U.S. patent application number 17/590479 was filed with the patent office on 2022-08-18 for tropical disease vaccines.
This patent application is currently assigned to ModernaTX, Inc.. The applicant listed for this patent is ModernaTX, Inc.. Invention is credited to Giuseppe Ciaramella, Sunny Himansu, Eric Yi-Chun Huang, Tal Zaks.
Application Number | 20220257746 17/590479 |
Document ID | / |
Family ID | 1000006308185 |
Filed Date | 2022-08-18 |
United States Patent
Application |
20220257746 |
Kind Code |
A1 |
Ciaramella; Giuseppe ; et
al. |
August 18, 2022 |
TROPICAL DISEASE VACCINES
Abstract
The disclosure relates to tropical diseases such as viral
mosquito borne illnesses and the treatment thereof. The invention
includes ribonucleic acid vaccines and combination vaccines, as
well as methods of using the vaccines and compositions comprising
the vaccines for treating and preventing tropical disease.
Inventors: |
Ciaramella; Giuseppe;
(Sudbury, MA) ; Himansu; Sunny; (Winchester,
MA) ; Huang; Eric Yi-Chun; (Boston, MA) ;
Zaks; Tal; (Newton, MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
ModernaTX, Inc. |
Cambridge |
MA |
US |
|
|
Assignee: |
ModernaTX, Inc.
Cambridge
MA
|
Family ID: |
1000006308185 |
Appl. No.: |
17/590479 |
Filed: |
February 1, 2022 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16850519 |
Apr 16, 2020 |
11278611 |
|
|
17590479 |
|
|
|
|
16136503 |
Sep 20, 2018 |
10675342 |
|
|
16850519 |
|
|
|
|
15674591 |
Aug 11, 2017 |
10238731 |
|
|
16136503 |
|
|
|
|
PCT/US2016/058324 |
Oct 21, 2016 |
|
|
|
15674591 |
|
|
|
|
62351255 |
Jun 16, 2016 |
|
|
|
62247347 |
Oct 28, 2015 |
|
|
|
62247390 |
Oct 28, 2015 |
|
|
|
62247445 |
Oct 28, 2015 |
|
|
|
62247595 |
Oct 28, 2015 |
|
|
|
62244937 |
Oct 22, 2015 |
|
|
|
62244814 |
Oct 22, 2015 |
|
|
|
62245207 |
Oct 22, 2015 |
|
|
|
62244950 |
Oct 22, 2015 |
|
|
|
62245031 |
Oct 22, 2015 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61K 9/0019 20130101;
A61K 39/015 20130101; A61P 11/00 20180101; A61K 2039/575 20130101;
C12N 2770/36134 20130101; Y02A 50/30 20180101; A61K 9/1271
20130101; A61K 9/513 20130101; A61K 2039/55555 20130101; A61K
2039/55511 20130101; A61K 39/42 20130101; A61K 39/39 20130101; A61K
2039/51 20130101; A61K 39/12 20130101; C12N 2770/24034 20130101;
A61K 2039/53 20130101; A61K 48/00 20130101; C12N 2770/24134
20130101; A61K 2039/5254 20130101 |
International
Class: |
A61K 39/12 20060101
A61K039/12; A61K 9/00 20060101 A61K009/00; A61K 9/127 20060101
A61K009/127; A61K 9/51 20060101 A61K009/51; A61K 39/015 20060101
A61K039/015; A61P 11/00 20060101 A61P011/00; A61K 39/39 20060101
A61K039/39; A61K 39/42 20060101 A61K039/42; A61K 48/00 20060101
A61K048/00 |
Claims
1.-185. (canceled)
186. A composition comprising a messenger ribonucleic acid (mRNA)
comprising an open reading frame (ORF) encoding a Zika virus (ZIKV)
polypeptide comprising an amino acid sequence having at least 90%
identity to the amino acid sequence of SEQ ID NO: 219 and an mRNA
comprising an ORF encoding at least one Dengue virus (DENV)
polypeptide.
187. The composition of claim 186, wherein the ZIKV polypeptide
comprises an amino acid sequence having at least 95% identity to
the amino acid sequence of SEQ ID NO: 219.
188. The composition of claim 187, wherein the ZIKV polypeptide
comprises the amino acid sequence of SEQ ID NO: 219.
189. The composition of claim 186, wherein the mRNA comprises a
chemical modification.
190. The composition of claim 189, wherein the chemical
modification is 1-methylpseudouridine.
191. The composition of claim 190, wherein the chemical
modification is in the carbon-5 position of uracil.
192. The composition of claim 186, wherein the RNA polynucleotide
further comprises a 5' terminal cap.
193. The composition of claim 192, wherein the 5' terminal cap is
7mG(5')ppp(5')NlmpNp.
194. The composition of claim 186, wherein the composition further
comprises a lipid nanoparticle.
195. The composition of claim 194, wherein the lipid nanoparticle
comprises an ionizable cationic lipid, a neutral lipid, a sterol,
and polyethylene glycol (PEG)-modified lipid.
196. The composition of claim 195, wherein the lipid nanoparticle
comprises 20-60 mol % ionizable cationic lipid, 5-25 mol % neutral
lipid, 25-55 mol % sterol, and 0.5-15 mol % PEG-modified lipid.
197. The composition of claim 195, wherein the ionizable cationic
lipid is Compound 25, the neutral lipid is
1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC), the sterol is
cholesterol, and the PEG-modified lipid is PEG-distearoyl glycerol
(PEG-DMG).
198. A composition comprising: an mRNA comprising an open reading
frame encoding a ZIKV polypeptide comprises an amino acid sequence
having at least 90% identity to the amino acid sequence of SEQ ID
NO: 219, an mRNA comprising an ORF encoding at least one DENV
polypeptide, and a lipid nanoparticle that comprises 40-50 mol %
ionizable cationic lipid, 10-20 mol % neutral lipid, 35-45 mol %
sterol, and 1-5 mol % PEG-modified lipid.
199. The composition of claim 198, wherein the ZIKV polypeptide
comprises an amino acid sequence having at least 95% identity to
the amino acid sequence of SEQ ID NO: 219.
200. The composition of claim 199, wherein the ZIKV polypeptide
comprises the amino acid sequence of SEQ ID NO: 219.
201. The composition of claim 200, wherein the ionizable cationic
lipid is Compound 25, the neutral lipid is DSPC, the sterol is
cholesterol, and the PEG-modified lipid is PEG-DMG.
202. The composition of claim 201, wherein the mRNA comprises a
chemical modification selected from 1-methylpseudouridine.
203. The composition of claim 202, wherein the mRNA comprises a
7mG(5')ppp(5')NlmpNp 5' terminal cap and a polyA tail.
204. A method comprising administering to a subject the composition
of claim 186.
205. A method comprising administering to a subject the composition
of claim 203.
Description
RELATED APPLICATIONS
[0001] This application is a continuation of U.S. application Ser.
No. 16/850,519, filed Apr. 16, 2020, which is a continuation of
U.S. application Ser. No. 16/136,503, filed Sep. 20, 2018, which is
a continuation of U.S. application Ser. No. 15/674,591, filed Aug.
11, 2017, which is a continuation of international application
number PCT/US2016/058324, filed Oct. 21, 2016, which was published
under PCT Article 21(2) in English, and which claims the benefit
under 35 U.S.C. .sctn. 119(e) of U.S. provisional application No.
62/351,255, filed Jun. 16, 2016, U.S. provisional application No.
62/247,347, filed Oct. 28, 2015, U.S. provisional application No.
62/247,390, filed Oct. 28, 2015, U.S. provisional application No.
62/247,445, filed Oct. 28, 2015, U.S. provisional application No.
62/247,595, filed Oct. 28, 2015, U.S. provisional application No.
62/244,937, filed Oct. 22, 2015, U.S. provisional application No.
62/244,814, filed Oct. 22, 2015, U.S. provisional application No.
62/245,207, filed Oct. 22, 2015, U.S. provisional application No.
62/244,950, filed Oct. 22, 2015, U.S. provisional application No.
62/245,031, filed Oct. 22, 2015, each of which is incorporated by
reference herein in its entirety.
REFERENCE TO A SEQUENCE LISTING SUBMITTED AS A TEXT FILE VIA
EFS-WEB
[0002] The instant application contains a Sequence Listing which
has been submitted in ASCII format via EFS-Web and is hereby
incorporated by reference in its entirety. Said ASCII copy, created
on Feb. 1, 2022, is named M137870030US09-SEQ-HJD and is 1,774,863
bytes in size.
BACKGROUND
[0003] Insects such as mosquitoes cause significant human suffering
by transmission of infectious disease to humans. The infections
carried by mosquitoes afflict humans, as well as companion animals
such as dogs and horses. Infectious agents transmitted by mosquitos
cause illnesses such as encephalitis, Chikungunya, yellow fever,
West Nile fever, malaria, and Dengue. The transmission of diseases
associated with mosquito bites can be interrupted by killing the
mosquitoes, isolating infected people from all mosquitoes while
they are infectious or vaccinating the exposed population.
[0004] Deoxyribonucleic acid (DNA) vaccination is one technique
used to stimulate humoral and cellular immune responses to foreign
antigens, such as Malaria, JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV,
ZIKV and YFV antigens. The direct injection of genetically
engineered DNA (e.g., naked plasmid DNA) into a living host results
in a small number of its cells directly producing an antigen,
resulting in a protective immunological response. With this
technique, however, comes potential problems, including the
possibility of insertional mutagenesis, which could lead to the
activation of oncogenes or the inhibition of tumor suppressor
genes.
SUMMARY
[0005] Provided herein are ribonucleic acid (RNA) vaccines that
build on the knowledge that RNA (e.g., messenger RNA (mRNA)) can
safely direct the body's cellular machinery to produce nearly any
protein of interest, from native proteins to antibodies and other
entirely novel protein constructs that can have therapeutic
activity inside and outside of cells. The RNA (e.g., mRNA) vaccines
of the present disclosure may be used to induce a balanced immune
response against Malaria (e.g., P. falciparum, P. vivax, P.
malariae and/or P. ovale), Japanese Encephalitis Virus (JEV), West
Nile Virus (WNV), Eastern Equine Encephalitis Virus (EEEV),
Venezuelan Equine Encephalitis Virus (VEEV), Sindbis Virus (SINV),
Chikungunya Virus (CHIKV), Dengue Virus (DENV), Zika Virus (ZIKV)
and/or Yellow Fever Virus (YFV), comprising both cellular and
humoral immunity, without risking the possibility of insertional
mutagenesis, for example. Malaria (e.g., P. falciparum, P. vivax,
P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV,
DENV, ZIKV and/or YFV are referred to herein as "tropical
diseases." Thus, the terms "tropical disease vaccines" and "Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale), JEV,
WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV" encompass
Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale) RNA vaccines, JEV RNA vaccines, WNV RNA vaccines, EEEV RNA
vaccines, SINV RNA vaccines, CHIKV RNA vaccines, DENV RNA vaccines,
ZIKV RNA vaccines, YFV RNA vaccines, and combination vaccines
comprising at least two (e.g., at least 3, 4, 5, 6, 7, 8 or 9) of
any of the Malaria (e.g., P. falciparum, P. vivax, P. malariae
and/or P. ovale) RNA vaccines, JEV RNA vaccines, WNV RNA vaccines,
EEEV RNA vaccines, SINV RNA vaccines, CHIKV RNA vaccines, DENV RNA
vaccines, ZIKV RNA vaccines, and YFV RNA vaccines.
[0006] The RNA (e.g., mRNA) vaccines may be utilized in various
settings depending on the prevalence of the infection or the degree
or level of unmet medical need. The RNA (e.g. mRNA) vaccines may be
utilized to treat and/or prevent Malaria (e.g., P. falciparum, P.
vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV,
CHIKV, DENV, ZIKV and/or YFV of various genotypes, strains, and
isolates. The RNA (e.g., mRNA) vaccines have superior properties in
that they produce much larger antibody titers and responses earlier
than commercially available anti-viral therapeutic treatments.
While not wishing to be bound by theory, it is believed that the
RNA (e.g., mRNA) vaccines, as mRNA polynucleotides, are better
designed to produce the appropriate protein conformation upon
translation, as the RNA (e.g., mRNA) vaccines co-opt natural
cellular machinery. Unlike traditional vaccines, which are
manufactured ex vivo and may trigger unwanted cellular responses,
RNA (e.g., mRNA) vaccines are presented to the cellular system in a
more native fashion.
[0007] Surprisingly, it has been shown that efficacy of mRNA
vaccines can be significantly enhanced when combined with a
flagellin adjuvant, in particular, when one or more
antigen-encoding mRNA is combined with an mRNA encoding flagellin.
RNA (e.g., mRNA) vaccines combined with the flagellin adjuvant
(e.g., mRNA-encoded flagellin adjuvant) have superior properties in
that they may produce much larger antibody titers and produce
responses earlier than commercially available vaccine
formulations.
[0008] Some embodiments of the present disclosure provide RNA
(e.g., mRNA) vaccines that include at least one RNA (e.g., mRNA)
polynucleotide having an open reading frame encoding at least one
antigenic polypeptide or an immunogenic fragment thereof (e.g., an
immunogenic fragment capable of inducing an immune response to the
antigenic polypeptide) and at least one RNA (e.g., mRNA
polynucleotide) having an open reading frame encoding a flagellin
adjuvant.
[0009] In some embodiments, at least one flagellin polypeptide
(e.g., encoded flagellin polypeptide) is a flagellin protein. In
some embodiments, at least one flagellin polypeptide (e.g., encoded
flagellin polypeptide) is an immunogenic flagellin fragment. In
some embodiments, at least one flagellin polypeptide and at least
one antigenic polypeptide are encoded by a single RNA (e.g., mRNA)
polynucleotide. In other embodiments, at least one flagellin
polypeptide and at least one antigenic polypeptide are each encoded
by a different RNA polynucleotide.
[0010] In some embodiments at least one flagellin polypeptide has
at least 80%, at least 85%, at least 90%, or at least 95% identity
to a flagellin polypeptide having a sequence of SEQ ID NO:
420-422.
[0011] Provided herein, in some embodiments, is a ribonucleic acid
(RNA) (e.g., mRNA) vaccine, comprising at least one (e.g., at least
2, 3, 4 or 5) RNA (e.g., mRNA) polynucleotide having an open
reading frame encoding at least one (e.g., at least 2, 3, 4 or 5)
Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
antigenic polypeptide, or any combination of two or more of the
foregoing antigenic polypeptides. Herein, use of the term
"antigenic polypeptide" encompasses immunogenic fragments of the
antigenic polypeptide (an immunogenic fragment that induces (or is
capable of inducing) an immune response to Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV) unless otherwise
stated.
[0012] Also provided herein, in some embodiments, is a RNA (e.g.,
mRNA) vaccine comprising at least one (e.g., at least 2, 3, 4 or 5)
RNA polynucleotide having an open reading frame encoding at least
one (e.g., at least 2, 3, 4 or 5) Malaria (e.g., P. falciparum, P.
vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV,
CHIKV, DENV, ZIKV and/or YFV antigenic polypeptide or an
immunogenic fragment thereof, linked to a signal peptide.
[0013] Further provided herein, in some embodiments, is a nucleic
acid (e.g., DNA) encoding at least one (e.g., at least 2, 3, 4 or
5) Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
RNA (e.g., mRNA) polynucleotide.
[0014] Further still, provided herein, in some embodiments, is a
method of inducing an immune response in a subject, the method
comprising administering to the subject a vaccine comprising at
least one (e.g., at least 2, 3, 4 or 5) RNA (e.g., mRNA)
polynucleotide having an open reading frame encoding at least one
(e.g., at least 2, 3, 4 or 5) Malaria (e.g., P. falciparum, P.
vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV,
CHIKV, DENV, ZIKV and/or YFV antigenic polypeptide, or any
combination of two or more of the foregoing antigenic
polypeptides.
[0015] Malaria
[0016] Some embodiments of the present disclosure provide Malaria
vaccines that include at least one ribonucleic acid (RNA)
polynucleotide having an open reading frame encoding at least one
Plasmodium (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale) antigenic polypeptide or an immunogenic fragment thereof
(e.g., an immunogenic fragment capable of raising an immune
response to Plasmodium).
[0017] In some embodiments, the antigenic polypeptide is a
circumsporozoite (CS) protein or an immunogenic fragment thereof
(e.g., capable of raising an immune response against
Plasmodium).
[0018] In some embodiments, the CS protein or fragment is fused to
the surface antigen from hepatitis B (HBsAg). In some embodiments,
the CS protein or fragment is in the form of a hybrid protein
comprising substantially all the C-terminal portion of the CS
protein of Plasmodium, four or more tandem repeats of the CS
protein immunodominant region, and the surface antigen from
hepatitis B (HBsAg). In some embodiments, the hybrid protein
comprises a sequence of CS protein of Plasmodium falciparum:
substantially as corresponding to amino acids 207-395 of P.
falciparum NF54 strain 3D7 clone CS protein fused in frame via a
linear linker to the N-terminal of HBsAg (Ballou W R et al. Am J
Trop Med Hyg 2004; 71(2_suppl):239-247, incorporated herein by
reference).
[0019] In some embodiments, the hybrid protein is RTS. In some
embodiments, the RTS is in the form of mixed particles RTS,S. In
some embodiments, the amount of RTS,S is 25 .mu.g or 50 .mu.g per
dose.
[0020] In some embodiments, the antigenic polypeptide is liver
stage antigen 1 (LSA1) or an immunogenic fragment thereof. In some
embodiments, the antigenic polypeptide is LSA-NRC.
[0021] In some embodiments, the antigenic polypeptide is merozoite
surface protein-1 (MSP1) or an immunogenic fragment thereof.
[0022] In some embodiments, the antigenic polypeptide is apical
membrane antigen 1 (AMA1) or an immunogenic fragment thereof.
[0023] In some embodiments, the antigenic polypeptide is
thrombospondin related adhesive protein (TRAP) or an immunogenic
fragment thereof.
[0024] In some embodiments, at least one RNA polynucleotide is
encoded by at least one nucleic acid sequence identified by any one
of SEQ ID NO: 1-6 (Table 1) and homologs having at least 80%
identity with a nucleic acid sequence identified by any one of SEQ
ID NO: 1-6 (Table 1). In some embodiments, at least one RNA
polynucleotide is encoded by at least one nucleic acid sequence
identified by any one of SEQ ID NO: 1-6 (Table 1) and homologs
having at least 90% (90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99%, 99.8% or 99.9%) identity with a nucleic acid sequence
identified by any one of SEQ ID NO: 1-6 (Table 1). In some
embodiments, at least one RNA polynucleotide is encoded by at least
one fragment of a nucleic acid sequence identified by any one of
SEQ ID NO: 1-6 (Table 1).
[0025] In some embodiments, at least one RNA polynucleotide
comprises at least one nucleic acid sequence identified by any one
of SEQ ID NO: 7-12 (Table 1) and homologs having at least 80%
identity with a nucleic acid sequence identified by any one of SEQ
ID NO: 7-12 (Table 1). In some embodiments, at least one RNA
polynucleotide comprises at least one nucleic acid sequence
identified by any one of SEQ ID NO: 7-12 (Table 1) and homologs
having at least 90% (90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99%, 99.8% or 99.9%) identity with a nucleic acid sequence
identified by any one of SEQ ID NO: 7-12 (Table 1). In some
embodiments, at least one RNA polynucleotide comprises at least one
fragment of a nucleic acid sequence identified by any one of SEQ ID
NO: 7-12 (Table 1).
[0026] In some embodiments, the at least one RNA polynucleotide
encodes at least one antigenic polypeptide having a sequence
identified by any one of SEQ ID NO: 13-17 (Table 2 and 3). In some
embodiments, the at least one RNA polynucleotide encodes at least
one protein variant having at least 95% identity to an antigenic
polypeptide having a sequence identified by any one of SEQ ID NO:
13-17 (Table 2 and 3). In some embodiments, at least one antigenic
polypeptide has an amino acid sequence identified by any one of SEQ
ID NO: 13-17 (Table 2 and 3). In some embodiments, at least one
antigenic polypeptide has at least 95% identity to an antigenic
polypeptide having a sequence identified by any one of SEQ ID NO:
13-17 (Table 2 and 3).
[0027] Japanese Encephalitis Virus (JEV) Some embodiments of the
present disclosure provide JEV vaccines that include at least one
ribonucleic acid (RNA) polynucleotide having an open reading frame
encoding at least one JEV antigenic polypeptide or an immunogenic
fragment thereof (e.g., an immunogenic fragment capable of inducing
an immune response to JEV).
[0028] In some embodiments, at least one antigenic polypeptide is
JEV E protein, JEV Es, JEV prM, JEV capsid, JEV NS1, JEV prM and E
polyprotein (prME) or an immunogenic fragment thereof. In some
embodiments, at least one antigenic polypeptide has at least 80%,
85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% sequence identity to JEV E
protein, JEV Es, JEV prM, JEV capsid, prME or JEV NS1.
[0029] In some embodiments, at least one RNA polynucleotide is
encoded by at least one nucleic acid sequence identified by any one
of SEQ ID NO: 18-19 (Table 4) and homologs having at least 80%
identity with a nucleic acid sequence identified by any one of SEQ
ID NO: 18-19 (Table 4). In some embodiments, at least one RNA
polynucleotide is encoded by at least one nucleic acid sequence
identified by any one of SEQ ID NO: 18-19 (Table 4) and homologs
having at least 90% (90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99%, 99.8% or 99.9%) identity with a nucleic acid sequence
identified by any one of SEQ ID NO: 18-19 (Table 4). In some
embodiments, at least one RNA polynucleotide is encoded by at least
one fragment of a nucleic acid sequence identified by any one of
SEQ ID NO: 18-19 (Table 4).
[0030] In some embodiments, at least one RNA polynucleotide
comprises at least one nucleic acid sequence identified by any one
of SEQ ID NO: 20-21 (Table 4) and homologs having at least 80%
identity with a nucleic acid sequence identified by any one of SEQ
ID NO: 20-21 (Table 4). In some embodiments, at least one RNA
polynucleotide comprises at least one nucleic acid sequence
identified by any one of SEQ ID NO: 20-21 (Table 4) and homologs
having at least 90% (90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99%, 99.8% or 99.9%) identity with a nucleic acid sequence
identified by any one of SEQ ID NO: 20-21 (Table 4). In some
embodiments, at least one RNA polynucleotide comprises at least one
fragment of a nucleic acid sequence identified by any one of SEQ ID
NO: 20-21 (Table 4).
[0031] In some embodiments, the at least one RNA polynucleotide
encodes at least one antigenic polypeptide having a sequence
identified by any one of SEQ ID NO: 22-29 (Table 5 and 6). In some
embodiments, the at least one RNA polynucleotide encodes at least
one protein variant having at least 95% identity to an antigenic
polypeptide having a sequence identified by any one of SEQ ID NO:
22-29 (Table 5 and 6). In some embodiments, at least one antigenic
polypeptide has an amino acid sequence identified by any one of SEQ
ID NO: 22-29 (Table 5 and 6). In some embodiments, at least one
antigenic polypeptide has at least 95% identity to an antigenic
polypeptide having a sequence identified by any one of SEQ ID NO:
22-29 (Table 5 and 6).
[0032] West Nile Virus (WNV), Eastern Equine Encephalitis (EEEV),
Venezuelan Equine Encephalitis Virus (VEEV), and Sindbis Virus
(SINV)
[0033] Some embodiments of the present disclosure provide
combination vaccines comprising one or more RNA (e.g., mRNA)
polynucleotides. The RNA polynucleotide(s) encode one or more
Arbovirus antigens and/or one or more Alphavirus antigens, on
either the same polynucleotide or different polynucleotides. RNA
polynucleotides featured in the vaccines of the present invention
can encode one antigen or can encode more than one antigen, e.g.,
several antigens (for example, polycistronic RNAs).
[0034] In some embodiments, at least one RNA polynucleotide is
encoded by at least one nucleic acid sequence identified by any one
of SEQ ID NO: 30-34, 48-49, 55-56 (Table 9, 12, 15) and homologs
having at least 80% identity with a nucleic acid sequence
identified by any one of SEQ ID NO: 30-34, 48-49, 55-56 (Table 9,
12, 15). In some embodiments, at least one RNA polynucleotide is
encoded by at least one nucleic acid sequence identified by any one
of SEQ ID NO: 30-34, 48-49, 55-56 (Table 9, 12, 15) and homologs
having at least 90% (90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99%, 99.8% or 99.9%) identity with a nucleic acid sequence
identified by any one of SEQ ID NO: 30-34, 48-49, 55-56 (Table 9,
12, 15). In some embodiments, at least one RNA polynucleotide is
encoded by at least one fragment of a nucleic acid sequence
identified by any one of SEQ ID NO: 30-34, 48-49, 55-56 (Table 9,
12, 15).
[0035] In some embodiments, at least one RNA polynucleotide
comprises at least one nucleic acid sequence identified by any one
of SEQ ID NO: 35-39, 50-51, 57-58 (Table 9, 12, 15) and homologs
having at least 80% identity with a nucleic acid sequence
identified by any one of SEQ ID NO: 35-39, 50-51, 57-58 (Table 9,
12, 15). In some embodiments, at least one RNA polynucleotide
comprises at least one nucleic acid sequence identified by any one
of SEQ ID NO: 35-39, 50-51, 57-58 (Table 9, 12, 15) and homologs
having at least 90% (90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99%, 99.8% or 99.9%) identity with a nucleic acid sequence
identified by any one of SEQ ID NO: 35-39, 50-51, 57-58 (Table 9,
12, 15). In some embodiments, at least one RNA polynucleotide
comprises at least one fragment of a nucleic acid sequence
identified by any one of SEQ ID NO: 35-39, 50-51, 57-58 (Table 9,
12, 15).
[0036] In some embodiments, the at least one RNA polynucleotide
encodes at least one antigenic polypeptide having a sequence
identified by any one of SEQ ID NO: 44-47, 52-54, 59-64 (Table 10,
11, 13, 14, 16, 17 and 18). In some embodiments, the at least one
RNA polynucleotide encodes at least one protein variant having at
least 95% identity to an antigenic polypeptide having a sequence
identified by any one of SEQ ID NO: 44-47, 52-54, 59-64 (Table 10,
11, 13, 14, 16, 17 and 18). In some embodiments, at least one
antigenic polypeptide has an amino acid sequence identified by any
one of SEQ ID NO: 44-47, 52-54, 59-64 (Table 10, 11, 13, 14, 16, 17
and 18). In some embodiments, at least one antigenic polypeptide
has at least 95% identity to an antigenic polypeptide having a
sequence identified by any one of SEQ ID NO: 44-47, 52-54, 59-64
(Table 10, 11, 13, 14, 16, 17 and 18).
[0037] Yellow Fever Virus (YFV)
[0038] Yellow fever is an acute viral haemorrhagic disease
transmitted by infected mosquitoes. The "yellow" in the name refers
to the jaundice that affects some patients. Symptoms of yellow
fever include fever, headache, jaundice, muscle pain, nausea,
vomiting and fatigue. A small proportion of patients who contract
the virus develop severe symptoms and approximately half of those
die within 7 to 10 days. Yellow fever virus (YFV) is endemic in
tropical areas of Africa and Central and South America. Large
epidemics of yellow fever occur when infected people introduce the
virus into heavily populated areas with high mosquito density and
where most people have little or no immunity, due to lack of
vaccination. In these conditions, infected mosquitoes transmit the
virus from person to person. Since the launch of the Yellow Fever
Initiative in 2006, significant progress in combatting the disease
has been made in West Africa and more than 105 million people have
been vaccinated in mass campaigns using an attenuated live vaccine.
Nonetheless, this vaccine can cause yellow fever vaccine-associated
viscerotropic disease as well as yellow fever vaccine-associated
neurotropic disease, each of which can be fatal.
[0039] Some embodiments of the present disclosure provide Yellow
fever virus (YFV) vaccines that include at least one ribonucleic
acid (RNA) polynucleotide (e.g., mRNA polynucleotide) having an
open reading frame encoding at least one YFV antigenic polypeptide
or an immunogenic fragment thereof (e.g., an immunogenic fragment
capable of inducing an immune response to YFV).
[0040] In some embodiments, the at least one antigenic polypeptide
is a YFV polyprotein.
[0041] In some embodiments, the at least one antigenic polypeptide
is a YFV capsid protein, a YFV premembrane/membrane protein, a YFV
envelope protein, a YFV non-structural protein 1, a YFV
non-structural protein 2A, a YFV non-structural protein 2B, a YFV
non-structural protein 3, a YFV non-structural protein 4A, a YFV
non-structural protein 4B, or a YFV non-structural protein 5.
[0042] In some embodiments, the at least one antigenic polypeptide
is a YFV capsid protein or an immunogenic fragment thereof, a YFV
premembrane/membrane protein or an immunogenic fragment thereof,
and a YFV envelope protein or an immunogenic fragment thereof.
[0043] In some embodiments, the at least one antigenic polypeptide
is a YFV capsid protein or an immunogenic fragment thereof and a
YFV premembrane/membrane protein or an immunogenic fragment
thereof.
[0044] In some embodiments, the at least one antigenic polypeptide
is a YFV capsid protein or an immunogenic fragment thereof and a
YFV envelope protein or an immunogenic fragment thereof.
[0045] In some embodiments, at least one antigenic polypeptide is a
YFV premembrane/membrane protein or an immunogenic fragment thereof
and a YFV envelope protein or an immunogenic fragment thereof.
[0046] In some embodiments, the at least one antigenic polypeptide
further comprises any one or more of a YFV non-structural protein
1, 2A, 2B, 3, 4A, 4B or 5.
[0047] In some embodiments, at least one RNA polynucleotide is
encoded by at least one nucleic acid sequence identified by any one
of SEQ ID NO: 65-80 (Table 21) and homologs having at least 80%
identity with a nucleic acid sequence identified by any one of SEQ
ID NO: 65-80 (Table 21). In some embodiments, at least one RNA
polynucleotide is encoded by at least one nucleic acid sequence
identified by any one of SEQ ID NO: 65-80 (Table 21) and homologs
having at least 90% (90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99%, 99.8% or 99.9%) identity with a nucleic acid sequence
identified by any one of SEQ ID NO: 65-80 (Table 21). In some
embodiments, at least one RNA polynucleotide is encoded by at least
one fragment of a nucleic acid sequence identified by any one of
SEQ ID NO: 65-80 (Table 21).
[0048] In some embodiments, at least one RNA polynucleotide
comprises at least one nucleic acid sequence identified by any one
of SEQ ID NO: 81-96 (Table 21) and homologs having at least 80%
identity with a nucleic acid sequence identified by any one of SEQ
ID NO: 81-96 (Table 21). In some embodiments, at least one RNA
polynucleotide comprises at least one nucleic acid sequence
identified by any one of SEQ ID NO: 81-96 (Table 21) and homologs
having at least 90% (90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99%, 99.8% or 99.9%) identity with a nucleic acid sequence
identified by any one of SEQ ID NO: 81-96 (Table 21). In some
embodiments, at least one RNA polynucleotide comprises at least one
fragment of a nucleic acid sequence identified by any one of SEQ ID
NO: 81-96 (Table 21).
[0049] In some embodiments, the at least one RNA polynucleotide
encodes at least one antigenic polypeptide having a sequence
identified by any one of SEQ ID NO: 97-117 (Table 22). In some
embodiments, the at least one RNA polynucleotide encodes at least
one protein variant having at least 95% identity to an antigenic
polypeptide having a sequence identified by any one of SEQ ID NO:
97-117 (Table 22). In some embodiments, at least one antigenic
polypeptide has an amino acid sequence identified by any one of SEQ
ID NO: 97-117 (Table 22). In some embodiments, at least one
antigenic polypeptide has at least 95% identity to an antigenic
polypeptide having a sequence identified by any one of SEQ ID NO:
97-117 (Table 22).
[0050] Zika Virus (ZIKV)
[0051] Zika virus (ZIKV) is a member of the Flaviviridae virus
family and the flavivirus genus. In humans, it causes a disease
known as Zika fever. It is related to dengue, yellow fever, West
Nile and Japanese encephalitis, viruses that are also members of
the virus family Flaviviridae. ZIKV is spread to people through
mosquito bites. The most common symptoms of ZIKV disease (Zika) are
fever, rash, joint pain, and red eye. The illness is usually mild
with symptoms lasting from several days to a week. There is no
vaccine to prevent, or medicine to treat, Zika virus.
[0052] Some embodiments of the present disclosure provide Zika
virus (ZIKV) vaccines that include at least one ribonucleic acid
(RNA) polynucleotide (e.g., mRNA polynucleotide) having an open
reading frame encoding at least one ZIKV antigenic polypeptide or
an immunogenic fragment thereof (e.g., an immunogenic fragment
capable of inducing an immune response to ZIKV).
[0053] In some embodiments, at least one antigenic polypeptide is a
ZIKV polyprotein. In some embodiments, at least one antigenic
polypeptide is a ZIKV structural polyprotein. In some embodiments,
at least one antigenic polypeptide is a ZIKV nonstructural
polyprotein.
[0054] In some embodiments, at least one antigenic polypeptide is a
ZIKV capsid protein, a ZIKV premembrane/membrane protein, a ZIKV
envelope protein, a ZIKV non-structural protein 1, a ZIKV
non-structural protein 2A, a ZIKV non-structural protein 2B, a ZIKV
non-structural protein 3, a ZIKV non-structural protein 4A, a ZIKV
non-structural protein 4B, or a ZIKV non-structural protein 5.
[0055] In some embodiments, at least one antigenic polypeptide is a
ZIKV capsid protein, a ZIKV premembrane/membrane protein, a ZIKV
envelope protein, a ZIKV non-structural protein 1, a ZIKV
non-structural protein 2A, a ZIKV non-structural protein 2B, a ZIKV
non-structural protein 3, a ZIKV non-structural protein 4A, a ZIKV
non-structural protein 4B, or a ZIKV non-structural protein 5.
[0056] In some embodiments, the vaccine comprises a RNA
polynucleotide having an open reading frame encoding a ZIKV capsid
protein, a RNA polynucleotide having an open reading frame encoding
a ZIKV premembrane/membrane protein, and a RNA polynucleotide
having an open reading frame encoding a ZIKV envelope protein.
[0057] In some embodiments, the vaccine comprises a RNA
polynucleotide having an open reading frame encoding a ZIKV capsid
protein and a RNA polynucleotide having an open reading frame
encoding a ZIKV premembrane/membrane protein.
[0058] In some embodiments, the vaccine comprises a RNA
polynucleotide having an open reading frame encoding a ZIKV capsid
protein and a RNA polynucleotide having an open reading frame
encoding a ZIKV envelope protein.
[0059] In some embodiments, the vaccine comprises a RNA
polynucleotide having an open reading frame encoding a ZIKV
premembrane/membrane protein and a RNA polynucleotide having an
open reading frame encoding a ZIKV envelope protein.
[0060] In some embodiments, the vaccine comprises a RNA
polynucleotide having an open reading frame encoding a ZIKV capsid
protein and at least one RNA polynucleotide having an open reading
frame encoding any one or more of a ZIKV non-structural protein 1,
2A, 2B, 3, 4A, 4B or 5.
[0061] In some embodiments, the vaccine comprises a RNA
polynucleotide having an open reading frame encoding a ZIKV
premembrane/membrane protein and at least one RNA polynucleotide
having an open reading frame encoding any one or more of a ZIKV
non-structural protein 1, 2A, 2B, 3, 4A, 4B or 5.
[0062] In some embodiments, the vaccine comprises a RNA
polynucleotide having an open reading frame encoding a ZIKV
envelope protein and at least one RNA polynucleotide having an open
reading frame encoding any one or more of a ZIKV non-structural
protein 1, 2A, 2B, 3, 4A, 4B or 5.
[0063] In some embodiments, the at least one antigenic polypeptide
comprises a combination of any two or more of a ZIKV capsid
protein, a ZIKV premembrane/membrane protein, a ZIKV envelope
protein, a ZIKV non-structural protein 1, a ZIKV non-structural
protein 2A, a ZIKV non-structural protein 2B, a ZIKV non-structural
protein 3, a ZIKV non-structural protein 4A, a ZIKV non-structural
protein 4B, or a ZIKV non-structural protein 5.
[0064] In some embodiments, at least one RNA polynucleotide is
encoded by at least one nucleic acid sequence identified by any one
of SEQ ID NO: 118-136 (Table 25) and homologs having at least 80%
identity with a nucleic acid sequence identified by any one of SEQ
ID NO: 118-136 (Table 25). In some embodiments, at least one RNA
polynucleotide is encoded by at least one nucleic acid sequence
identified by any one of SEQ ID NO: 118-136 (Table 25) and homologs
having at least 90% (90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99%, 99.8% or 99.9%) identity with a nucleic acid sequence
identified by any one of SEQ ID NO: 118-136 (Table 25). In some
embodiments, at least one RNA polynucleotide is encoded by at least
one fragment of a nucleic acid sequence identified by any one of
SEQ ID NO: 118-136 (Table 25).
[0065] In some embodiments, at least one RNA polynucleotide
comprises at least one nucleic acid sequence identified by any one
of SEQ ID NO: 137-155 (Table 25) and homologs having at least 80%
identity with a nucleic acid sequence identified by any one of SEQ
ID NO: 137-155 (Table 25). In some embodiments, at least one RNA
polynucleotide comprises at least one nucleic acid sequence
identified by any one of SEQ ID NO: 137-155 (Table 25) and homologs
having at least 90% (90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99%, 99.8% or 99.9%) identity with a nucleic acid sequence
identified by any one of SEQ ID NO: 137-155 (Table 25). In some
embodiments, at least one RNA polynucleotide comprises at least one
fragment of a nucleic acid sequence identified by any one of SEQ ID
NO: 137-155 (Table 25).
[0066] In some embodiments, the at least one RNA polynucleotide
encodes at least one antigenic polypeptide having a sequence
identified by any one of SEQ ID NO: 156-222 or 469 (Table 26 and
27). In some embodiments, the at least one RNA polynucleotide
encodes at least one protein variant having at least 95% identity
to an antigenic polypeptide having a sequence identified by any one
of SEQ ID NO: 156-222 or 469 (Table 26 and 27). In some
embodiments, at least one antigenic polypeptide has an amino acid
sequence identified by any one of SEQ ID NO: 156-222 or 469 (Table
26 and 27). In some embodiments, at least one antigenic polypeptide
has at least 95% identity to an antigenic polypeptide having a
sequence identified by any one of SEQ ID NO: 156-222 or 469 (Table
26 and 27).
[0067] Dengue Virus (DENV) Dengue virus (DENV) is a mosquito-borne
(Aedes aegypti/Aedes albopictus) member of the family Flaviviridae
(positive-sense, single-stranded RNA virus). Dengue virus is a
positive-sense RNA virus of the Flavivirus genus of the
Flaviviridae family, which also includes West Nile virus, Yellow
Fever Virus, and Japanese Encephalitis virus. It is transmitted to
humans through Stegomyia aegypti (formerly Aedes) mosquito vectors
and is mainly found in the tropical and semitropical areas of the
world, where it is endemic in Asia, the Pacific region, Africa,
Latin America, and the Caribbean. The incidence of infections has
increased 30-fold over the last 50 years (WHO, Dengue: Guidelines
for diagnosis, treatment, prevention, and control (2009)) and
Dengue virus is the second most common tropical infectious disease
worldwide after malaria.
[0068] Severe disease is most commonly observed in secondary,
heterologous DENV infections. Antibody-dependent enhancement of
infection has been proposed as the primary mechanism of dengue
immunopathogenesis. The potential risk of immune enhancement of
infection and disease underscores the importance of developing
dengue vaccines which produce balanced, long-lasting immunity to at
least DENV 1-4, if not all five of the DENV serotypes. While
several dengue vaccines are in development, none have been
officially licensed and/or approved to date.
[0069] In view of the lack of Dengue virus (DENV) vaccines, there
is a significant need for a vaccine that would be safe and
effective in all patient populations to prevent and/or to treat
DENV infection, including those individuals at risk for secondary,
heterotypic infections (those with more than one circulating
serotype).
[0070] Some embodiments of the present disclosure provide Dengue
virus (DENV) vaccines that include at least one ribonucleic acid
(RNA) polynucleotide (e.g., mRNA polynucleotide) having an open
reading frame encoding at least one DENV antigenic polypeptide or
an immunogenic fragment thereof (e.g., an immunogenic fragment
capable of inducing an immune response to DENV).
[0071] The methods of the present disclosure, in some embodiments,
enable the production of highly antigenic DENV RNA vaccines,
including RNA polynucleotides encoding concatemeric peptide
epitopes. The peptide epitopes are designed to be processed
intracellularly and presented to the immune system in an efficient
manner. The RNA (e.g., mRNA) vaccines described herein are useful
for generating a desired immune response by selecting appropriate T
or B cell epitopes which are able to be presented more effectively
on MHC-I or MHC-II molecules (depending on whether they are T or
B-cell epitopes, respectively).
