ser 35
404112PRTArtificial SequenceSEQ ID NO4 - Synthetic 4Arg Val Lys Phe
Ser Arg Ser Ala Asp Ala Pro Ala Tyr Lys Gln Gly1 5 10 15Gln Asn Gln
Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr 20 25 30Asp Val
Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys 35 40 45Pro
Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln Lys 50 55
60Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu Arg65
70 75 80Arg Arg Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr
Ala 85 90 95Thr Lys Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro
Pro Arg 100 105 1105236PRTArtificial SequenceSEQ ID NO5 - Synthetic
5Ile Gln Met Thr Gln Thr Thr Ser Ser Leu Ser Ala Ser Leu Gly Asp1 5
10 15Arg Val Thr Ile Ser Cys Arg Ala Ser Gln Asp Ile Ser Asn Phe
Leu 20 25 30Asn Trp Tyr Gln Gln Lys Pro Asp Gly Thr Val Lys Leu Leu
Ile Tyr 35 40 45Tyr Thr Ser Arg Leu His Ser Gly Val Pro Ser Arg Phe
Ser Gly Ser 50 55 60Gly Ser Gly Thr Asp Phe Ser Leu Thr Ile Ser Lys
Leu Glu Gln Glu65 70 75 80Asp Ile Ala Thr Tyr Phe Cys Gln Gln Gly
Asn Thr Leu Pro Leu Thr 85 90 95Phe Gly Ala Gly Thr Lys Leu Glu Leu
Lys Gly Gly Gly Gly Ser Gly 100 105 110Gly Gly Gly Ser Gly Gly Gly
Gly Ser Leu Gln Gln Ser Gly Pro Glu 115 120 125Leu Val Lys Pro Gly
Ala Ser Val Lys Ile Ser Cys Lys Ala Ser Gly 130 135 140Tyr Thr Phe
Thr Asp Tyr Tyr Met Asn Trp Val Lys Leu Ser His Gly145 150 155
160Lys Ser Leu Glu Trp Ile Gly Asp Ile Val Pro Asn Asn Gly Asp Thr
165 170 175Thr Tyr Asn Gln Asn Phe Arg Gly Lys Ala Thr Leu Thr Val
Asp Lys 180 185 190Ser Ser Ser Thr Ala Tyr Met Glu Leu Arg Ser Leu
Thr Ser Glu Asp 195 200 205Ser Ala Val Tyr Tyr Cys Ala Arg Phe Ser
Asn Tyr Val Tyr Pro Phe 210 215 220Asp Tyr Trp Gly Gln Gly Thr Thr
Ile Thr Val Ser225 230 2356480PRTArtificial SequenceSEQ ID NO6 -
Synthetic 6Met Ala Leu Pro Val Thr Ala Leu Leu Leu Pro Leu Ala Leu
Leu Leu1 5 10 15His Ala Ala Arg Pro Ile Gln Met Thr Gln Thr Thr Ser
Ser Leu Ser 20 25 30Ala Ser Leu Gly Asp Arg Val Thr Ile Ser Cys Arg
Ala Ser Gln Asp 35 40 45Ile Ser Asn Phe Leu Asn Trp Tyr Gln Gln Lys
Pro Asp Gly Thr Val 50 55 60Lys Leu Leu Ile Tyr Tyr Thr Ser Arg Leu
His Ser Gly Val Pro Ser65 70 75 80Arg Phe Ser Gly Ser Gly Ser Gly
Thr Asp Phe Ser Leu Thr Ile Ser 85 90 95Lys Leu Glu Gln Glu Asp Ile
Ala Thr Tyr Phe Cys Gln Gln Gly Asn 100 105 110Thr Leu Pro Leu Thr
Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys Gly 115 120 125Gly Gly Gly
Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Leu Gln 130 135 140Gln
Ser Gly Pro Glu Leu Val Lys Pro Gly Ala Ser Val Lys Ile Ser145 150
155 160Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr Tyr Met Asn Trp
Val 165 170 175Lys Leu Ser His Gly Lys Ser Leu Glu Trp Ile Gly Asp
Ile Val Pro 180 185 190Asn Asn Gly Asp Thr Thr Tyr Asn Gln Asn Phe
Arg Gly Lys Ala Thr 195 200 205Leu Thr Val Asp Lys Ser Ser Ser Thr
Ala Tyr Met Glu Leu Arg Ser 210 215 220Leu Thr Ser Glu Asp Ser Ala