[0072] In some embodiments, the at least one RNA polynucleotide
encodes a DENV capsid protein or immunogenic fragment or epitope
thereof. In some embodiments, the at least one RNA polynucleotide
encodes a DENV membrane protein or immunogenic fragment or epitope
thereof. In some embodiments, the at least one RNA polynucleotide
encodes a DENV precursor-membrane protein or immunogenic fragment
or epitope thereof. In some embodiments, the at least one RNA
polynucleotide encodes a DENV precursor membrane (prM) and envelope
(E) polypeptide (DENV prME) or immunogenic fragment or epitope
thereof. In some embodiments, the at least one RNA (e.g., mRNA)
polynucleotide encodes a DENV nonstructural protein or immunogenic
fragment or epitope thereof, for example a DENV non-structural
protein selected from NS1, NS2A, NS2B, NS3, NS4A, NS4B, and NS5
proteins, or immunogenic fragments or epitopes thereof. In some
embodiments, the DENV non-structural protein is NS3.
[0073] In some embodiments, the Dengue virus antigen comprises one
or more Dengue virus peptide epitopes. In some embodiments, the one
or more Dengue virus peptide epitopes is from a DENV envelope
protein. In some embodiments, the one or more Dengue virus peptide
epitopes is from a DENV capsid protein. In some embodiments, the
one or more Dengue virus peptide epitopes is from a DENV membrane
protein. In some embodiments, the one or more Dengue virus peptide
epitopes is from a DENV pre-membrane protein. In some embodiments,
the one or more Dengue virus peptide epitopes is from a sequence
comprising DENV precursor membrane (prM) and envelope (E)
polypeptide (DENV prME).
[0074] In some embodiments, the at least one Dengue virus antigen
is a DENV2 prME peptide epitope. In some embodiments, the one or
more Dengue virus peptide epitopes is from a DENV nonstructural
protein.
[0075] In any of these embodiments, the at least one RNA (e.g.,
mRNA) polynucleotide encodes a DENV polypeptide, fragment, or
epitope from a DENV serotype selected from DENV-1, DENV-2, DENV-3,
DENV-4, and DENV-5. In some embodiments, the one or more Dengue
virus peptide epitopes is from a DENV-2 serotype. In some
embodiments, the one or more Dengue virus peptide epitopes is from
a DENV2 membrane polypeptide. In some embodiments, the one or more
Dengue virus peptide epitopes is from a DENV2 envelope polypeptide.
In some embodiments, the one or more Dengue virus peptide epitopes
is from a DENV2 pre-membrane polypeptide. In some embodiments, the
one or more Dengue virus peptide epitopes is from a DENV2 capsid
polypeptide. In some embodiments, the one or more Dengue virus
peptide epitopes is from a DENV2 non-structural polypeptide. In
some embodiments, the one or more Dengue virus peptide epitopes is
from a DENV2 pre-membrane polypeptide. In some embodiments, the one
or more Dengue virus peptide epitopes is from a DENV2 PrME
polypeptide.
[0076] In some embodiments, the Dengue virus antigen is a
concatemeric Dengue virus antigen comprising two or more Dengue
virus peptide epitopes. In some embodiments, the Dengue virus
concatemeric antigen comprises between 2-100 Dengue peptide
epitopes interspersed by cleavage sensitive sites. In some
embodiments, the peptide epitopes are not epitopes of antibody
dependent enhancement. In some embodiments, the Dengue virus
vaccine's peptide epitopes are T cell epitopes and/or B cell
epitopes. In other embodiments, the Dengue virus vaccine's peptide
epitopes comprise a combination of T cell epitopes and B cell
epitopes. In some embodiments, at least one of the peptide epitopes
of the Dengue virus vaccine is a T cell epitope.
[0077] In some embodiments, the protease cleavage site of the
Dengue virus vaccine comprises the amino acid sequence GFLG (SEQ ID
NO: 429), KVSR (SEQ ID NO: 430), TVGLR (SEQ ID NO: 431), PMGLP (SEQ
ID NO: 432), or PMGAP (SEQ ID NO: 433).
[0078] In some embodiments, the at least one RNA polynucleotide
encodes a DENV envelope protein, and one or more concatemeric
Dengue virus antigen(s), such as any of the concatemeric antigens
described herein. In some embodiments, the at least one RNA
polynucleotide encodes a DENV membrane protein, and a concatemeric
virus antigen, such as any of the concatemeric antigens described
herein. In some embodiments, the at least one RNA polynucleotide
encodes a DENV capsid protein and a concatemeric virus antigen,
such as any of the concatemeric antigens described herein. In some
embodiments, the at least one RNA polynucleotide encodes a DENV
nonstructural protein, for example a DENV non-structural protein
selected from NS1, NS2A, NS2B, NS3, SN4A, NS4B, and NS5 proteins,
and a concatemeric Dengue virus antigen, such as any of the
concatemeric antigens described herein. In some embodiments, the
DENV non-structural protein is NS3. In some embodiments, the at
least one RNA polynucleotide encodes a DENV precursor membrane
protein, and one or more concatemeric Dengue virus antigen(s), such
as any of the concatemeric antigens described herein. In some
embodiments, the at least one RNA polynucleotide encodes a DENV
prME polypeptide, and one or more concatemeric Dengue virus
antigen(s), such as any of the concatemeric antigens described
herein.
[0079] In some embodiments, the peptide epitopes comprise at least
one MHC class I epitope and at least one MHC class II epitope. In
some embodiments, at least 10% of the epitopes are MHC class I
epitopes. In some embodiments, at least 20% of the epitopes are MHC
class I epitopes. In some embodiments, at least 30% of the epitopes
are MHC class I epitopes. In some embodiments, at least 40% of the
epitopes are MHC class I epitopes. In some embodiments, at least
50%, 60%, 70%, 80%, 90% or 100% of the epitopes are MHC class I
epitopes. In some embodiments, at least 10% of the epitopes are MHC
class II epitopes. In some embodiments, at least 20% of the
epitopes are MHC class II epitopes. In some embodiments, at least
30% of the epitopes are MHC class II epitopes. In some embodiments,
at least 40% of the epitopes are MHC class II epitopes. In some
embodiments, at least 50%, 60%, 70%, 80%, 90% or 100% of the
epitopes are MHC class II epitopes. In some embodiments, the ratio
of MHC class I epitopes to MHC class II epitopes is a ratio
selected from about 10%:about 90%; about 20%:about 80%; about
30%:about 70%; about 40%:about 60%; about 50%:about 50%; about
60%:about 40%; about 70%:about 30%; about 80%: about 20%; about
90%: about 10% MHC class 1: MHC class II epitopes. In some
embodiments, the ratio of MHC class II epitopes to MHC class I
epitopes is a ratio selected from about 10%:about 90%; about
20%:about 80%; about 30%:about 70%; about 40%:about 60%; about
50%:about 50%; about 60%:about 40%; about 70%:about 30%; about 80%:
about 20%; about 90%: about 10% MHC class II: MHC class I epitopes.
In some embodiments, at least one of the peptide epitopes of the
Dengue virus vaccine is a B cell epitope. In some embodiments, the
T cell epitope of the Dengue virus vaccine comprises between 8-11
amino acids. In some embodiments, the B cell epitope of the Dengue
virus vaccine comprises between 13-17 amino acids.
[0080] In any of these embodiments, the concatemeric Dengue virus
antigen may comprise two or more Dengue virus peptide epitopes
selected from a DENV envelope polypeptide, DENV capsid polypeptide,
DENV membrane polypeptide, DENV precursor-membrane polypeptide,
DENV nonstructural polypeptide, DENV prME polypeptide, and any
combination thereof, and the two or more Dengue virus peptide
epitopes may be from any DENV serotype, for example, a DENV
serotype selected from DENV-1, DENV-2, DENV-3, DENV-4, DENV-5 and
combinations thereof. In some embodiments, the concatemeric Dengue
virus antigen comprises two or more Dengue virus peptide epitopes
from DENV-2 serotype. In some embodiments, the concatemeric Dengue
virus antigen comprises two or more DENV2 prME peptide epitopes,
which may be the same or different DENV prME peptide epitopes.
[0081] In some embodiments, at least one RNA polynucleotide is
encoded by at least one nucleic acid sequence identified by any one
of SEQ ID NO: 223-239 (Table 28) and homologs having at least 80%
identity with a nucleic acid sequence identified by any one of SEQ
ID NO: 223-239 (Table 28). In some embodiments, at least one RNA
polynucleotide is encoded by at least one nucleic acid sequence
identified by any one of SEQ ID NO: 223-239 (Table 28) and homologs
having at least 90% (90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99%, 99.8% or 99.9%) identity with a nucleic acid sequence
identified by any one of SEQ ID NO: 223-239 (Table 28). In some
embodiments, at least one RNA polynucleotide is encoded by at least
one fragment of a nucleic acid sequence identified by any one of
SEQ ID NO: 223-239 (Table 28).
[0082] In some embodiments, at least one RNA polynucleotide
comprises at least one nucleic acid sequence identified by any one
of SEQ ID NO: 240-256 (Table 28) and homologs having at least 80%
identity with a nucleic acid sequence identified by any one of SEQ
ID NO: 240-256 (Table 28). In some embodiments, at least one RNA
polynucleotide comprises at least one nucleic acid sequence
identified by any one of SEQ ID NO: 240-256 (Table 28) and homologs
having at least 90% (90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99%, 99.8% or 99.9%) identity with a nucleic acid sequence
identified by any one of SEQ ID NO: 240-256 (Table 28). In some
embodiments, at least one RNA polynucleotide comprises at least one
fragment of a nucleic acid sequence identified by any one of SEQ ID
NO: 240-256 (Table 28).
[0083] In some embodiments, the at least one RNA polynucleotide
encodes at least one antigenic polypeptide having a sequence
identified by any one of SEQ ID NO: 259-291 (Table 29 and 42). In
some embodiments, the at least one RNA polynucleotide encodes at
least one protein variant having at least 95% identity to an
antigenic polypeptide having a sequence identified by any one of
SEQ ID NO: 259-291 (Table 29 and 42). In some embodiments, at least
one antigenic polypeptide has an amino acid sequence identified by
any one of SEQ ID NO: 259-291 (Table 29 and 42). In some
embodiments, at least one antigenic polypeptide has at least 95%
identity to an antigenic polypeptide having a sequence identified
by any one of SEQ ID NO: 259-291 (Table 29 and 42).
[0084] Chikungunya Virus (CHIKV)
[0085] Some embodiments of the present disclosure provide
Chikungunya virus (CHIKV) vaccines that include at least one
ribonucleic acid (RNA) polynucleotide (e.g., mRNA polynucleotide)
having an open reading frame encoding at least one CHIKV antigenic
polypeptide or an immunogenic fragment thereof (e.g., an
immunogenic fragment capable of inducing an immune response to
CHIKV).
[0086] Chikungunya virus (CHIKV) is a mosquito-borne virus
belonging to the Alphavirus genus of the Togaviridae family that
was first isolated in 1953 in Tanzania, where the virus was
endemic. Outbreaks occur repeatedly in west, central, and southern
Africa and have caused several human epidemics in those areas since
that time. The virus is passed to humans by two species of mosquito
of the genus Aedes: A. albopictus and A. aegypti. There are several
Chikungunya genotypes: Indian Ocean, East/Central/South African
(ECSA), Asian, West African, and Brazilian.
[0087] The CHIKV antigenic polypeptide may be a Chikungunya
structural protein or an antigenic fragment or epitope thereof. In
some embodiments, the antigenic polypeptide is a CHIKV structural
protein or an antigenic fragment thereof. For example, a CHIKV
structural protein may be an envelope protein (E), a 6K protein, or
a capsid (C) protein. In some embodiments, the CHIKV structural
protein is an envelope protein selected from E1, E2, and E3. In
some embodiments, the CHIKV structural protein is E1 or E2. In some
embodiments, the CHIKV structural protein is a capsid protein. In
some embodiments, the antigenic polypeptide is a fragment or
epitope of a CHIKV structural protein.
[0088] In some embodiments, the antigenic polypeptide comprises two
or more CHIKV structural proteins. In some embodiments, the two or
more CHIKV structural proteins are envelope proteins. In some
embodiments, the two or more CHIKV structural proteins are E1 and
E2. In some embodiments, the two or more CHIKV structural proteins
are E1 and E3. In some embodiments, the two or more CHIKV
structural proteins are E2 and E3. In some embodiments, the two or
more CHIKV structural proteins are E1, E2, and E3. In some
embodiments, the two or more CHIKV structural proteins are envelope
and capsid proteins. In some embodiments, the two or more CHIKV
structural proteins are E1 and C. In some embodiments, the two or
more CHIKV structural proteins are E2 and C. In some embodiments,
the two or more CHIKV structural proteins are E3 and C. In some
embodiments, the two or more CHIKV structural proteins are E1, E2,
and C. In some embodiments, the two or more CHIKV structural
proteins are E1, E3, and C. In some embodiments, the two or more
CHIKV structural proteins are E2, E3, and C. In some embodiments,
the two or more CHIKV structural proteins are E1, E2, E3, and C. In
some embodiments, the two or more CHIKV structural proteins are E1,
6K, and E2. In some embodiments, the two or more CHIKV structural
proteins are E2, 6K, and E3. In some embodiments, the two or more
CHIKV structural proteins are E1, 6K, and E3. In some embodiments,
the two or more CHIKV structural proteins are E1, E2, E3, 6K, and
C. In some embodiments, the antigenic polypeptide comprises the
CHIKV structural polyprotein comprising C, E3, E2, 6K, and E1. In
some embodiments, the antigenic polypeptide is a fragment or
epitope of two or more CHIKV structural proteins or a fragment or
epitope of the polyprotein.
[0089] In some embodiments, at least one RNA polynucleotide is
encoded by at least one nucleic acid sequence identified by any one
of SEQ ID NO: 376-388 (Table 47) and homologs having at least 80%
identity with a nucleic acid sequence identified by any one of SEQ
ID NO: 376-388 (Table 47). In some embodiments, at least one RNA
polynucleotide is encoded by at least one nucleic acid sequence
identified by any one of SEQ ID NO: 376-388 (Table 47) and homologs
having at least 90% (90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99%, 99.8% or 99.9%) identity with a nucleic acid sequence
identified by any one of SEQ ID NO: 376-388 (Table 47). In some
embodiments, at least one RNA polynucleotide is encoded by at least
one fragment of a nucleic acid sequence identified by any one of
SEQ ID NO: 376-388 (Table 47).
[0090] In some embodiments, at least one RNA polynucleotide
comprises at least one nucleic acid sequence identified by any one
of SEQ ID NO: 389-401 (Table 47) and homologs having at least 80%
identity with a nucleic acid sequence identified by any one of SEQ
ID NO: 389-401 (Table 47). In some embodiments, at least one RNA
polynucleotide comprises at least one nucleic acid sequence
identified by any one of SEQ ID NO: 389-401 (Table 47) and homologs
having at least 90% (90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
99%, 99.8% or 99.9%) identity with a nucleic acid sequence
identified by any one of SEQ ID NO: 389-401 (Table 47). In some
embodiments, at least one RNA polynucleotide comprises at least one
fragment of a nucleic acid sequence identified by any one of SEQ ID
NO: 389-401 (Table 47).
[0091] In some embodiments, the at least one RNA polynucleotide
encodes at least one antigenic polypeptide having a sequence
identified by any one of SEQ ID NO: 402-413 (Table 48). In some
embodiments, the at least one RNA polynucleotide encodes at least
one protein variant having at least 95% identity to an antigenic
polypeptide having a sequence identified by any one of SEQ ID NO:
402-413 (Table 48). In some embodiments, at least one antigenic
polypeptide has an amino acid sequence identified by any one of SEQ
ID NO: 402-413 (Table 48). In some embodiments, at least one
antigenic polypeptide has at least 95% identity to an antigenic
polypeptide having a sequence identified by any one of SEQ ID NO:
402-413 (Table 48).
[0092] In some embodiments, an open reading frame of a RNA (e.g.,
mRNA) vaccine is codon-optimized. In some embodiments, at least one
RNA polynucleotide encodes at least one antigenic polypeptide
comprising an amino acid sequence identified by any one of SEQ ID
NO: 13-17, 22-29, 44-47, 52-54, 59-64, 97-117, 156-222, 469,
259-291 or 402-413 and is codon optimized mRNA.
[0093] In some embodiments, a RNA (e.g., mRNA) vaccine further
comprising an adjuvant.
[0094] Tables 3, 6, 11, 14, 17, 27, and 42 provide National Center
for Biotechnology Information (NCBI) accession numbers of interest.
It should be understood that the phrase "an amino acid sequence of
Tables 3, 6, 11, 14, 17, 27, and 42" refers to an amino acid
sequence identified by one or more NCBI accession numbers listed in
Tables 3, 6, 11, 14, 17, 27, and 42. Each of the amino acid
sequences, and variants having greater than 95% identity or greater
than 98% identity to each of the amino acid sequences encompassed
by the accession numbers of Tables 3, 6, 11, 14, 17, 27, and 42 are
included within the constructs (polynucleotides/polypeptides) of
the present disclosure.
[0095] In some embodiments, at least one mRNA polynucleotide is
encoded by a nucleic acid comprising a sequence identified by any
one of SEQ ID NO: 1-6, 18, 19, 30-34, 48, 49, 55, 56, 65-80,
118-136, 223-239 or 376-388 and having less than 80% identity to
wild-type mRNA sequence. In some embodiments, at least one mRNA
polynucleotide is encoded by a nucleic acid comprising a sequence
identified by any one of SEQ ID NO: 1-6, 18, 19, 30-34, 48, 49, 55,
56, 65-80, 118-136, 223-239 or 376-388 and having less than 75%,
85% or 95% identity to a wild-type mRNA sequence. In some
embodiments, at least one mRNA polynucleotide is encoded by nucleic
acid comprising a sequence identified by any one of SEQ ID NO: 1-6,
18, 19, 30-34, 48, 49, 55, 56, 65-80, 118-136, 223-239 or 376-388
and having less than 50-80%, 60-80%, 40-80%, 30-80%, 70-80%, 75-80%
or 78-80% identity to wild-type mRNA sequence. In some embodiments,
at least one mRNA polynucleotide is encoded by a nucleic acid
comprising a sequence identified by any one of SEQ ID NO: 1-6, 18,
19, 30-34, 48, 49, 55, 56, 65-80, 118-136, 223-239 or 376-388 and
having less than 40-85%, 50-85%, 60-85%, 30-85%, 70-85%, 75-85% or
80-85% identity to wild-type mRNA sequence. In some embodiments, at
least one mRNA polynucleotide is encoded by a nucleic acid
comprising a sequence identified by any one of SEQ ID NO: 1-6, 18,
19, 30-34, 48, 49, 55, 56, 65-80, 118-136, 223-239 or 376-388 and
having less than 40-90%, 50-90%, 60-90%, 30-90%, 70-90%, 75-90%,
80-90%, or 85-90% identity to wild-type mRNA sequence.
[0096] In some embodiments, at least one mRNA polynucleotide
comprises a nucleic acid comprising a sequence identified by any
one of SEQ ID NO: 7-12, 20-21, 35-39, 50-51, 57-58, 81-96, 137-155,
240-256, or 389-401 (with or without a signal sequence, 5' UTR, 3'
UTR, and/or polyA tail) and having less than 80% identity to
wild-type mRNA sequence. In some embodiments, at least one mRNA
polynucleotide comprises a nucleic acid comprising a sequence
identified by any one of SEQ ID NO: 7-12, 20-21, 35-39, 50-51,
57-58, 81-96, 137-155, 240-256, or 389-401 (with or without a
signal sequence, 5' UTR, 3' UTR, and/or polyA tail) and having less
than 75%, 85% or 95% identity to a wild-type mRNA sequence. In some
embodiments, at least one mRNA polynucleotide comprises nucleic
acid comprising a sequence identified by any one of SEQ ID NO:
7-12, 20-21, 35-39, 50-51, 57-58, 81-96, 137-155, 240-256, or
389-401 (with or without a signal sequence, 5' UTR, 3' UTR, and/or
polyA tail) and having less than 50-80%, 60-80%, 40-80%, 30-80%,
70-80%, 75-80% or 78-80% identity to wild-type mRNA sequence. In
some embodiments, at least one mRNA polynucleotide comprises a
nucleic acid comprising a sequence identified by any one of SEQ ID
NO: 7-12, 20-21, 35-39, 50-51, 57-58, 81-96, 137-155, 240-256, or
389-401 (with or without a signal sequence, 5' UTR, 3' UTR, and/or
polyA tail) and having less than 40-85%, 50-85%, 60-85%, 30-85%,
70-85%, 75-85% or 80-85% identity to wild-type mRNA sequence. In
some embodiments, at least one mRNA polynucleotide comprises a
nucleic acid comprising a sequence identified by any one of SEQ ID
NO: 7-12, 20-21, 35-39, 50-51, 57-58, 81-96, 137-155, 240-256, or
389-401 (with or without a signal sequence, 5' UTR, 3' UTR, and/or
polyA tail) and having less than 40-90%, 50-90%, 60-90%, 30-90%,
70-90%, 75-90%, 80-90%, or 85-90% identity to wild-type mRNA
sequence.
[0097] In some embodiments, at least one RNA polynucleotide encodes
at least one antigenic polypeptide comprising an amino acid
sequence identified by any one of SEQ ID NO: 13-17, 22-29, 44-47,
52-54, 59-64, 97-117, 156-222, 469, 259-291 or 402-413 and having
at least 80% (e.g., 85%, 90%, 95%, 98%, 99%) identity to wild-type
mRNA sequence, but does not include wild-type mRNA sequence.
[0098] In some embodiments, at least one RNA polynucleotide encodes
at least one antigenic polypeptide comprising an amino acid
sequence identified by any one of SEQ ID NO: 13-17, 22-29, 44-47,
52-54, 59-64, 97-117, 156-222, 469, 259-291 or 402-413 and has less
than 95%, 90%, 85%, 80% or 75% identity to wild-type mRNA sequence.
In some embodiments, at least one RNA polynucleotide encodes at
least one antigenic polypeptide comprising an amino acid sequence
identified by any one of SEQ ID NO: 13-17, 22-29, 44-47, 52-54,
59-64, 97-117, 156-222, 469, 259-291 or 402-413 and has 30-80%,
40-80%, 50-80%, 60-80%, 70-80%, 75-80% or 78-80%, 30-85%, 40-85%,
50-85%, 60-85%, 70-85%, 75-85% or 78-85%, 30-90%, 40-90%, 50-90%,
60-90%, 70-90%, 75-90%, 80-90% or 85-90% identity to wild-type mRNA
sequence.
[0099] In some embodiments, at least one RNA polynucleotide encodes
at least one antigenic polypeptide having at least 90%, at least
95%, at least 96%, at least 97%, at least 98%, or at least 99%
identity to an amino acid sequence identified by any one of SEQ ID
NO: 13-17, 22-29, 44-47, 52-54, 59-64, 97-117, 156-222, 469,
259-291 or 402-413. In some embodiments, at least one RNA
polynucleotide encodes at least one antigenic polypeptide having
95-99% identity to an amino acid sequence identified by any one of
SEQ ID NO: 13-17, 22-29, 44-47, 52-54, 59-64, 97-117, 156-222, 469,
259-291 or 402-413.
[0100] In some embodiments, at least one RNA polynucleotide encodes
at least one antigenic polypeptide having at least 90%, at least
95%, at least 96%, at least 97%, at least 98%, or at least 99%
identity to amino acid sequence identified by any one of SEQ ID NO:
13-17, 22-29, 44-47, 52-54, 59-64, 97-117, 156-222, 469, 259-291 or
402-413 and having membrane fusion activity. In some embodiments,
at least one RNA polynucleotide encodes at least one antigenic
polypeptide having 95-99% identity to amino acid sequence
identified by any one of SEQ ID NO: 13-17, 22-29, 44-47, 52-54,
59-64, 97-117, 156-222, 469, 259-291 or 402-413 and having membrane
fusion activity.
[0101] In some embodiments, at least one RNA polynucleotide encodes
at least one antigenic polypeptide (e.g., at least one Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale), JEV,
WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV antigenic
polypeptide) that attaches to cell receptors.
[0102] In some embodiments, at least one RNA polynucleotide encodes
at least one antigenic polypeptide (e.g., at least one Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale), JEV,
WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV antigenic
polypeptide) antigenic polypeptide) that causes fusion of viral and
cellular membranes.
[0103] In some embodiments, at least one RNA polynucleotide encodes
at least one antigenic polypeptide (e.g., at least one Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale), JEV,
WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV antigenic
polypeptide) that is responsible for binding of the virus to a cell
being infected.
[0104] Some embodiments of the present disclosure provide a vaccine
that includes at least one ribonucleic acid (RNA) (e.g., mRNA)
polynucleotide having an open reading frame encoding at least one
antigenic polypeptide (e.g., at least one Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV antigenic polypeptide), at
least one 5' terminal cap and at least one chemical modification,
formulated within a lipid nanoparticle.
[0105] In some embodiments, a 5' terminal cap is
7mG(5')ppp(5')NlmpNp.
[0106] In some embodiments, at least one chemical modification is
selected from pseudouridine, N1-methylpseudouridine,
N1-ethylpseudouridine, 2-thiouridine, 4'-thiouridine,
5-methylcytosine, 5-methyluridine,
2-thio-1-methyl-1-deaza-pseudouridine,
2-thio-1-methyl-pseudouridine, 2-thio-5-aza-uridine,
2-thio-dihydropseudouridine, 2-thio-dihydrouridine,
2-thio-pseudouridine, 4-methoxy-2-thio-pseudouridine,
4-methoxy-pseudouridine, 4-thio-1-methyl-pseudouridine,
4-thio-pseudouridine, 5-aza-uridine, dihydropseudouridine,
5-methoxyuridine and 2'-O-methyl uridine. In some embodiments, the
chemical modification is in the 5-position of the uracil. In some
embodiments, the chemical modification is a N1-methylpseudouridine
or a N1-ethylpseudouridine.
[0107] In some embodiments, a lipid nanoparticle comprises a
cationic lipid, a PEG-modified lipid, a sterol and a non-cationic
lipid. In some embodiments, a cationic lipid is an ionizable
cationic lipid and the non-cationic lipid is a neutral lipid, and
the sterol is a cholesterol. In some embodiments, a cationic lipid
is selected from the group consisting of
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA),
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319),
(12Z,15Z)--N,N-dimethyl-2-nonylhenicosa-12,15-dien-1-amine (L608),
and N,N-dimethyl-1-[(1S,2R)-2-octylcyclopropyl]heptadecan-8-amine
(L530).
[0108] In some embodiments, the lipid is
##STR00001##
[0109] In some embodiments, the lipid is
##STR00002##
[0110] In some embodiments, a lipid nanoparticle comprises
compounds of Formula (I) and/or Formula (II), discussed below.
[0111] In some embodiments, a lipid nanoparticle comprises
Compounds 3, 18, 20, 25, 26, 29, 30, 60, 108-112, or 122, as
discussed below.
[0112] Some embodiments of the present disclosure provide a vaccine
that includes at least one RNA (e.g., mRNA) polynucleotide having
an open reading frame encoding at least one antigenic polypeptide
(e.g., at least one Malaria (e.g., P. falciparum, P. vivax, P.
malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV,
ZIKV and/or YFV antigenic polypeptide), wherein at least 80% (e.g.,
85%, 90%, 95%, 98%, 99%) of the uracil in the open reading frame
have a chemical modification, optionally wherein the vaccine is
formulated in a lipid nanoparticle (e.g., a lipid nanoparticle
comprises a cationic lipid, a PEG-modified lipid, a sterol and a
non-cationic lipid).
[0113] In some embodiments, 100% of the uracil in the open reading
frame have a chemical modification. In some embodiments, a chemical
modification is in the 5-position of the uracil. In some
embodiments, a chemical modification is a N1-methyl pseudouridine.
In some embodiments, 100% of the uracil in the open reading frame
have a N1-methyl pseudouridine in the 5-position of the uracil.
[0114] In some embodiments, an open reading frame of a RNA (e.g.,
mRNA) polynucleotide encodes at least two antigenic polypeptides
(e.g., at least one Malaria (e.g., P. falciparum, P. vivax, P.
malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV,
ZIKV and/or YFV antigenic polypeptide). In some embodiments, the
open reading frame encodes at least five or at least ten antigenic
polypeptides. In some embodiments, the open reading frame encodes
at least 100 antigenic polypeptides. In some embodiments, the open
reading frame encodes 2-100 antigenic polypeptides.
[0115] In some embodiments, a vaccine comprises at least two RNA
(e.g., mRNA) polynucleotides, each having an open reading frame
encoding at least one antigenic polypeptide (e.g., at least one
Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
antigenic polypeptide). In some embodiments, the vaccine comprises
at least five or at least ten RNA (e.g., mRNA) polynucleotides,
each having an open reading frame encoding at least one antigenic
polypeptide or an immunogenic fragment thereof. In some
embodiments, the vaccine comprises at least 100 RNA (e.g., mRNA)
polynucleotides, each having an open reading frame encoding at
least one antigenic polypeptide. In some embodiments, the vaccine
comprises 2-100 RNA (e.g., mRNA) polynucleotides, each having an
open reading frame encoding at least one antigenic polypeptide.
[0116] In some embodiments, at least one antigenic polypeptide
(e.g., at least one Malaria (e.g., P. falciparum, P. vivax, P.
malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV,
ZIKV and/or YFV antigenic polypeptide) is fused to a signal
peptide. In some embodiments, the signal peptide is selected from:
a HuIgGk signal peptide (METPAQLLFLLLLWLPDTTG; SEQ ID NO: 423); IgE
heavy chain epsilon-1 signal peptide (MDWTWILFLVAAATRVHS; SEQ ID
NO: 424); Japanese encephalitis PRM signal sequence
(MLGSNSGQRVVFTILLLLVAPAYS; SEQ ID NO: 425), VSINVg protein signal
sequence (MKCLLYLAFLFIGVNCA; SEQ ID NO: 426) and Japanese
encephalitis JEV signal sequence (MWLVSLAIVTACAGA; SEQ ID NO:
427).
[0117] In some embodiments, the signal peptide is fused to the
N-terminus of at least one antigenic polypeptide. In some
embodiments, a signal peptide is fused to the C-terminus of at
least one antigenic polypeptide.
[0118] In some embodiments, at least one antigenic polypeptide
(e.g., at least one Malaria (e.g., P. falciparum, P. vivax, P.
malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV,
ZIKV and/or YFV antigenic polypeptide) comprises a mutated N-linked
glycosylation site.
[0119] Also provided herein is a RNA (e.g., mRNA) vaccine of any
one of the foregoing paragraphs (e.g., at least one Malaria (e.g.,
P. falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV,
EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV antigenic
polypeptide), formulated in a nanoparticle (e.g., a lipid
nanoparticle).
[0120] In some embodiments, the nanoparticle has a mean diameter of
50-200 nm. In some embodiments, the nanoparticle is a lipid
nanoparticle.
[0121] In some embodiments, a lipid nanoparticle comprises
compounds of Formula (I) and/or Formula (II), discussed below.
[0122] In some embodiments, a tropical disease RNA (e.g., mRNA)
vaccine is formulated in a lipid nanoparticle that comprises a
compound selected from Compounds 3, 18, 20, 25, 26, 29, 30, 60,
108-112 and 122, described below.
[0123] In some embodiments, the nanoparticle has a polydispersity
value of less than 0.4 (e.g., less than 0.3, 0.2 or 0.1).
[0124] In some embodiments, the nanoparticle has a net neutral
charge at a neutral pH value.
[0125] In some embodiments, the RNA (e.g., mRNA) vaccine is
multivalent.
[0126] Some embodiments of the present disclosure provide methods
of inducing an antigen specific immune response in a subject,
comprising administering to the subject any of the RNA (e.g., mRNA)
vaccine as provided herein in an amount effective to produce an
antigen-specific immune response. In some embodiments, the RNA
(e.g., mRNA) vaccine is a Malaria (e.g., P. falciparum, P. vivax,
P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV,
DENV, ZIKV and/or YFV vaccine. In some embodiments, the RNA (e.g.,
mRNA) vaccine is a combination vaccine comprising a combination of
Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale) vaccine, JEV vaccine, WNV vaccine, EEEV vaccine, SINV
vaccine, CHIKV vaccine, DENV vaccine, ZIKV vaccine and/or YFV
vaccine.
[0127] In some embodiments, an antigen-specific immune response
comprises a T cell response or a B cell response.
[0128] In some embodiments, a method of producing an
antigen-specific immune response comprises administering to a
subject a single dose (no booster dose) of a RNA (e.g., mRNA)
vaccine of the present disclosure. In some embodiments, the RNA
(e.g., mRNA) vaccine is a Malaria (e.g., P. falciparum, P. vivax,
P. malariae and/or P. ovale) vaccine, JEV vaccine, WNV vaccine,
EEEV vaccine, SINV vaccine, CHIKV vaccine, DENV vaccine, ZIKV
vaccine and/or YFV vaccine. In some embodiments, the RNA (e.g.,
mRNA) vaccine is a combination vaccine comprising a combination of
any two or more of the foregoing vaccines.
[0129] In some embodiments, a method further comprises
administering to the subject a second (booster) dose of a RNA
(e.g., mRNA) vaccine. Additional doses of a RNA (e.g., mRNA)
vaccine may be administered.
[0130] In some embodiments, the subjects exhibit a seroconversion
rate of at least 80% (e.g., at least 85%, at least 90%, or at least
95%) following the first dose or the second (booster) dose of the
vaccine. Seroconversion is the time period during which a specific
antibody develops and becomes detectable in the blood. After
seroconversion has occurred, a virus can be detected in blood tests
for the antibody. During an infection or immunization, antigens
enter the blood, and the immune system begins to produce antibodies
in response. Before seroconversion, the antigen itself may or may
not be detectable, but antibodies are considered absent. During
seroconversion, antibodies are present but not yet detectable. Any
time after seroconversion, the antibodies can be detected in the
blood, indicating a prior or current infection.
[0131] In some embodiments, a RNA (e.g., mRNA) vaccine is
administered to a subject by intradermal, intramuscular injection,
or by intranasal administration.
[0132] Some embodiments of the present disclosure provide methods
of inducing an antigen specific immune response in a subject,
including administering to a subject a RNA (e.g., mRNA) vaccine in
an effective amount to produce an antigen specific immune response
in a subject. Antigen-specific immune responses in a subject may be
determined, in some embodiments, by assaying for antibody titer
(for titer of an antibody that binds to a Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV antigenic polypeptide)
following administration to the subject of any of the RNA (e.g.,
mRNA) vaccines of the present disclosure. In some embodiments, the
anti-antigenic polypeptide antibody titer produced in the subject
is increased by at least 1 log relative to a control. In some
embodiments, the anti-antigenic polypeptide antibody titer produced
in the subject is increased by 1-3 log relative to a control.
[0133] In some embodiments, the anti-antigenic polypeptide antibody
titer produced in a subject is increased at least 2 times relative
to a control. In some embodiments, the anti-antigenic polypeptide
antibody titer produced in the subject is increased at least 5
times relative to a control. In some embodiments, the
anti-antigenic polypeptide antibody titer produced in the subject
is increased at least 10 times relative to a control. In some
embodiments, the anti-antigenic polypeptide antibody titer produced
in the subject is increased 2-10 times relative to a control.
[0134] In some embodiments, the control is an anti-antigenic
polypeptide antibody titer produced in a subject who has not been
administered a RNA (e.g., mRNA) vaccine of the present disclosure.
In some embodiments, the control is an anti-antigenic polypeptide
antibody titer produced in a subject who has been administered a
live attenuated or inactivated Malaria (e.g., P. falciparum, P.
vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV,
CHIKV, DENV, ZIKV and/or YFV vaccine (see, e.g., Ren J. et al. J of
Gen. Virol. 2015; 96: 1515-1520), or wherein the control is an
anti-antigenic polypeptide antibody titer produced in a subject who
has been administered a recombinant or purified Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV protein vaccine. In some
embodiments, the control is an anti-antigenic polypeptide antibody
titer produced in a subject who has been administered a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale), JEV,
WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV virus-like
particle (VLP) vaccine (see, e.g., Cox R G et al., J Virol. 2014
June; 88(11): 6368-6379).
[0135] A RNA (e.g., mRNA) vaccine of the present disclosure is
administered to a subject in an effective amount (an amount
effective to induce an immune response). In some embodiments, the
effective amount is a dose equivalent to an at least 2-fold, at
least 4-fold, at least 10-fold, at least 100-fold, at least
1000-fold reduction in the standard of care dose of a recombinant
Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
protein vaccine, wherein the anti-antigenic polypeptide antibody
titer produced in the subject is equivalent to an anti-antigenic
polypeptide antibody titer produced in a control subject
administered the standard of care dose of a recombinant Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale), JEV,
WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV protein
vaccine, a purified Malaria (e.g., P. falciparum, P. vivax, P.
malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV,
ZIKV and/or YFV protein vaccine, a live attenuated Malaria (e.g.,
P. falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV,
EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV vaccine, an
inactivated Malaria (e.g., P. falciparum, P. vivax, P. malariae
and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV
and/or YFV vaccine, or a Malaria (e.g., P. falciparum, P. vivax, P.
malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV,
ZIKV and/or YFV VLP vaccine. In some embodiments, the effective
amount is a dose equivalent to 2-1000-fold reduction in the
standard of care dose of a recombinant Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV protein vaccine, wherein
the anti-antigenic polypeptide antibody titer produced in the
subject is equivalent to an anti-antigenic polypeptide antibody
titer produced in a control subject administered the standard of
care dose of a recombinant Malaria (e.g., P. falciparum, P. vivax,
P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV,
DENV, ZIKV and/or YFV protein vaccine, a purified Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV protein vaccine, a live
attenuated Malaria (e.g., P. falciparum, P. vivax, P. malariae
and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV
and/or YFV vaccine, an inactivated Malaria (e.g., P. falciparum, P.
vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV,
CHIKV, DENV, ZIKV and/or YFV vaccine, or a Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV VLP vaccine.
[0136] In some embodiments, the control is an anti-antigenic
polypeptide antibody titer produced in a subject who has been
administered a virus-like particle (VLP) vaccine comprising
structural proteins of Malaria (e.g., P. falciparum, P. vivax, P.
malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV,
ZIKV and/or YFV.
[0137] In some embodiments, the RNA (e.g., mRNA) vaccine is
formulated in an effective amount to produce an antigen specific
immune response in a subject.
[0138] In some embodiments, the effective amount is a total dose of
25 .mu.g to 1000 .mu.g, or 50 .mu.g to 1000 .mu.g. In some
embodiments, the effective amount is a total dose of 100 .mu.g. In
some embodiments, the effective amount is a dose of 25 .mu.g
administered to the subject a total of two times. In some
embodiments, the effective amount is a dose of 100 .mu.g
administered to the subject a total of two times. In some
embodiments, the effective amount is a dose of 400 .mu.g
administered to the subject a total of two times. In some
embodiments, the effective amount is a dose of 500 .mu.g
administered to the subject a total of two times.
[0139] In some embodiments, the efficacy (or effectiveness) of a
RNA (e.g., mRNA) vaccine is greater than 60%. In some embodiments,
the RNA (e.g., mRNA) polynucleotide of the vaccine is at least one
of Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
antigenic polypeptide.
[0140] Vaccine efficacy may be assessed using standard analyses
(see, e.g., Weinberg et al., J Infect Dis. 2010 Jun. 1;
201(11):1607-10). For example, vaccine efficacy may be measured by
double-blind, randomized, clinical controlled trials. Vaccine
efficacy may be expressed as a proportionate reduction in disease
attack rate (AR) between the unvaccinated (ARU) and vaccinated
(ARV) study cohorts and can be calculated from the relative risk
(RR) of disease among the vaccinated group with use of the
following formulas:
Efficacy=(ARU-ARV)/ARU.times.100; and
Efficacy=(1-RR).times.100.
[0141] Likewise, vaccine effectiveness may be assessed using
standard analyses (see, e.g., Weinberg et al., J Infect Dis. 2010
Jun. 1; 201(11):1607-10). Vaccine effectiveness is an assessment of
how a vaccine (which may have already proven to have high vaccine
efficacy) reduces disease in a population. This measure can assess
the net balance of benefits and adverse effects of a vaccination
program, not just the vaccine itself, under natural field
conditions rather than in a controlled clinical trial. Vaccine
effectiveness is proportional to vaccine efficacy (potency) but is
also affected by how well target groups in the population are
immunized, as well as by other non-vaccine-related factors that
influence the `real-world` outcomes of hospitalizations, ambulatory
visits, or costs. For example, a retrospective case control
analysis may be used, in which the rates of vaccination among a set
of infected cases and appropriate controls are compared. Vaccine
effectiveness may be expressed as a rate difference, with use of
the odds ratio (OR) for developing infection despite
vaccination:
Effectiveness=(1-OR).times.100.
[0142] In some embodiments, the efficacy (or effectiveness) of a
RNA (e.g., mRNA) vaccine is at least 65%, at least 70%, at least
75%, at least 80%, at least 85%, or at least 90%.
[0143] In some embodiments, the vaccine immunizes the subject
against Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or
P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
for up to 2 years. In some embodiments, the vaccine immunizes the
subject against Malaria (e.g., P. falciparum, P. vivax, P. malariae
and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV
and/or YFV for more than 2 years, more than 3 years, more than 4
years, or for 5-10 years.
[0144] In some embodiments, the subject is about 5 years old or
younger. For example, the subject may be between the ages of about
1 year and about 5 years (e.g., about 1, 2, 3, 4 or 5 years), or
between the ages of about 6 months and about 1 year (e.g., about 6,
7, 8, 9, 10, 11 or 12 months). In some embodiments, the subject is
about 12 months or younger (e.g., 12, 11, 10, 9, 8, 7, 6, 5, 4, 3,
2 months or 1 month). In some embodiments, the subject is about 6
months or younger.
[0145] In some embodiments, the subject was born full term (e.g.,
about 37-42 weeks). In some embodiments, the subject was born
prematurely, for example, at about 36 weeks of gestation or earlier
(e.g., about 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26 or 25
weeks). For example, the subject may have been born at about 32
weeks of gestation or earlier. In some embodiments, the subject was
born prematurely between about 32 weeks and about 36 weeks of
gestation. In such subjects, a RNA (e.g., mRNA) vaccine may be
administered later in life, for example, at the age of about 6
months to about 5 years, or older.
[0146] In some embodiments, the subject is an adult between the
ages of about 20 years and about 50 years (e.g., about 20, 25, 30,
35, 40, 45 or 50 years old).
[0147] In some embodiments, the subject is an elderly subject about
60 years old, about 70 years old, or older (e.g., about 60, 65, 70,
75, 80, 85 or 90 years old).
[0148] In some embodiments, the subject has been exposed to Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale), JEV,
WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV (e.g., C.
trachomatis); the subject is infected with Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV (e.g., C. trachomatis); or
subject is at risk of infection by Malaria (e.g., P. falciparum, P.
vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV,
CHIKV, DENV, ZIKV and/or YFV (e.g., C. trachomatis).
[0149] In some embodiments, the subject is immunocompromised (has
an impaired immune system, e.g., has an immune disorder or
autoimmune disorder).
[0150] In some embodiments the nucleic acid vaccines described
herein are chemically modified. In other embodiments the nucleic
acid vaccines are unmodified.
[0151] Yet other aspects provide compositions for and methods of
vaccinating a subject comprising administering to the subject a
nucleic acid vaccine comprising one or more RNA polynucleotides
having an open reading frame encoding a first virus antigenic
polypeptide, wherein the RNA polynucleotide does not include a
stabilization element, and wherein an adjuvant is not coformulated
or co-administered with the vaccine.
[0152] In other aspects the invention is a composition for or
method of vaccinating a subject comprising administering to the
subject a nucleic acid vaccine comprising one or more RNA
polynucleotides having an open reading frame encoding a first
antigenic polypeptide wherein a dosage of between 10 .mu.g/kg and
400 .mu.g/kg of the nucleic acid vaccine is administered to the
subject. In some embodiments the dosage of the RNA polynucleotide
is 1-5 .mu.g, 5-10 .mu.g, 10-15 .mu.g, 15-20 .mu.g, 10-25 .mu.g,
20-25 .mu.g, 20-50 .mu.g, 30-50 .mu.g, 40-50 .mu.g, 40-60 .mu.g,
60-80 .mu.g, 60-100 .mu.g, 50-100 .mu.g, 80-120 .mu.g, 40-120
.mu.g, 40-150 .mu.g, 50-150 .mu.g, 50-200 .mu.g, 80-200 .mu.g,
100-200 .mu.g, 120-250 .mu.g, 150-250 .mu.g, 180-280 .mu.g, 200-300
.mu.g, 50-300 .mu.g, 80-300 .mu.g, 100-300 .mu.g, 40-300 .mu.g,
50-350 .mu.g, 100-350 .mu.g, 200-350 .mu.g, 300-350 .mu.g, 320-400
.mu.g, 40-380 .mu.g, 40-100 .mu.g, 100-400 .mu.g, 200-400 .mu.g, or
300-400 .mu.g per dose. In some embodiments, the nucleic acid
vaccine is administered to the subject by intradermal or
intramuscular injection. In some embodiments, the nucleic acid
vaccine is administered to the subject on day zero. In some
embodiments, a second dose of the nucleic acid vaccine is
administered to the subject on day twenty one.
[0153] In some embodiments, a dosage of 25 micrograms of the RNA
polynucleotide is included in the nucleic acid vaccine administered
to the subject. In some embodiments, a dosage of 100 micrograms of
the RNA polynucleotide is included in the nucleic acid vaccine
administered to the subject. In some embodiments, a dosage of 50
micrograms of the RNA polynucleotide is included in the nucleic
acid vaccine administered to the subject. In some embodiments, a
dosage of 75 micrograms of the RNA polynucleotide is included in
the nucleic acid vaccine administered to the subject. In some
embodiments, a dosage of 150 micrograms of the RNA polynucleotide
is included in the nucleic acid vaccine administered to the
subject. In some embodiments, a dosage of 400 micrograms of the RNA
polynucleotide is included in the nucleic acid vaccine administered
to the subject. In some embodiments, a dosage of 200 micrograms of
the RNA polynucleotide is included in the nucleic acid vaccine
administered to the subject. In some embodiments, the RNA
polynucleotide accumulates at a 100 fold higher level in the local
lymph node in comparison with the distal lymph node. In other
embodiments the nucleic acid vaccine is chemically modified and in
other embodiments the nucleic acid vaccine is not chemically
modified.
[0154] Aspects of the invention provide a nucleic acid vaccine
comprising one or more RNA polynucleotides having an open reading
frame encoding a first antigenic polypeptide, wherein the RNA
polynucleotide does not include a stabilization element, and a
pharmaceutically acceptable carrier or excipient, wherein an
adjuvant is not included in the vaccine. In some embodiments, the
stabilization element is a histone stem-loop. In some embodiments,
the stabilization element is a nucleic acid sequence having
increased GC content relative to wild type sequence.
[0155] Aspects of the invention provide nucleic acid vaccines
comprising one or more RNA polynucleotides having an open reading
frame encoding a first antigenic polypeptide, wherein the RNA
polynucleotide is present in the formulation for in vivo
administration to a host, which confers an antibody titer superior
to the criterion for seroprotection for the first antigen for an
acceptable percentage of human subjects. In some embodiments, the
antibody titer produced by the mRNA vaccines of the invention is a
neutralizing antibody titer. In some embodiments the neutralizing
antibody titer is greater than a protein vaccine. In other
embodiments the neutralizing antibody titer produced by the mRNA
vaccines of the invention is greater than an adjuvanted protein
vaccine. In yet other embodiments the neutralizing antibody titer
produced by the mRNA vaccines of the invention is 1,000-10,000,
1,200-10,000, 1,400-10,000, 1,500-10,000, 1,000-5,000, 1,000-4,000,
1,800-10,000, 2000-10,000, 2,000-5,000, 2,000-3,000, 2,000-4,000,
3,000-5,000, 3,000-4,000, or 2,000-2,500. A neutralization titer is
typically expressed as the highest serum dilution required to
achieve a 50% reduction in the number of plaques.
[0156] Also provided are nucleic acid vaccines comprising one or
more RNA polynucleotides having an open reading frame encoding a
first antigenic polypeptide, wherein the RNA polynucleotide is
present in a formulation for in vivo administration to a host for
eliciting a longer lasting high antibody titer than an antibody
titer elicited by an mRNA vaccine having a stabilizing element or
formulated with an adjuvant and encoding the first antigenic
polypeptide. In some embodiments, the RNA polynucleotide is
formulated to produce neutralizing antibodies within one week of a
single administration. In some embodiments, the adjuvant is
selected from a cationic peptide and an immunostimulatory nucleic
acid. In some embodiments, the cationic peptide is protamine.
[0157] Aspects provide nucleic acid vaccines comprising one or more
RNA polynucleotides having an open reading frame comprising at
least one chemical modification or optionally no modified
nucleotides, the open reading frame encoding a first antigenic
polypeptide, wherein the RNA polynucleotide is present in the
formulation for in vivo administration to a host such that the
level of antigen expression in the host significantly exceeds a
level of antigen expression produced by an mRNA vaccine having a
stabilizing element or formulated with an adjuvant and encoding the
first antigenic polypeptide.
[0158] Other aspects provide nucleic acid vaccines comprising one
or more RNA polynucleotides having an open reading frame comprising
at least one chemical modification or optionally no modified
nucleotides, the open reading frame encoding a first antigenic
polypeptide, wherein the vaccine has at least 10 fold less RNA
polynucleotide than is required for an unmodified mRNA vaccine to
produce an equivalent antibody titer. In some embodiments, the RNA
polynucleotide is present in a dosage of 25-100 micrograms.
[0159] Aspects of the invention also provide a unit of use vaccine,
comprising between 10 ug and 400 ug of one or more RNA
polynucleotides having an open reading frame comprising at least
one chemical modification or optionally no modified nucleotides,
the open reading frame encoding a first antigenic polypeptide, and
a pharmaceutically acceptable carrier or excipient, formulated for
delivery to a human subject. In some embodiments, the vaccine
further comprises a cationic lipid nanoparticle.
[0160] Aspects of the invention provide methods of creating,
maintaining or restoring antigenic memory to a virus strain in an
individual or population of individuals comprising administering to
said individual or population an antigenic memory booster nucleic
acid vaccine comprising (a) at least one RNA polynucleotide, said
polynucleotide comprising at least one chemical modification or
optionally no modified nucleotides and two or more codon-optimized
open reading frames, said open reading frames encoding a set of
reference antigenic polypeptides, and (b) optionally a
pharmaceutically acceptable carrier or excipient.
[0161] In some embodiments, the vaccine is administered to the
individual via a route selected from the group consisting of
intramuscular administration, intradermal administration and
subcutaneous administration. In some embodiments, the administering
step comprises contacting a muscle tissue of the subject with a
device suitable for injection of the composition. In some
embodiments, the administering step comprises contacting a muscle
tissue of the subject with a device suitable for injection of the
composition in combination with electroporation.
[0162] Aspects of the invention provide methods of vaccinating a
subject comprising administering to the subject a single dosage of
between 25 ug/kg and 400 ug/kg of a nucleic acid vaccine comprising
one or more RNA polynucleotides having an open reading frame
encoding a first antigenic polypeptide in an effective amount to
vaccinate the subject.
[0163] Other aspects provide nucleic acid vaccines comprising one
or more RNA polynucleotides having an open reading frame comprising
at least one chemical modification, the open reading frame encoding
a first antigenic polypeptide, wherein the vaccine has at least 10
fold less RNA polynucleotide than is required for an unmodified
mRNA vaccine to produce an equivalent antibody titer. In some
embodiments, the RNA polynucleotide is present in a dosage of
25-100 micrograms.
[0164] Other aspects provide nucleic acid vaccines comprising an
LNP formulated RNA polynucleotide having an open reading frame
comprising no nucleotide modifications (unmodified), the open
reading frame encoding a first antigenic polypeptide, wherein the
vaccine has at least 10 fold less RNA polynucleotide than is
required for an unmodified mRNA vaccine not formulated in a LNP to
produce an equivalent antibody titer. In some embodiments, the RNA
polynucleotide is present in a dosage of 25-100 micrograms.
[0165] The data presented in the Examples demonstrate significant
enhanced immune responses using the formulations of the invention.
Both chemically modified and unmodified RNA vaccines are useful
according to the invention. Surprisingly, in contrast to prior art
reports that it was preferable to use chemically unmodified mRNA
formulated in a carrier for the production of vaccines, it is
described herein that chemically modified mRNA-LNP vaccines
required a much lower effective mRNA dose than unmodified mRNA,
i.e., tenfold less than unmodified mRNA when formulated in carriers
other than LNP. Both the chemically modified and unmodified RNA
vaccines of the invention produce better immune responses than mRNA
vaccines formulated in a different lipid carrier.
[0166] In other aspects the invention encompasses a method of
treating an elderly subject age 60 years or older comprising
administering to the subject a nucleic acid vaccine comprising one
or more RNA polynucleotides having an open reading frame encoding a
virus antigenic polypeptide in an effective amount to vaccinate the
subject.
[0167] In other aspects the invention encompasses a method of
treating a young subject age 17 years or younger comprising
administering to the subject a nucleic acid vaccine comprising one
or more RNA polynucleotides having an open reading frame encoding a
virus antigenic polypeptide in an effective amount to vaccinate the
subject.
[0168] In other aspects the invention encompasses a method of
treating an adult subject comprising administering to the subject a
nucleic acid vaccine comprising one or more RNA polynucleotides
having an open reading frame encoding a virus antigenic polypeptide
in an effective amount to vaccinate the subject.
[0169] In some aspects the invention is a method of vaccinating a
subject with a combination vaccine including at least two nucleic
acid sequences encoding antigens wherein the dosage for the vaccine
is a combined therapeutic dosage wherein the dosage of each
individual nucleic acid encoding an antigen is a sub therapeutic
dosage. In some embodiments, the combined dosage is 25 micrograms
of the RNA polynucleotide in the nucleic acid vaccine administered
to the subject. In some embodiments, the combined dosage is 100
micrograms of the RNA polynucleotide in the nucleic acid vaccine
administered to the subject. In some embodiments the combined
dosage is 50 micrograms of the RNA polynucleotide in the nucleic
acid vaccine administered to the subject. In some embodiments, the
combined dosage is 75 micrograms of the RNA polynucleotide in the
nucleic acid vaccine administered to the subject. In some
embodiments, the combined dosage is 150 micrograms of the RNA
polynucleotide in the nucleic acid vaccine administered to the
subject. In some embodiments, the combined dosage is 400 micrograms
of the RNA polynucleotide in the nucleic acid vaccine administered
to the subject. In some embodiments, the sub therapeutic dosage of
each individual nucleic acid encoding an antigen is 1, 2, 3, 4, 5,
6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20
micrograms. In other embodiments the nucleic acid vaccine is
chemically modified and in other embodiments the nucleic acid
vaccine is not chemically modified.
[0170] The RNA polynucleotide is one of SEQ ID NO: 1-12, 18-21,
30-39, 48-51, 55-58, 56, 65-96, 118-155, 223-256 or 376-401 and
includes at least one chemical modification. In other embodiments
the RNA polynucleotide is one of SEQ ID NO: 1-12, 18-21, 30-39,
48-51, 55-58, 56, 65-96, 118-155, 223-256 or 376-401 and does not
include any nucleotide modifications, or is unmodified. In yet
other embodiments the at least one RNA polynucleotide encodes an
antigenic protein of any of SEQ ID NO: 13-17, 22-29, 44-47, 52-54,
59-64, 97-117, 156-222, 469, 259-291 or 402-413 and includes at
least one chemical modification. In other embodiments the RNA
polynucleotide encodes an antigenic protein of any of SEQ ID NO:
13-17, 22-29, 44-47, 52-54, 59-64, 97-117, 156-222, 469, 259-291 or
402-413 and does not include any nucleotide modifications, or is
unmodified.
[0171] In preferred aspects, vaccines of the invention (e.g.,
LNP-encapsulated mRNA vaccines) produce prophylactically- and/or
therapeutically-efficacious levels, concentrations and/or titers of
antigen-specific antibodies in the blood or serum of a vaccinated
subject. As defined herein, the term antibody titer refers to the
amount of antigen-specific antibody produces in s subject, e.g., a
human subject. In exemplary embodiments, antibody titer is
expressed as the inverse of the greatest dilution (in a serial
dilution) that still gives a positive result. In exemplary
embodiments, antibody titer is determined or measured by
enzyme-linked immunosorbent assay (ELISA). In exemplary
embodiments, antibody titer is determined or measured by
neutralization assay, e.g., by microneutralization assay. In
certain aspects, antibody titer measurement is expressed as a
ratio, such as 1:40, 1:100, etc.
[0172] In exemplary embodiments of the invention, an efficacious
vaccine produces an antibody titer of greater than 1:40, greater
that 1:100, greater than 1:400, greater than 1:1000, greater than
1:2000, greater than 1:3000, greater than 1:4000, greater than
1:500, greater than 1:6000, greater than 1:7500, greater than
1:10000. In exemplary embodiments, the antibody titer is produced
or reached by 10 days following vaccination, by 20 days following
vaccination, by 30 days following vaccination, by 40 days following
vaccination, or by 50 or more days following vaccination. In
exemplary embodiments, the titer is produced or reached following a
single dose of vaccine administered to the subject. In other
embodiments, the titer is produced or reached following multiple
doses, e.g., following a first and a second dose (e.g., a booster
dose.)
[0173] In exemplary aspects of the invention, antigen-specific
antibodies are measured in units of .mu.g/ml or are measured in
units of IU/L (International Units per liter) or mIU/ml (milli
International Units per ml). In exemplary embodiments of the
invention, an efficacious vaccine produces >0.5 .mu.g/ml,
>0.1 .mu.g/ml, >0.2 .mu.g/ml, >0.35 .mu.g/ml, >0.5
.mu.g/ml, >1 .mu.g/ml, >2 .mu.g/ml, >5 .mu.g/ml or >10
.mu.g/ml. In exemplary embodiments of the invention, an efficacious
vaccine produces >10 mIU/ml, >20 mIU/ml, >50 mIU/ml,
>100 mIU/ml, >200 mIU/ml, >500 mIU/ml or >1000 mIU/ml.
In exemplary embodiments, the antibody level or concentration is
produced or reached by 10 days following vaccination, by 20 days
following vaccination, by 30 days following vaccination, by 40 days
following vaccination, or by 50 or more days following vaccination.
In exemplary embodiments, the level or concentration is produced or
reached following a single dose of vaccine administered to the
subject. In other embodiments, the level or concentration is
produced or reached following multiple doses, e.g., following a
first and a second dose (e.g., a booster dose.) In exemplary
embodiments, antibody level or concentration is determined or
measured by enzyme-linked immunosorbent assay (ELISA). In exemplary
embodiments, antibody level or concentration is determined or
measured by neutralization assay, e.g., by microneutralization
assay.
[0174] The details of various embodiments of the disclosure are set
forth in the description below. Other features, objects, and
advantages of the disclosure will be apparent from the description
and from the claims.
BRIEF DESCRIPTION OF THE DRAWINGS
[0175] FIG. 1 shows data from an immunogenicity experiment in which
mice were immunized with JEV prME mRNA vaccine. The data show that
immunization of mice with JEV mRNA vaccine at 10 .mu.g, 2 .mu.g and
0.5 .mu.g doses produces neutralizing antibodies measured between
10.sup.2 to 10.sup.4 PRNT50 titers.
[0176] FIG. 2 shows a histogram indicating intracellular detection
of ZIKA prME protein using human serum containing anti-ZIKV antigen
antibodies.
[0177] FIG. 3 shows the results of detecting prME protein
expression in mammalian cells with fluorescence-activated cell
sorting (FACS) using a flow cytometer. Cells expressing prME showed
higher fluorescence intensity when stained with anti-ZIKV human
serum.
[0178] FIG. 4 shows a bar graph of the data provided in FIG. 3.
[0179] FIG. 5 shows a reducing SDS-PAGE gel of Zika VLP.
[0180] FIG. 6 shows a graph of neutralizing titers obtained from
BALB/c mice immunized with a ZIKV mRNA vaccine encoding prME.
[0181] FIGS. 7A-7B show percent animal survival (FIG. 7A) and
percent weight change (FIG. 7B) in animals following administration
of two different doses of a ZIKV RNA vaccine comprising mRNA
encoding ZIKV prME.
[0182] FIGS. 8A-8C show Dengue Virus MHC I T cell epitopes. The
sequences, from left to right correspond to SEQ ID NO: 365-366
(FIG. 8A), 367-368 (FIG. 8B), and 369-370 (FIG. 8C).
[0183] FIGS. 9A-9C show Dengue Virus MHC II T cell epitopes. The
sequences, from left to right, correspond to SEQ ID NO: 371-372
(FIG. 9A), 373-374 (FIG. 9B), and 375 (FIG. 9C).
[0184] FIG. 10 is a graph depicting the results of an ELISPOT assay
of dengue-specific peptides.
[0185] FIG. 11 is a graph depicting the results of an ELISPOT assay
of dengue-specific peptides.
[0186] FIG. 12 is a schematic of a bone marrow/liver/thymus (BLT)
mouse and data on human CD8 T cells stimulated with Dengue peptide
epitope.
[0187] FIGS. 13A and 13B shows the results of an Intracellular
Cytokine Staining assay performed in PBMC cells.
[0188] FIG. 14A shows FACS analyses of cells expressing DENV2 prMEs
using different antibodies against Dengue envelope protein. Numbers
in the upper right corner of each plot indicate mean fluorescent
intensity. FIG. 14B shows a repeat of staining in triplicate and in
two different cell lines (HeLa and 293T).
[0189] FIG. 15 is a graph showing the kinetics of OVA peptide
presentation in Jawsii cells. All mRNAs tested are formulated in
MC3 lipid nanoparticles.
[0190] FIG. 16 is a graph showing the Mean Fluorescent Intensity
(MFI) of antibody binding to DENV-1, 2, 3, and 4 prME epitopes
presented on the cell surface.
[0191] FIGS. 17A-17D are graphs showing the design and the results
of a challenge study in AG129 mice. FIG. 17A shows the
immunization, challenge, and serum collection schedules. FIG. 17B
shows the survival of the AG129 mice challenged with Dengue D2Y98P
virus after being immunized with the indicated DENV mRNA vaccines.
All immunized mice survived 11 days post infection, while the
unimmunized (control) mice died. FIGS. 17C and 17D show the weight
loss of the AG129 mice post infection. Vaccine 1, 7, 8, or 9
correspond to DENV vaccine construct 22, 21, 23, or 24 of the
present disclosure, respectively.
[0192] FIG. 18 is a graph showing the results of an in vitro
neutralization assay using serum from mice immunized with the DENV
mRNA vaccines in FIGS. 17A-17D.
[0193] FIGS. 19A-19I are graphs showing the results of a challenge
study in AG129 mice. The challenge study design is shown in Table
46. FIGS. 19A-19F show the survival, weight loss, and heath score
of the AG129 mice challenged with D2Y98P virus after being
immunized with the DENV mRNA vaccine groups 1-12 in Table 46. FIGS.
19G-19I show the survival, weight loss, and heath score of the
AG129 mice challenged with D2Y98P virus after being immunized with
the DENV mRNA vaccine groups 13-19 in Table 46.
[0194] FIG. 20 shows CHIKV envelope protein detection of lysate in
HeLa cells 16 hours post-transfection.
[0195] FIG. 21A is a graph showing the survival rates of AG129 mice
vaccinated with a single 2 .mu.g dose or two 2 .mu.g doses of
Chikungunya E1 antigen administered either intramuscularly or
intradermally. FIG. 21B is a graph showing the percent weight loss
of AG129 mice vaccinated with a single 2 .mu.g dose or two 2 .mu.g
doses of Chikungunya E1 antigen administered either intramuscularly
or intradermally. FIG. 21C is a graph showing the health scores of
AG129 mice vaccinated with a single 2 .mu.g dose or two 2 .mu.g
doses of Chikungunya E1 antigen administered either intramuscularly
or intradermally.
[0196] FIG. 22A is a graph showing the survival rates of AG129 mice
vaccinated with a single 2 .mu.g dose or two 2 .mu.g doses of
Chikungunya E2 antigen administered either intramuscularly or
intradermally. FIG. 22B is a graph showing the percent weight loss
of AG129 mice vaccinated with a single 2 .mu.g dose or two 2 .mu.g
doses of Chikungunya E2 antigen administered either intramuscularly
or intradermally. FIG. 22C is a graph showing the health scores of
AG129 mice vaccinated with a single 2 .mu.g dose or two 2 .mu.g
doses of Chikungunya E2 antigen administered either intramuscularly
or intradermally.
[0197] FIG. 23A is a graph showing the survival rates of AG129 mice
vaccinated with a single 2 .mu.g dose or two 2 .mu.g doses of
Chikungunya C-E3-E2-6K-E1 antigen administered either
intramuscularly or intradermally. FIG. 23B is a graph showing the
percent weight loss of AG129 mice vaccinated with a single 2 .mu.g
dose or two 2 .mu.g doses of Chikungunya C-E3-E2-6K-E1 antigen
administered either intramuscularly or intradermally. FIG. 23C is a
graph showing the health scores of AG129 mice vaccinated with a
single 2 .mu.g dose or two 2 .mu.g doses of Chikungunya
C-E3-E2-6K-E1 antigen administered either intramuscularly or
intradermally.
[0198] FIG. 24A is a graph showing the survival rates of AG129 mice
vaccinated with a single 10 .mu.g dose or two 10 .mu.g doses of
Chikungunya E1 antigen administered either intramuscularly or
intradermally. FIG. 24B is a graph showing the percent weight loss
of AG129 mice vaccinated with a single 10 .mu.g dose or two 10
.mu.g doses of Chikungunya E1 antigen administered either
intramuscularly or intradermally. FIG. 24C is a graph showing the
health scores of AG129 mice vaccinated with a single 10 .mu.g dose
or two 10 .mu.g doses of Chikungunya E1 antigen administered either
intramuscularly or intradermally.
[0199] FIG. 25A is a graph showing the survival rates of AG129 mice
vaccinated with a single 10 .mu.g dose or two 10 .mu.g doses of
Chikungunya E2 antigen administered either intramuscularly or
intradermally. FIG. 25B is a graph showing the percent weight loss
of AG129 mice vaccinated with a single 10 .mu.g dose or two 10
.mu.g doses of Chikungunya E2 antigen administered either
intramuscularly or intradermally. FIG. 25C is a graph showing the
health scores of AG129 mice vaccinated with a single 10 .mu.g dose
or two 10 .mu.g doses of Chikungunya E2 antigen administered either
intramuscularly or intradermally.
[0200] FIG. 26A is a graph showing the survival rates of AG129 mice
vaccinated with a single 10 .mu.g dose or two 10 .mu.g doses of
Chikungunya C-E3-E2-6K-E1 antigen administered either
intramuscularly or intradermally. FIG. 26B is a graph showing the
percent weight loss of AG129 mice vaccinated with a single 10 .mu.g
dose or two 10 .mu.g doses of Chikungunya C-E3-E2-6K-E1 antigen
administered either intramuscularly or intradermally. FIG. 26C is a
graph showing the health scores of AG129 mice vaccinated with a
single 10 .mu.g dose or two 10 .mu.g doses of Chikungunya
C-E3-E2-6K-E1 antigen administered either intramuscularly or
intradermally.
[0201] FIGS. 27A-27B are graphs showing the survival curves from a
CHIKV challenge study in AG129 mice immunized with CHIKV mRNA
vaccines in 10 .mu.g, 2 .mu.g, or 0.04 .mu.g doses. Mice were
divided into 14 groups (1-4 and 7-16, n=5). FIG. 27A shows the
survival curve of mice groups 1-4 and 7-9 challenged on day 56 post
immunization. FIG. 27B shows the survival curve of mice groups
10-16 challenged on day 112 post immunization. Survival curves were
plotted as "percent survival" versus "days post infection." See
also Table 63 for survival percentage.
[0202] FIGS. 28A-28B are graphs showing the weight changes post
challenge in AG129 mice immunized with CHIKV mRNA vaccines. FIG.
28A shows the weight change of mice groups 1-4 and 7-9 challenged
on day 56 post immunization. FIG. 28B shows the weight changes of
mice groups 10-16 challenged on day 112 post immunization. Initial
weights were assessed on individual mice on study Day 0 and daily
thereafter. The mean percent weights for each group compared to
their percent weight on Day 0 (baseline) were plotted against "days
post-infection". Error bars represent the standard deviation
(SD).
[0203] FIGS. 29A-29B are graphs showing the post challenge heath
scores of AG129 mice immunized with CHIKV mRNA vaccines. FIG. 29A
shows the health scores of mice groups 1-4 and 7-9 challenged on
day 56 post immunization. FIG. 29B shows the health score of mice
groups 10-16 challenged on day 112 post immunization. The mean
health scores for each group were plotted against "days post
infection" and error bars represent the SD. Mean health scores were
calculated based on observations described in Table 51.
[0204] FIGS. 30A-30C are graphs showing the antibody titers
measured by ELISA assays in the serum of AG129 mice (groups 1-4 and
7-9) 28 days post immunization with CHIKV mRNA vaccines. FIG. 30A
shows the serum antibody titers against CHIKV E1 protein. FIG. 30B
shows the serum antibody titers against CHIKV E2 protein. FIG. 30C
shows the serum antibody titers against CHIKV lysate.
[0205] FIGS. 31A-31C are graphs showing the antibody titers
measured by ELISA assays in the serum of AG129 mice (groups 10-16)
28 days post immunization with CHIKV mRNA vaccine. FIG. 31A shows
the serum antibody titers against CHIKV E1 protein. FIG. 31B shows
the serum antibody titers against CHIKV E2 protein. FIG. 31C shows
the serum antibody titers against CHIKV lysate.
[0206] FIGS. 32A-32C are graphs showing the antibody titers
measured by ELISA assays in the serum of AG129 mice (groups 10-16)
56 days post immunization with CHIKV mRNA vaccine. FIG. 32A shows
the serum antibody titers against CHIKV E1 protein. FIG. 32B shows
the serum antibody titers against CHIKV E2 protein. FIG. 32C shows
the serum antibody titers against CHIKV lysate.
[0207] FIGS. 33A-33C are graphs showing the antibody titers
measured by ELISA assays in the serum of AG129 mice (groups 10-16)
112 days post immunization with CHIKV mRNA vaccine. FIG. 33A shows
the serum antibody titers against CHIKV E1 protein. FIG. 33B shows
the serum antibody titers against CHIKV E2 protein. FIG. 33C shows
the serum antibody titers against CHIKV lysate.
[0208] FIG. 34 shows a set of graphs depicting results of an ELISA
assay to identify the amount of antibodies produced in AG129 mice
in response to vaccination with mRNA encoding secreted CHIKV E1
structural protein, secreted CHIKV E2 structural protein, or CHIKV
full structural polyprotein C-E3-E2-6k-E1 at a dose of 10 .mu.g or
2 .mu.g at 28 days post immunization.
[0209] FIG. 35 shows a set of graphs depicting results of an ELISA
assay to identify the amount of antibodies produced in AG129 mice
in response to vaccination with mRNA encoding secreted CHIKV E1
structural protein, secreted CHIKV E2 structural protein, or CHIKV
full structural polyprotein C-E3-E2-6k-E1 at a dose of 10 .mu.g or
2 .mu.g at 28 days post immunization. The two panels depict
different studies.
[0210] FIG. 36 is a graph depicting comparison of ELISA titers from
the data of FIG. 34 to survival in the data of FIG. 35 left
panel.
[0211] FIG. 37 shows a set of graphs depicting efficacy results in
mice in response to vaccination with mRNA encoding CHIKV full
structural polyprotein C-E3-E2-6k-E1 at a dose of 10 .mu.g (left
panels), 2 .mu.g (middle panels) or 0.4 .mu.g (right panels) at 56
days (top panels) or 112 days (bottom panels)
post-immunization.
[0212] FIG. 38 shows a set of graphs depicting amount of
neutralizing antibody produced in mice in response to vaccination
with mRNA encoding CHIKV full structural polyprotein C-E3-E2-6k-E1
at a dose of 10 .mu.g, 2 .mu.g, or 0.4 .mu.g at 56 days post
immunization.
[0213] FIG. 39 shows a set of graphs depicting binding antibody
produced in mice in response to vaccination with mRNA encoding
CHIKV full structural polyprotein C-E3-E2-6k-E1 at a dose of 10
.mu.g, 2 .mu.g, or 0.4 .mu.g at 56 days post immunization (top
panels) and the corresponding correlation between binding and
neutralizing antibodies (bottom panels).
[0214] FIG. 40 shows a set of graphs depicting amount of
neutralizing antibody produced in A129 mice in response to
vaccination with mRNA encoding CHIKV full structural polyprotein
C-E3-E2-6k-E1 at a dose of 10 .mu.g, 2 .mu.g, or 0.4 .mu.g at 56
days post immunization against three different strains of CHIKV,
African-Senegal (left panel), La Reunion (middle panel) and CDC CAR
(right panel).
[0215] FIG. 41 shows a graph depicting neutralizing antibodies
against CHIKV S27 strain.
[0216] FIG. 42 is a graph depicting antibody titer against CHIKV
lysate post 3rd vaccination 10 with the mRNA vaccine in Sprague
Dawley rats.
[0217] FIG. 43 shows a set of graphs depicting antibody titers
following vaccination of mice with mRNA encoded CHIKV polyprotein
(C-E3-E2-6K-E1).
[0218] FIG. 44 shows a set of plots depicting cytokine secretion
and T-cell activation following vaccination of mice with mRNA
encoded CHIKV polyprotein (C-E3-E2-6K-E1).
[0219] FIGS. 45A-45B show a set of graphs depicting CD8+ T cell
activation following vaccination of mice with mRNA encoded CHIKV
polyprotein (C-E3-E2-6K-E1).
[0220] FIG. 46 shows a set of graphs depicting binding antibody
titers against CHIKV lysate (upper graph) and neutralizing titers
against 37997 CHIKV. The vaccine induces a robust antibody response
in non-human primates (NHPs).
[0221] FIG. 47 shows a set of graphs depicting a robust CD4
response to a CHIKV vaccine in NHPs.
DETAILED DESCRIPTION
[0222] Vaccines containing antigens from more than one pathogenic
organism within a single dose are referred to as "multivalent" or
"combination" vaccines. While various combination vaccines have
been approved for human use in several countries, including
trivalent vaccines for protecting against diphtheria, tetanus and
pertussis ("DTP" vaccines) and trivalent vaccines for protecting
against measles, mumps and rubella ("MMR" vaccines), combination
vaccines are more complex and are associated with more problems
than monovalent vaccines. For instance, current combination
vaccines can include relatively high amounts of aluminum salts as
adjuvants which causes concern to some patients despite empirical
safety studies. Additionally, the well-documented phenomenon of
antigenic competition (or interference) complicates the development
of multi-component vaccines. Antigenic interference refers to the
observation that administering multiple antigens often results in a
diminished response to certain antigens relative to the immune
response observed when such antigens are administered individually.
The combination RNA vaccines of the invention can be designed to
encode two, three, four, five or more, antigens against multiple
pathogenic organisms, while avoiding a number of the problems
associated with traditional combination vaccines.
[0223] Travelers facing a particular geographic viral threat would
also benefit from vaccination with a combination vaccine of the
invention. The traveler's vaccine may be tailored based on the
prevalence of particular viral diseases in the destination
location. For instance a combination vaccine including WNV, SINV,
VEEV, and EEEV would be particularly beneficial.
[0224] Embodiments of the present disclosure provide RNA (e.g.,
mRNA) vaccines that are useful for vaccinating against multiple
pathogens. The combination vaccines of the present disclosure
encode antigens from multiple pathogens (e.g., bacteria,
arboviruses, alphaviruses and flaviviruses), including but not
limited to Plasmodium (e.g., P. falciparum, P. vivax, P. malariae
and/or P. ovale), Japanese Encephalitis Virus (JEV), West Nile
Virus (WNV), Eastern Equine Encephalitis (EEEV), Venezuelan Equine
Encephalitis Virus (VEEV), Sindbis Virus (SINV), Chikungunya Virus
(CHIKV), Dengue Virus (DENV), Zika Virus (ZIKV) and/or Yellow Fever
Virus (YFV) antigenic polypeptide.
[0225] Thus, the present disclosure provides, in some embodiments,
vaccines that comprise RNA (e.g., mRNA) polynucleotides encoding a
Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
antigenic polypeptide. The present disclosure also provides, in
some embodiments, combination vaccines that comprise at least one
RNA (e.g., mRNA) polynucleotide encoding at least two antigenic
polypeptides selected from Malaria (e.g., P. falciparum, P. vivax,
P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV,
DENV, ZIKV and YFV antigenic polypeptides. Also provided herein are
methods of administering the RNA (e.g., mRNA) vaccines, methods of
producing the RNA (e.g., mRNA) vaccines, compositions (e.g.,
pharmaceutical compositions) comprising the RNA (e.g., mRNA)
vaccines, and nucleic acids (e.g., DNA) encoding the RNA (e.g.,
mRNA) vaccines. In some embodiments, a RNA (e.g., mRNA) vaccine
comprises an adjuvant, such as a flagellin adjuvant, as provided
herein.
[0226] The RNA (e.g., mRNA) vaccines (e.g., Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV RNA vaccines), in some
embodiments, may be used to induce a balanced immune response,
comprising both cellular and humoral immunity, without many of the
risks associated with DNA vaccination.
[0227] The entire contents of International Application No.
PCT/US2015/02740 is incorporated herein by reference.
Malaria
[0228] Malaria is an infectious disease caused by protozoan
parasites from the Plasmodium family. Anopheles mosquitoes transmit
Malaria, and they must have been infected through a previous blood
meal taken from an infected person. When a mosquito bites an
infected person, a small amount of blood is taken in and contains
microscopic Malaria parasites. There are four main types of Malaria
which infect humans: Plasmodium falciparum, P. vivax, P. malariae
and P. ovale. Falciparum Malaria is the most deadly type. Many
Malaria parasites are now immune to the most common drugs used to
treat the disease.
[0229] Embodiments of the present disclosure provide RNA (e.g.,
mRNA) vaccines that include polynucleotide encoding a Plasmodium
antigen. Malaria parasites are microorganisms that belong to the
genus Plasmodium. There are more than 100 species of Plasmodium,
which can infect many animal species such as reptiles, birds, and
various mammals. Four species of Plasmodium have long been
recognized to infect humans in nature, including P. falciparum, P.
vivax, P. malariae and P. ovale. In addition, there is one species
that naturally infects macaques which has recently been recognized
to be a cause of zoonotic Malaria in humans.
[0230] Malaria RNA (e.g., mRNA) vaccines, as provided herein may be
used to induce a balanced immune response, comprising both cellular
and humoral immunity, without many of the risks associated with DNA
vaccination.
[0231] P. falciparum infects humans and is found worldwide in
tropical and subtropical areas. It is estimated that every year
approximately 1 million people are killed by P. falciparum,
especially in Africa where this species predominates. P. falciparum
can cause severe Malaria because it multiples rapidly in the blood,
and can thus cause severe blood loss (anemia). In addition, the
infected parasites can clog small blood vessels. When this occurs
in the brain, cerebral Malaria results, a complication that can be
fatal. Some embodiments of the present disclosure provide Malaria
vaccines that include at least one RNA (e.g., mRNA) polynucleotide
having an open reading frame encoding at least one P. falciparum
antigenic polypeptide or an immunogenic fragment thereof (e.g., an
immunogenic fragment capable of raising an immune response to P.
falciparum).
[0232] P. vivax infects humans and is found mostly in Asia, Latin
America, and in some parts of Africa. Because of the population
densities, especially in Asia, it is probably the most prevalent
human Malaria parasite. P. vivax (as well as P. ovale) has dormant
liver stages ("hypnozoites") that can activate and invade the blood
("relapse") several months or years after the infecting mosquito
bite. Some embodiments of the present disclosure provide Malaria
vaccines that include at least RNA (e.g., mRNA) polynucleotide
having an open reading frame encoding at least one P. vivax
antigenic polypeptide or an immunogenic fragment thereof (e.g., an
immunogenic fragment capable of raising an immune response to P.
vivax).
[0233] P. ovale infects humans and is found mostly in Africa
(especially West Africa) and the islands of the western Pacific. It
is biologically and morphologically very similar to P. vivax.
However, differently from P. vivax, it can infect individuals who
are negative for the Duffy blood group, which is the case for many
residents of sub-Saharan Africa. This explains the greater
prevalence of P. ovale (rather than P. vivax) in most of Africa.
Some embodiments of the present disclosure provide Malaria vaccines
that include at least one RNA (e.g., mRNA) polynucleotide having an
open reading frame encoding at least one P. ovale antigenic
polypeptide or an immunogenic fragment thereof (e.g., an
immunogenic fragment capable of raising an immune response to P.
ovale).
[0234] P. malariae infects humans and is found worldwide. It is the
only human Malaria parasite species that has a quartan cycle
(three-day cycle). The three other species that infect human have a
tertian, two-day cycle. If untreated, P. malariae causes a
long-lasting, chronic infection that in some cases can last a
lifetime. In some chronically infected patients P. malariae can
cause serious complications such as the nephrotic syndrome. Some
embodiments of the present disclosure provide Malaria vaccines that
include at least one RNA (e.g., mRNA) polynucleotide having an open
reading frame encoding at least one P. malariae antigenic
polypeptide or an immunogenic fragment thereof (e.g., an
immunogenic fragment capable of raising an immune response to P.
malariae). P. knowlesi is found throughout Southeast Asia as a
natural pathogen of long-tailed and pig-tailed macaques. It has
recently been shown to be a significant cause of zoonotic Malaria
in that region, particularly in Malaysia. P. knowlesi has a 24-hour
replication cycle and so can rapidly progress from an uncomplicated
to a severe infection; fatal cases have been reported.