Val Tyr Tyr Cys Ala Arg Phe Ser Asn225 230 235 240Tyr Val Tyr Pro
Phe Asp Tyr Trp Gly Gln Gly Thr Thr Ile Thr Val 245 250 255Ser Thr
Thr Thr Pro Ala Pro Arg Pro Pro Thr Pro Ala Pro Thr Ile 260 265
270Ala Ser Gln Pro Leu Ser Leu Arg Pro Glu Ala Cys Arg Pro Ala Ala
275 280 285Gly Gly Ala Val His Thr Arg Gly Leu Asp Phe Ala Cys Asp
Ile Tyr 290 295 300Ile Trp Ala Pro Leu Ala Gly Thr Cys Gly Val Leu
Leu Leu Ser Leu305 310 315 320Val Ile Thr Leu Tyr Cys Lys Arg Gly
Arg Lys Lys Leu Leu Tyr Ile 325 330 335Phe Lys Gln Pro Phe Met Arg
Pro Val Gln Thr Thr Gln Glu Glu Asp 340 345 350Gly Cys Ser Cys Arg
Phe Pro Glu Glu Glu Glu Gly Gly Cys Glu Leu 355 360 365Arg Val Lys
Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln Gly 370 375 380Gln
Asn Gln Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr385 390
395 400Asp Val Leu Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly
Lys 405 410 415Pro Arg Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu
Leu Gln Lys 420 425 430Asp Lys Met Ala Glu Ala Tyr Ser Glu Ile Gly
Met Lys Gly Glu Arg 435 440 445Arg Arg Gly Lys Gly His Asp Gly Leu
Tyr Gln Gly Leu Ser Thr Ala 450 455 460Thr Lys Asp Thr Tyr Asp Ala
Leu His Met Gln Ala Leu Pro Pro Arg465 470 475
48071439DNAArtificial SequenceSEQ ID NO7 - Synthetic 7atggccctgc
ctgtgacagc cctgctgctg cctctggctc tgctgctgca tgccgctaga 60cccatccaga
tgacacagac tacatcctcc ctgtctgcct ctctgggaga cagagtcacc
120atcagttgca gggcaagtca ggacattagc aattttttaa actggtatca
gcagaaacca 180gatggaactg ttaaactcct gatctactac acatcaagat
tacattctgg agtcccatca 240aggttcagtg gcagtgggtc tggaacagat
ttttctctca ccattagcaa actggagcaa 300gaagatattg ccacttactt
ttgccaacag ggtaatacgc ttccacttac gttcggcgct 360gggacaaagt
tggaacttaa aggtggtggt ggttctggcg gcggcggctc cggaggagga
420ggatcgctgc aacagtctgg acctgagttg gtgaagcctg gggcttcagt
gaagatttcc 480tgcaaggctt ctggatacac attcactgac tactacatga
attgggtgaa gcttagccat 540ggaaagagcc ttgagtggat tggagatatt
gttcctaaca atggtgatac tacttacaac 600cagaatttca gaggcaaggc
cacattgact gtagacaagt cctccagcac agcctacatg 660gagctccgca
gcctgacatc tgaggactct gcagtctatt actgtgcaag attcagtaat
720tacgtttacc cttttgacta ctggggccaa ggcaccacta tcacagtctc
caccacgacg 780ccagcgccgc gaccaccaac accggcgccc accatcgcgt
cgcagcccct gtccctgcgc 840ccagaggcgt gccggccagc ggcggggggc
gcagtgcaca cgagggggct ggacttcgcc 900tgtgatatct acatctgggc
gcccttggcc gggacttgtg gggtccttct cctgtcactg 960gttatcaccc
tttactgcaa acggggcaga aagaaactcc tgtatatatt caaacaacca
1020tttatgagac cagtacaaac tactcaagag gaagatggct gtagctgccg
atttccagaa 1080gaagaagaag gaggatgtga actgagagtg aagttcagca
ggagcgcaga cgcccccgcg 1140taccagcagg gccagaacca gctctataac
gagctcaatc taggacgaag agaggagtac 1200gatgttttgg acaagagacg
tggccgggac cctgagatgg ggggaaagcc gagaaggaag 1260aaccctcagg
aaggcctgta caatgaactg cagaaagata agatggcgga ggcctacagt
1320gagattggga tgaaaggcga gcgccggagg ggcaaggggc acgatggcct
ttaccagggt 1380ctcagtacag ccaccaagga cacctacgac gcccttcaca
tgcaggccct gccccctcg 1439
* * * * *