[0235] In some embodiments, an antigenic polypeptide is any antigen
that is expressed on the sporozoite or other pre-erythrocytic stage
of a Plasmodium parasite, such as the liver stage. For example, an
antigenic polypeptide may be a circumsporozoite (CS) protein, liver
stage antigen-1 (LSA1) (see, e.g. WO2004/044167 and Cummings J F et
al. Vaccine 2010; 28:5135-44, incorporated herein by reference),
liver stage antigen-3 (LSA-3) (see, e.g., EP 0 570 489 and EP 0 833
917, incorporated herein by reference), Pfs 16 kD (see, e.g., WO
91/18922 and EP 597 843), Exported antigen-1 (Exp-1) (described for
example in Meraldi et al. Parasite Immunol 2002; 24(3):141,
incorporated herein by reference),
sporozoite-threonine-asparagine-rich protein (STARP). sporozoite
and liver stage antigen (SALSA), thrombospondin related anonymous
protein (TRAP) (see, e.g., WO 90/01496, WO 91/11516 and WO
92/11868, incorporated herein by reference) and apical merozoite
antigen-1 (AMA1) (see, e.g., EP 0 372 019 and Remargue E J et al.
Trends in Parasilology 2007; 24(2):74-84, incorporated herein by
reference) which has recently been shown to be present at the liver
stage (in addition to the erythrocytic stage), and merozoite
surface protein-1 (MSP1) (see, e.g., Reed Z H et al. Vaccine 2009;
27:1651-60, incorporated herein by reference). An antigenic
polypeptide may be the entire protein, an immunogenic fragment
thereof, or a derivative thereof of any of the foregoing antigens.
Immunogenic fragments of Malaria antigens are known. including, for
example, the ectodomain from AMA1 (see, e.g., WO 02/077195,
incorporated herein by reference). Derivatives include, for
example, fusions with other proteins that may be Malaria proteins
or non-Malaria proteins, such as HBsAg. Derivatives of the present
disclosure are capable of raising an immune response against the
native antigen.
[0236] The sporozoite stage of Plasmodium (e.g., P. falciparunm or
P. vivax) is a potential target of a Malaria vaccine. The major
surface protein of the sporozoite is circumsporozoite protein (CS
protein). The Plasmodium circumsporozoite protein (CS) is expressed
during the sporozoite and early liver stages of parasitic
infection. This protein is involved in the adhesion of the
sporozoite to the hepatocyte and invasion of the hepatocyte.
Anti-CS antibodies inhibit parasite invasion and are also
associated with a reduced risk of clinical Malaria in some studies.
Antibodies raised through immunization with only the conserved
Asparagine-Alanine-Asparagine-Proline (NANP) amino acid repeat
sequence, the immunodominant B-cell epitope from P. falciparum CS,
are capable of blocking sporozoite invasion of hepatocytes.
[0237] CS protein has been cloned, expressed and sequenced for a
variety of strains, for example for P. falciparum the NF54 strain,
clone 3D7 (Caspers et al. Parasitol 1989; 35:185-190, incorporated
herein by reference). The protein from strain 3D7 has a central
immunodominant repeat region comprising a tetrapeptide
Asn-Ala-Asn-Pro (SEQ ID NO: 434) repeated 40 times and interspersed
with four minor repeats of the tetrapeptide Asn-Val-Asp-Pro (SEQ ID
NO: 435). In other strains, the number of major and minor repeats
as well as their relative position varies. This central portion is
flanked by an N and C terminal portion composed of non-repetitive
amino acid sequences designated as the repeatless portion of the CS
protein.
[0238] Some embodiments of the present disclosure provide Malaria
vaccines that include at least one RNA (e.g., mRNA) polynucleotide
having an open reading frame encoding Plasmodium CS protein or an
immunogenic fragment thereof (e.g., an immunogenic fragment capable
of raising an immune response to Plasmodium).
[0239] Liver Stage Antigen-1 (LSA1), expressed during Plasmodium
falciparum: hepatic schizogony is highly conserved, is abundantly
expressed from early through late schizogony, presumably allowing
time for both circulating and memory-recalled effector cells to
infiltrate the liver and exert their effector function, and it is
possible that high titer antibody could act upon the cloud of
flocculent liver stage antigen enveloping hepatic merozoites to
impede the latter's emergence and subsequent invasion of
erythrocytes. LSA1 is a 230 kDa protein, with a large central
repeat region (over 80 repeats of 17 amino acids each) flanked by
two highly conserved N- and C-terminal regions, known to contain B
cell and CD4+ and CD8.sup.+ T cell epitopes.
[0240] Some embodiments of the present disclosure provide Malaria
vaccines that include at least one RNA (e.g., mRNA) polynucleotide
having an open reading frame encoding Plasmodium LSA1 or an
immunogenic fragment thereof (e.g., an immunogenic fragment capable
of raising an immune response to Plasmodium). In some embodiments,
Malaria vaccines include at least one RNA (e.g., mRNA)
polynucleotide having an open reading frame encoding a recombinant
protein with full-length C- and N-terminal flanking domains and two
of the 17 amino acid repeats from the central repeat region,
referred to as "LSA-NRC."
[0241] Present on the surface of all known Plasmodium spp.,
merozoite surface protein 1 (MSP1) is a polypeptide of 190-230 kDa
that undergoes processing during schizont rupture to produce at
least four distinct fragments (83, 28-30, 38-45 and 42 kDa).
Further cleavage of the carboxy-terminal 42-kDa (MSP142) fragment
yields a 19-kDa fragment (MSP119), in a process that appears to be
critical for merozoite invasion. Both MSP.sub.142 and MSP.sub.119
regions of P. falciparum are encompassed by the present
disclosure.
[0242] Thus, in some embodiments, Malaria vaccines include at least
one RNA (e.g., mRNA) polynucleotide having an open reading frame
encoding Plasmodium MSP1 or an immunogenic fragment thereof (e.g.,
an immunogenic fragment capable of raising an immune response to
Plasmodium).
[0243] In some embodiments, Malaria vaccines include at least one
RNA (e.g., mRNA) polynucleotide having an open reading frame
encoding Plasmodium MSP1, MSP3 and AMA1.
[0244] Apical membrane antigen 1 (AMA1) is a micronemal protein of
apicomplexan parasites that appears to be essential during the
invasion of host cells. Immune responses to Plasmodium AMA1 can
have parasite-inhibitory effects, both as measured in vitro and in
animal challenge models. First identified as an invariant
Plasmodium knowlesi merozoite surface antigen, AMA1 is believed to
be unique to apicomplexan and derives from a single essential gene
present in all Plasmodium species.
[0245] Some embodiments of the present disclosure provide Malaria
vaccines that include at least one RNA (e.g., mRNA) polynucleotide
having an open reading frame encoding Plasmodium AMA1 or an
immunogenic fragment thereof (e.g., an immunogenic fragment capable
of raising an immune response to Plasmodium).
Japanese Encephalitis Virus (JEV)
[0246] Japanese encephalitis virus (JEV), a mosquito-borne
flavivirus, is a common cause of encephalitis in Asia. Japanese
encephalitis (JE) occurs throughout most of Asia and parts of the
western Pacific. Among an estimated 35,000-50,000 annual cases,
approximately 20%-30% of patients die, and 30%-50% of survivors
have neurologic or psychiatric sequelae. In endemic countries, JE
is primarily a disease of children. However, travel-associated JE,
although rare, can occur in a wide portion of the population. JEV
is transmitted in an enzootic cycle between mosquitoes and
amplifying vertebrate hosts, primarily pigs and wading birds. JEV
is transmitted to humans through the bite of an infected mosquito,
primarily in rural agricultural areas. In most temperate areas of
Asia, JEV transmission is seasonal, and substantial epidemics can
occur.
[0247] Vaccines available for use against JEV infection include
live virus inactivated by such methods as formalin treatment, as
well as attenuated virus (Tsai et al., in Vaccines (Plotkin, ed.)
W.B. Saunders, Philadelphia, Pa., 1994, pp. 671-713). Whole virus
vaccines, although effective, do have certain problems and/or
disadvantages. The viruses are cultivated in mouse brain or in cell
culture using mammalian cells as the host. Such culture methods are
cumbersome and expensive.
[0248] Embodiments of the present disclosure provide RNA (e.g.,
mRNA) vaccines that include polynucleotide encoding a JEV antigen.
JEV is a small-enveloped virus with a single-stranded, plus-sense
RNA genome, consisting of a single open reading frame that codes
for a large polyprotein which is co- and post-translationally
cleaved into three structural (capsid, C; pre-membrane, prM; and
envelope, E) and seven non-structural proteins (NS1, NS2A, NS2B,
NS3, NS4A, NS4B and NS5). The RNA genome of JEV has a type I cap
structure at its 5'-terminus but lacks a poly(A) tail at its 3'
terminus. E protein is involved in a number of important functions
related to virus infection such as receptor binding and membrane
fusion. E protein has been used to raise antibodies that neutralize
virus activity in vitro as well as in vivo. Additionally, sub-viral
particles consisting of only the prM and the E proteins were highly
effective in generating protective immune response in mice against
JEV. The ability of various JEV structural and non-structural
proteins to produce an immune response has been examined. (Chen, H.
W., et al., 1999. J. Virol. 73:10137-10145.) In view of these and
other studies it has been concluded that the E protein is an
important protein for inducing protective immunity against JEV.
[0249] The full-length E protein is membrane anchored. Immunogenic
fragments of the E protein can be generated by removing the anchor
signal. For instance, truncated Ea protein wherein a 102-amino acid
hydrophobic sequence has been removed from the C-terminus of the
protein to generate a 398-amino acid Es protein for immunogenic
antigenic fragments. Other immunogenic fragments include a
secretory form of E protein, as opposed to the anchored protein.
Thus immunogenic fragments include the truncated E protein and the
secretory envelope protein (Es) of JEV. JEV antigens may also
include one or more non-structural proteins selected from NS1,
NS2A, NS2B, NS3, NS4A, NS4B and NS5.
[0250] Since the envelope (most external portion of a JEV particle)
is the first to encounter target cells, the present disclosure
encompasses antigenic polypeptides associated with the envelope as
immunogenic agents. In brief, surface and membrane proteins E, Es,
capsid and prM--as single antigens or in combination with or
without adjuvants may be used as JEV vaccine antigens.
[0251] In some embodiments, JEV vaccines comprise RNA (e.g., mRNA)
encoding JEV E antigenic polypeptides or immunogenic fragments
thereof.
[0252] In some embodiments, JEV vaccines comprise RNA (e.g., mRNA)
encoding JEV Es antigenic polypeptides or immunogenic fragments
thereof.
[0253] In some embodiments, JEV vaccines comprise RNA (e.g., mRNA)
encoding JEV capsid antigenic polypeptides or immunogenic fragments
thereof.
[0254] In some embodiments, JEV vaccines comprise RNA (e.g., mRNA)
encoding JEV prM antigenic polypeptides or immunogenic fragments
thereof.
[0255] In some embodiments, JEV vaccines comprise RNA (e.g., mRNA)
encoding JEV NS1 antigenic polypeptides or immunogenic fragments
thereof.
[0256] In some embodiments, JEV vaccines comprise RNA (e.g., mRNA)
encoding JEV antigenic polypeptides having at least 80%, 85%, 90%,
92%, 95%, 96%, 97%, 98% or 99% identity with JEV E protein and has
receptor binding and/or membrane fusion activity.
[0257] In some embodiments, JEV vaccines comprise RNA (e.g., mRNA)
encoding JEV antigenic polypeptides having at least 80%, 85%, 90%,
92%, 95%, 96%, 97%, 98% or 99% identity with JEV Es protein and has
receptor binding and/or membrane fusion activity.
[0258] In some embodiments, JEV vaccines comprise RNA (e.g., mRNA)
encoding JEV antigenic polypeptides having at least 80%, 85%, 90%,
92%, 95%, 96%, 97%, 98% or 99% identity with JEV capsid protein
having capsid activity.
[0259] In some embodiments, JEV vaccines comprise RNA (e.g., mRNA)
encoding JEV antigenic polypeptides having at least 80%, 85%, 90%,
92%, 95%, 96%, 97%, 98% or 99% identity with JEV prM protein and
has activity of an immature virion.
[0260] In some embodiments, JEV vaccines comprise RNA (e.g., mRNA)
encoding JEV antigenic polypeptides having at least 80%, 85%, 90%,
92%, 95%, 96%, 97%, 98% or 99% identity with JEV NS1 protein and
has viral replication and pathogenicity activity.
[0261] JEV RNA vaccines, as provided herein may be used to induce a
balanced immune response, comprising both cellular and humoral
immunity, without many of the risks associated with DNA
vaccination.
West Nile Virus (WNV), Eastern Equine Encephalitis (EEEV),
Venezuelan Equine Encephalitis Virus (VEEV), and Sindbis Virus
(SINV)
[0262] WNV was first isolated in the West Nile region of Uganda,
Africa, and belongs to the Flaviviridae family Flavivirus genus.
The structure of virus particles consists of a spherical structure
wherein a capsid protein (C protein) is bonded to one (+) chain RNA
virus gene, and a lipid bilayer membrane surrounding the spherical
structure. The lipid membrane includes two kinds of proteins:
envelope protein (E protein) and membrane protein (M protein). M
protein is produced as a precursor prM protein and cleaved with a
protease called furin to become a mature protein. West Nile virus
(WNV) is an important mosquito transmitted virus which is now
native to the U.S.
[0263] West Nile fever is a systemic acute fever disease caused by
infection with WNV. Occasionally, the virus invades and grows in
the central nervous system to cause lethal brain meningitis. WNV is
widely distributed in Africa, Middle East, part of Europe, Russia,
India, and Indonesia. The virus is maintained and propagated by an
infection ring. The West Nile fever virus is transmitted to birds
and mammals by the bites of certain mosquitoes (e.g., Culex, Aedes,
Anopheles). Direct transmission may happen from WNV infected
subject to healthy subject by oral transmission (prey and
transmission through colostrum) and blood/organ vectored
transmission. Humans, horses and domestic animals are hosts.
Recently, WNV invaded and was indigenized in the US and has
expanded since then. A prevalent US strain is West Nile virus
NY99-flamingo382-99 strain (Lanciotti, R. S. et al., Science, 286:
2333-2337, 1999) (GenBank Accession No. AF196835).
[0264] The WNV antigens in the combination RNA vaccine may be
derived from a particular WNV strain, such as NY99 or KEN-3829 or
any other strain. Additional WNV strains are known in the art. West
Nile virus antigens include the following proteins and
polyproteins: C (capsid), E (envelope), M (membrane), prM
(Pre-membrane), NS2A, NS2B, NS3 prM-E, M-E, prM-M, prM-M-E, and
NS2A-NS2B-NS3.
[0265] Eastern equine encephalitis virus (EEEV), Western equine
encephalitis virus (WEEV), and Venezuelan equine encephalitis virus
(VEEV) are members of the Alphavirus genus of the family
Togaviridae. The genus is comprised of at least 27 different
arthropod-borne RNA viruses that are found throughout much of the
world. The viruses normally circulate among avian or rodent hosts
through the feeding activities of a variety of mosquitoes.
[0266] EEEV causes encephalitis in humans and equines in epidemic
proportions. However, EEEV causes the most severe of the arboviral
encephalitides in humans, with high mortality and severe
neurological sequelae in survivors (Fields Virology, 4.sup.th Ed.,
Chapter 30 Alphaviruses, [2002] 917-962). The virus is known to be
focally endemic along much of the Atlantic and Gulf Coasts of North
America. It has also been found in southern Canada, the Caribbean,
Central America, the eastern part of Mexico and in large sections
of South America. Inland foci exist in the Great Lakes region and
South Dakota in the U.S. as well as the Amazon Basin.
[0267] The current EEEV vaccine for veterinary applications in the
U.S. is a formalin-inactivated whole virus preparation derived from
the PE-6 strain (Bartelloni, et al. [1970] Am J. Trop Med Hyg.
19:123-126; Marie, et al. [1970] Am J Trop Med Hyg. 19:119-122).
Currently there is no human vaccine. The inactivated veterinary
vaccine is poorly immunogenic, requires multiple inoculations with
frequent boosters and generally results in immunity of short
duration.
[0268] EEEV, SINV, JEV, and CHIKV all have single-stranded,
positive sense RNA genomes. A portion of the genome encodes the
viral structural proteins Capsid, E3, E2, 6K, and E1, each of which
are derived by proteolytic cleavage of the product of a single open
reading frame. The nucleocapsid (C) protein possesses
autoproteotytic activity which cleaves the C protein from the
precursor protein soon after the ribosome transits the junction
between the C and E3 protein coding sequence. Subsequently, the
envelope glycoproteins E2 and E1 are derived by proteolytic
cleavage in association with intracellular membranes and form
heterodimers. E2 initially appears in the infected cell as the
precursor protein PE2, which consists of E3 and E2. After extensive
glycosylation and transit through the endoplasmic reticulum and the
Golgi apparatus, E3 is cleaved from E2 by the furin protease.
Subsequently, the E2/E1 complex is transported to the cell surface
where it is incorporated into virus budding from the plasma
membrane. The envelope proteins play an important role in
attachment and fusion to cells.
[0269] Sindbis Virus (SINV) is also a member of the Togaviridae
family, in the alphavirus subfamily and is transmitted by
mosquitoes. Sindbis fever is most common in South and East Africa,
Egypt, Israel, Philippines and parts of Australia. The genome
encodes four non-structural proteins at the 5' end and the capsid
and two envelope proteins at the 3' end. The non-structural
proteins are involved in genome replication and the production of
new genomic RNA and a shorter sub-genomic RNA strand. The viruses
assemble at the host cell surfaces and acquire their envelope
through budding.
Yellow Fever Virus (YFV)
[0270] Along with other viruses in the Flaviviridae family, Yellow
fever virus is enveloped and icosahedral with a non-segmented,
single-stranded, positive sense RNA genome. It is most closely
related to the Sepik virus and is one of the two viruses in clade
VIII. In 1927, Yellow fever virus was the first human virus to be
isolated. It is found in tropical areas of Africa and South
America. YFV is believed to have originated in Africa and spread to
South America through slave trades in the 17.sup.th century. Since
then, there have been Yellow fever outbreaks in the Americas,
Africa and Europe. It is transmitted by mosquitoes and has been
isolated from a number of species in the genus Aedes (e.g., Aedes
aegypti, Aedes africanus or Aedes albopictus). Mosquitos of the
genus Haemagogus and Sabethes can also serve as vectors. Studies
show that the extrinsic incubation period in mosquitoes is about 10
days. Vertebrate hosts of the virus include monkeys and humans.
[0271] Forty-seven African and South American countries are either
endemic for, or have regions that are endemic from, Yellow fever.
It is estimated that in 2013 alone, there were 84,000 to 170,000
severe cases of yellow fever and 29,000 to 60,000 deaths associated
with Yellow fever.
[0272] What is important is not only the number of cases but also
the clinical manifestation of the cases. After YFV incubates in the
body for about 6 days, symptoms including fever, muscle pain,
backache, headache, loss of appetite, and nausea or vomiting are
observed. In most cases, these symptoms disappear after about 4
days. In a small percentage of patients, a more toxic phase of the
disease is observed within 24 hours of recovering from the initial
symptoms. In this toxic phase, patients develop high fever,
jaundice, dark urine and abdominal pain with vomiting. Half of the
patients that enter the toxic phase die within 10 days.
[0273] In some embodiments, YFV vaccines comprise RNA (e.g., mRNA)
encoding a YFV antigenic polypeptide having at least 95%, at least
96%, at least 97%, at least 98% or at least 99% identity with YFV
polyprotein and having YFV polyprotein activity, respectively. The
YFV polyprotein is cleaved into capsid, precursor membrane,
envelope, and non-structural proteins (NS1, NS2A, NS2B, NS3, NS4A,
NS4B, NS5).
[0274] A protein is considered to have YFV polyprotein activity if,
for example, it facilitates the attachment of the viral envelope to
host receptors, mediates internalization into the host cell, and
aids in fusion of the virus membrane with the host's endosomal
membrane.
Zika Virus (ZIKV)
[0275] Along with other viruses in the Flaviviridae family, Zika
virus is enveloped and icosahedral with a non-segmented,
single-stranded, positive sense RNA genome. It is most closely
related to the Spondweni virus and is one of the two viruses in the
Spondweni virus clade. The virus was first isolated in 1947 from a
rhesus monkey in the Zika Forest of Uganda, Africa and was isolated
for the first time from humans in 1968 in Nigeria. From 1951
through 1981, evidence of human infection was reported from other
African countries such as Uganda, Tanzania, Egypt, Central African
Republic, Sierra Leone and Gabon, as well as in parts of Asia
including India, Malaysia, the Philippines, Thailand, Vietnam and
Indonesia. It is transmitted by mosquitoes and has been isolated
from a number of species in the genus Aedes--Aedes aegypti, Aedes
africanus, Aedes apicoargenteus, Aedes furcifer, Aedes
luteocephalus and Aedes vitattus. Studies show that the extrinsic
incubation period in mosquitoes is about 10 days. The vertebrate
hosts of the virus include monkeys and humans.
[0276] As of early 2016, the most widespread outbreak of Zika
fever, caused by the Zika virus, is ongoing primarily in the
Americas. The outbreak began in April 2015 in Brazil, and
subsequently spread to other countries in South America, Central
America, and the Caribbean.
[0277] The Zika virus was first linked with newborn microcephaly
during the Brazil Zika virus outbreak. In 2015, there were 2,782
cases of microcephaly compared with 147 in 2014 and 167 in 2013.
The Brazilian Health Ministry has reported 4783 cases of suspected
microcephaly as of Jan. 30, 2016, an increase of more than 1000
cases from a week earlier. Confirmation of many of the recent cases
is pending, and it is difficult to estimate how many cases went
unreported before the recent awareness of the risk of virus
infections.
[0278] What is important is not only the number of cases but also
the clinical manifestation of the cases. Brazil is seeing severe
cases of microcephaly, which are more likely to be paired with
greater developmental delays. Most of what is being reported out of
Brazil is microcephaly with other associated abnormalities. The
potential consequence of this is the fact that there are likely to
be subclinical cases where the neurological sequelae will only
become evident as the children grow.
[0279] Zika virus has also been associated with an increase in a
rare condition known as Guillain-Barre, where the infected
individual becomes essentially paralyzed. During the Zika virus
outbreak in French Polynesia, of the 74 patients which had had Zika
symptoms, 42 were diagnosed with Guillain-Barre syndrome. In
Brazil, 121 cases of neurological manifestations and Guillain-Barre
syndrome (GBS) were reported, all cases with a history of Zika-like
symptoms.
[0280] The design of preferred Zika vaccine mRNA constructs of the
invention encode prME proteins from the Zika virus intended to
produce significant immunogenicity. The open reading frame
comprises a signal peptide (to optimize expression into the
endoplasmic reticulum) followed by the Zika prME polyprotein
sequence. The particular prME sequence used is from a Micronesian
strain (2007) that most closely represents a consensus of
contemporary strain prMEs. This construct has 99% prME sequence
identity to the current Brazilian isolates.
[0281] Within the Zika family, there is a high level of homology
within the prME sequence (>90%) across all strains so far
isolated. The high degree of homology is also preserved when
comparing the original isolates from 1947 to the more contemporary
strains circulating in Brazil in 2015, suggesting that there is
"drift" occurring from the original isolates.
[0282] Furthermore, attenuated virus preparations have provided
cross-immunization to all other strains tested, including Latin
American/Asian, and African. Overall, this data suggests that
cross-protection of all Zika strains is possible with a vaccine
based on prME. In fact, the prM/M and E proteins of ZIKV have a
very high level (99%) of sequence conservation between the
currently circulating Asiatic and Brazilian viral strains.
[0283] The M and E proteins are on the surface of the viral
particle. Neutralizing antibodies predominantly bind to the E
protein, the preM/M protein functions as a chaperone for proper
folding of E protein and prevent premature fusion of E protein
within acidic compartments along the cellular secretory
pathway.
[0284] Described herein are examples of ZIKV vaccine designs
comprising mRNA encoding the both prM/M and E proteins or E protein
alone. In some embodiments, the mRNA encodes an artificial signal
peptide fused to prM protein fused to E protein. In some
embodiments, the mRNA encodes an artificial signal peptide fused to
E protein.
[0285] ZIKV vaccine constructs can encode the prME or E proteins
from different strains, for example, Brazil_isolate_ZikaSPH2015 or
ACD75819_Micronesia, having a signal peptide fused to the N-termini
of the antigenic protein(s). In some embodiments, ZIKV vaccines
comprise mRNAs encoding antigenic polypeptides having amino acid
sequences of SEQ ID NO: 156-222 or 469.
Dengue Virus (DENV)
[0286] There is no specific treatment for DENV infection, and
control of DENV by vaccination has proved elusive, in part, because
the pathogenesis of DHF/DSS is not completely understood. While
infection with one serotype confers lifelong homotypic immunity, it
confers only short term (approximately three to six months) cross
protection against heterotypic serotypes. Also, there is evidence
that prior infection with one type can produce an antibody response
that can intensify, or enhance, the course of disease during a
subsequent infection with a different serotype. The possibility
that vaccine components could elicit enhancing antibody responses,
as opposed to protective responses, has been a major concern in
designing and testing vaccines to protect against dengue
infections.
[0287] In late 2015 and early 2016, the first dengue vaccine,
Dengvaxia (CYD-TDV) by Sanofi Pasteur, was registered in several
countries for use in individuals 9-45 years of age living in
endemic areas. Issues with the vaccine include (1) weak protection
against DENV1 and DENV2 (<60% efficacy); (2) relative risk of
dengue hospitalization among children <9 years old (7.5.times.
higher than placebo); (3) immunogenicity not sustained after 1-2
years (implying the need for a 4.sup.th dose booster); and (4)
lowest efficacy against DENV2, which often causes more severe
conditions. This latter point is a major weakness with the
Dengvaxia vaccine, signaling the need of a new, more effective
vaccine effective against DENV2. Other tetravalent live-attenuated
vaccines are under development in phase II and phase III clinical
trials, and other vaccine candidates (based on subunit, DNA and
purified inactivated virus platforms) are at earlier stages of
clinical development, although the ability of these vaccine
candidates to provide broad serotype protection has not been
demonstrated.
[0288] Embodiments of the present disclosure provide RNA (e.g.,
mRNA) vaccines that include at least one RNA polynucleotide
encoding a Dengue virus (DENV) antigen. Dengue virus is a
mosquito-borne (Aedes aegypti/Aedes albopictus) member of the
family Flaviviridae (positive-sense, single-stranded RNA virus).
The dengue virus genome encodes ten genes and is translated as a
single polypeptide which is cut into ten proteins: the capsid,
envelope, membrane, and nonstructural proteins (NS1, NS2A, NS2B,
NS3, SN4A, NS4B, and NS5 proteins). The virus' main antigen is DENV
envelope (E) protein, which is a component of the viral surface and
is thought to facilitate the binding of the virus to cellular
receptors (Heinz et al., Virology. 1983, 126:525). There are four
similar but distinct serotypes of dengue virus (DENV-1, DENV-2,
DENV-3, DENV-4, and DENV-5), which result annually in an estimated
50-100 million cases of dengue fever and 500,000 cases of the more
severe dengue hemorrhagic fever/dengue shock syndrome (DHF/DSS)
(Gubler et al., Adv Virus Res. 1999, 53:35-70). The four serotypes
show immunological cross-reactivity, but are distinguishable in
plaque reduction neutralization tests and by their respective
monoclonal antibodies. The dengue virus E protein includes a
serotype-specific antigenic determinant and determinants necessary
for virus neutralization (Mason et al., J Gen Virol. 1990,
71:2107-2114).
[0289] After inoculation, the dendritic cells become infected and
travel to lymph nodes. Monocytes and macrophages are also targeted
shortly thereafter. Generally, the infected individual will be
protected against homotypic reinfection for life; however, the
individual will only be protected against other serotypes for a few
weeks or months (Sabin, Am J Trop Med Hyg. 1952, 1:30-50). In fact,
DHF/DSS is generally found in children and adults infected with a
dengue virus serotype differing from their respective primary
infection. Thus, it is necessary to develop a vaccine that provides
immunity to all four serotypes.
[0290] The DENV E (envelope) protein is found on the viral surface
and plays a role in the initial attachment of the viral particle to
the host cell. Several molecules which interact with the viral E
protein (ICAM3-grabbing non-integrin, CD209, Rab 5, GRP 78, and the
mannose receptor) are thought to be important factors mediating
attachment and viral entry.
[0291] The DENV prM (membrane) protein is important in the
formation and maturation of the viral particle. The membrane
protein consists of seven antiparallel .beta.-strands stabilized by
three disulfide bonds. The glycoprotein shell of the mature DENV
virion consists of 180 copies each of the E protein and M protein.
The immature virion comprises E and prM proteins, which form 90
heterodimer spikes on the exterior of the viral particle. The
immature viral particle buds into the endoplasmic reticulum and
eventually travels via the secretory pathway to the Golgi
apparatus. As the virion passes through the trans-Golgi Network
(TGN), it is exposed to an acidic environment which causes a
conformational change in the E protein which causes it to
disassociate from the prM protein and form E homodimers. During the
maturation phase, the pr peptide is cleaved from the M peptide by
the host protease, furin. The M protein then acts as a
transmembrane protein under the E-protein shell of the mature
virion. The pr peptide remains associated with the E protein until
the viral particle is released into the extracellular environment,
acting like a cap covering the hydrophobic fusion loop of the E
protein until the viral particle has exited the cell.
[0292] The DENV NS3 is a serine protease, as well as an RNA
helicase and RTPase/NTPase. The protease domain consists of six
.beta.-strands arranged into two .beta.-barrels formed by residues
1-180 of the protein. The catalytic triad (His-51, Asp-75 and
Ser-135), is found between these two .beta.-barrels, and its
activity is dependent on the presence of the NS2B cofactor which
wraps around the NS3 protease domain and becomes part of the active
site. The remaining NS3 residues (180-618), form the three
subdomains of the DENV helicase. A six-stranded parallel
.beta.-sheet surrounded by four .alpha.-helices make up subdomains
I and II, and subdomain III is composed of 4 .alpha.-helices
surrounded by three shorter .alpha.-helices and two antiparallel
.beta.-strands.
Chikungunya Virus (CHIKV)
[0293] Presently, CHIKV is a re-emerging human pathogen that has
now established itself in Southeast Asia and has more recently
spread to Europe. The Chikungunya virus (CHIKV) was introduced into
Asia around 1958, and sites of endemic transmission within
Southeastern Asia, including the Indian Ocean, were observed
through 1996. The CHIKV epidemic moved throughout Asia, reaching
Europe and Africa in the early 2000s, and was imported via
travelers to North America and South America from 2005 to 2007.
Sporadic outbreaks are still occurring in several countries, such
as Italy, infecting naive populations. Singapore, for instance,
experienced two successive waves of Chikungunya virus outbreaks in
January and August 2008. Of the two strain lineages of CHIKV, the
African strain remains enzootic by cycling between mosquitoes and
monkeys, but the Asian strain is transmitted directly between
mosquitoes and humans. This cycle of transmission may have allowed
the virus to become more pathogenic as the reservoir host was
eliminated.
[0294] In humans, CHIKV causes a debilitating disease characterized
by fever, headache, nausea, vomiting, fatigue, rash, muscle pain
and joint pain. Following the acute phase of the illness, patients
develop severe chronic symptoms lasting from several weeks to
months, including fatigue, incapacitating joint pain and
polyarthritis.
[0295] The re-emergence of CHIKV has caused millions of cases
throughout countries around the Indian Ocean and in Southeast Asia.
Specifically, India, Indonesia, Maldives, Myanmar and Thailand have
reported over 1.9 million cases since 2005. Globally, human CHIKV
epidemics from 2004-2011 have resulted in 1.4-6.5 million reported
cases, including a number of deaths. Thus, CHIKV remains a public
threat that constitutes a major public health problem with severe
social and economic impact.
[0296] Despite significant morbidity and some cases of mortality
associated with CHIKV infection and its growing prevalence and
geographic distribution, there is currently no licensed CHIKV
vaccine or antiviral approved for human use. Several potential
CHIKV vaccine candidates have been tested in humans and animals
with varying success.
[0297] Chikungunya virus is a small (about 60-70 nm diameter),
spherical, enveloped, positive-strand RNA virus having a capsid
with icosahedral symmetry. The virion consists of an envelope and a
nucleocapsid. The virion RNA is infectious and serves as both
genome and viral messenger RNA. The genome is a linear, ssRNA(+)
genome of 11,805 nucleotides which encodes two polyproteins that
are processed by host and viral proteases into non-structural
proteins (nsP1, nsP2, nsP3, and RdRpnsP4) necessary for RNA
synthesis (replication and transcription) and structural proteins
(capsid and envelope proteins C, E3, E2, 6K, and E1) which attach
to host receptors and mediate endocytosis of virus into the host
cell. The E1 and E2 glycoproteins form heterodimers that associate
as 80 trimeric spikes on the viral surface covering the surface
evenly. The envelope glycoproteins play a role in attachment to
cells. The capsid protein possesses a protease activity that
results in its self-cleavage from the nascent structural protein.
Following its cleavage, the capsid protein binds to viral RNA and
rapidly assembles into icosahedric core particles. The resulting
nucleocapsid eventually associates with the cytoplasmic domain of
E2 at the cell membrane, leading to budding and formation of mature
virions.
[0298] E2 is an envelope glycoprotein responsible for viral
attachment to target host cell, by binding to the cell receptor. E2
is synthesized as a p62 precursor which is processed at the cell
membrane prior to virion budding, giving rise to an E2-E1
heterodimer. The C-terminus of E2 is involved in budding by
interacting with capsid proteins.
[0299] E1 is an envelope glycoprotein with fusion activity, which
is inactive as long as E1 is bound to E2 in the mature virion.
Following virus attachment to target cell and endocytosis,
acidification of the endosome induces dissociation of the E1/E2
heterodimer and concomitant trimerization of the E1 subunits. The
E1 trimer is fusion active and promotes the release of the viral
nucleocapsid in the cytoplasm after endosome and viral membrane
fusion.
[0300] E3 is an accessory protein that functions as a membrane
translocation/transport signal for E1 and E2.
[0301] 6K is another accessory protein involved in virus
glycoprotein processing, cell permeabilization, and the budding of
viral particles. Like E3, it functions as a membrane transport
signal for E1 and E2.
[0302] The CHIKV structural proteins have been shown to be
antigenic, which proteins, fragments, and epitopes thereof are
encompassed within the invention. A phylogenetic tree of
Chikungunya virus strains derived from complete concatenated open
reading frames for the nonstructural and structural polyproteins
shows key envelope glycoprotein E1 amino acid substitutions that
facilitated (Indian Ocean lineage) or prevented (Asian lineage)
adaptation to Aedes albopictus. There are membrane-bound and
secreted forms of E1 and E2, as well as the full length polyprotein
antigen (C-E3-E2-6K-E1), which retains the protein's native
conformation. Additionally, the different Chikungunya genotypes,
strains and isolates can also yield different antigens, which are
functional in the constructs of the invention. For example, there
are several different Chikungunya genotypes: Indian Ocean,
East/Central/South African (ECSA), Asian, West African, and the
Brazilian isolates (ECSA/Asian). There are three main Chikungunya
genotype. These are ESCA (East-South-Central Africa), Asia, and
West Africa. While sometimes names differ in publications, all
belong to these three geographical strains.
[0303] The entire contents of International Application No.
PCT/US2015/02740 is incorporated herein by reference.
Combination Vaccines
[0304] Embodiments of the present disclosure also provide
combination RNA (e.g., mRNA) vaccines. A "combination RNA (e.g.,
mRNA) vaccine" of the present disclosure refers to a vaccine
comprising at least one (e.g., at least 2, 3, 4, 5, 6, 7, 8, 9 or
10) RNA (e.g., mRNA) polynucleotide having an open reading frame
encoding a combination of at least one Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale) antigenic
polypeptide, at least one JEV antigenic polypeptide, at least one
WNV antigenic polypeptide, at least one EEEV antigenic polypeptide,
at least one VEEV antigenic polypeptide, at least one SINV
antigenic polypeptide, at least on CHIKV antigenic polypeptide, at
least one DENV antigenic polypeptide, at least one ZIKV antigenic
polypeptide, at least one YFV antigenic polypeptide, or any
combination of two, three, four, five, six, seven, eight, nine, ten
or more of the foregoing antigenic polypeptides.
[0305] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a WNV antigenic
polypeptide, a EEEV antigenic polypeptide, a VEEV antigenic
polypeptide, a SINV antigenic polypeptide, a CHIKV antigenic
polypeptide, a DENV antigenic polypeptide, a ZIKV antigenic
polypeptide and a YFV antigenic polypeptide.
[0306] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide and a JEV antigenic polypeptide.
[0307] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide and a WNV antigenic polypeptide.
[0308] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide and a EEEV antigenic polypeptide.
[0309] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide and a VEEV antigenic polypeptide.
[0310] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide and a SINV antigenic polypeptide.
[0311] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0312] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide and a DENV antigenic polypeptide.
[0313] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0314] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide and a YFV antigenic polypeptide.
[0315] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide and a WNV antigenic polypeptide.
[0316] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide and a EEEV antigenic polypeptide.
[0317] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide and a VEEV antigenic polypeptide.
[0318] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide and a SINV antigenic polypeptide.
[0319] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0320] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide and a DENV antigenic polypeptide.
[0321] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0322] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide and a YFV antigenic polypeptide.
[0323] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide and a EEEV antigenic polypeptide.
[0324] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide and a VEEV antigenic polypeptide.
[0325] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide and a SINV antigenic polypeptide.
[0326] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0327] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide and a DENV antigenic polypeptide.
[0328] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0329] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide and a YFV antigenic polypeptide.
[0330] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide and a VEEV antigenic polypeptide.
[0331] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide and a SINV antigenic polypeptide.
[0332] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0333] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide and a DENV antigenic polypeptide.
[0334] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0335] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide and a YFV antigenic polypeptide.
[0336] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a VEEV
antigenic polypeptide and a SINV antigenic polypeptide.
[0337] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a VEEV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0338] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a VEEV
antigenic polypeptide and a DENV antigenic polypeptide.
[0339] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a VEEV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0340] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a VEEV
antigenic polypeptide and a YFV antigenic polypeptide.
[0341] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a SINV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0342] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a SINV
antigenic polypeptide and a DENV antigenic polypeptide.
[0343] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a SINV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0344] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a SINV
antigenic polypeptide and a YFV antigenic polypeptide.
[0345] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a CHIKV
antigenic polypeptide and a DENV antigenic polypeptide.
[0346] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a CHIKV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0347] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a CHIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0348] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a DENV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0349] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a DENV
antigenic polypeptide and a YFV antigenic polypeptide.
[0350] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0351] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide and a WNV
antigenic polypeptide.
[0352] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide and a EEEV
antigenic polypeptide.
[0353] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide and a VEEV
antigenic polypeptide.
[0354] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide and a SINV
antigenic polypeptide.
[0355] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide and a CHIKV
antigenic polypeptide.
[0356] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide and a DENV
antigenic polypeptide.
[0357] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0358] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide and a YFV
antigenic polypeptide.
[0359] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide and a EEEV
antigenic polypeptide.
[0360] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide and a VEEV
antigenic polypeptide.
[0361] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide and a SINV
antigenic polypeptide.
[0362] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide and a CHIKV
antigenic polypeptide.
[0363] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide and a DENV
antigenic polypeptide.
[0364] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0365] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide and a YFV
antigenic polypeptide.
[0366] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a EEEV antigenic polypeptide and a VEEV
antigenic polypeptide.
[0367] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a EEEV antigenic polypeptide and a SINV
antigenic polypeptide.
[0368] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a EEEV antigenic polypeptide and a CHIKV
antigenic polypeptide.
[0369] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a EEEV antigenic polypeptide and a DENV
antigenic polypeptide.
[0370] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a EEEV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0371] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a EEEV antigenic polypeptide and a YFV
antigenic polypeptide.
[0372] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a VEEV antigenic polypeptide and a SINV
antigenic polypeptide.
[0373] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a VEEV antigenic polypeptide and a CHIKV
antigenic polypeptide.
[0374] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a VEEV antigenic polypeptide and a DENV
antigenic polypeptide.
[0375] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a VEEV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0376] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a VEEV antigenic polypeptide and a YFV
antigenic polypeptide.
[0377] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, SINV antigenic polypeptide and a CHIKV
antigenic polypeptide.
[0378] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, SINV antigenic polypeptide and a DENV
antigenic polypeptide.
[0379] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, SINV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0380] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, SINV antigenic polypeptide and a YFV
antigenic polypeptide.
[0381] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a CHIKV antigenic polypeptide and a DENV
antigenic polypeptide.
[0382] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a CHIKV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0383] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a CHIKV antigenic polypeptide and a YFV
antigenic polypeptide.
[0384] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a DENV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0385] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a DENV antigenic polypeptide and a YFV
antigenic polypeptide.
[0386] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a ZIKV antigenic polypeptide and a YFV
antigenic polypeptide.
[0387] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide and a EEEV
antigenic polypeptide.
[0388] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide and a VEEV
antigenic polypeptide.
[0389] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide and a SINV
antigenic polypeptide.
[0390] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide and a CHIKV
antigenic polypeptide.
[0391] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide and a DENV
antigenic polypeptide.
[0392] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0393] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide and a YFV
antigenic polypeptide.
[0394] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide and a VEEV
antigenic polypeptide.
[0395] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide and a SINV
antigenic polypeptide.
[0396] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide and a CHIKV
antigenic polypeptide.
[0397] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide and a DENV
antigenic polypeptide.
[0398] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0399] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide and a YFV
antigenic polypeptide.
[0400] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a VEEV antigenic polypeptide and a SINV
antigenic polypeptide.
[0401] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a VEEV antigenic polypeptide and a CHIKV
antigenic polypeptide.
[0402] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a VEEV antigenic polypeptide and a DENV
antigenic polypeptide.
[0403] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a VEEV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0404] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a VEEV antigenic polypeptide and a YFV
antigenic polypeptide.
[0405] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a SINV antigenic polypeptide and a CHIKV
antigenic polypeptide.
[0406] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a SINV antigenic polypeptide and DENV
antigenic polypeptide.
[0407] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a SINV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0408] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a SINV antigenic polypeptide and a YFV
antigenic polypeptide.
[0409] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, CHIKV antigenic polypeptide and a DENV
antigenic polypeptide.
[0410] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, CHIKV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0411] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, CHIKV antigenic polypeptide and a YFV
antigenic polypeptide.
[0412] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a DENV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0413] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a DENV antigenic polypeptide and a YFV
antigenic polypeptide.
[0414] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a ZIKV antigenic polypeptide and a YFV
antigenic polypeptide.
[0415] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide and a VEEV
antigenic polypeptide.
[0416] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide and a SINV
antigenic polypeptide.
[0417] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide and a CHIKV
antigenic polypeptide.
[0418] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide and a DENV
antigenic polypeptide.
[0419] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0420] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide and a YFV
antigenic polypeptide.
[0421] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding WNV antigenic
polypeptide, a VEEV antigenic polypeptide and a SINV antigenic
polypeptide.
[0422] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding WNV antigenic
polypeptide, a VEEV antigenic polypeptide and a CHIKV antigenic
polypeptide.
[0423] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding WNV antigenic
polypeptide, a VEEV antigenic polypeptide and a DENV antigenic
polypeptide.
[0424] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding WNV antigenic
polypeptide, a VEEV antigenic polypeptide and a ZIKV antigenic
polypeptide.
[0425] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding WNV antigenic
polypeptide, a VEEV antigenic polypeptide and a YFV antigenic
polypeptide.
[0426] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a SINV antigenic polypeptide and a CHIKV
antigenic polypeptide.
[0427] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a SINV antigenic polypeptide and a DENV
antigenic polypeptide.
[0428] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a SINV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0429] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a SINV antigenic polypeptide and a YFV
antigenic polypeptide.
[0430] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a SINV antigenic polypeptide and a CHIKV
antigenic polypeptide.
[0431] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a SINV antigenic polypeptide and a DENV
antigenic polypeptide.
[0432] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a SINV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0433] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a SINV antigenic polypeptide and a YFV
antigenic polypeptide.
[0434] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a CHIKV antigenic polypeptide and a DENV
antigenic polypeptide.
[0435] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a CHIKV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0436] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a CHIKV antigenic polypeptide and a YFV
antigenic polypeptide.
[0437] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a DENV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0438] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a DENV antigenic polypeptide and YFV
antigenic polypeptide.
[0439] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a ZIKV antigenic polypeptide and YFV
antigenic polypeptide.
[0440] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide and a SINV
antigenic polypeptide.
[0441] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide and a CHIKV
antigenic polypeptide.
[0442] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide and a DENV
antigenic polypeptide.
[0443] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0444] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide and a YFV
antigenic polypeptide.
[0445] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a SINV antigenic polypeptide and a CHIKV
antigenic polypeptide.
[0446] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a SINV antigenic polypeptide and a DENV
antigenic polypeptide.
[0447] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a SINV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0448] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a SINV antigenic polypeptide and a YFV
antigenic polypeptide.
[0449] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a CHIKV antigenic polypeptide and a DENV
antigenic polypeptide.
[0450] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a CHIKV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0451] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a CHIKV antigenic polypeptide and a YFV
antigenic polypeptide.
[0452] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a DENV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0453] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a DENV antigenic polypeptide and a YFV
antigenic polypeptide.
[0454] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a ZIKV antigenic polypeptide and a YFV
antigenic polypeptide.
[0455] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a VEEV
antigenic polypeptide, a SINV antigenic polypeptide and a CHIKV
antigenic polypeptide.
[0456] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a VEEV
antigenic polypeptide, a SINV antigenic polypeptide and a DENV
antigenic polypeptide.
[0457] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a VEEV
antigenic polypeptide, a SINV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0458] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a VEEV
antigenic polypeptide, a SINV antigenic polypeptide and a YFV
antigenic polypeptide.
[0459] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a VEEV
antigenic polypeptide, a CHIKV antigenic polypeptide and a DENV
antigenic polypeptide.
[0460] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a VEEV
antigenic polypeptide, a CHIKV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0461] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a VEEV
antigenic polypeptide, a CHIKV antigenic polypeptide and a YFV
antigenic polypeptide.
[0462] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a VEEV
antigenic polypeptide, a DENV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0463] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a VEEV
antigenic polypeptide, a DENV antigenic polypeptide and a YFV
antigenic polypeptide.
[0464] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a VEEV
antigenic polypeptide, a ZIKV antigenic polypeptide and a YFV
antigenic polypeptide.
[0465] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a SINV
antigenic polypeptide, a CHIKV antigenic polypeptide and a DENV
antigenic polypeptide.
[0466] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a SINV
antigenic polypeptide, a CHIKV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0467] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a SINV
antigenic polypeptide, a CHIKV antigenic polypeptide and a YFV
antigenic polypeptide.
[0468] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a SINV
antigenic polypeptide, a DENV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0469] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a SINV
antigenic polypeptide, a DENV antigenic polypeptide and a YFV
antigenic polypeptide.
[0470] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a SINV
antigenic polypeptide, a ZIKV antigenic polypeptide and a YFV
antigenic polypeptide.
[0471] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a CHIKV
antigenic polypeptide, a DENV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0472] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a CHIKV
antigenic polypeptide, a DENV antigenic polypeptide and a YFV
antigenic polypeptide.
[0473] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a CHIKV
antigenic polypeptide, a ZIKV antigenic polypeptide and a YFV
antigenic polypeptide.
[0474] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a DENV
antigenic polypeptide, a ZIKV antigenic polypeptide and a YFV
antigenic polypeptide.
[0475] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a WNV antigenic
polypeptide and a EEEV antigenic polypeptide.
[0476] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a WNV antigenic
polypeptide and a VEEV antigenic polypeptide.
[0477] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a WNV antigenic
polypeptide and a SINV antigenic polypeptide.
[0478] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a WNV antigenic
polypeptide and a CHIKV antigenic polypeptide.
[0479] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a WNV antigenic
polypeptide and a DENV antigenic polypeptide.
[0480] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a WNV antigenic
polypeptide and a ZIKV antigenic polypeptide.
[0481] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a WNV antigenic
polypeptide and a YFV antigenic polypeptide.
[0482] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a EEEV
antigenic polypeptide and a VEEV antigenic polypeptide.
[0483] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a EEEV
antigenic polypeptide and a SINV antigenic polypeptide.
[0484] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a EEEV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0485] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a EEEV
antigenic polypeptide and a DENV antigenic polypeptide.
[0486] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a EEEV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0487] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a EEEV
antigenic polypeptide and a YFV antigenic polypeptide.
[0488] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide and a VEEV
antigenic polypeptide and a SINV antigenic polypeptide.
[0489] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide and a VEEV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0490] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide and a VEEV
antigenic polypeptide and a DENV antigenic polypeptide.
[0491] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide and a VEEV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0492] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide and a VEEV
antigenic polypeptide and a YFV antigenic polypeptide.
[0493] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a SINV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0494] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a SINV
antigenic polypeptide and a DENV antigenic polypeptide.
[0495] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a SINV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0496] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a SINV
antigenic polypeptide and a YFV antigenic polypeptide.
[0497] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a DENV antigenic polypeptide.
[0498] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0499] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0500] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a DENV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0501] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a DENV
antigenic polypeptide and a YFV antigenic polypeptide.
[0502] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0503] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, a EEEV
antigenic polypeptide and a VEEV antigenic polypeptide.
[0504] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, a EEEV
antigenic polypeptide and a SINV antigenic polypeptide.
[0505] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, a EEEV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0506] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, a EEEV
antigenic polypeptide and a DENV antigenic polypeptide.
[0507] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, a EEEV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0508] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, a EEEV
antigenic polypeptide and a YFV antigenic polypeptide.
[0509] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, a VEEV
antigenic polypeptide and a SINV antigenic polypeptide.
[0510] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, a VEEV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0511] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, a VEEV
antigenic polypeptide and a DENV antigenic polypeptide.
[0512] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, a VEEV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0513] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, a VEEV
antigenic polypeptide and a YFV antigenic polypeptide.
[0514] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, a SINV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0515] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, a SINV
antigenic polypeptide and a DENV antigenic polypeptide.
[0516] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, a SINV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0517] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, a SINV
antigenic polypeptide and YFV antigenic polypeptide.
[0518] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, a CHIKV
antigenic polypeptide and a DENV antigenic polypeptide.
[0519] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, a CHIKV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0520] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, a CHIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0521] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, DENV antigenic
polypeptide and a ZIKV antigenic polypeptide.
[0522] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, DENV antigenic
polypeptide and a YFV antigenic polypeptide.
[0523] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, ZIKV antigenic
polypeptide and a YFV antigenic polypeptide.
[0524] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, EEEV antigenic polypeptide, a VEEV antigenic
polypeptide and a SINV antigenic polypeptide.
[0525] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, EEEV antigenic polypeptide, a VEEV antigenic
polypeptide and a CHIKV antigenic polypeptide.
[0526] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, EEEV antigenic polypeptide, a VEEV antigenic
polypeptide and a DENV antigenic polypeptide.
[0527] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, EEEV antigenic polypeptide, a VEEV antigenic
polypeptide and a ZIKV antigenic polypeptide.
[0528] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, EEEV antigenic polypeptide, a VEEV antigenic
polypeptide and a YFV antigenic polypeptide.
[0529] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a SINV antigenic polypeptide and a CHIKV
antigenic polypeptide.
[0530] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a SINV antigenic polypeptide and a DENV
antigenic polypeptide.
[0531] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a SINV antigenic polypeptide and a ZIKV
antigenic polypeptide.
[0532] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a SINV antigenic polypeptide and a YFV
antigenic polypeptide.
[0533] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a EEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a DENV antigenic polypeptide.
[0534] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a EEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0535] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a EEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0536] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a EEEV antigenic polypeptide, DENV antigenic
polypeptide and a ZIKV antigenic polypeptide.
[0537] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a EEEV antigenic polypeptide, DENV antigenic
polypeptide and a YFV antigenic polypeptide.
[0538] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a EEEV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0539] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0540] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide and a DENV antigenic polypeptide.
[0541] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0542] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide and a YFV antigenic polypeptide.
[0543] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a VEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a DENV antigenic polypeptide.
[0544] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a VEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0545] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a VEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0546] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a VEEV antigenic polypeptide, a DENV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0547] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a VEEV antigenic polypeptide, a DENV
antigenic polypeptide and a YFV antigenic polypeptide.
[0548] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a VEEV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0549] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a SINV antigenic polypeptide, a CHIKV
antigenic polypeptide and a DENV antigenic polypeptide.
[0550] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a SINV antigenic polypeptide, a CHIKV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0551] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a SINV antigenic polypeptide, a CHIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0552] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a SINV antigenic polypeptide, a DENV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0553] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a SINV antigenic polypeptide, a DENV
antigenic polypeptide and a YFV antigenic polypeptide.
[0554] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a SINV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0555] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a CHIKV antigenic polypeptide, a DENV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0556] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a CHIKV antigenic polypeptide, a DENV
antigenic polypeptide and a YFV antigenic polypeptide.
[0557] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a CHIKV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0558] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a DENV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0559] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a EEEV
antigenic polypeptide and a VEEV antigenic.
[0560] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a EEEV
antigenic polypeptide and a SINV antigenic polypeptide.
[0561] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a EEEV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0562] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a EEEV
antigenic polypeptide and a DENV antigenic polypeptide.
[0563] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a EEEV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0564] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a EEEV
antigenic polypeptide and a YFV antigenic polypeptide.
[0565] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a VEEV
antigenic polypeptide and a SINV antigenic polypeptide.
[0566] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a VEEV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0567] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a VEEV
antigenic polypeptide and a DENV antigenic polypeptide.
[0568] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a VEEV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0569] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a VEEV
antigenic polypeptide and a YFV antigenic polypeptide.
[0570] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a VEEV
antigenic polypeptide and a SINV antigenic polypeptide.
[0571] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a VEEV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0572] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a VEEV
antigenic polypeptide and a DENV antigenic polypeptide.
[0573] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a VEEV
antigenic polypeptide and a ZIKV antigenic polypeptide and a YFV
antigenic polypeptide.
[0574] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a VEEV
antigenic polypeptide and a YFV antigenic polypeptide.
[0575] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a SINV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0576] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a SINV
antigenic polypeptide and a DENV antigenic polypeptide.
[0577] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a SINV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0578] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a SINV
antigenic polypeptide and a YFV antigenic polypeptide.
[0579] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a CHIKV
antigenic polypeptide and a DENV antigenic polypeptide.
[0580] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a CHIKV
antigenic polypeptide and a ZIKV antigenic polypeptide
[0581] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a CHIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0582] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a DENV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0583] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a DENV
antigenic polypeptide and a YFV antigenic polypeptide.
[0584] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a ZIKV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0585] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide, a VEEV
antigenic polypeptide and a SINV antigenic polypeptide.
[0586] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide, a VEEV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0587] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide, a VEEV
antigenic polypeptide and a DENV antigenic polypeptide.
[0588] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide, a VEEV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0589] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide, a VEEV
antigenic polypeptide and a YFV antigenic polypeptide.
[0590] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide, a SINV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0591] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide, a SINV
antigenic polypeptide and a DENV antigenic polypeptide.
[0592] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide, a SINV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0593] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide, a SINV
antigenic polypeptide and a YFV antigenic polypeptide.
[0594] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a DENV antigenic polypeptide.
[0595] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0596] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0597] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide, a DENV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0598] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide, a DENV
antigenic polypeptide and a YFV antigenic polypeptide.
[0599] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a EEEV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0600] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0601] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide and a DENV antigenic polypeptide.
[0602] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0603] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide and a YFV antigenic polypeptide.
[0604] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a VEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a DENV antigenic polypeptide.
[0605] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a VEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0606] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a VEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0607] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a VEEV antigenic polypeptide, a DENV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0608] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a VEEV antigenic polypeptide, a DENV
antigenic polypeptide and a YFV antigenic polypeptide.
[0609] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a VEEV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0610] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a SINV antigenic polypeptide, a CHIKV
antigenic polypeptide and a DENV antigenic polypeptide.
[0611] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a SINV antigenic polypeptide, a CHIKV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0612] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a SINV antigenic polypeptide, a CHIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0613] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a SINV antigenic polypeptide, a DENV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0614] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a SINV antigenic polypeptide, a DENV
antigenic polypeptide and a YFV antigenic polypeptide.
[0615] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a SINV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0616] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a CHIKV antigenic polypeptide, a DENV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0617] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a CHIKV antigenic polypeptide, a DENV
antigenic polypeptide and a YFV antigenic polypeptide.
[0618] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a CHIKV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0619] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a DENV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0620] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide, a VEEV
antigenic polypeptide and a SINV antigenic polypeptide.
[0621] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide, a VEEV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0622] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide, a VEEV
antigenic polypeptide and a DENV antigenic polypeptide.
[0623] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide, a VEEV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0624] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide, a VEEV
antigenic polypeptide and a YFV antigenic polypeptide.
[0625] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide, a SINV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0626] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide, a SINV
antigenic polypeptide and a DENV antigenic polypeptide.
[0627] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide, a SINV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0628] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide, a SINV
antigenic polypeptide and a YFV antigenic polypeptide.
[0629] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a DENV antigenic polypeptide.
[0630] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0631] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0632] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide, a DENV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0633] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide, a DENV
antigenic polypeptide and a YFV antigenic polypeptide.
[0634] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a EEEV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0635] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0636] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide and a DENV antigenic polypeptide.
[0637] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0638] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide and a YFV antigenic polypeptide.
[0639] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a VEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a DENV antigenic polypeptide.
[0640] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a VEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0641] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a VEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0642] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a VEEV antigenic polypeptide, a DENV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0643] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a VEEV antigenic polypeptide, a DENV
antigenic polypeptide and a YFV antigenic polypeptide.
[0644] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a VEEV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0645] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a SINV antigenic polypeptide, a CHIKV
antigenic polypeptide and a DENV antigenic polypeptide.
[0646] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a SINV antigenic polypeptide, a CHIKV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0647] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a SINV antigenic polypeptide, a CHIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0648] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a SINV antigenic polypeptide, a DENV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0649] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a SINV antigenic polypeptide, a DENV
antigenic polypeptide and a YFV antigenic polypeptide.
[0650] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a SINV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0651] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a CHIKV antigenic polypeptide, a DENV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0652] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a CHIKV antigenic polypeptide, a DENV
antigenic polypeptide and a YFV antigenic polypeptide.
[0653] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a CHIKV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0654] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a WNV
antigenic polypeptide, a DENV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0655] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide and a CHIKV antigenic polypeptide.
[0656] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide and a DENV antigenic polypeptide.
[0657] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0658] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide and a YFV antigenic polypeptide.
[0659] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a DENV antigenic polypeptide.
[0660] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0661] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide, a CHIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0662] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide, a DENV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0663] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide, a DENV
antigenic polypeptide and a YFV antigenic polypeptide.
[0664] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0665] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a SINV antigenic polypeptide, a CHIKV
antigenic polypeptide and a DENV antigenic polypeptide.
[0666] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a SINV antigenic polypeptide, a CHIKV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0667] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a SINV antigenic polypeptide, a CHIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0668] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a SINV antigenic polypeptide, a DENV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0669] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a SINV antigenic polypeptide, a DENV
antigenic polypeptide and a YFV antigenic polypeptide.
[0670] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a SINV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0671] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a SINV antigenic polypeptide, a DENV
antigenic polypeptide and a ZIKV antigenic polypeptide.
[0672] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a SINV antigenic polypeptide, a DENV
antigenic polypeptide and a YFV antigenic polypeptide.
[0673] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a EEEV
antigenic polypeptide, a SINV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0674] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding VEEV antigenic
polypeptide, a SINV antigenic polypeptide, a CHIKV antigenic
polypeptide and a DENV antigenic polypeptide
[0675] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding VEEV antigenic
polypeptide, a SINV antigenic polypeptide, a CHIKV antigenic
polypeptide and a ZIKV antigenic polypeptide.
[0676] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding VEEV antigenic
polypeptide, a SINV antigenic polypeptide, a CHIKV antigenic
polypeptide and a YFV antigenic polypeptide.
[0677] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding VEEV antigenic
polypeptide, a SINV antigenic polypeptide, a DENV antigenic
polypeptide and a ZIKV antigenic polypeptide.
[0678] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding VEEV antigenic
polypeptide, a SINV antigenic polypeptide, a DENV antigenic
polypeptide and a YFV antigenic polypeptide.
[0679] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding VEEV antigenic
polypeptide, a SINV antigenic polypeptide, a ZIKV antigenic
polypeptide and a YFV antigenic polypeptide.
[0680] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding VEEV antigenic
polypeptide, a CHIKV antigenic polypeptide, a DENV antigenic
polypeptide and a ZIKV antigenic polypeptide.
[0681] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding VEEV antigenic
polypeptide, a CHIKV antigenic polypeptide, a DENV antigenic
polypeptide and a YFV antigenic polypeptide.
[0682] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding VEEV antigenic
polypeptide, a CHIKV antigenic polypeptide, a ZIKV antigenic
polypeptide and a YFV antigenic polypeptide.
[0683] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding VEEV antigenic
polypeptide, a DENV antigenic polypeptide, a ZIKV antigenic
polypeptide and a YFV antigenic polypeptide.
[0684] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding SINV antigenic
polypeptide, a CHIKV antigenic polypeptide, a DENV antigenic
polypeptide and a ZIKV antigenic polypeptide.
[0685] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding SINV antigenic
polypeptide, a CHIKV antigenic polypeptide, a DENV antigenic
polypeptide and a YFV antigenic polypeptide.
[0686] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding SINV antigenic
polypeptide, a CHIKV antigenic polypeptide, a ZIKV antigenic
polypeptide and a YFV antigenic polypeptide.
[0687] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding SINV antigenic
polypeptide, a DENV antigenic polypeptide, a ZIKV antigenic
polypeptide and a YFV antigenic polypeptide.
[0688] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding CHIKV
antigenic polypeptide, a DENV antigenic polypeptide, a ZIKV
antigenic polypeptide and a YFV antigenic polypeptide.
[0689] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide, a CHIKV antigenic polypeptide, a DENV
antigenic polypeptide, a ZIKV antigenic polypeptide and a YFV
antigenic polypeptide.
[0690] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a WNV antigenic polypeptide, a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide, a CHIKV antigenic polypeptide, a DENV
antigenic polypeptide, a ZIKV antigenic polypeptide and a YFV
antigenic polypeptide.
[0691] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide, a CHIKV antigenic polypeptide, a DENV
antigenic polypeptide, a ZIKV antigenic polypeptide and a YFV
antigenic polypeptide.
[0692] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a WNV antigenic
polypeptide, a VEEV antigenic polypeptide, a SINV antigenic
polypeptide, a CHIKV antigenic polypeptide, a DENV antigenic
polypeptide, a ZIKV antigenic polypeptide and a YFV antigenic
polypeptide.
[0693] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a WNV antigenic
polypeptide, a EEEV antigenic polypeptide, a SINV antigenic
polypeptide, a CHIKV antigenic polypeptide, a DENV antigenic
polypeptide, a ZIKV antigenic polypeptide and a YFV antigenic
polypeptide.
[0694] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a WNV antigenic
polypeptide, a EEEV antigenic polypeptide, a VEEV antigenic
polypeptide, a CHIKV antigenic polypeptide, a DENV antigenic
polypeptide, a ZIKV antigenic polypeptide and a YFV antigenic
polypeptide.
[0695] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a WNV antigenic
polypeptide, a EEEV antigenic polypeptide, a VEEV antigenic
polypeptide, a SINV antigenic polypeptide, a DENV antigenic
polypeptide, a ZIKV antigenic polypeptide and a YFV antigenic
polypeptide.
[0696] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a WNV antigenic
polypeptide, a EEEV antigenic polypeptide, a VEEV antigenic
polypeptide, a SINV antigenic polypeptide, a CHIKV antigenic
polypeptide, a ZIKV antigenic polypeptide and a YFV antigenic
polypeptide.
[0697] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a WNV antigenic
polypeptide, a EEEV antigenic polypeptide, a VEEV antigenic
polypeptide, a SINV antigenic polypeptide, a CHIKV antigenic
polypeptide, a DENV antigenic polypeptide, and a YFV antigenic
polypeptide.
[0698] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a Malaria
(e.g., P. falciparum, P. vivax, P. malariae and/or P. ovale)
antigenic polypeptide, a JEV antigenic polypeptide, a WNV antigenic
polypeptide, a EEEV antigenic polypeptide, a VEEV antigenic
polypeptide, a SINV antigenic polypeptide, a CHIKV antigenic
polypeptide, a DENV antigenic polypeptide, and a ZIKV antigenic
polypeptide.
[0699] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide, and a SINV
antigenic polypeptide.
[0700] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a EEEV
antigenic polypeptide, a VEEV antigenic polypeptide, a SINV
antigenic polypeptide, and a CHIKV antigenic polypeptide.
[0701] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a EEEV
antigenic polypeptide, a SINV antigenic polypeptide, and a CHIKV
antigenic polypeptide.
[0702] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises a RNA (e.g., mRNA) polynucleotide encoding a JEV
antigenic polypeptide, a WNV antigenic polypeptide, a EEEV
antigenic polypeptide, a SINV antigenic polypeptide, a CHIKV
antigenic polypeptide and a DENV antigenic polypeptide.
[0703] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises at least two RNA (e.g., mRNA) polynucleotides selected
from Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale) antigenic polypeptides, JEV antigenic polypeptides, WNV
antigenic polypeptides, EEEV antigenic polypeptides, VEEV antigenic
polypeptides, SINV antigenic polypeptides, CHIKV antigenic
polypeptides, DENV antigenic polypeptides, ZIKV antigenic
polypeptides and a YFV antigenic polypeptides.
[0704] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises at least three RNA (e.g., mRNA) polynucleotides selected
from Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale) antigenic polypeptides, JEV antigenic polypeptides, WNV
antigenic polypeptides, EEEV antigenic polypeptides, VEEV antigenic
polypeptides, SINV antigenic polypeptides, CHIKV antigenic
polypeptides, DENV antigenic polypeptides, ZIKV antigenic
polypeptides and a YFV antigenic polypeptides.
[0705] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises at least four RNA (e.g., mRNA) polynucleotides selected
from Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale) antigenic polypeptides, JEV antigenic polypeptides, WNV
antigenic polypeptides, EEEV antigenic polypeptides, VEEV antigenic
polypeptides, SINV antigenic polypeptides, CHIKV antigenic
polypeptides, DENV antigenic polypeptides, ZIKV antigenic
polypeptides and a YFV antigenic polypeptides.
[0706] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises at least five RNA (e.g., mRNA) polynucleotides selected
from Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale) antigenic polypeptides, JEV antigenic polypeptides, WNV
antigenic polypeptides, EEEV antigenic polypeptides, VEEV antigenic
polypeptides, SINV antigenic polypeptides, CHIKV antigenic
polypeptides, DENV antigenic polypeptides, ZIKV antigenic
polypeptides and a YFV antigenic polypeptides.
[0707] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises at least six RNA (e.g., mRNA) polynucleotides selected
from Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale) antigenic polypeptides, JEV antigenic polypeptides, WNV
antigenic polypeptides, EEEV antigenic polypeptides, VEEV antigenic
polypeptides, SINV antigenic polypeptides, CHIKV antigenic
polypeptides, DENV antigenic polypeptides, ZIKV antigenic
polypeptides and a YFV antigenic polypeptides.
[0708] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises at least seven RNA (e.g., mRNA) polynucleotides selected
from Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale) antigenic polypeptides, JEV antigenic polypeptides, WNV
antigenic polypeptides, EEEV antigenic polypeptides, VEEV antigenic
polypeptides, SINV antigenic polypeptides, CHIKV antigenic
polypeptides, DENV antigenic polypeptides, ZIKV antigenic
polypeptides and a YFV antigenic polypeptides.
[0709] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises at least eight RNA (e.g., mRNA) polynucleotides selected
from Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale) antigenic polypeptides, JEV antigenic polypeptides, WNV
antigenic polypeptides, EEEV antigenic polypeptides, VEEV antigenic
polypeptides, SINV antigenic polypeptides, CHIKV antigenic
polypeptides, DENV antigenic polypeptides, ZIKV antigenic
polypeptides and a YFV antigenic polypeptides.
[0710] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises at least nine RNA (e.g., mRNA) polynucleotides selected
from Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale) antigenic polypeptides, JEV antigenic polypeptides, WNV
antigenic polypeptides, EEEV antigenic polypeptides, VEEV antigenic
polypeptides, SINV antigenic polypeptides, CHIKV antigenic
polypeptides, DENV antigenic polypeptides, ZIKV antigenic
polypeptides and a YFV antigenic polypeptides.
[0711] In some embodiments, a combination RNA (e.g., mRNA) vaccine
comprises at least ten RNA (e.g., mRNA) polynucleotides selected
from Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale) antigenic polypeptides, JEV antigenic polypeptides, WNV
antigenic polypeptides, EEEV antigenic polypeptides, VEEV antigenic
polypeptides, SINV antigenic polypeptides, CHIKV antigenic
polypeptides, DENV antigenic polypeptides, ZIKV antigenic
polypeptides and a YFV antigenic polypeptides.
[0712] Additional combination vaccines are encompassed by the
following numbered paragraphs:
[0713] 1. A combination vaccine comprising at least one RNA (e.g.,
mRNA) encoding at least one tropical disease antigenic
polypeptide.
[0714] 2. The combination vaccine of paragraph 1, wherein the at
least one polypeptide is at least one Malaria (e.g., P. falciparum,
P. vivax, P. malariae and/or P. ovale) antigenic polypeptide.
[0715] 3. The combination vaccine of paragraph 1 or 2, wherein the
at least one polypeptide is at least one JEV antigenic
polypeptide.
[0716] 4. The combination vaccine of any one of paragraphs 1-3,
wherein the at least one polypeptide is at least one WNV antigenic
polypeptide.
[0717] 5. The combination vaccine of any one of paragraphs 1-4,
wherein the at least one polypeptide is at least one EEEV antigenic
polypeptide.
[0718] 6. The combination vaccine of any one of paragraphs 1-5,
wherein the at least one polypeptide is at least one VEEV antigenic
polypeptide.
[0719] 7. The combination vaccine of any one of paragraphs 1-6,
wherein the at least one polypeptide is at least one SINV antigenic
polypeptide.
[0720] 8. The combination vaccine of any one of paragraphs 1-7,
wherein the at least one polypeptide is at least one CHIKV
antigenic polypeptide.
[0721] 9. The combination vaccine of any one of paragraphs 1-8,
wherein the at least one polypeptide is at least one DENV antigenic
polypeptide.
[0722] 10. The combination vaccine of any one of paragraphs 1-9,
wherein the at least one polypeptide is at least one ZIKV antigenic
polypeptide.
[0723] 11. The combination vaccine of any one of paragraphs 1-10,
wherein the at least one polypeptide is at least one YFV antigenic
polypeptide.
[0724] It has been discovered that the mRNA vaccines described
herein are superior to current vaccines in several ways. First, the
lipid nanoparticle (LNP) delivery is superior to other formulations
including a protamine base approach described in the literature and
no additional adjuvants are to be necessary. The use of LNPs
enables the effective delivery of chemically modified or unmodified
mRNA vaccines. Additionally it has been demonstrated herein that
both modified and unmodified LNP formulated mRNA vaccines were
superior to conventional vaccines by a significant degree. In some
embodiments the mRNA vaccines of the invention are superior to
conventional vaccines by a factor of at least 10 fold, 20 fold, 40
fold, 50 fold, 100 fold, 500 fold or 1,000 fold.
[0725] Although attempts have been made to produce functional RNA
vaccines, including mRNA vaccines and self-replicating RNA
vaccines, the therapeutic efficacy of these RNA vaccines has not
yet been fully established. Quite surprisingly, the inventors have
discovered, according to aspects of the invention a class of
formulations for delivering mRNA vaccines in vivo that results in
significantly enhanced, and in many respects synergistic, immune
responses including enhanced antigen generation and functional
antibody production with neutralization capability. These results
can be achieved even when significantly lower doses of the mRNA are
administered in comparison with mRNA doses used in other classes of
lipid based formulations. The formulations of the invention have
demonstrated significant unexpected in vivo immune responses
sufficient to establish the efficacy of functional mRNA vaccines as
prophylactic and therapeutic agents. Additionally, self-replicating
RNA vaccines rely on viral replication pathways to deliver enough
RNA to a cell to produce an immunogenic response. The formulations
of the invention do not require viral replication to produce enough
protein to result in a strong immune response. Thus, the mRNA of
the invention are not self-replicating RNA and do not include
components necessary for viral replication.
[0726] The invention involves, in some aspects, the surprising
finding that lipid nanoparticle (LNP) formulations significantly
enhance the effectiveness of mRNA vaccines, including chemically
modified and unmodified mRNA vaccines. The efficacy of mRNA
vaccines formulated in LNP was examined in vivo using several
distinct antigens. The results presented herein demonstrate the
unexpected superior efficacy of the mRNA vaccines formulated in LNP
over other commercially available vaccines.
[0727] In addition to providing an enhanced immune response, the
formulations of the invention generate a more rapid immune response
with fewer doses of antigen than other vaccines tested. The
mRNA-LNP formulations of the invention also produce quantitatively
and qualitatively better immune responses than vaccines formulated
in a different carriers.
[0728] The data described herein demonstrate that the formulations
of the invention produced significant unexpected improvements over
existing antigen vaccines. Additionally, the mRNA-LNP formulations
of the invention are superior to other vaccines even when the dose
of mRNA is lower than other vaccines.
[0729] The LNP used in the studies described herein has been used
previously to deliver siRNA in various animal models as well as in
humans. In view of the observations made in association with the
siRNA delivery of LNP formulations, the fact that LNP is useful in
vaccines is quite surprising. It has been observed that therapeutic
delivery of siRNA formulated in LNP causes an undesirable
inflammatory response associated with a transient IgM response,
typically leading to a reduction in antigen production and a
compromised immune response. In contrast to the findings observed
with siRNA, the LNP-mRNA formulations of the invention are
demonstrated herein to generate enhanced IgG levels, sufficient for
prophylactic and therapeutic methods rather than transient IgM
responses.
Nucleic Acids/Polynucleotides
[0730] Tropical disease vaccines, as provided herein, comprise at
least one (one or more) ribonucleic acid (RNA) (e.g., mRNA)
polynucleotide having an open reading frame encoding at least one
Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
antigenic polypeptide. The term "nucleic acid" includes any
compound and/or substance that comprises a polymer of nucleotides
(nucleotide monomer). These polymers are referred to as
polynucleotides. Thus, the terms "nucleic acid" and
"polynucleotide" are used interchangeably.
[0731] Nucleic acids may be or may include, for example,
ribonucleic acids (RNAs), deoxyribonucleic acids (DNAs), threose
nucleic acids (TNAs), glycol nucleic acids (GNAs), peptide nucleic
acids (PNAs), locked nucleic acids (LNAs, including LNA having a
.beta.-D-ribo configuration, .alpha.-LNA having an .alpha.-L-ribo
configuration (a diastereomer of LNA), 2'-amino-LNA having a
2'-amino functionalization, and 2'-amino-.alpha.-LNA having a
2'-amino functionalization), ethylene nucleic acids (ENA),
cyclohexenyl nucleic acids (CeNA) or chimeras or combinations
thereof.
[0732] In some embodiments, polynucleotides of the present
disclosure function as messenger RNA (mRNA). "Messenger RNA" (mRNA)
refers to any polynucleotide that encodes a (at least one)
polypeptide (a naturally-occurring, non-naturally-occurring, or
modified polymer of amino acids) and can be translated to produce
the encoded polypeptide in vitro, in vivo, in situ or ex vivo. The
skilled artisan will appreciate that, except where otherwise noted,
polynucleotide sequences set forth in the instant application will
recite "T"s in a representative DNA sequence but where the sequence
represents RNA (e.g., mRNA), the "T"s would be substituted for
"U"s. Thus, any of the RNA polynucleotides encoded by a DNA
identified by a particular sequence identification number may also
comprise the corresponding RNA (e.g., mRNA) sequence encoded by the
DNA, where each "T" of the DNA sequence is substituted with
"U."
[0733] The basic components of an mRNA molecule typically include
at least one coding region, a 5' untranslated region (UTR), a 3'
UTR, a 5' cap and a poly-A tail. Polynucleotides of the present
disclosure may function as mRNA but can be distinguished from
wild-type mRNA in their functional and/or structural design
features, which serve to overcome existing problems of effective
polypeptide expression using nucleic-acid based therapeutics.
[0734] In some embodiments, a RNA polynucleotide of an RNA (e.g.,
mRNA) vaccine encodes 2-10, 2-9, 2-8, 2-7, 2-6, 2-5, 2-4, 2-3,
3-10, 3-9, 3-8, 3-7, 3-6, 3-5, 3-4, 4-10, 4-9, 4-8, 4-7, 4-6, 4-5,
5-10, 5-9, 5-8, 5-7, 5-6, 6-10, 6-9, 6-8, 6-7, 7-10, 7-9, 7-8,
8-10, 8-9 or 9-10 antigenic polypeptides. In some embodiments, a
RNA (e.g., mRNA) polynucleotide of a tropical disease vaccine
encodes at least 10, 20, 30, 40, 50, 60, 70, 80, 90 or 100
antigenic polypeptides. In some embodiments, a RNA (e.g., mRNA)
polynucleotide of a tropical disease vaccine encodes at least 100
or at least 200 antigenic polypeptides. In some embodiments, a RNA
polynucleotide of a tropical disease vaccine encodes 1-10, 5-15,
10-20, 15-25, 20-30, 25-35, 30-40, 35-45, 40-50, 1-50, 1-100, 2-50
or 2-100 antigenic polypeptides.
[0735] Polynucleotides of the present disclosure, in some
embodiments, are codon optimized. Codon optimization methods are
known in the art and may be used as provided herein. Codon
optimization, in some embodiments, may be used to match codon
frequencies in target and host organisms to ensure proper folding;
bias GC content to increase mRNA stability or reduce secondary
structures; minimize tandem repeat codons or base runs that may
impair gene construction or expression; customize transcriptional
and translational control regions; insert or remove protein
trafficking sequences; remove/add post translation modification
sites in encoded protein (e.g. glycosylation sites); add, remove or
shuffle protein domains; insert or delete restriction sites; modify
ribosome binding sites and mRNA degradation sites; adjust
translational rates to allow the various domains of the protein to
fold properly; or to reduce or eliminate problem secondary
structures within the polynucleotide. Codon optimization tools,
algorithms and services are known in the art--non-limiting examples
include services from GeneArt (Life Technologies), DNA2.0 (Menlo
Park Calif.) and/or proprietary methods. In some embodiments, the
open reading frame (ORF) sequence is optimized using optimization
algorithms.
[0736] In some embodiments, a codon optimized sequence shares less
than 95% sequence identity, less than 90% sequence identity, less
than 85% sequence identity, less than 80% sequence identity, or
less than 75% sequence identity to a naturally-occurring or
wild-type sequence (e.g., a naturally-occurring or wild-type mRNA
sequence encoding a polypeptide or protein of interest (e.g., an
antigenic protein or antigenic polypeptide)).
[0737] In some embodiments, a codon-optimized sequence shares
between 65% and 85% (e.g., between about 67% and about 85%, or
between about 67% and about 80%) sequence identity to a
naturally-occurring sequence or a wild-type sequence (e.g., a
naturally-occurring or wild-type mRNA sequence encoding a
polypeptide or protein of interest (e.g., an antigenic protein or
polypeptide)). In some embodiments, a codon-optimized sequence
shares between 65% and 75%, or about 80% sequence identity to a
naturally-occurring sequence or wild-type sequence (e.g., a
naturally-occurring or wild-type mRNA sequence encoding a
polypeptide or protein of interest (e.g., an antigenic protein or
polypeptide)).
[0738] In some embodiments a codon-optimized RNA (e.g., mRNA) may,
for instance, be one in which the levels of G/C are enhanced. The
G/C-content of nucleic acid molecules may influence the stability
of the RNA. RNA having an increased amount of guanine (G) and/or
cytosine (C) residues may be functionally more stable than nucleic
acids containing a large amount of adenine (A) and thymine (T) or
uracil (U) nucleotides. WO02/098443 discloses a pharmaceutical
composition containing an mRNA stabilized by sequence modifications
in the translated region. Due to the degeneracy of the genetic
code, the modifications work by substituting existing codons for
those that promote greater RNA stability without changing the
resulting amino acid. The approach is limited to coding regions of
the RNA.
Antigens/Antigenic Polypeptides
[0739] In some embodiments, an antigenic polypeptide (e.g., at
least one Malaria (e.g., P. falciparum, P. vivax, P. malariae
and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV
and/or YFV antigenic polypeptide) is longer than 25 amino acids and
shorter than 50 amino acids. Polypeptides include gene products,
naturally occurring polypeptides, synthetic polypeptides, homologs,
orthologs, paralogs, fragments and other equivalents, variants, and
analogs of the foregoing. A polypeptide may be a single molecule or
may be a multi-molecular complex such as a dimer, trimer or
tetramer. Polypeptides may also comprise single chain polypeptides
or multichain polypeptides, such as antibodies or insulin, and may
be associated or linked to each other. Most commonly, disulfide
linkages are found in multichain polypeptides. The term
"polypeptide" may also apply to amino acid polymers in which at
least one amino acid residue is an artificial chemical analogue of
a corresponding naturally-occurring amino acid.
[0740] A "polypeptide variant" is a molecule that differs in its
amino acid sequence relative to a native sequence or a reference
sequence. Amino acid sequence variants may possess substitutions,
deletions, insertions, or a combination of any two or three of the
foregoing, at certain positions within the amino acid sequence, as
compared to a native sequence or a reference sequence. Ordinarily,
variants possess at least 50% identity to a native sequence or a
reference sequence. In some embodiments, variants share at least
80% identity or at least 90% identity with a native sequence or a
reference sequence.
[0741] In some embodiments "variant mimics" are provided. A
"variant mimic" contains at least one amino acid that would mimic
an activated sequence. For example, glutamate may serve as a mimic
for phosphoro-threonine and/or phosphoro-serine. Alternatively,
variant mimics may result in deactivation or in an inactivated
product containing the mimic. For example, phenylalanine may act as
an inactivating substitution for tyrosine, or alanine may act as an
inactivating substitution for serine.
[0742] "Orthologs" refers to genes in different species that
evolved from a common ancestral gene by speciation. Normally,
orthologs retain the same function in the course of evolution.
Identification of orthologs is important for reliable prediction of
gene function in newly sequenced genomes.
[0743] "Analogs" is meant to include polypeptide variants that
differ by one or more amino acid alterations, for example,
substitutions, additions or deletions of amino acid residues that
still maintain one or more of the properties of the parent or
starting polypeptide.
[0744] The present disclosure provides several types of
compositions that are polynucleotide or polypeptide based,
including variants and derivatives. These include, for example,
substitutional, insertional, deletion and covalent variants and
derivatives. The term "derivative" is synonymous with the term
"variant" and generally refers to a molecule that has been modified
and/or changed in any way relative to a reference molecule or a
starting molecule.
[0745] As such, polynucleotides encoding peptides or polypeptides
containing substitutions, insertions and/or additions, deletions
and covalent modifications with respect to reference sequences, in
particular the polypeptide sequences disclosed herein, are included
within the scope of this disclosure. For example, sequence tags or
amino acids, such as one or more lysines, can be added to peptide
sequences (e.g., at the N-terminal or C-terminal ends). Sequence
tags can be used for peptide detection, purification or
localization. Lysines can be used to increase peptide solubility or
to allow for biotinylation. Alternatively, amino acid residues
located at the carboxy and amino terminal regions of the amino acid
sequence of a peptide or protein may optionally be deleted
providing for truncated sequences. Certain amino acids (e.g.,
C-terminal residues or N-terminal residues) alternatively may be
deleted depending on the use of the sequence, as for example,
expression of the sequence as part of a larger sequence that is
soluble, or linked to a solid support.
[0746] "Substitutional variants" when referring to polypeptides are
those that have at least one amino acid residue in a native or
starting sequence removed and a different amino acid inserted in
its place at the same position. Substitutions may be single, where
only one amino acid in the molecule has been substituted, or they
may be multiple, where two or more (e.g., 3, 4 or 5) amino acids
have been substituted in the same molecule.
[0747] As used herein the term "conservative amino acid
substitution" refers to the substitution of an amino acid that is
normally present in the sequence with a different amino acid of
similar size, charge, or polarity. Examples of conservative
substitutions include the substitution of a non-polar (hydrophobic)
residue such as isoleucine, valine and leucine for another
non-polar residue. Likewise, examples of conservative substitutions
include the substitution of one polar (hydrophilic) residue for
another such as between arginine and lysine, between glutamine and
asparagine, and between glycine and serine. Additionally, the
substitution of a basic residue such as lysine, arginine or
histidine for another, or the substitution of one acidic residue
such as aspartic acid or glutamic acid for another acidic residue
are additional examples of conservative substitutions. Examples of
non-conservative substitutions include the substitution of a
non-polar (hydrophobic) amino acid residue such as isoleucine,
valine, leucine, alanine, methionine for a polar (hydrophilic)
residue such as cysteine, glutamine, glutamic acid or lysine and/or
a polar residue for a non-polar residue.
[0748] "Features" when referring to polypeptide or polynucleotide
are defined as distinct amino acid sequence-based or
nucleotide-based components of a molecule respectively. Features of
the polypeptides encoded by the polynucleotides include surface
manifestations, local conformational shape, folds, loops,
half-loops, domains, half-domains, sites, termini and any
combination(s) thereof.
[0749] As used herein when referring to polypeptides the term
"domain" refers to a motif of a polypeptide having one or more
identifiable structural or functional characteristics or properties
(e.g., binding capacity, serving as a site for protein-protein
interactions).
[0750] As used herein when referring to polypeptides the terms
"site" as it pertains to amino acid based embodiments is used
synonymously with "amino acid residue" and "amino acid side chain."
As used herein when referring to polynucleotides the terms "site"
as it pertains to nucleotide based embodiments is used synonymously
with "nucleotide." A site represents a position within a peptide or
polypeptide or polynucleotide that may be modified, manipulated,
altered, derivatized or varied within the polypeptide-based or
polynucleotide-based molecules.
[0751] As used herein the terms "termini" or "terminus" when
referring to polypeptides or polynucleotides refer to an extremity
of a polypeptide or polynucleotide respectively. Such extremity is
not limited only to the first or final site of the polypeptide or
polynucleotide but may include additional amino acids or
nucleotides in the terminal regions. Polypeptide-based molecules
may be characterized as having both an N-terminus (terminated by an
amino acid with a free amino group (NH.sub.2)) and a C-terminus
(terminated by an amino acid with a free carboxyl group (COOH)).
Proteins are in some cases made up of multiple polypeptide chains
brought together by disulfide bonds or by non-covalent forces
(multimers, oligomers). These proteins have multiple N- and
C-termini. Alternatively, the termini of the polypeptides may be
modified such that they begin or end, as the case may be, with a
non-polypeptide based moiety such as an organic conjugate.
[0752] As recognized by those skilled in the art, protein
fragments, functional protein domains, and homologous proteins are
also considered to be within the scope of polypeptides of interest.
For example, provided herein is any protein fragment (meaning a
polypeptide sequence at least one amino acid residue shorter than a
reference polypeptide sequence but otherwise identical) of a
reference protein having a length of 10, 20, 30, 40, 50, 60, 70,
80, 90, 100 or longer than 100 amino acids. In another example, any
protein that includes a stretch of 20, 30, 40, 50, or 100
(contiguous) amino acids that are 40%, 50%, 60%, 70%, 80%, 90%,
95%, or 100% identical to any of the sequences described herein can
be utilized in accordance with the disclosure. In some embodiments,
a polypeptide includes 2, 3, 4, 5, 6, 7, 8, 9, 10, or more
mutations as shown in any of the sequences provided herein or
referenced herein. In another example, any protein that includes a
stretch of 20, 30, 40, 50, or 100 amino acids that are greater than
80%, 90%, 95%, or 100% identical to any of the sequences described
herein, wherein the protein has a stretch of 5, 10, 15, 20, 25, or
30 amino acids that are less than 80%, 75%, 70%, 65% to 60%
identical to any of the sequences described herein can be utilized
in accordance with the disclosure.
[0753] Polypeptide or polynucleotide molecules of the present
disclosure may share a certain degree of sequence similarity or
identity with the reference molecules (e.g., reference polypeptides
or reference polynucleotides), for example, with art-described
molecules (e.g., engineered or designed molecules or wild-type
molecules). The term "identity," as known in the art, refers to a
relationship between the sequences of two or more polypeptides or
polynucleotides, as determined by comparing the sequences. In the
art, identity also means the degree of sequence relatedness between
two sequences as determined by the number of matches between
strings of two or more amino acid residues or nucleic acid
residues. Identity measures the percent of identical matches
between the smaller of two or more sequences with gap alignments
(if any) addressed by a particular mathematical model or computer
program (e.g., "algorithms"). Identity of related peptides can be
readily calculated by known methods. "% identity" as it applies to
polypeptide or polynucleotide sequences is defined as the
percentage of residues (amino acid residues or nucleic acid
residues) in the candidate amino acid or nucleic acid sequence that
are identical with the residues in the amino acid sequence or
nucleic acid sequence of a second sequence after aligning the
sequences and introducing gaps, if necessary, to achieve the
maximum percent identity. Methods and computer programs for the
alignment are well known in the art. Identity depends on a
calculation of percent identity but may differ in value due to gaps
and penalties introduced in the calculation. Generally, variants of
a particular polynucleotide or polypeptide have at least 40%, 45%,
50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%,
95%, 96%, 97%, 98%, 99% but less than 100% sequence identity to
that particular reference polynucleotide or polypeptide as
determined by sequence alignment programs and parameters described
herein and known to those skilled in the art. Such tools for
alignment include those of the BLAST suite (Stephen F. Altschul, et
al. (1997). "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs," Nucleic Acids Res.
25:3389-3402). Another popular local alignment technique is based
on the Smith-Waterman algorithm (Smith, T. F. & Waterman, M. S.
(1981) "Identification of common molecular subsequences." J. Mol.
Biol. 147:195-197). A general global alignment technique based on
dynamic programming is the Needleman-Wunsch algorithm (Needleman,
S. B. & Wunsch, C. D. (1970) "A general method applicable to
the search for similarities in the amino acid sequences of two
proteins." J. Mol. Biol. 48:443-453). More recently, a Fast Optimal
Global Sequence Alignment Algorithm (FOGSAA) was developed that
purportedly produces global alignment of nucleotide and protein
sequences faster than other optimal global alignment methods,
including the Needleman-Wunsch algorithm. Other tools are described
herein, specifically in the definition of "identity" below.
[0754] As used herein, the term "homology" refers to the overall
relatedness between polymeric molecules, e.g. between nucleic acid
molecules (e.g. DNA molecules and/or RNA molecules) and/or between
polypeptide molecules. Polymeric molecules (e.g. nucleic acid
molecules (e.g. DNA molecules and/or RNA molecules) and/or
polypeptide molecules) that share a threshold level of similarity
or identity determined by alignment of matching residues are termed
homologous. Homology is a qualitative term that describes a
relationship between molecules and can be based upon the
quantitative similarity or identity. Similarity or identity is a
quantitative term that defines the degree of sequence match between
two compared sequences. In some embodiments, polymeric molecules
are considered to be "homologous" to one another if their sequences
are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%,
80%, 85%, 90%, 95%, or 99% identical or similar. The term
"homologous" necessarily refers to a comparison between at least
two sequences (polynucleotide or polypeptide sequences). Two
polynucleotide sequences are considered homologous if the
polypeptides they encode are at least 50%, 60%, 70%, 80%, 90%, 95%,
or even 99% for at least one stretch of at least 20 amino acids. In
some embodiments, homologous polynucleotide sequences are
characterized by the ability to encode a stretch of at least 4-5
uniquely specified amino acids. For polynucleotide sequences less
than 60 nucleotides in length, homology is determined by the
ability to encode a stretch of at least 4-5 uniquely specified
amino acids. Two protein sequences are considered homologous if the
proteins are at least 50%, 60%, 70%, 80%, or 90% identical for at
least one stretch of at least 20 amino acids.
[0755] Homology implies that the compared sequences diverged in
evolution from a common origin. The term "homolog" refers to a
first amino acid sequence or nucleic acid sequence (e.g., gene (DNA
or RNA) or protein sequence) that is related to a second amino acid
sequence or nucleic acid sequence by descent from a common
ancestral sequence. The term "homolog" may apply to the
relationship between genes and/or proteins separated by the event
of speciation or to the relationship between genes and/or proteins
separated by the event of genetic duplication. "Orthologs" are
genes (or proteins) in different species that evolved from a common
ancestral gene (or protein) by speciation. Typically, orthologs
retain the same function in the course of evolution. "Paralogs" are
genes (or proteins) related by duplication within a genome.
Orthologs retain the same function in the course of evolution,
whereas paralogs evolve new functions, even if these are related to
the original one.
[0756] The term "identity" refers to the overall relatedness
between polymeric molecules, for example, between polynucleotide
molecules (e.g. DNA molecules and/or RNA molecules) and/or between
polypeptide molecules. Calculation of the percent identity of two
polynucleic acid sequences, for example, can be performed by
aligning the two sequences for optimal comparison purposes (e.g.,
gaps can be introduced in one or both of a first and a second
nucleic acid sequences for optimal alignment and non-identical
sequences can be disregarded for comparison purposes). In certain
embodiments, the length of a sequence aligned for comparison
purposes is at least 30%, at least 40%, at least 50%, at least 60%,
at least 70%, at least 80%, at least 90%, at least 95%, or 100% of
the length of the reference sequence. The nucleotides at
corresponding nucleotide positions are then compared. When a
position in the first sequence is occupied by the same nucleotide
as the corresponding position in the second sequence, then the
molecules are identical at that position. The percent identity
between the two sequences is a function of the number of identical
positions shared by the sequences, taking into account the number
of gaps, and the length of each gap, which needs to be introduced
for optimal alignment of the two sequences. The comparison of
sequences and determination of percent identity between two
sequences can be accomplished using a mathematical algorithm. For
example, the percent identity between two nucleic acid sequences
can be determined using methods such as those described in
Computational Molecular Biology, Lesk, A. M., ed., Oxford
University Press, New York, 1988; Biocomputing: Informatics and
Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993;
Sequence Analysis in Molecular Biology, von Heinje, G., Academic
Press, 1987; Computer Analysis of Sequence Data, Part I, Griffin,
A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994;
and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds.,
M Stockton Press, New York, 1991; each of which is incorporated
herein by reference. For example, the percent identity between two
nucleic acid sequences can be determined using the algorithm of
Meyers and Miller (CABIOS, 1989, 4:11-17), which has been
incorporated into the ALIGN program (version 2.0) using a PAM120
weight residue table, a gap length penalty of 12 and a gap penalty
of 4. The percent identity between two nucleic acid sequences can,
alternatively, be determined using the GAP program in the GCG
software package using an NWSgapdna.CMP matrix. Methods commonly
employed to determine percent identity between sequences include,
but are not limited to those disclosed in Carillo, H., and Lipman,
D., SIAM J Applied Math., 48:1073 (1988); incorporated herein by
reference. Techniques for determining identity are codified in
publicly available computer programs. Exemplary computer software
to determine homology between two sequences include, but are not
limited to, GCG program package, Devereux, J., et al., Nucleic
Acids Research, 12, 387 (1984)), BLASTP, BLASTN, and FASTA
Altschul, S. F. et al., J. Molec. Biol., 215, 403 (1990)).
Multiprotein and Multicomponent Vaccines
[0757] The present disclosure encompasses tropical disease vaccines
comprising multiple RNA (e.g., mRNA) polynucleotides, each encoding
a single antigenic polypeptide, as well as tropical disease
vaccines comprising a single RNA polynucleotide encoding more than
one antigenic polypeptide (e.g., as a fusion polypeptide). Thus, a
vaccine composition comprising a RNA (e.g., mRNA) polynucleotide
having an open reading frame encoding a first antigenic polypeptide
and a RNA (e.g., mRNA) polynucleotide having an open reading frame
encoding a second antigenic polypeptide encompasses (a) vaccines
that comprise a first RNA polynucleotide encoding a first antigenic
polypeptide and a second RNA polynucleotide encoding a second
antigenic polypeptide, and (b) vaccines that comprise a single RNA
polynucleotide encoding a first and second antigenic polypeptide
(e.g., as a fusion polypeptide). RNA (e.g., mRNA) vaccines of the
present disclosure, in some embodiments, comprise 2-10 (e.g., 2, 3,
4, 5, 6, 7, 8, 9 or 10), or more, RNA polynucleotides having an
open reading frame, each of which encodes a different antigenic
polypeptide (or a single RNA polynucleotide encoding 2-10, or more,
different antigenic polypeptides). The antigenic polypeptides may
be selected from Malaria (e.g., P. falciparum, P. vivax, P.
malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV,
ZIKV and YFV antigenic polypeptides.
[0758] In some embodiments, a tropical disease vaccine comprises a
RNA (e.g., mRNA) polynucleotide having an open reading frame
encoding a viral capsid protein, a RNA (e.g., mRNA) polynucleotide
having an open reading frame encoding a viral premembrane/membrane
protein, and a RNA (e.g., mRNA) polynucleotide having an open
reading frame encoding a viral envelope protein. In some
embodiments, a tropical disease vaccine comprises a RNA (e.g.,
mRNA) polynucleotide having an open reading frame encoding a viral
fusion (F) protein and a RNA polynucleotide having an open reading
frame encoding a viral major surface glycoprotein (G protein). In
some embodiments, a vaccine comprises a RNA (e.g., mRNA)
polynucleotide having an open reading frame encoding a viral F
protein. In some embodiments, a vaccine comprises a RNA (e.g.,
mRNA) polynucleotide having an open reading frame encoding a viral
G protein. In some embodiments, a vaccine comprises a RNA (e.g.,
mRNA) polynucleotide having an open reading frame encoding a HN
protein.
[0759] In some embodiments, a multicomponent vaccine comprises at
least one RNA (e.g., mRNA) polynucleotide encoding at least one
antigenic polypeptide fused to a signal peptide (e.g., SEQ ID NO:
304-307). The signal peptide may be fused at the N-terminus or the
C-terminus of an antigenic polypeptide. An antigenic polypeptide
fused to a signal peptide may be selected from Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and YFV antigenic polypeptides.
Signal Peptides
[0760] In some embodiments, antigenic polypeptides encoded by
tropical disease RNA (e.g., mRNA) polynucleotides comprise a signal
peptide. Signal peptides, comprising the N-terminal 15-60 amino
acids of proteins, are typically needed for the translocation
across the membrane on the secretory pathway and, thus, universally
control the entry of most proteins both in eukaryotes and
prokaryotes to the secretory pathway. Signal peptides generally
include three regions: an N-terminal region of differing length,
which usually comprises positively charged amino acids; a
hydrophobic region; and a short carboxy-terminal peptide region. In
eukaryotes, the signal peptide of a nascent precursor protein
(pre-protein) directs the ribosome to the rough endoplasmic
reticulum (ER) membrane and initiates the transport of the growing
peptide chain across it for processing. ER processing produces
mature proteins, wherein the signal peptide is cleaved from
precursor proteins, typically by a ER-resident signal peptidase of
the host cell, or they remain uncleaved and function as a membrane
anchor. A signal peptide may also facilitate the targeting of the
protein to the cell membrane. The signal peptide, however, is not
responsible for the final destination of the mature protein.
Secretory proteins devoid of additional address tags in their
sequence are by default secreted to the external environment.
During recent years, a more advanced view of signal peptides has
evolved, showing that the functions and immunodominance of certain
signal peptides are much more versatile than previously
anticipated.
[0761] Tropical disease vaccines of the present disclosure may
comprise, for example, RNA (e.g., mRNA) polynucleotides encoding an
artificial signal peptide, wherein the signal peptide coding
sequence is operably linked to and is in frame with the coding
sequence of the antigenic polypeptide. Thus, tropical disease
vaccines of the present disclosure, in some embodiments, produce an
antigenic polypeptide (e.g., a Malaria (e.g., P. falciparum, P.
vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV,
CHIKV, DENV, ZIKV and/or YFV antigenic polypeptide) fused to a
signal peptide. In some embodiments, a signal peptide is fused to
the N-terminus of the antigenic polypeptide. In some embodiments, a
signal peptide is fused to the C-terminus of the antigenic
polypeptide.
[0762] In some embodiments, the signal peptide fused to the
antigenic polypeptide is an artificial signal peptide. In some
embodiments, an artificial signal peptide fused to the antigenic
polypeptide encoded by the RNA (e.g., mRNA) vaccine is obtained
from an immunoglobulin protein, e.g., an IgE signal peptide or an
IgG signal peptide. In some embodiments, a signal peptide fused to
the antigenic polypeptide encoded by a RNA (e.g., mRNA) vaccine is
an Ig heavy chain epsilon-1 signal peptide (IgE HC SP) having the
sequence of: MDWTWILFLVAAATRVHS; SEQ ID NO: 424. In some
embodiments, a signal peptide fused to the antigenic polypeptide
encoded by the (e.g., mRNA) RNA (e.g., mRNA) vaccine is an IgGk
chain V-III region HAH signal peptide (IgGk SP) having the sequence
of METPAQLLFLLLLWLPDTTG; SEQ ID NO: 423. In some embodiments, the
signal peptide is selected from: Japanese encephalitis PRM signal
sequence (MLGSNSGQRVVFTILLLLVAPAYS; SEQ ID NO: 425), VSINVg protein
signal sequence (MKCLLYLAFLFIGVNCA; SEQ ID NO: 426) and Japanese
encephalitis JEV signal sequence (MWLVSLAIVTACAGA; SEQ ID NO:
427).
[0763] In some embodiments, the antigenic polypeptide encoded by a
RNA (e.g., mRNA) vaccine comprises an amino acid sequence
identified by any one of SEQ ID NO: 13-17, 22-29, 44-47, 52-54,
59-64, 97-117, 156-222, 469, 259-291 or 402-413 fused to a signal
peptide identified by any one of SEQ ID NO: 423-427. The examples
disclosed herein are not meant to be limiting and any signal
peptide that is known in the art to facilitate targeting of a
protein to ER for processing and/or targeting of a protein to the
cell membrane may be used in accordance with the present
disclosure.
[0764] A signal peptide may have a length of 15-60 amino acids. For
example, a signal peptide may have a length of 15, 16, 17, 18, 19,
20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36,
37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53,
54, 55, 56, 57, 58, 59, or 60 amino acids. In some embodiments, a
signal peptide has a length of 20-60, 25-60, 30-60, 35-60, 40-60,
45-60, 50-60, 55-60, 15-55, 20-55, 25-55, 30-55, 35-55, 40-55,
45-55, 50-55, 15-50, 20-50, 25-50, 30-50, 35-50, 40-50, 45-50,
15-45, 20-45, 25-45, 30-45, 35-45, 40-45, 15-40, 20-40, 25-40,
30-40, 35-40, 15-35, 20-35, 25-35, 30-35, 15-30, 20-30, 25-30,
15-25, 20-25, or 15-20 amino acids.
[0765] A signal peptide is typically cleaved from the nascent
polypeptide at the cleavage junction during ER processing. The
mature antigenic polypeptide produce by a tropical disease RNA
(e.g., mRNA) vaccine of the present disclosure typically does not
comprise a signal peptide.
Chemical Modifications
[0766] Tropical disease vaccines of the present disclosure, in some
embodiments, comprise at least RNA (e.g. mRNA) polynucleotide
having an open reading frame encoding at least one antigenic
polypeptide that comprises at least one chemical modification.
[0767] The terms "chemical modification" and "chemically modified"
refer to modification with respect to adenosine (A), guanosine (G),
uridine (U), thymidine (T) or cytidine (C) ribonucleosides or
deoxyribnucleosides in at least one of their position, pattern,
percent or population. Generally, these terms do not refer to the
ribonucleotide modifications in naturally occurring 5'-terminal
mRNA cap moieties. With respect to a polypeptide, the term
"modification" refers to a modification relative to the canonical
set 20 amino acids. Polypeptides, as provided herein, are also
considered "modified" of they contain amino acid substitutions,
insertions or a combination of substitutions and insertions.
[0768] Polynucleotides (e.g., RNA polynucleotides, such as mRNA
polynucleotides), in some embodiments, comprise various (more than
one) different modifications. In some embodiments, a particular
region of a polynucleotide contains one, two or more (optionally
different) nucleoside or nucleotide modifications. In some
embodiments, a modified RNA polynucleotide (e.g., a modified mRNA
polynucleotide), introduced to a cell or organism, exhibits reduced
degradation in the cell or organism, respectively, relative to an
unmodified polynucleotide. In some embodiments, a modified RNA
polynucleotide (e.g., a modified mRNA polynucleotide), introduced
into a cell or organism, may exhibit reduced immunogenicity in the
cell or organism, respectively (e.g., a reduced innate
response).
[0769] Modifications of polynucleotides include, without
limitation, those described herein. Polynucleotides (e.g., RNA
polynucleotides, such as mRNA polynucleotides) may comprise
modifications that are naturally-occurring, non-naturally-occurring
or the polynucleotide may comprise a combination of
naturally-occurring and non-naturally-occurring modifications.
Polynucleotides may include any useful modification, for example,
of a sugar, a nucleobase, or an internucleoside linkage (e.g., to a
linking phosphate, to a phosphodiester linkage or to the
phosphodiester backbone).
[0770] Polynucleotides (e.g., RNA polynucleotides, such as mRNA
polynucleotides), in some embodiments, comprise non-natural
modified nucleotides that are introduced during synthesis or
post-synthesis of the polynucleotides to achieve desired functions
or properties. The modifications may be present on an
internucleotide linkages, purine or pyrimidine bases, or sugars.
The modification may be introduced with chemical synthesis or with
a polymerase enzyme at the terminal of a chain or anywhere else in
the chain. Any of the regions of a polynucleotide may be chemically
modified.
[0771] The present disclosure provides for modified nucleosides and
nucleotides of a polynucleotide (e.g., RNA polynucleotides, such as
mRNA polynucleotides). A "nucleoside" refers to a compound
containing a sugar molecule (e.g., a pentose or ribose) or a
derivative thereof in combination with an organic base (e.g., a
purine or pyrimidine) or a derivative thereof (also referred to
herein as "nucleobase"). A "nucleotide" refers to a nucleoside,
including a phosphate group. Modified nucleotides may by
synthesized by any useful method, such as, for example, chemically,
enzymatically, or recombinantly, to include one or more modified or
non-natural nucleosides. Polynucleotides may comprise a region or
regions of linked nucleosides. Such regions may have variable
backbone linkages. The linkages may be standard phosphodiester
linkages, in which case the polynucleotides would comprise regions
of nucleotides.
[0772] Modified nucleotide base pairing encompasses not only the
standard adenosine-thymine, adenosine-uracil, or guanosine-cytosine
base pairs, but also base pairs formed between nucleotides and/or
modified nucleotides comprising non-standard or modified bases,
wherein the arrangement of hydrogen bond donors and hydrogen bond
acceptors permits hydrogen bonding between a non-standard base and
a standard base or between two complementary non-standard base
structures. One example of such non-standard base pairing is the
base pairing between the modified nucleotide inosine and adenine,
cytosine or uracil. Any combination of base/sugar or linker may be
incorporated into polynucleotides of the present disclosure.
[0773] Modifications of polynucleotides (e.g., RNA polynucleotides,
such as mRNA polynucleotides) that are useful in the vaccines of
the present disclosure include, but are not limited to the
following: 2-methylthio-N6-(cis-hydroxyisopentenyl)adenosine;
2-methylthio-N6-methyladenosine; 2-methylthio-N6-threonyl
carbamoyladenosine; N6-glycinylcarbamoyladenosine;
N6-isopentenyladenosine; N6-methyladenosine;
N6-threonylcarbamoyladenosine; 1,2'-O-dimethyladenosine;
1-methyladenosine; 2'-O-methyladenosine; 2'-O-ribosyladenosine
(phosphate); 2-methyladenosine; 2-methylthio-N6
isopentenyladenosine; 2-methylthio-N6-hydroxynorvalyl
carbamoyladenosine; 2'-O-methyladenosine; 2'-O-ribosyladenosine
(phosphate); Isopentenyladenosine;
N6-(cis-hydroxyisopentenyl)adenosine; N6,2'-O-dimethyladenosine;
N6,2'-O-dimethyladenosine; N6,N6,2'-O-trimethyladenosine;
N6,N6-dimethyladenosine; N6-acetyladenosine;
N6-hydroxynorvalylcarbamoyladenosine;
N6-methyl-N6-threonylcarbamoyladenosine; 2-methyladenosine;
2-methylthio-N6-isopentenyladenosine; 7-deaza-adenosine;
N1-methyl-adenosine; N6, N6 (dimethyl)adenine;
N6-cis-hydroxy-isopentenyl-adenosine; .alpha.-thio-adenosine; 2
(amino)adenine; 2 (aminopropyl)adenine; 2 (methylthio) N6
(isopentenyl)adenine; 2-(alkyl)adenine; 2-(aminoalkyl)adenine;
2-(aminopropyl)adenine; 2-(halo)adenine; 2-(halo)adenine;
2-(propyl)adenine; 2'-Amino-2'-deoxy-ATP; 2'-Azido-2'-deoxy-ATP;
2'-Deoxy-2'-a-aminoadenosine TP; 2'-Deoxy-2'-a-azidoadenosine TP; 6
(alkyl)adenine; 6 (methyl)adenine; 6-(alkyl)adenine;
6-(methyl)adenine; 7 (deaza)adenine; 8 (alkenyl)adenine; 8
(alkynyl)adenine; 8 (amino)adenine; 8 (thioalkyl)adenine;
8-(alkenyl)adenine; 8-(alkyl)adenine; 8-(alkynyl)adenine;
8-(amino)adenine; 8-(halo)adenine; 8-(hydroxyl)adenine;
8-(thioalkyl)adenine; 8-(thiol)adenine; 8-azido-adenosine; aza
adenine; deaza adenine; N6 (methyl)adenine; N6-(isopentyl)adenine;
7-deaza-8-aza-adenosine; 7-methyladenine; 1-Deazaadenosine TP;
2'Fluoro-N6-Bz-deoxyadenosine TP; 2'-OMe-2-Amino-ATP;
2'O-methyl-N6-Bz-deoxyadenosine TP; 2'-a-Ethynyladenosine TP;
2-aminoadenine; 2-Aminoadenosine TP; 2-Amino-ATP;
2'-a-Trifluoromethyladenosine TP; 2-Azidoadenosine TP;
2'-b-Ethynyladenosine TP; 2-Bromoadenosine TP;
2'-b-Trifluoromethyladenosine TP; 2-Chloroadenosine TP;
2'-Deoxy-2',2'-difluoroadenosine TP;
2'-Deoxy-2'-a-mercaptoadenosine TP;
2'-Deoxy-2'-a-thiomethoxyadenosine TP; 2'-Deoxy-2'-b-aminoadenosine
TP; 2'-Deoxy-2'-b-azidoadenosine TP; 2'-Deoxy-2'-b-bromoadenosine
TP; 2'-Deoxy-2'-b-chloroadenosine TP; 2'-Deoxy-2'-b-fluoroadenosine
TP; 2'-Deoxy-2'-b-iodoadenosine TP; 2'-Deoxy-2'-b-mercaptoadenosine
TP; 2'-Deoxy-2'-b-thiomethoxyadenosine TP; 2-Fluoroadenosine TP;
2-Iodoadenosine TP; 2-Mercaptoadenosine TP; 2-methoxy-adenine;
2-methylthio-adenine; 2-Trifluoromethyladenosine TP;
3-Deaza-3-bromoadenosine TP; 3-Deaza-3-chloroadenosine TP;
3-Deaza-3-fluoroadenosine TP; 3-Deaza-3-iodoadenosine TP;
3-Deazaadenosine TP; 4'-Azidoadenosine TP; 4'-Carbocyclic adenosine
TP; 4'-Ethynyladenosine TP; 5'-Homo-adenosine TP; 8-Aza-ATP;
8-bromo-adenosine TP; 8-Trifluoromethyladenosine TP;
9-Deazaadenosine TP; 2-aminopurine; 7-deaza-2,6-diaminopurine;
7-deaza-8-aza-2,6-diaminopurine; 7-deaza-8-aza-2-aminopurine;
2,6-diaminopurine; 7-deaza-8-aza-adenine, 7-deaza-2-aminopurine;
2-thiocytidine; 3-methylcytidine; 5-formylcytidine;
5-hydroxymethylcytidine; 5-methylcytidine; N4-acetylcytidine;
2'-O-methylcytidine; 2'-O-methylcytidine; 5,2'-O-dimethylcytidine;
5-formyl-2'-O-methylcytidine; Lysidine; N4,2'-O-dimethylcytidine;
N4-acetyl-2'-O-methylcytidine; N4-methylcytidine;
N4,N4-Dimethyl-2'-OMe-Cytidine TP; 4-methylcytidine;
5-aza-cytidine; Pseudo-iso-cytidine; pyrrolo-cytidine;
a-thio-cytidine; 2-(thio)cytosine; 2'-Amino-2'-deoxy-CTP;
2'-Azido-2'-deoxy-CTP; 2'-Deoxy-2'-a-aminocytidine TP;
2'-Deoxy-2'-a-azidocytidine TP; 3 (deaza) 5 (aza)cytosine; 3
(methyl)cytosine; 3-(alkyl)cytosine; 3-(deaza) 5 (aza)cytosine;
3-(methyl)cytidine; 4,2'-O-dimethylcytidine; 5 (halo)cytosine; 5
(methyl)cytosine; 5 (propynyl)cytosine; 5
(trifluoromethyl)cytosine; 5-(alkyl)cytosine; 5-(alkynyl)cytosine;
5-(halo)cytosine; 5-(propynyl)cytosine;
5-(trifluoromethyl)cytosine; 5-bromo-cytidine; 5-iodo-cytidine;
5-propynyl cytosine; 6-(azo)cytosine; 6-aza-cytidine; aza cytosine;
deaza cytosine; N4 (acetyl)cytosine;
1-methyl-1-deaza-pseudoisocytidine; 1-methyl-pseudoisocytidine;
2-methoxy-5-methyl-cytidine; 2-methoxy-cytidine;
2-thio-5-methyl-cytidine; 4-methoxy-1-methyl-pseudoisocytidine;
4-methoxy-pseudoisocytidine;
4-thio-1-methyl-1-deaza-pseudoisocytidine;
4-thio-1-methyl-pseudoisocytidine; 4-thio-pseudoisocytidine;
5-aza-zebularine; 5-methyl-zebularine; pyrrolo-pseudoisocytidine;
Zebularine; (E)-5-(2-Bromo-vinyl)cytidine TP; 2,2'-anhydro-cytidine
TP hydrochloride; 2'Fluor-N4-Bz-cytidine TP;
2'Fluoro-N4-Acetyl-cytidine TP; 2'-O-Methyl-N4-Acetyl-cytidine TP;
2'O-methyl-N4-Bz-cytidine TP; 2'-a-Ethynylcytidine TP;
2'-a-Trifluoromethylcytidine TP; 2'-b-Ethynylcytidine TP;
2'-b-Trifluoromethylcytidine TP; 2'-Deoxy-2',2'-difluorocytidine
TP; 2'-Deoxy-2'-a-mercaptocytidine TP;
2'-Deoxy-2'-a-thiomethoxycytidine TP; 2'-Deoxy-2'-b-aminocytidine
TP; 2'-Deoxy-2'-b-azidocytidine TP; 2'-Deoxy-2'-b-bromocytidine TP;
2'-Deoxy-2'-b-chlorocytidine TP; 2'-Deoxy-2'-b-fluorocytidine TP;
2'-Deoxy-2'-b-iodocytidine TP; 2'-Deoxy-2'-b-mercaptocytidine TP;
2'-Deoxy-2'-b-thiomethoxycytidine TP;
2'-O-Methyl-5-(1-propynyl)cytidine TP; 3'-Ethynylcytidine TP;
4'-Azidocytidine TP; 4'-Carbocyclic cytidine TP; 4'-Ethynylcytidine
TP; 5-(1-Propynyl)ara-cytidine TP;
5-(2-Chloro-phenyl)-2-thiocytidine TP;
5-(4-Amino-phenyl)-2-thiocytidine TP; 5-Aminoallyl-CTP;
5-Cyanocytidine TP; 5-Ethynylara-cytidine TP; 5-Ethynylcytidine TP;
5'-Homo-cytidine TP; 5-Methoxycytidine TP;
5-Trifluoromethyl-Cytidine TP; N4-Amino-cytidine TP;
N4-Benzoyl-cytidine TP; Pseudoisocytidine; 7-methylguanosine;
N2,2'-O-dimethylguanosine; N2-methylguanosine; Wyosine;
1,2'-O-dimethylguanosine; 1-methylguanosine; 2'-O-methylguanosine;
2'-O-ribosylguanosine (phosphate); 2'-O-methylguanosine;
2'-O-ribosylguanosine (phosphate); 7-aminomethyl-7-deazaguanosine;
7-cyano-7-deazaguanosine; Archaeosine; Methylwyosine;
N2,7-dimethylguanosine; N2,N2,2'-O-trimethylguanosine;
N2,N2,7-trimethylguanosine; N2,N2-dimethylguanosine;
N2,7,2'-O-trimethylguanosine; 6-thio-guanosine; 7-deaza-guanosine;
8-oxo-guanosine; N1-methyl-guanosine; a-thio-guanosine; 2
(propyl)guanine; 2-(alkyl)guanine; 2'-Amino-2'-deoxy-GTP;
2'-Azido-2'-deoxy-GTP; 2'-Deoxy-2'-a-aminoguanosine TP;
2'-Deoxy-2'-a-azidoguanosine TP; 6 (methyl)guanine;
6-(alkyl)guanine; 6-(methyl)guanine; 6-methyl-guanosine; 7
(alkyl)guanine; 7 (deaza)guanine; 7 (methyl)guanine;
7-(alkyl)guanine; 7-(deaza)guanine; 7-(methyl)guanine; 8
(alkyl)guanine; 8 (alkynyl)guanine; 8 (halo)guanine; 8
(thioalkyl)guanine; 8-(alkenyl)guanine; 8-(alkyl)guanine;
8-(alkynyl)guanine; 8-(amino)guanine; 8-(halo)guanine;
8-(hydroxyl)guanine; 8-(thioalkyl)guanine; 8-(thiol)guanine; aza
guanine; deaza guanine; N (methyl)guanine; N-(methyl)guanine;
1-methyl-6-thio-guanosine; 6-methoxy-guanosine;
6-thio-7-deaza-8-aza-guanosine; 6-thio-7-deaza-guanosine;
6-thio-7-methyl-guanosine; 7-deaza-8-aza-guanosine;
7-methyl-8-oxo-guanosine; N2,N2-dimethyl-6-thio-guanosine;
N2-methyl-6-thio-guanosine; 1-Me-GTP;
2'Fluoro-N2-isobutyl-guanosine TP; 2'O-methyl-N2-isobutyl-guanosine
TP; 2'-a-Ethynylguanosine TP; 2'-a-Trifluoromethylguanosine TP;
2'-b-Ethynylguanosine TP; 2'-b-Trifluoromethylguanosine TP;
2'-Deoxy-2',2'-difluoroguanosine TP;
2'-Deoxy-2'-a-mercaptoguanosine TP;
2'-Deoxy-2'-a-thiomethoxyguanosine TP; 2'-Deoxy-2'-b-aminoguanosine
TP; 2'-Deoxy-2'-b-azidoguanosine TP; 2'-Deoxy-2'-b-bromoguanosine
TP; 2'-Deoxy-2'-b-chloroguanosine TP; 2'-Deoxy-2'-b-fluoroguanosine
TP; 2'-Deoxy-2'-b-iodoguanosine TP; 2'-Deoxy-2'-b-mercaptoguanosine
TP; 2'-Deoxy-2'-b-thiomethoxyguanosine TP; 4'-Azidoguanosine TP;
4'-Carbocyclic guanosine TP; 4'-Ethynylguanosine TP;
5'-Homo-guanosine TP; 8-bromo-guanosine TP; 9-Deazaguanosine TP;
N2-isobutyl-guanosine TP; 1-methylinosine; Inosine;
1,2'-O-dimethylinosine; 2'-O-methylinosine; 7-methylinosine;
2'-O-methylinosine; Epoxyqueuosine; galactosyl-queuosine;
Mannosylqueuosine; Queuosine; allyamino-thymidine; aza thymidine;
deaza thymidine; deoxy-thymidine; 2'-O-methyluridine;
2-thiouridine; 3-methyluridine; 5-carboxymethyluridine;
5-hydroxyuridine; 5-methyluridine; 5-taurinomethyl-2-thiouridine;
5-taurinomethyluridine; Dihydrouridine; Pseudouridine;
(3-(3-amino-3-carboxypropyl)uridine;
1-methyl-3-(3-amino-5-carboxypropyl)pseudouridine;
1-methylpseduouridine; 1-methyl-pseudouridine; 2'-O-methyluridine;
2'-O-methylpseudouridine; 2'-O-methyluridine;
2-thio-2'-O-methyluridine; 3-(3-amino-3-carboxypropyl)uridine;
3,2'-O-dimethyluridine; 3-Methyl-pseudo-Uridine TP; 4-thiouridine;
5-(carboxyhydroxymethyl)uridine; 5-(carboxyhydroxymethyl)uridine
methyl ester; 5,2'-O-dimethyluridine; 5,6-dihydro-uridine;
5-aminomethyl-2-thiouridine; 5-carbamoylmethyl-2'-O-methyluridine;
5-carbamoylmethyluridine; 5-carboxyhydroxymethyluridine;
5-carboxyhydroxymethyluridine methyl ester;
5-carboxymethylaminomethyl-2'-O-methyluridine;
5-carboxymethylaminomethyl-2-thiouridine;
5-carboxymethylaminomethyl-2-thiouridine;
5-carboxymethylaminomethyluridine;
5-carboxymethylaminomethyluridine; 5-Carbamoylmethyluridine TP;
5-methoxycarbonylmethyl-2'-O-methyluridine;
5-methoxycarbonylmethyl-2-thiouridine;
5-methoxycarbonylmethyluridine; 5-methoxyuridine;
5-methyl-2-thiouridine; 5-methylaminomethyl-2-selenouridine;
5-methylaminomethyl-2-thiouridine; 5-methylaminomethyluridine;
5-Methyldihydrouridine; 5-Oxyacetic acid-Uridine TP; 5-Oxyacetic
acid-methyl ester-Uridine TP; N1-methyl-pseudo-uridine; uridine
5-oxyacetic acid; uridine 5-oxyacetic acid methyl ester;
3-(3-Amino-3-carboxypropyl)-Uridine TP;
5-(iso-Pentenylaminomethyl)-2-thiouridine TP;
5-(iso-Pentenylaminomethyl)-2'-O-methyluridine TP;
5-(iso-Pentenylaminomethyl)uridine TP; 5-propynyl uracil;
a-thio-uridine; 1
(aminoalkylamino-carbonylethylenyl)-2(thio)-pseudouracil; 1
(aminoalkylaminocarbonylethylenyl)-2,4-(dithio)pseudouracil; 1
(aminoalkylaminocarbonylethylenyl)-4 (thio)pseudouracil; 1
(aminoalkylaminocarbonylethylenyl)-pseudouracil; 1
(aminocarbonylethylenyl)-2(thio)-pseudouracil; 1
(aminocarbonylethylenyl)-2,4-(dithio)pseudouracil; 1
(aminocarbonylethylenyl)-4 (thio)pseudouracil; 1
(aminocarbonylethylenyl)-pseudouracil; 1 substituted
2(thio)-pseudouracil; 1 substituted 2,4-(dithio)pseudouracil; 1
substituted 4 (thio)pseudouracil; 1 substituted pseudouracil;
1-(aminoalkylamino-carbonylethylenyl)-2-(thio)-pseudouracil;
1-Methyl-3-(3-amino-3-carboxypropyl) pseudouridine TP;
1-Methyl-3-(3-amino-3-carboxypropyl)pseudo-UTP;
1-Methyl-pseudo-UTP; 2 (thio)pseudouracil; 2' deoxy uridine; 2'
fluorouridine; 2-(thio)uracil; 2,4-(dithio)psuedouracil; 2' methyl,
2'amino, 2'azido, 2'fluro-guanosine; 2'-Amino-2'-deoxy-UTP;
2'-Azido-2'-deoxy-UTP; 2'-Azido-deoxyuridine TP;
2'-O-methylpseudouridine; 2' deoxy uridine; 2' fluorouridine;
2'-Deoxy-2'-a-aminouridine TP; 2'-Deoxy-2'-a-azidouridine TP;
2-methylpseudouridine; 3 (3 amino-3 carboxypropyl)uracil; 4
(thio)pseudouracil; 4-(thio)pseudouracil; 4-(thio)uracil;
4-thiouracil; 5 (1,3-diazole-1-alkyl)uracil; 5
(2-aminopropyl)uracil; 5 (aminoalkyl)uracil; 5
(dimethylaminoalkyl)uracil; 5 (guanidiniumalkyl)uracil; 5
(methoxycarbonylmethyl)-2-(thio)uracil; 5
(methoxycarbonyl-methyl)uracil; 5 (methyl) 2 (thio)uracil; 5
(methyl) 2,4 (dithio)uracil; 5 (methyl) 4 (thio)uracil; 5
(methylaminomethyl)-2 (thio)uracil; 5 (methylaminomethyl)-2,4
(dithio)uracil; 5 (methylaminomethyl)-4 (thio)uracil; 5
(propynyl)uracil; 5 (trifluoromethyl)uracil;
5-(2-aminopropyl)uracil; 5-(alkyl)-2-(thio)pseudouracil;
5-(alkyl)-2,4 (dithio)pseudouracil; 5-(alkyl)-4 (thio)pseudouracil;
5-(alkyl)pseudouracil; 5-(alkyl)uracil; 5-(alkynyl)uracil;
5-(allylamino)uracil; 5-(cyanoalkyl)uracil;
5-(dialkylaminoalkyl)uracil; 5-(dimethylaminoalkyl)uracil;
5-(guanidiniumalkyl)uracil; 5-(halo)uracil;
5-(1,3-diazole-1-alkyl)uracil; 5-(methoxy)uracil;
5-(methoxycarbonylmethyl)-2-(thio)uracil;
5-(methoxycarbonyl-methyl)uracil; 5-(methyl) 2(thio)uracil;
5-(methyl) 2,4 (dithio)uracil; 5-(methyl) 4 (thio)uracil;
5-(methyl)-2-(thio)pseudouracil; 5-(methyl)-2,4
(dithio)pseudouracil; 5-(methyl)-4 (thio)pseudouracil;
5-(methyl)pseudouracil; 5-(methylaminomethyl)-2 (thio)uracil;
5-(methylaminomethyl)-2,4(dithio)uracil;
5-(methylaminomethyl)-4-(thio)uracil; 5-(propynyl)uracil;
5-(trifluoromethyl)uracil; 5-aminoallyl-uridine; 5-bromo-uridine;
5-iodo-uridine; 5-uracil; 6 (azo)uracil; 6-(azo)uracil;
6-aza-uridine; allyamino-uracil; aza uracil; deaza uracil; N3
(methyl)uracil; Pseudo-UTP-1-2-ethanoic acid; Pseudouracil;
4-Thio-pseudo-UTP; 1-carboxymethyl-pseudouridine;
1-methyl-1-deaza-pseudouridine; 1-propynyl-uridine;
1-taurinomethyl-1-methyl-uridine; 1-taurinomethyl-4-thio-uridine;
1-taurinomethyl-pseudouridine; 2-methoxy-4-thio-pseudouridine;
2-thio-1-methyl-1-deaza-pseudouridine;
2-thio-1-methyl-pseudouridine; 2-thio-5-aza-uridine;
2-thio-dihydropseudouridine; 2-thio-dihydrouridine;
2-thio-pseudouridine; 4-methoxy-2-thio-pseudouridine;
4-methoxy-pseudouridine; 4-thio-1-methyl-pseudouridine;
4-thio-pseudouridine; 5-aza-uridine; Dihydropseudouridine;
(.+-.)1-(2-Hydroxypropyl)pseudouridine TP;
(2R)-1-(2-Hydroxypropyl)pseudouridine TP;
(2S)-1-(2-Hydroxypropyl)pseudouridine TP;
(E)-5-(2-Bromo-vinyl)ara-uridine TP; (E)-5-(2-Bromo-vinyl)uridine
TP; (Z)-5-(2-Bromo-vinyl)ara-uridine TP;
(Z)-5-(2-Bromo-vinyl)uridine TP;
1-(2,2,2-Trifluoroethyl)-pseudo-UTP;
1-(2,2,3,3,3-Pentafluoropropyl)pseudouridine TP;
1-(2,2-Diethoxyethyl)pseudouridine TP;
1-(2,4,6-Trimethylbenzyl)pseudouridine TP;
1-(2,4,6-Trimethyl-benzyl)pseudo-UTP;
1-(2,4,6-Trimethyl-phenyl)pseudo-UTP;
1-(2-Amino-2-carboxyethyl)pseudo-UTP; 1-(2-Amino-ethyl)pseudo-UTP;
1-(2-Hydroxyethyl)pseudouridine TP; 1-(2-Methoxyethyl)pseudouridine
TP; 1-(3,4-Bis-trifluoromethoxybenzyl)pseudouridine TP;
1-(3,4-Dimethoxybenzyl)pseudouridine TP;
1-(3-Amino-3-carboxypropyl)pseudo-UTP;
1-(3-Amino-propyl)pseudo-UTP;
1-(3-Cyclopropyl-prop-2-ynyl)pseudouridine TP;
1-(4-Amino-4-carboxybutyl)pseudo-UTP; 1-(4-Amino-benzyl)pseudo-UTP;
1-(4-Amino-butyl)pseudo-UTP; 1-(4-Amino-phenyl)pseudo-UTP;
1-(4-Azidobenzyl)pseudouridine TP; 1-(4-Bromobenzyl)pseudouridine
TP; 1-(4-Chlorobenzyl)pseudouridine TP;
1-(4-Fluorobenzyl)pseudouridine TP; 1-(4-Iodobenzyl)pseudouridine
TP; 1-(4-Methanesulfonylbenzyl)pseudouridine TP;
1-(4-Methoxybenzyl)pseudouridine TP;
1-(4-Methoxy-benzyl)pseudo-UTP; 1-(4-Methoxy-phenyl)pseudo-UTP;
1-(4-Methylbenzyl)pseudouridine TP; 1-(4-Methyl-benzyl)pseudo-UTP;
1-(4-Nitrobenzyl)pseudouridine TP; 1-(4-Nitro-benzyl)pseudo-UTP;
1(4-Nitro-phenyl)pseudo-UTP; 1-(4-Thiomethoxybenzyl)pseudouridine
TP; 1-(4-Trifluoromethoxybenzyl)pseudouridine TP;
1-(4-Trifluoromethylbenzyl)pseudouridine TP;
1-(5-Amino-pentyl)pseudo-UTP; 1-(6-Amino-hexyl)pseudo-UTP;
1,6-Dimethyl-pseudo-UTP;
1-[3-(2-{2-[2-(2-Aminoethoxy)-ethoxy]-ethoxy}-ethoxy)-propionyl]pseudouri-
dine TP; 1-{3-[2-(2-Aminoethoxy)-ethoxy]-propionyl} pseudouridine
TP; 1-Acetylpseudouridine TP; 1-Alkyl-6-(1-propynyl)-pseudo-UTP;
1-Alkyl-6-(2-propynyl)-pseudo-UTP; 1-Alkyl-6-allyl-pseudo-UTP;
1-Alkyl-6-ethynyl-pseudo-UTP; 1-Alkyl-6-homoallyl-pseudo-UTP;
1-Alkyl-6-vinyl-pseudo-UTP; 1-Allylpseudouridine TP;
1-Aminomethyl-pseudo-UTP; 1-Benzoylpseudouridine TP;
1-Benzyloxymethylpseudouridine TP; 1-Benzyl-pseudo-UTP;
1-Biotinyl-PEG2-pseudouridine TP; 1-Biotinylpseudouridine TP;
1-Butyl-pseudo-UTP; 1-Cyanomethylpseudouridine TP;
1-Cyclobutylmethyl-pseudo-UTP; 1-Cyclobutyl-pseudo-UTP;
1-Cycloheptylmethyl-pseudo-UTP; 1-Cycloheptyl-pseudo-UTP;
1-Cyclohexylmethyl-pseudo-UTP; 1-Cyclohexyl-pseudo-UTP;
1-Cyclooctylmethyl-pseudo-UTP; 1-Cyclooctyl-pseudo-UTP;
1-Cyclopentylmethyl-pseudo-UTP; 1-Cyclopentyl-pseudo-UTP;
1-Cyclopropylmethyl-pseudo-UTP; 1-Cyclopropyl-pseudo-UTP;
1-Ethyl-pseudo-UTP; 1-Hexyl-pseudo-UTP; 1-Homoallylpseudouridine
TP; 1-Hydroxymethylpseudouridine TP; 1-iso-propyl-pseudo-UTP;
1-Me-2-thio-pseudo-UTP; 1-Me-4-thio-pseudo-UTP;
1-Me-alpha-thio-pseudo-UTP; 1-Methanesulfonylmethylpseudouridine
TP; 1-Methoxymethylpseudouridine TP;
1-Methyl-6-(2,2,2-Trifluoroethyl)pseudo-UTP;
1-Methyl-6-(4-morpholino)-pseudo-UTP;
1-Methyl-6-(4-thiomorpholino)-pseudo-UTP; 1-Methyl-6-(substituted
phenyl)pseudo-UTP; 1-Methyl-6-amino-pseudo-UTP;
1-Methyl-6-azido-pseudo-UTP; 1-Methyl-6-bromo-pseudo-UTP;
1-Methyl-6-butyl-pseudo-UTP; 1-Methyl-6-chloro-pseudo-UTP;
1-Methyl-6-cyano-pseudo-UTP; 1-Methyl-6-dimethylamino-pseudo-UTP;
1-Methyl-6-ethoxy-pseudo-UTP;
1-Methyl-6-ethylcarboxylate-pseudo-UTP;
1-Methyl-6-ethyl-pseudo-UTP; 1-Methyl-6-fluoro-pseudo-UTP;
1-Methyl-6-formyl-pseudo-UTP; 1-Methyl-6-hydroxyamino-pseudo-UTP;
1-Methyl-6-hydroxy-pseudo-UTP; 1-Methyl-6-iodo-pseudo-UTP;
1-Methyl-6-iso-propyl-pseudo-UTP; 1-Methyl-6-methoxy-pseudo-UTP;
1-Methyl-6-methylamino-pseudo-UTP; 1-Methyl-6-phenyl-pseudo-UTP;
1-Methyl-6-propyl-pseudo-UTP; 1-Methyl-6-tert-butyl-pseudo-UTP;
1-Methyl-6-trifluoromethoxy-pseudo-UTP;
1-Methyl-6-trifluoromethyl-pseudo-UTP;
1-Morpholinomethylpseudouridine TP; 1-Pentyl-pseudo-UTP;
1-Phenyl-pseudo-UTP; 1-Pivaloylpseudouridine TP;
1-Propargylpseudouridine TP; 1-Propyl-pseudo-UTP;
1-propynyl-pseudouridine; 1-p-tolyl-pseudo-UTP;
1-tert-Butyl-pseudo-UTP; 1-Thiomethoxymethylpseudouridine TP;
1-Thiomorpholinomethylpseudouridine TP;
1-Trifluoroacetylpseudouridine TP; 1-Trifluoromethyl-pseudo-UTP;
1-Vinylpseudouridine TP; 2,2'-anhydro-uridine TP;
2'-bromo-deoxyuridine TP; 2'-F-5-Methyl-2'-deoxy-UTP;
2'-OMe-5-Me-UTP; 2'-OMe-pseudo-UTP; 2'-a-Ethynyluridine TP;
2'-a-Trifluoromethyluridine TP; 2'-b-Ethynyluridine TP;
2'-b-Trifluoromethyluridine TP; 2'-Deoxy-2',2'-difluorouridine TP;
2'-Deoxy-2'-a-mercaptouridine TP; 2'-Deoxy-2'-a-thiomethoxyuridine
TP; 2'-Deoxy-2'-b-aminouridine TP; 2'-Deoxy-2'-b-azidouridine TP;
2'-Deoxy-2'-b-bromouridine TP; 2'-Deoxy-2'-b-chlorouridine TP;
2'-Deoxy-2'-b-fluorouridine TP; 2'-Deoxy-2'-b-iodouridine TP;
2'-Deoxy-2'-b-mercaptouridine TP; 2'-Deoxy-2'-b-thiomethoxyuridine
TP; 2-methoxy-4-thio-uridine; 2-methoxyuridine;
2'-O-Methyl-5-(1-propynyl)uridine TP; 3-Alkyl-pseudo-UTP;
4'-Azidouridine TP; 4'-Carbocyclic uridine TP; 4'-Ethynyluridine
TP; 5-(1-Propynyl)ara-uridine TP; 5-(2-Furanyl)uridine TP;
5-Cyanouridine TP; 5-Dimethylaminouridine TP; 5'-Homo-uridine TP;
5-iodo-2'-fluoro-deoxyuridine TP; 5-Phenylethynyluridine TP;
5-Trideuteromethyl-6-deuterouridine TP; 5-Trifluoromethyl-Uridine
TP; 5-Vinylarauridine TP; 6-(2,2,2-Trifluoroethyl)-pseudo-UTP;
6-(4-Morpholino)-pseudo-UTP; 6-(4-Thiomorpholino)-pseudo-UTP;
6-(Substituted-Phenyl)-pseudo-UTP; 6-Amino-pseudo-UTP;
6-Azido-pseudo-UTP; 6-Bromo-pseudo-UTP; 6-Butyl-pseudo-UTP;
6-Chloro-pseudo-UTP; 6-Cyano-pseudo-UTP;
6-Dimethylamino-pseudo-UTP; 6-Ethoxy-pseudo-UTP;
6-Ethylcarboxylate-pseudo-UTP; 6-Ethyl-pseudo-UTP;
6-Fluoro-pseudo-UTP; 6-Formyl-pseudo-UTP;
6-Hydroxyamino-pseudo-UTP; 6-Hydroxy-pseudo-UTP; 6-Iodo-pseudo-UTP;
6-iso-Propyl-pseudo-UTP; 6-Methoxy-pseudo-UTP;
6-Methylamino-pseudo-UTP; 6-Methyl-pseudo-UTP; 6-Phenyl-pseudo-UTP;
6-Phenyl-pseudo-UTP; 6-Propyl-pseudo-UTP; 6-tert-Butyl-pseudo-UTP;
6-Trifluoromethoxy-pseudo-UTP; 6-Trifluoromethyl-pseudo-UTP;
Alpha-thio-pseudo-UTP; Pseudouridine 1-(4-methylbenzenesulfonic
acid) TP; Pseudouridine 1-(4-methylbenzoic acid) TP; Pseudouridine
TP 1-[3-(2-ethoxy)]propionic acid; Pseudouridine TP
1-[3-{2-(2-[2-(2-ethoxy)-ethoxy]-ethoxy)-ethoxy}]propionic acid;
Pseudouridine TP
1-[3-{2-(2-[2-{2(2-ethoxy)-ethoxy}-ethoxy]-ethoxy)-ethoxy}]propionic
acid; Pseudouridine TP
1-[3-{2-(2-[2-ethoxy]-ethoxy)-ethoxy}]propionic acid; Pseudouridine
TP 1-[3-{2-(2-ethoxy)-ethoxy}] propionic acid; Pseudouridine TP
1-methylphosphonic acid; Pseudouridine TP 1-methylphosphonic acid
diethyl ester; Pseudo-UTP-N1-3-propionic acid;
Pseudo-UTP-N1-4-butanoic acid; Pseudo-UTP-N1-5-pentanoic acid;
Pseudo-UTP-N1-6-hexanoic acid; Pseudo-UTP-N1-7-heptanoic acid;
Pseudo-UTP-N1-methyl-p-benzoic acid; Pseudo-UTP-N1-p-benzoic acid;
Wybutosine; Hydroxywybutosine; Isowyosine; Peroxywybutosine;
undermodified hydroxywybutosine; 4-demethylwyosine;
2,6-(diamino)purine; 1-(aza)-2-(thio)-3-(aza)-phenoxazin-1-yl:
1,3-(diaza)-2-(oxo)-phenthiazin-1-yl;
1,3-(diaza)-2-(oxo)-phenoxazin-1-yl;
1,3,5-(triaza)-2,6-(dioxa)-naphthalene; 2 (amino)purine;
2,4,5-(trimethyl)phenyl; 2' methyl, 2'amino, 2'azido,
2'fluro-cytidine; 2' methyl, 2'amino, 2'azido, 2'fluro-adenine;
2'methyl, 2'amino, 2'azido, 2'fluro-uridine;
2'-amino-2'-deoxyribose; 2-amino-6-Chloro-purine; 2-aza-inosinyl;
2'-azido-2'-deoxyribose; 2'fluoro-2'-deoxyribose;
2'-fluoro-modified bases; 2'-O-methyl-ribose;
2-oxo-7-aminopyridopyrimidin-3-yl; 2-oxo-pyridopyrimidine-3-yl;
2-pyridinone; 3 nitropyrrole;
3-(methyl)-7-(propynyl)isocarbostyrilyl;
3-(methyl)isocarbostyrilyl; 4-(fluoro)-6-(methyl)benzimidazole;
4-(methyl)benzimidazole; 4-(methyl)indolyl; 4,6-(dimethyl)indolyl;
5 nitroindole; 5 substituted pyrimidines;
5-(methyl)isocarbostyrilyl; 5-nitroindole; 6-(aza)pyrimidine;
6-(azo)thymine; 6-(methyl)-7-(aza)indolyl; 6-chloro-purine;
6-phenyl-pyrrolo-pyrimidin-2-on-3-yl;
7-(aminoalkylhydroxy)-1-(aza)-2-(thio)-3-(aza)-phenthiazin-1-yl;
7-(aminoalkylhydroxy)-1-(aza)-2-(thio)-3-(aza)-phenoxazin-1-yl;
7-(aminoalkylhydroxy)-1,3-(diaza)-2-(oxo)-phenoxazin-1-yl;
7-(aminoalkylhydroxy)-1,3-(diaza)-2-(oxo)-phenthiazin-1-yl;
7-(aminoalkylhydroxy)-1,3-(diaza)-2-(oxo)-phenoxazin-1-yl;
7-(aza)indolyl;
7-(guanidiniumalkylhydroxy)-1-(aza)-2-(thio)-3-(aza)-phenoxazinl-yl;
7-(guanidiniumalkylhydroxy)-1-(aza)-2-(thio)-3-(aza)-phenthiazin-1-yl;
7-(guanidiniumalkylhydroxy)-1-(aza)-2-(thio)-3-(aza)-phenoxazin-1-yl;
7-(guanidiniumalkylhydroxy)-1,3-(diaza)-2-(oxo)-phenoxazin-1-yl;
7-(guanidiniumalkyl-hydroxy)-1,3-(diaza)-2-(oxo)-phenthiazin-1-yl;
7-(guanidiniumalkylhydroxy)-1,3-(diaza)-2-(oxo)-phenoxazin-1-yl;
7-(propynyl)isocarbostyrilyl; 7-(propynyl)isocarbostyrilyl,
propynyl-7-(aza)indolyl; 7-deaza-inosinyl; 7-substituted
1-(aza)-2-(thio)-3-(aza)-phenoxazin-1-yl; 7-substituted
1,3-(diaza)-2-(oxo)-phenoxazin-1-yl; 9-(methyl)-imidizopyridinyl;
Aminoindolyl; Anthracenyl;
bis-ortho-(aminoalkylhydroxy)-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl;
bis-ortho-substituted-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl;
Difluorotolyl; Hypoxanthine; Imidizopyridinyl; Inosinyl;
Isocarbostyrilyl; Isoguanisine; N2-substituted purines;
N6-methyl-2-amino-purine; N6-substituted purines; N-alkylated
derivative; Napthalenyl; Nitrobenzimidazolyl; Nitroimidazolyl;
Nitroindazolyl; Nitropyrazolyl; Nubularine; O6-substituted purines;
O-alkylated derivative;
ortho-(aminoalkylhydroxy)-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl;
ortho-substituted-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl; Oxoformycin
TP; para-(aminoalkylhydroxy)-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl;
para-substituted-6-phenyl-pyrrolo-pyrimidin-2-on-3-yl; Pentacenyl;
Phenanthracenyl; Phenyl; propynyl-7-(aza)indolyl; Pyrenyl;
pyridopyrimidin-3-yl; pyridopyrimidin-3-yl,
2-oxo-7-amino-pyridopyrimidin-3-yl; pyrrolo-pyrimidin-2-on-3-yl;
Pyrrolopyrimidinyl; Pyrrolopyrizinyl; Stilbenzyl; substituted
1,2,4-triazoles; Tetracenyl; Tubercidine; Xanthine;
Xanthosine-5'-TP; 2-thio-zebularine; 5-aza-2-thio-zebularine;
7-deaza-2-amino-purine; pyridin-4-one ribonucleoside;
2-Amino-riboside-TP; Formycin A TP; Formycin B TP; Pyrrolosine TP;
2'-OH-ara-adenosine TP; 2'-OH-ara-cytidine TP; 2'-OH-ara-uridine
TP; 2'-OH-ara-guanosine TP; 5-(2-carbomethoxyvinyl)uridine TP; and
N6-(19-Amino-pentaoxanonadecyl)adenosine TP.
[0774] In some embodiments, polynucleotides (e.g., RNA
polynucleotides, such as mRNA polynucleotides) include a
combination of at least two (e.g., 2, 3, 4 or more) of the
aforementioned modified nucleobases.
[0775] In some embodiments, modified nucleobases in polynucleotides
(e.g., RNA polynucleotides, such as mRNA polynucleotides) are
selected from the group consisting of pseudouridine (.psi.),
N1-methylpseudouridine (m.sup.1.psi.), N1-ethylpseudouridine,
2-thiouridine, 4'-thiouridine, 5-methylcytosine,
2-thio-1-methyl-1-deaza-pseudouridine,
2-thio-1-methyl-pseudouridine, 2-thio-5-aza-uridine,
2-thio-dihydropseudouridine, 2-thio-dihydrouridine,
2-thio-pseudouridine, 4-methoxy-2-thio-pseudouridine,
4-methoxy-pseudouridine, 4-thio-1-methyl-pseudouridine,
4-thio-pseudouridine, 5-aza-uridine, dihydropseudouridine,
5-methoxyuridine and 2'-O-methyl uridine. In some embodiments,
polynucleotides (e.g., RNA polynucleotides, such as mRNA
polynucleotides) include a combination of at least two (e.g., 2, 3,
4 or more) of the aforementioned modified nucleobases.
[0776] In some embodiments, modified nucleobases in polynucleotides
(e.g., RNA polynucleotides, such as mRNA polynucleotides) are
selected from the group consisting of 1-methyl-pseudouridine
(m.sup.1.psi.), 5-methoxy-uridine (mo.sup.5U), 5-methyl-cytidine
(m.sup.5C), pseudouridine (.psi.), .alpha.-thio-guanosine and
.alpha.-thio-adenosine. In some embodiments, polynucleotides (e.g.,
RNA polynucleotides, such as mRNA polynucleotides) include a
combination of at least two (e.g., 2, 3, 4 or more) of the
aforementioned modified nucleobases.
[0777] In some embodiments, polynucleotides (e.g., RNA
polynucleotides, such as mRNA polynucleotides) comprise
pseudouridine (.psi.) and 5-methyl-cytidine (m.sup.5C). In some
embodiments, polynucleotides (e.g., RNA polynucleotides, such as
mRNA polynucleotides) comprise 1-methyl-pseudouridine
(m.sup.1.psi.). In some embodiments, polynucleotides (e.g., RNA
polynucleotides, such as mRNA polynucleotides) comprise
1-methyl-pseudouridine (m.sup.1.psi.) and 5-methyl-cytidine
(m.sup.5C). In some embodiments, polynucleotides (e.g., RNA
polynucleotides, such as mRNA polynucleotides) comprise
2-thiouridine (s.sup.2U). In some embodiments, polynucleotides
(e.g., RNA polynucleotides, such as mRNA polynucleotides) comprise
2-thiouridine and 5-methyl-cytidine (m.sup.5C). In some
embodiments, polynucleotides (e.g., RNA polynucleotides, such as
mRNA polynucleotides) comprise methoxy-uridine (mo.sup.5U). In some
embodiments, polynucleotides (e.g., RNA polynucleotides, such as
mRNA polynucleotides) comprise 5-methoxy-uridine (mo.sup.5U) and
5-methyl-cytidine (m.sup.5C). In some embodiments, polynucleotides
(e.g., RNA polynucleotides, such as mRNA polynucleotides) comprise
2'-O-methyl uridine. In some embodiments polynucleotides (e.g., RNA
polynucleotides, such as mRNA polynucleotides) comprise 2'-O-methyl
uridine and 5-methyl-cytidine (m.sup.5C). In some embodiments,
polynucleotides (e.g., RNA polynucleotides, such as mRNA
polynucleotides) comprise N6-methyl-adenosine (m.sup.6A). In some
embodiments, polynucleotides (e.g., RNA polynucleotides, such as
mRNA polynucleotides) comprise N6-methyl-adenosine (m.sup.6A) and
5-methyl-cytidine (m.sup.5C).
[0778] In some embodiments, polynucleotides (e.g., RNA
polynucleotides, such as mRNA polynucleotides) are uniformly
modified (e.g., fully modified, modified throughout the entire
sequence) for a particular modification. For example, a
polynucleotide can be uniformly modified with 5-methyl-cytidine
(m.sup.5C), meaning that all cytosine residues in the mRNA sequence
are replaced with 5-methyl-cytidine (m.sup.5C). Similarly, a
polynucleotide can be uniformly modified for any type of nucleoside
residue present in the sequence by replacement with a modified
residue such as those set forth above.
[0779] Exemplary nucleobases and nucleosides having a modified
cytosine include N4-acetyl-cytidine (ac4C), 5-methyl-cytidine
(m5C), 5-halo-cytidine (e.g., 5-iodo-cytidine),
5-hydroxymethyl-cytidine (hm5C), 1-methyl-pseudoisocytidine,
2-thio-cytidine (s2C), and 2-thio-5-methyl-cytidine.
[0780] In some embodiments, a modified nucleobase is a modified
uridine. In some embodiments, a modified nucleobase is a modified
cytosine. Nucleosides having a modified uridine include 5-cyano
uridine, and 4'-thio uridine.
[0781] In some embodiments, a modified nucleobase is a modified
adenine. Exemplary nucleobases and nucleosides having a modified
adenine include 7-deaza-adenine, 1-methyl-adenosine (m1A),
2-methyl-adenine (m2A), and N6-methyl-adenosine (m6A).
[0782] In some embodiments, a modified nucleobase is a modified
guanine. Exemplary nucleobases and nucleosides having a modified
guanine include inosine (I), 1-methyl-inosine (m1I), wyosine (imG),
methylwyosine (mimG), 7-deaza-guanosine, 7-cyano-7-deaza-guanosine
(preQ0), 7-aminomethyl-7-deaza-guanosine (preQ1),
7-methyl-guanosine (m7G), 1-methyl-guanosine (m1G),
8-oxo-guanosine, 7-methyl-8-oxo-guanosine.
[0783] The polynucleotides of the present disclosure may be
partially or fully modified along the entire length of the
molecule. For example, one or more or all or a given type of
nucleotide (e.g., purine or pyrimidine, or any one or more or all
of A, G, U, C) may be uniformly modified in a polynucleotide of the
invention, or in a given predetermined sequence region thereof
(e.g., in the mRNA including or excluding the polyA tail). In some
embodiments, all nucleotides X in a polynucleotide of the present
disclosure (or in a given sequence region thereof) are modified
nucleotides, wherein X may any one of nucleotides A, G, U, C, or
any one of the combinations A+G, A+U, A+C, G+U, G+C, U+C, A+G+U,
A+G+C, G+U+C or A+G+C.
[0784] The polynucleotide may contain from about 1% to about 100%
modified nucleotides (either in relation to overall nucleotide
content, or in relation to one or more types of nucleotide, i.e.,
any one or more of A, G, U or C) or any intervening percentage
(e.g., from 1% to 20%, from 1% to 25%, from 1% to 50%, from 1% to
60%, from 1% to 70%, from 1% to 80%, from 1% to 90%, from 1% to
95%, from 10% to 20%, from 10% to 25%, from 10% to 50%, from 10% to
60%, from 10% to 70%, from 10% to 80%, from 10% to 90%, from 10% to
95%, from 10% to 100%, from 20% to 25%, from 20% to 50%, from 20%
to 60%, from 20% to 70%, from 20% to 80%, from 20% to 90%, from 20%
to 95%, from 20% to 100%, from 50% to 60%, from 50% to 70%, from
50% to 80%, from 50% to 90%, from 50% to 95%, from 50% to 100%,
from 70% to 80%, from 70% to 90%, from 70% to 95%, from 70% to
100%, from 80% to 90%, from 80% to 95%, from 80% to 100%, from 90%
to 95%, from 90% to 100%, and from 95% to 100%). Any remaining
percentage is accounted for by the presence of unmodified A, G, U,
or C.
[0785] The polynucleotides may contain at a minimum 1% and at
maximum 100% modified nucleotides, or any intervening percentage,
such as at least 5% modified nucleotides, at least 10% modified
nucleotides, at least 25% modified nucleotides, at least 50%
modified nucleotides, at least 80% modified nucleotides, or at
least 90% modified nucleotides. For example, the polynucleotides
may contain a modified pyrimidine such as a modified uracil or
cytosine. In some embodiments, at least 5%, at least 10%, at least
25%, at least 50%, at least 80%, at least 90% or 100% of the uracil
in the polynucleotide is replaced with a modified uracil (e.g., a
5-substituted uracil). The modified uracil can be replaced by a
compound having a single unique structure, or can be replaced by a
plurality of compounds having different structures (e.g., 2, 3, 4
or more unique structures). In some embodiments, at least 5%, at
least 10%, at least 25%, at least 50%, at least 80%, at least 90%
or 100% of the cytosine in the polynucleotide is replaced with a
modified cytosine (e.g., a 5-substituted cytosine). The modified
cytosine can be replaced by a compound having a single unique
structure, or can be replaced by a plurality of compounds having
different structures (e.g., 2, 3, 4 or more unique structures).
[0786] Thus, in some embodiments, the RNA (e.g., mRNA) vaccines
comprise a 5'UTR element, an optionally codon optimized open
reading frame, and a 3'UTR element, a poly(A) sequence and/or a
polyadenylation signal wherein the RNA is not chemically
modified.
[0787] In some embodiments, the modified nucleobase is a modified
uracil. Exemplary nucleobases and nucleosides having a modified
uracil include pseudouridine (.psi.), pyridin-4-one ribonucleoside,
5-aza-uridine, 6-aza-uridine, 2-thio-5-aza-uridine, 2-thio-uridine
(s.sup.2U), 4-thio-uridine (s.sup.4U), 4-thio-pseudouridine,
2-thio-pseudouridine, 5-hydroxy-uridine (ho.sup.5U),
5-aminoallyl-uridine, 5-halo-uridine (e.g., 5-iodo-uridine or
5-bromo-uridine), 3-methyl-uridine (m.sup.3U), 5-methoxy-uridine
(mo.sup.5U), uridine 5-oxyacetic acid (cmo.sup.5U), uridine
5-oxyacetic acid methyl ester (memo.sup.5U),
5-carboxymethyl-uridine (cm.sup.5U), 1-carboxymethyl-pseudouridine,
5-carboxyhydroxymethyl-uridine (chm.sup.5U),
5-carboxyhydroxymethyl-uridine methyl ester (mchm.sup.5U),
5-methoxycarbonylmethyl-uridine (mcm.sup.5U),
5-methoxycarbonylmethyl-2-thio-uridine (mcm.sup.5s.sup.2U),
5-aminomethyl-2-thio-uridine (nm.sup.5s.sup.2U),
5-methylaminomethyl-uridine (mnm.sup.5U),
5-methylaminomethyl-2-thio-uridine (mnm.sup.5s.sup.2U),
5-methylaminomethyl-2-seleno-uridine (mnm.sup.5se.sup.2U),
5-carbamoylmethyl-uridine (ncm.sup.5U),
5-carboxymethylaminomethyl-uridine (cmnm.sup.5U),
5-carboxymethylaminomethyl-2-thio-uridine (cmnm.sup.5s.sup.2U),
5-propynyl-uridine, 1-propynyl-pseudouridine,
5-taurinomethyl-uridine (.tau.m.sup.5U),
1-taurinomethyl-pseudouridine,
5-taurinomethyl-2-thio-uridine(.tau.m.sup.5s2U),
1-taurinomethyl-4-thio-pseudouridine, 5-methyl-uridine (m.sup.5U,
i.e., having the nucleobase deoxythymine), 1-methyl-pseudouridine
(m.sup.1.psi.), 5-methyl-2-thio-uridine (m.sup.5s.sup.2U),
1-methyl-4-thio-pseudouridine (m.sup.1s.sup.4.psi.),
4-thio-1-methyl-pseudouridine, 3-methyl-pseudouridine
(m.sup.3.psi.), 2-thio-1-methyl-pseudouridine,
1-methyl-1-deaza-pseudouridine,
2-thio-1-methyl-1-deaza-pseudouridine, dihydrouridine (D),
dihydropseudouridine, 5,6-dihydrouridine, 5-methyl-dihydrouridine
(m.sup.5D), 2-thio-dihydrouridine, 2-thio-dihydropseudouridine,
2-methoxy-uridine, 2-methoxy-4-thio-uridine,
4-methoxy-pseudouridine, 4-methoxy-2-thio-pseudouridine,
N1-methyl-pseudouridine, 3-(3-amino-3-carboxypropyl)uridine
(acp.sup.3U), 1-methyl-3-(3-amino-3-carboxypropyl)pseudouridine
(acp.sup.3W), 5-(isopentenylaminomethyl)uridine (inm.sup.5U),
5-(isopentenylaminomethyl)-2-thio-uridine (inm.sup.5s.sup.2U),
.alpha.-thio-uridine, 2'-O-methyl-uridine (Um),
5,2'-O-dimethyl-uridine (m.sup.5Um), 2'-O-methyl-pseudouridine
(Wm), 2-thio-2'-O-methyl-uridine (s.sup.2Um),
5-methoxycarbonylmethyl-2'-O-methyl-uridine (mcm.sup.5Um),
5-carbamoylmethyl-2'-O-methyl-uridine (ncm.sup.5Um),
5-carboxymethylaminomethyl-2'-O-methyl-uridine (cmnm.sup.5Um),
3,2'-O-dimethyl-uridine (m.sup.3Um), and
5-(isopentenylaminomethyl)-2'-O-methyl-uridine (inm.sup.5Um),
1-thio-uridine, deoxythymidine, 2'-F-ara-uridine, 2'-F-uridine,
2'-OH-ara-uridine, 5-(2-carbomethoxyvinyl) uridine, and
5-[3-(1-E-propenylamino)]uridine.
[0788] In some embodiments, the modified nucleobase is a modified
cytosine. Exemplary nucleobases and nucleosides having a modified
cytosine include 5-aza-cytidine, 6-aza-cytidine, pseudoisocytidine,
3-methyl-cytidine (m.sup.3C), N4-acetyl-cytidine (ac.sup.4C),
5-formyl-cytidine (f.sup.5C), N4-methyl-cytidine (m.sup.4C),
5-methyl-cytidine (m.sup.5C), 5-halo-cytidine (e.g.,
5-iodo-cytidine), 5-hydroxymethyl-cytidine (hm.sup.5C),
1-methyl-pseudoisocytidine, pyrrolo-cytidine,
pyrrolo-pseudoisocytidine, 2-thio-cytidine (s.sup.2C),
2-thio-5-methyl-cytidine, 4-thio-pseudoisocytidine,
4-thio-1-methyl-pseudoisocytidine,
4-thio-1-methyl-1-deaza-pseudoisocytidine,
1-methyl-1-deaza-pseudoisocytidine, zebularine, 5-aza-zebularine,
5-methyl-zebularine, 5-aza-2-thio-zebularine, 2-thio-zebularine,
2-methoxy-cytidine, 2-methoxy-5-methyl-cytidine,
4-methoxy-pseudoisocytidine, 4-methoxy-1-methyl-pseudoisocytidine,
lysidine (k.sub.2C), .alpha.-thio-cytidine, 2'-O-methyl-cytidine
(Cm), 5,2'-O-dimethyl-cytidine (m.sup.5Cm),
N4-acetyl-2'-O-methyl-cytidine (ac.sup.4Cm),
N4,2'-O-dimethyl-cytidine (m.sup.4Cm),
5-formyl-2'-O-methyl-cytidine (f.sup.5Cm),
N4,N4,2'-O-trimethyl-cytidine (m.sup.4.sub.2Cm), 1-thio-cytidine,
2'-F-ara-cytidine, 2'-F-cytidine, and 2'-OH-ara-cytidine.
[0789] In some embodiments, the modified nucleobase is a modified
adenine. Exemplary nucleobases and nucleosides having a modified
adenine include 2-amino-purine, 2, 6-diaminopurine,
2-amino-6-halo-purine (e.g., 2-amino-6-chloro-purine),
6-halo-purine (e.g., 6-chloro-purine), 2-amino-6-methyl-purine,
8-azido-adenosine, 7-deaza-adenine, 7-deaza-8-aza-adenine,
7-deaza-2-amino-purine, 7-deaza-8-aza-2-amino-purine,
7-deaza-2,6-diaminopurine, 7-deaza-8-aza-2,6-diaminopurine,
1-methyl-adenosine (m.sup.1A), 2-methyl-adenine (m.sup.2A),
N6-methyl-adenosine (m.sup.6A), 2-methylthio-N6-methyl-adenosine
(ms.sup.2m.sup.6A), N6-isopentenyl-adenosine (i.sup.6A),
2-methylthio-N6-isopentenyl-adenosine (ms.sup.2i.sup.6A),
N6-(cis-hydroxyisopentenyl)adenosine (io.sup.6A),
2-methylthio-N6-(cis-hydroxyisopentenyl)adenosine
(ms.sup.2io.sup.6A), N6-glycinylcarbamoyl-adenosine (g.sup.6A),
N6-threonylcarbamoyl-adenosine (t.sup.6A),
N6-methyl-N6-threonylcarbamoyl-adenosine (m.sup.6t.sup.6A),
2-methylthio-N6-threonylcarbamoyl-adenosine (ms.sup.2g.sup.6A),
N6,N6-dimethyl-adenosine (m.sup.6.sub.2A),
N6-hydroxynorvalylcarbamoyl-adenosine (hn.sup.6A),
2-methylthio-N6-hydroxynorvalylcarbamoyl-adenosine
(ms.sup.2hn.sup.6A), N6-acetyl-adenosine (ac.sup.6A),
7-methyl-adenine, 2-methylthio-adenine, 2-methoxy-adenine,
a-thio-adenosine, 2'-O-methyl-adenosine (Am),
N6,2'-O-dimethyl-adenosine (m.sup.6Am),
N6,N6,2'-O-trimethyl-adenosine (m.sup.6.sub.2Am),
1,2'-O-dimethyl-adenosine (m.sup.1Am), 2'-O-ribosyladenosine
(phosphate) (Ar(p)), 2-amino-N6-methyl-purine, 1-thio-adenosine,
8-azido-adenosine, 2'-F-ara-adenosine, 2'-F-adenosine,
2'-OH-ara-adenosine, and
N6-(19-amino-pentaoxanonadecyl)-adenosine.
[0790] In some embodiments, the modified nucleobase is a modified
guanine. Exemplary nucleobases and nucleosides having a modified
guanine include inosine (I), 1-methyl-inosine (m.sup.1I), wyosine
(imG), methylwyosine (mimG), 4-demethyl-wyosine (imG-14),
isowyosine (imG2), wybutosine (yW), peroxywybutosine (o.sub.2yW),
hydroxywybutosine (OhyW), undermodified hydroxywybutosine (OhyW*),
7-deaza-guanosine, queuosine (Q), epoxyqueuosine (oQ),
galactosyl-queuosine (galQ), mannosyl-queuosine (manQ),
7-cyano-7-deaza-guanosine (preQ.sub.0),
7-aminomethyl-7-deaza-guanosine (preQ.sub.1), archaeosine
(G.sup.+), 7-deaza-8-aza-guanosine, 6-thio-guanosine,
6-thio-7-deaza-guanosine, 6-thio-7-deaza-8-aza-guanosine,
7-methyl-guanosine (m.sup.7G), 6-thio-7-methyl-guanosine,
7-methyl-inosine, 6-methoxy-guanosine, 1-methyl-guanosine
(m.sup.1G), N2-methyl-guanosine (m.sup.2G),
N2,N2-dimethyl-guanosine (m.sup.2.sub.2G), N2,7-dimethyl-guanosine
(m.sup.2,7G), N2, N2,7-dimethyl-guanosine (m.sup.2,2,7G),
8-oxo-guanosine, 7-methyl-8-oxo-guanosine,
1-methyl-6-thio-guanosine, N2-methyl-6-thio-guanosine,
N2,N2-dimethyl-6-thio-guanosine, .alpha.-thio-guanosine,
2'-O-methyl-guanosine (Gm), N2-methyl-2'-O-methyl-guanosine
(m.sup.2Gm), N2,N2-dimethyl-2'-O-methyl-guanosine
(m.sup.2.sub.2Gm), 1-methyl-2'-O-methyl-guanosine (m.sup.1Gm),
N2,7-dimethyl-2'-O-methyl-guanosine (m.sup.2,7Gm),
2'-O-methyl-inosine (Im), 1,2'-O-dimethyl-inosine (m.sup.1Im),
2'-O-ribosylguanosine (phosphate) (Gr(p)), 1-thio-guanosine,
06-methyl-guanosine, 2'-F-ara-guanosine, and 2'-F-guanosine.
N-Linked Glycosylation Site Mutants
[0791] N-linked glycans of viral proteins play important roles in
modulating the immune response. Glycans can be important for
maintaining the appropriate antigenic conformations, shielding
potential neutralization epitopes, and may alter the proteolytic
susceptibility of proteins. Some viruses have putative N-linked
glycosylation sites. Deletion or modification of an N-linked
glycosylation site may enhance the immune response. Thus, the
present disclosure provides, in some embodiments, RNA (e.g., mRNA)
vaccines comprising nucleic acids (e.g., mRNA) encoding antigenic
polypeptides that comprise a deletion or modification at one or
more N-linked glycosylation sites.
In Vitro Transcription of RNA (e.g., mRNA)
[0792] Tropical disease vaccines of the present disclosure comprise
at least one RNA polynucleotide, such as a mRNA (e.g., modified
mRNA). mRNA, for example, is transcribed in vitro from template
DNA, referred to as an "in vitro transcription template." In some
embodiments, an in vitro transcription template encodes a 5'
untranslated (UTR) region, contains an open reading frame, and
encodes a 3' UTR and a polyA tail. The particular nucleic acid
sequence composition and length of an in vitro transcription
template will depend on the mRNA encoded by the template.
[0793] A "5' untranslated region" (5'UTR) refers to a region of an
mRNA that is directly upstream (i.e., 5') from the start codon
(i.e., the first codon of an mRNA transcript translated by a
ribosome) that does not encode a polypeptide.
[0794] A "3' untranslated region" (3'UTR) refers to a region of an
mRNA that is directly downstream (i.e., 3') from the stop codon
(i.e., the codon of an mRNA transcript that signals a termination
of translation) that does not encode a polypeptide.
[0795] An "open reading frame" is a continuous stretch of DNA
beginning with a start codon (e.g., methionine (ATG)), and ending
with a stop codon (e.g., TAA, TAG or TGA) and encodes a
polypeptide.
[0796] A "polyA tail" is a region of mRNA that is downstream, e.g.,
directly downstream (i.e., 3'), from the 3' UTR that contains
multiple, consecutive adenosine monophosphates. A polyA tail may
contain 10 to 300 adenosine monophosphates. For example, a polyA
tail may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120,
130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250,
260, 270, 280, 290 or 300 adenosine monophosphates. In some
embodiments, a polyA tail contains 50 to 250 adenosine
monophosphates. In a relevant biological setting (e.g., in cells,
in vivo) the poly(A) tail functions to protect mRNA from enzymatic
degradation, e.g., in the cytoplasm, and aids in transcription
termination, export of the mRNA from the nucleus and
translation.
[0797] In some embodiments, a polynucleotide includes 200 to 3,000
nucleotides. For example, a polynucleotide may include 200 to 500,
200 to 1000, 200 to 1500, 200 to 3000, 500 to 1000, 500 to 1500,
500 to 2000, 500 to 3000, 1000 to 1500, 1000 to 2000, 1000 to 3000,
1500 to 3000, or 2000 to 3000 nucleotides.
Flagellin Adjuvants
[0798] Flagellin is an approximately 500 amino acid monomeric
protein that polymerizes to form the flagella associated with
bacterial motion. Flagellin is expressed by a variety of
flagellated bacteria (Salmonella typhimurium for example) as well
as non-flagellated bacteria (such as Escherichia coli). Sensing of
flagellin by cells of the innate immune system (dendritic cells,
macrophages, etc.) is mediated by the Toll-like receptor 5 (TLR5)
as well as by Nod-like receptors (NLRs) Ipaf and Naip5. TLRs and
NLRs have been identified as playing a role in the activation of
innate immune response and adaptive immune response. As such,
flagellin provides an adjuvant effect in a vaccine.
[0799] The nucleotide and amino acid sequences encoding known
flagellin polypeptides are publicly available in the NCBI GenBank
database. The flagellin sequences from S. Typhimurium, H. Pylori,
V. Cholera, S. marcesens, S. flexneri, T. pallidum, L. pneumophila,
B. burgdorferei, C. difficile, R. meliloti, A. tumefaciens, R.
lupini, B. clarridgeiae, P. Mirabilis, B. subtilus, L.
monocytogenes, P. aeruginosa, and E. coli, among others are
known.
[0800] A flagellin polypeptide, as used herein, refers to a full
length flagellin protein, immunogenic fragments thereof, and
peptides having at least 50% sequence identity to a flagellin
protein or immunogenic fragments thereof. Exemplary flagellin
proteins include flagellin from Salmonella typhi (UniPro Entry
number: Q56086), Salmonella typhimurium (A0A0C9DG09), Salmonella
enteritidis (A0A0C9BAB7), and Salmonella choleraesuis (Q6V2X8), and
proteins having an amino acid sequence identified by any one of SEQ
ID NO: 420-422 (Table 66). In some embodiments, the flagellin
polypeptide has at least 60%, 70%, 75%, 80%, 90%, 95%, 97%, 98%, or
99% sequence identity to a flagellin protein or immunogenic
fragments thereof.
[0801] In some embodiments, the flagellin polypeptide is an
immunogenic fragment. An immunogenic fragment is a portion of a
flagellin protein that provokes an immune response. In some
embodiments, the immune response is a TLR5 immune response. An
example of an immunogenic fragment is a flagellin protein in which
all or a portion of a hinge region has been deleted or replaced
with other amino acids. For example, an antigenic polypeptide may
be inserted in the hinge region. Hinge regions are the
hypervariable regions of a flagellin. Hinge regions of a flagellin
are also referred to as "D3 domain or region," "propeller domain or
region," "hypervariable domain or region" and "variable domain or
region." "At least a portion of a hinge region," as used herein,
refers to any part of the hinge region of the flagellin, or the
entirety of the hinge region. In other embodiments an immunogenic
fragment of flagellin is a 20, 25, 30, 35, or 40 amino acid
C-terminal fragment of flagellin.
[0802] The flagellin monomer is formed by domains D0 through D3. D0
and D1, which form the stem, are composed of tandem long alpha
helices and are highly conserved among different bacteria. The D1
domain includes several stretches of amino acids that are useful
for TLR5 activation. The entire D1 domain or one or more of the
active regions within the domain are immunogenic fragments of
flagellin. Examples of immunogenic regions within the D1 domain
include residues 88-114 and residues 411-431 in Salmonella
typhimurium FliC flagellin. Within the 13 amino acids in the 88-100
region, at least 6 substitutions are permitted between Salmonella
flagellin and other flagellins that still preserve TLR5 activation.
Thus, immunogenic fragments of flagellin include flagellin like
sequences that activate TLR5 and contain a 13 amino acid motif that
is 53% or more identical to the Salmonella sequence in 88-100 of
FliC (LQRVRELAVQSAN; SEQ ID NO: 428).
[0803] In some embodiments, the RNA (e.g., mRNA) vaccine includes
an RNA that encodes a fusion protein of flagellin and one or more
antigenic polypeptides. A "fusion protein" as used herein, refers
to a linking of two components of the construct. In some
embodiments, a carboxy-terminus of the antigenic polypeptide is
fused or linked to an amino terminus of the flagellin polypeptide.
In other embodiments, an amino-terminus of the antigenic
polypeptide is fused or linked to a carboxy-terminus of the
flagellin polypeptide. The fusion protein may include, for example,
one, two, three, four, five, six or more flagellin polypeptides
linked to one, two, three, four, five, six or more antigenic
polypeptides. When two or more flagellin polypeptides and/or two or
more antigenic polypeptides are linked such a construct may be
referred to as a "multimer."
[0804] Each of the components of a fusion protein may be directly
linked to one another or they may be connected through a linker.
For instance, the linker may be an amino acid linker. The amino
acid linker encoded for by the RNA (e.g., mRNA) vaccine to link the
components of the fusion protein may include, for instance, at
least one member selected from the group consisting of a lysine
residue, a glutamic acid residue, a serine residue and an arginine
residue. In some embodiments the linker is 1-30, 1-25, 1-25, 5-10,
5, 15, or 5-20 amino acids in length.
[0805] In other embodiments the RNA (e.g., mRNA) vaccine includes
at least two separate RNA polynucleotides, one encoding one or more
antigenic polypeptides and the other encoding the flagellin
polypeptide. The at least two RNA polynucleotides may be
co-formulated in a carrier such as a lipid nanoparticle.
Broad Spectrum RNA (e.g., mRNA) Vaccines
[0806] There may be situations where persons are at risk for
infection with more than one strain of Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV. RNA (e.g., mRNA)
therapeutic vaccines are particularly amenable to combination
vaccination approaches due to a number of factors including, but
not limited to, speed of manufacture, ability to rapidly tailor
vaccines to accommodate perceived geographical threat, and the
like. Moreover, because the vaccines utilize the human body to
produce the antigenic protein, the vaccines are amenable to the
production of larger, more complex antigenic proteins, allowing for
proper folding, surface expression, antigen presentation, etc. in
the human subject. To protect against more than one strain of
Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV, a
combination vaccine can be administered that includes RNA (e.g.,
mRNA) encoding at least one antigenic polypeptide protein (or
antigenic portion thereof) of a first tropical disease virus or
organism and further includes RNA encoding at least one antigenic
polypeptide protein (or antigenic portion thereof) of a second
tropical disease virus or organism. RNA (e.g., mRNA) can be
co-formulated, for example, in a single lipid nanoparticle (LNP) or
can be formulated in separate LNPs for co-administration.
Methods of Treatment
[0807] Provided herein are compositions (e.g., pharmaceutical
compositions), methods, kits and reagents for prevention and/or
treatment of tropical diseases in humans and other mammals.
Tropical disease RNA (e.g. mRNA) vaccines can be used as
therapeutic or prophylactic agents, alone or in combination with
other vaccine(s). They may be used in medicine to prevent and/or
treat tropical disease. In exemplary aspects, the RNA (e.g., mRNA)
vaccines of the present disclosure are used to provide prophylactic
protection from Malaria (e.g., P. falciparum, P. vivax, P. malariae
and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV
and/or YFV. Prophylactic protection from Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV can be achieved following
administration of a RNA (e.g., mRNA) vaccine of the present
disclosure. Tropical disease RNA (e.g., mRNA) vaccines of the
present disclosure may be used to treat or prevent viral
"co-infections" containing two or more tropical disease infections.
Vaccines can be administered once, twice, three times, four times
or more, but it is likely sufficient to administer the vaccine once
(optionally followed by a single booster). It is possible, although
less desirable, to administer the vaccine to an infected individual
to achieve a therapeutic response. Dosing may need to be adjusted
accordingly.
[0808] A method of eliciting an immune response in a subject
against Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or
P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
is provided in aspects of the present disclosure. The method
involves administering to the subject a tropical disease RNA (e.g.,
mRNA) vaccine comprising at least one RNA (e.g., mRNA)
polynucleotide having an open reading frame encoding at least one
Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
antigenic polypeptide, thereby inducing in the subject an immune
response specific to Malaria (e.g., P. falciparum, P. vivax, P.
malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV,
ZIKV and/or YFV antigenic polypeptide or an immunogenic fragment
thereof, wherein anti-antigenic polypeptide antibody titer in the
subject is increased following vaccination relative to
anti-antigenic polypeptide antibody titer in a subject vaccinated
with a prophylactically effective dose of a traditional vaccine
against Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or
P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or
YFV. An "anti-antigenic polypeptide antibody" is a serum antibody
the binds specifically to the antigenic polypeptide.
[0809] In some embodiments, a RNA (e.g., mRNA) vaccine (e.g., a
Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
RNA vaccine) capable of eliciting an immune response is
administered intramuscularly or intranasally via a composition
including a compound according to Formula (I), (IA), (II), (IIa),
(IIb), (IIc), (IId) or (IIe) (e.g., Compound 3, 18, 20, 25, 26, 29,
30, 60, 108-112, or 122).
[0810] A prophylactically effective dose is a therapeutically
effective dose that prevents infection with the virus at a
clinically acceptable level. In some embodiments the
therapeutically effective dose is a dose listed in a package insert
for the vaccine. A traditional vaccine, as used herein, refers to a
vaccine other than the RNA (e.g., mRNA) vaccines of the present
disclosure. For instance, a traditional vaccine includes but is not
limited to live/attenuated microorganism vaccines,
killed/inactivated microorganism vaccines, subunit vaccines,
protein antigen vaccines, DNA vaccines, VLP vaccines, etc. In
exemplary embodiments, a traditional vaccine is a vaccine that has
achieved regulatory approval and/or is registered by a national
drug regulatory body, for example the Food and Drug Administration
(FDA) in the United States or the European Medicines Agency
(EMA).
[0811] In some embodiments the anti-antigenic polypeptide antibody
titer in the subject is increased 1 log to 10 log following
vaccination relative to anti-antigenic polypeptide antibody titer
in a subject vaccinated with a prophylactically effective dose of a
traditional vaccine against Malaria (e.g., P. falciparum, P. vivax,
P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV,
DENV, ZIKV and/or YFV.
[0812] In some embodiments the anti-antigenic polypeptide antibody
titer in the subject is increased 1 log, 2 log, 3 log, 5 log or 10
log following vaccination relative to anti-antigenic polypeptide
antibody titer in a subject vaccinated with a prophylactically
effective dose of a traditional vaccine against Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV.
[0813] A method of eliciting an immune response in a subject
against Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or
P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
is provided in other aspects of the disclosure. The method involves
administering to the subject a tropical disease RNA (e.g., mRNA)
vaccine comprising at least one RNA (e.g., mRNA) polynucleotide
having an open reading frame encoding at least one Malaria (e.g.,
P. falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV,
EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV antigenic
polypeptide or an immunogenic fragment thereof, thereby inducing in
the subject an immune response specific to Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV antigenic polypeptide or
an immunogenic fragment thereof, wherein the immune response in the
subject is equivalent to an immune response in a subject vaccinated
with a traditional vaccine against the Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV at 2 times to 100 times
the dosage level relative to the RNA (e.g., mRNA) vaccine.
[0814] In some embodiments, the immune response in the subject is
equivalent to an immune response in a subject vaccinated with a
traditional vaccine at 2, 3, 4, 5, 10, 50, 100 times the dosage
level relative to the Malaria (e.g., P. falciparum, P. vivax, P.
malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV,
ZIKV and/or YFV RNA (e.g., mRNA) vaccine.
[0815] In some embodiments the immune response in the subject is
equivalent to an immune response in a subject vaccinated with a
traditional vaccine at 10-100 times, or 100-1000 times, the dosage
level relative to the Malaria (e.g., P. falciparum, P. vivax, P.
malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV,
ZIKV and/or YFV RNA (e.g., mRNA) vaccine.
[0816] In some embodiments the immune response is assessed by
determining protein antibody titer in the subject.
[0817] Some embodiments provide a method of inducing an immune
response in a subject by administering to the subject a tropical
disease RNA (e.g., mRNA) vaccine comprising at least one RNA (e.g.,
mRNA) polynucleotide having an open reading frame encoding at least
one Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
antigenic polypeptide, thereby inducing in the subject an immune
response specific to the antigenic polypeptide or an immunogenic
fragment thereof, wherein the immune response in the subject is
induced 2 days to 10 weeks earlier relative to an immune response
induced in a subject vaccinated with a prophylactically effective
dose of a traditional vaccine against Malaria (e.g., P. falciparum,
P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV,
CHIKV, DENV, ZIKV and/or YFV. In some embodiments, the immune
response in the subject is induced in a subject vaccinated with a
prophylactically effective dose of a traditional vaccine at 2 times
to 100 times the dosage level relative to the RNA (e.g., mRNA)
vaccine.
[0818] In some embodiments the immune response in the subject is
equivalent to an immune response in a subject vaccinated with a
traditional vaccine at 2, 3, 4, 5, 10, 50, 100 times the dosage
level relative to the Malaria (e.g., P. falciparum, P. vivax, P.
malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV,
ZIKV and/or YFV RNA (e.g., mRNA) vaccine.
[0819] In some embodiments, the immune response in the subject is
induced 2 days earlier, or 3 days earlier, relative to an immune
response induced in a subject vaccinated with a prophylactically
effective dose of a traditional vaccine.
[0820] In some embodiments the immune response in the subject is
induced 1 week, 2 weeks, 3 weeks, 5 weeks, or 10 weeks earlier
relative to an immune response induced in a subject vaccinated with
a prophylactically effective dose of a traditional vaccine.
Therapeutic and Prophylactic Compositions
[0821] Provided herein are compositions (e.g., pharmaceutical
compositions), methods, kits and reagents for prevention, treatment
or diagnosis of Malaria (e.g., P. falciparum, P. vivax, P. malariae
and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV
and/or YFV in humans and other mammals, for example. Tropical
disease RNA (e.g. mRNA) vaccines can be used as therapeutic or
prophylactic agents. They may be used in medicine to prevent and/or
treat infectious disease. In some embodiments, the RNA (e.g., mRNA)
vaccines of the present disclosure are used fin the priming of
immune effector cells, for example, to activate peripheral blood
mononuclear cells (PBMCs) ex vivo, which are then infused
(re-infused) into a subject.
[0822] In some embodiments, tropical disease vaccine containing RNA
(e.g., mRNA) polynucleotides as described herein can be
administered to a subject (e.g., a mammalian subject, such as a
human subject), and the RNA (e.g., mRNA) polynucleotides are
translated in vivo to produce an antigenic polypeptide.
[0823] The tropical disease RNA (e.g., mRNA) vaccines may be
induced for translation of a polypeptide (e.g., antigen or
immunogen) in a cell, tissue or organism. In some embodiments, such
translation occurs in vivo, although such translation may occur ex
vivo, in culture or in vitro. In some embodiments, the cell, tissue
or organism is contacted with an effective amount of a composition
containing a tropical disease RNA (e.g., mRNA) vaccine that
contains a polynucleotide that has at least one a translatable
region encoding an antigenic polypeptide.
[0824] An "effective amount" of a tropical disease RNA (e.g. mRNA)
vaccine is provided based, at least in part, on the target tissue,
target cell type, means of administration, physical characteristics
of the polynucleotide (e.g., size, and extent of modified
nucleosides) and other components of the vaccine, and other
determinants. In general, an effective amount of the tropical
disease RNA (e.g., mRNA) vaccine composition provides an induced or
boosted immune response as a function of antigen production in the
cell, preferably more efficient than a composition containing a
corresponding unmodified polynucleotide encoding the same antigen
or a peptide antigen. Increased antigen production may be
demonstrated by increased cell transfection (the percentage of
cells transfected with the RNA, e.g., mRNA, vaccine), increased
protein translation from the polynucleotide, decreased nucleic acid
degradation (as demonstrated, for example, by increased duration of
protein translation from a modified polynucleotide), or altered
antigen specific immune response of the host cell.
[0825] In some embodiments, RNA (e.g. mRNA) vaccines (including
polynucleotides their encoded polypeptides) in accordance with the
present disclosure may be used for treatment of Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV.
[0826] Tropical disease RNA (e.g. mRNA) vaccines may be
administered prophylactically or therapeutically as part of an
active immunization scheme to healthy individuals or early in
infection during the incubation phase or during active infection
after onset of symptoms. In some embodiments, the amount of RNA
(e.g., mRNA) vaccine of the present disclosure provided to a cell,
a tissue or a subject may be an amount effective for immune
prophylaxis.
[0827] Tropical disease RNA (e.g. mRNA) vaccines may be
administrated with other prophylactic or therapeutic compounds. As
a non-limiting example, a prophylactic or therapeutic compound may
be an adjuvant or a booster. As used herein, when referring to a
prophylactic composition, such as a vaccine, the term "booster"
refers to an extra administration of the prophylactic (vaccine)
composition. A booster (or booster vaccine) may be given after an
earlier administration of the prophylactic composition. The time of
administration between the initial administration of the
prophylactic composition and the booster may be, but is not limited
to, 1 minute, 2 minutes, 3 minutes, 4 minutes, 5 minutes, 6
minutes, 7 minutes, 8 minutes, 9 minutes, 10 minutes, 15 minutes,
20 minutes 35 minutes, 40 minutes, 45 minutes, 50 minutes, 55
minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7
hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14
hours, 15 hours, 16 hours, 17 hours, 18 hours, 19 hours, 20 hours,
21 hours, 22 hours, 23 hours, 1 day, 36 hours, 2 days, 3 days, 4
days, 5 days, 6 days, 1 week, 10 days, 2 weeks, 3 weeks, 1 month, 2
months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months,
9 months, 10 months, 11 months, 1 year, 18 months, 2 years, 3
years, 4 years, 5 years, 6 years, 7 years, 8 years, 9 years, 10
years, 11 years, 12 years, 13 years, 14 years, 15 years, 16 years,
17 years, 18 years, 19 years, 20 years, 25 years, 30 years, 35
years, 40 years, 45 years, 50 years, 55 years, 60 years, 65 years,
70 years, 75 years, 80 years, 85 years, 90 years, 95 years or more
than 99 years. In some embodiments, the time of administration
between the initial administration of the prophylactic composition
and the booster may be, but is not limited to, 1 week, 2 weeks, 3
weeks, 1 month, 2 months, 3 months, 6 months or 1 year.
[0828] In some embodiments, tropical disease RNA (e.g. mRNA)
vaccines may be administered intramuscularly, intradermally, or
intranasally, similarly to the administration of inactivated
vaccines known in the art.
[0829] Tropical disease RNA (e.g. mRNA) vaccines may be utilized in
various settings depending on the prevalence of the infection or
the degree or level of unmet medical need. As a non-limiting
example, the RNA (e.g., mRNA) vaccines may be utilized to treat
and/or prevent a variety of tropical diseases. RNA (e.g., mRNA)
vaccines have superior properties in that they produce much larger
antibody titers and produce responses early than commercially
available anti-viral agents/compositions.
[0830] Provided herein are pharmaceutical compositions including
tropical disease RNA (e.g. mRNA) vaccines and RNA (e.g. mRNA)
vaccine compositions and/or complexes optionally in combination
with one or more pharmaceutically acceptable excipients.
[0831] Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or
P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
RNA (e.g. mRNA) vaccines may be formulated or administered alone or
in conjunction with one or more other components. For instance,
Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
RNA (e.g., mRNA) vaccines (vaccine compositions) may comprise other
components including, but not limited to, adjuvants.
[0832] In some embodiments, tropical disease (e.g. mRNA) vaccines
do not include an adjuvant (they are adjuvant free).
[0833] Tropical disease RNA (e.g. mRNA) vaccines may be formulated
or administered in combination with one or more
pharmaceutically-acceptable excipients. In some embodiments,
vaccine compositions comprise at least one additional active
substances, such as, for example, a therapeutically-active
substance, a prophylactically-active substance, or a combination of
both. Vaccine compositions may be sterile, pyrogen-free or both
sterile and pyrogen-free. General considerations in the formulation
and/or manufacture of pharmaceutical agents, such as vaccine
compositions, may be found, for example, in Remington: The Science
and Practice of Pharmacy 21st ed., Lippincott Williams &
Wilkins, 2005 (incorporated herein by reference in its
entirety).
[0834] In some embodiments, tropical disease RNA (e.g. mRNA)
vaccines are administered to humans, human patients or subjects.
For the purposes of the present disclosure, the phrase "active
ingredient" generally refers to the RNA (e.g., mRNA) vaccines or
the polynucleotides contained therein, for example, RNA
polynucleotides (e.g., mRNA polynucleotides) encoding antigenic
polypeptides.
[0835] Formulations of the tropical disease vaccine compositions
described herein may be prepared by any method known or hereafter
developed in the art of pharmacology. In general, such preparatory
methods include the step of bringing the active ingredient (e.g.,
mRNA polynucleotide) into association with an excipient and/or one
or more other accessory ingredients, and then, if necessary and/or
desirable, dividing, shaping and/or packaging the product into a
desired single- or multi-dose unit.
[0836] Relative amounts of the active ingredient, the
pharmaceutically acceptable excipient, and/or any additional
ingredients in a pharmaceutical composition in accordance with the
disclosure will vary, depending upon the identity, size, and/or
condition of the subject treated and further depending upon the
route by which the composition is to be administered. By way of
example, the composition may comprise between 0.1% and 100%, e.g.,
between 0.5 and 50%, between 1-30%, between 5-80%, at least 80%
(w/w) active ingredient.
[0837] Tropical disease RNA (e.g. mRNA) vaccines can be formulated
using one or more excipients to: increase stability; increase cell
transfection; permit the sustained or delayed release (e.g., from a
depot formulation); alter the biodistribution (e.g., target to
specific tissues or cell types); increase the translation of
encoded protein in vivo; and/or alter the release profile of
encoded protein (antigen) in vivo. In addition to traditional
excipients such as any and all solvents, dispersion media,
diluents, or other liquid vehicles, dispersion or suspension aids,
surface active agents, isotonic agents, thickening or emulsifying
agents, preservatives, excipients can include, without limitation,
lipidoids, liposomes, lipid nanoparticles, polymers, lipoplexes,
core-shell nanoparticles, peptides, proteins, cells transfected
with tropical disease RNA (e.g. mRNA) vaccines (e.g., for
transplantation into a subject), hyaluronidase, nanoparticle mimics
and combinations thereof.
Stabilizing Elements
[0838] Naturally-occurring eukaryotic mRNA molecules have been
found to contain stabilizing elements, including, but not limited
to untranslated regions (UTR) at their 5'-end (5'UTR) and/or at
their 3'-end (3'UTR), in addition to other structural features,
such as a 5'-cap structure or a 3'-poly(A) tail. Both the 5'UTR and
the 3'UTR are typically transcribed from the genomic DNA and are
elements of the premature mRNA. Characteristic structural features
of mature mRNA, such as the 5'-cap and the 3'-poly(A) tail are
usually added to the transcribed (premature) mRNA during mRNA
processing. The 3'-poly(A) tail is typically a stretch of adenine
nucleotides added to the 3'-end of the transcribed mRNA. It can
comprise up to about 400 adenine nucleotides. In some embodiments
the length of the 3'-poly(A) tail may be an essential element with
respect to the stability of the individual mRNA.
[0839] In some embodiments the RNA (e.g., mRNA) vaccine may include
one or more stabilizing elements. Stabilizing elements may include
for instance a histone stem-loop. A stem-loop binding protein
(SLBP), a 32 kDa protein has been identified. It is associated with
the histone stem-loop at the 3'-end of the histone messages in both
the nucleus and the cytoplasm. Its expression level is regulated by
the cell cycle; it peaks during the S-phase, when histone mRNA
levels are also elevated. The protein has been shown to be
essential for 10 efficient 3'-end processing of histone pre-mRNA by
the U7 snRNP. SLBP continues to be associated with the stem-loop
after processing, and then stimulates the translation of mature
histone mRNAs into histone proteins in the cytoplasm. The RNA
binding domain of SLBP is conserved through metazoa and protozoa;
its binding to the histone stem-loop depends on the structure of
the loop. The minimum binding site includes at least three
nucleotides 5' and two nucleotides 3' relative to the
stem-loop.
[0840] In some embodiments, the RNA (e.g., mRNA) vaccines include a
coding region, at least one histone stem-loop, and optionally, a
poly(A) sequence or polyadenylation signal. The poly(A) sequence or
polyadenylation signal generally should enhance the expression
level of the encoded protein. The encoded protein, in some
embodiments, is not a histone protein, a reporter protein (e.g.
Luciferase, GFP, EGFP, .beta.-Galactosidase, EGFP), or a marker or
selection protein (e.g. alpha-Globin, Galactokinase and
Xanthine:guanine phosphoribosyl transferase (GPT)).
[0841] In some embodiments, the combination of a poly(A) sequence
or polyadenylation signal and at least one histone stem-loop, even
though both represent alternative mechanisms in nature, acts
synergistically to increase the protein expression beyond the level
observed with either of the individual elements. It has been found
that the synergistic effect of the combination of poly(A) and at
least one histone stem-loop does not depend on the order of the
elements or the length of the poly(A) sequence.
[0842] In some embodiments, the RNA (e.g., mRNA) vaccine does not
comprise a histone downstream element (HDE). "Histone downstream
element" (HDE) includes a purine-rich polynucleotide stretch of
approximately 15 to 20 nucleotides 3' of naturally occurring
stem-loops, representing the binding site for the U7 snRNA, which
is involved in processing of histone pre-mRNA into mature histone
mRNA. Ideally, the inventive nucleic acid does not include an
intron.
[0843] In some embodiments, the RNA (e.g., mRNA) vaccine may or may
not contain an enhancer and/or promoter sequence, which may be
modified or unmodified or which may be activated or inactivated. In
some embodiments, the histone stem-loop is generally derived from
histone genes, and includes an intramolecular base pairing of two
neighbored partially or entirely reverse complementary sequences
separated by a spacer, including (e.g., consisting of) a short
sequence, which forms the loop of the structure. The unpaired loop
region is typically unable to base pair with either of the stem
loop elements. It occurs more often in RNA, as is a key component
of many RNA secondary structures, but may be present in
single-stranded DNA as well. Stability of the stem-loop structure
generally depends on the length, number of mismatches or bulges,
and base composition of the paired region. In some embodiments,
wobble base pairing (non-Watson-Crick base pairing) may result. In
some embodiments, the at least one histone stem-loop sequence
comprises a length of 15 to 45 nucleotides.
[0844] In other embodiments the RNA (e.g., mRNA) vaccine may have
one or more AU-rich sequences removed. These sequences, sometimes
referred to as AURES, are destabilizing sequences found in the
3'UTR. The AURES may be removed from the RNA (e.g., mRNA) vaccines.
Alternatively the AURES may remain in the RNA (e.g., mRNA)
vaccine.
Nanoparticle Formulations
[0845] In some embodiments, tropical disease RNA (e.g. mRNA)
vaccines are formulated in a nanoparticle. In some embodiments,
tropical disease RNA (e.g. mRNA) vaccines are formulated in a lipid
nanoparticle. In some embodiments, tropical disease RNA (e.g. mRNA)
vaccines are formulated in a lipid-polycation complex, referred to
as a cationic lipid nanoparticle. As a non-limiting example, the
polycation may include a cationic peptide or a polypeptide such as,
but not limited to, polylysine, polyornithine and/or polyarginine.
In some embodiments, tropical disease RNA (e.g., mRNA) vaccines are
formulated in a lipid nanoparticle that includes a non-cationic
lipid such as, but not limited to, cholesterol or dioleoyl
phosphatidylethanolamine (DOPE).
[0846] A lipid nanoparticle formulation may be influenced by, but
not limited to, the selection of the cationic lipid component, the
degree of cationic lipid saturation, the nature of the PEGylation,
ratio of all components and biophysical parameters such as size. In
one example by Semple et al. (Nature Biotech. 2010 28:172-176), the
lipid nanoparticle formulation is composed of 57.1% cationic lipid,
7.1% dipalmitoylphosphatidylcholine, 34.3% cholesterol, and 1.4%
PEG-c-DMA. As another example, changing the composition of the
cationic lipid can more effectively deliver siRNA to various
antigen presenting cells (Basha et al. Mol Ther. 2011
19:2186-2200).
[0847] In some embodiments, lipid nanoparticle formulations may
comprise 35 to 45% cationic lipid, 40% to 50% cationic lipid, 50%
to 60% cationic lipid and/or 55% to 65% cationic lipid. In some
embodiments, the ratio of lipid to RNA (e.g., mRNA) in lipid
nanoparticles may be 5:1 to 20:1, 10:1 to 25:1, 15:1 to 30:1 and/or
at least 30:1.
[0848] In some embodiments, the ratio of PEG in the lipid
nanoparticle formulations may be increased or decreased and/or the
carbon chain length of the PEG lipid may be modified from C14 to
C18 to alter the pharmacokinetics and/or biodistribution of the
lipid nanoparticle formulations. As a non-limiting example, lipid
nanoparticle formulations may contain 0.5% to 3.0%, 1.0% to 3.5%,
1.5% to 4.0%, 2.0% to 4.5%, 2.5% to 5.0% and/or 3.0% to 6.0% of the
lipid molar ratio of PEG-c-DOMG
(R-3-[(.omega.-methoxy-poly(ethyleneglycol)2000)carbamoyl)]-1,2-dimyristy-
loxypropyl-3-amine) (also referred to herein as PEG-DOMG) as
compared to the cationic lipid, DSPC and cholesterol. In some
embodiments, the PEG-c-DOMG may be replaced with a PEG lipid such
as, but not limited to, PEG-DSG (1,2-Distearoyl-sn-glycerol,
methoxypolyethylene glycol), PEG-DMG (1,2-Dimyristoyl-sn-glycerol)
and/or PEG-DPG (1,2-Dipalmitoyl-sn-glycerol, methoxypolyethylene
glycol). The cationic lipid may be selected from any lipid known in
the art such as, but not limited to, DLin-MC3-DMA, DLin-DMA,
C12-200 and DLin-KC2-DMA.
[0849] In some embodiments, a tropical disease RNA (e.g. mRNA)
vaccine formulation is a nanoparticle that comprises at least one
lipid. The lipid may be selected from, but is not limited to,
DLin-DMA, DLin-K-DMA, 98N12-5, C12-200, DLin-MC3-DMA, DLin-KC2-DMA,
DODMA, PLGA, PEG, PEG-DMG, PEGylated lipids and amino alcohol
lipids. In some embodiments, the lipid may be a cationic lipid such
as, but not limited to, DLin-DMA, DLin-D-DMA, DLin-MC3-DMA,
DLin-KC2-DMA, DODMA and amino alcohol lipids. The amino alcohol
cationic lipid may be the lipids described in and/or made by the
methods described in U.S. Patent Publication No. US20130150625,
herein incorporated by reference in its entirety. As a non-limiting
example, the cationic lipid may be
2-amino-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-2-{[(9Z,2Z)-octadeca-9,12-
-dien-1-yloxy]methyl}propan-1-ol (Compound 1 in US20130150625);
2-amino-3-[(9Z)-octadec-9-en-1-yloxy]-2-{[(9Z)-octadec-9-en-1-yloxy]methy-
l}propan-1-ol (Compound 2 in US20130150625);
2-amino-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-2-[(octyloxy)methyl]propa-
n-1-ol (Compound 3 in US20130150625); and
2-(dimethylamino)-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-2-{[(9Z,12Z)-oc-
tadeca-9,12-dien-1-yloxy]methyl}propan-1-ol (Compound 4 in
US20130150625); or any pharmaceutically acceptable salt or
stereoisomer thereof.
[0850] Lipid nanoparticle formulations typically comprise a lipid,
in particular, an ionizable cationic lipid, for example,
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), or
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), and
further comprise a neutral lipid, a sterol and a molecule capable
of reducing particle aggregation, for example a PEG or PEG-modified
lipid.
[0851] In some embodiments, a lipid nanoparticle formulation
consists essentially of (i) at least one lipid selected from the
group consisting of
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319); (ii) a
neutral lipid selected from DSPC, DPPC, POPC, DOPE and SM; (iii) a
sterol, e.g., cholesterol; and (iv) a PEG-lipid, e.g., PEG-DMG or
PEG-cDMA, in a molar ratio of 20-60% cationic lipid:5-25% neutral
lipid:25-55% sterol; 0.5-15% PEG-lipid.
[0852] In some embodiments, a lipid nanoparticle formulation
includes 25% to 75% on a molar basis of a cationic lipid selected
from 2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane
(DLin-KC2-DMA), dilinoleyl-methyl-4-dimethylaminobutyrate
(DLin-MC3-DMA), and di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), e.g.,
35% to 65%, 45% to 65%, 60%, 57.5%, 50% or 40% on a molar
basis.
[0853] In some embodiments, a lipid nanoparticle formulation
includes 0.5% to 15% on a molar basis of the neutral lipid, e.g.,
3% to 12%, 5% to 10% or 15%, 10%, or 7.5% on a molar basis.
Examples of neutral lipids include, without limitation, DSPC, POPC,
DPPC, DOPE and SM. In some embodiments, the formulation includes 5%
to 50% on a molar basis of the sterol (e.g., 15% to 45%, 20% to
40%, 40%, 38.5%, 35%, or 31% on a molar basis). A non-limiting
example of a sterol is cholesterol. In some embodiments, a lipid
nanoparticle formulation includes 0.5% to 20% on a molar basis of
the PEG or PEG-modified lipid (e.g., 0.5% to 10%, 0.5% to 5%, 1.5%,
0.5%, 1.5%, 3.5%, or 5% on a molar basis). In some embodiments, a
PEG or PEG modified lipid comprises a PEG molecule of an average
molecular weight of 2,000 Da. In some embodiments, a PEG or PEG
modified lipid comprises a PEG molecule of an average molecular
weight of less than 2,000, for example around 1,500 Da, around
1,000 Da, or around 500 Da. Non-limiting examples of PEG-modified
lipids include PEG-distearoyl glycerol (PEG-DMG) (also referred
herein as PEG-C14 or C14-PEG), PEG-cDMA (further discussed in Reyes
et al. J. Controlled Release, 107, 276-287 (2005) the contents of
which are herein incorporated by reference in their entirety).
[0854] In some embodiments, lipid nanoparticle formulations include
25-75% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), 0.5-15%
of the neutral lipid, 5-50% of the sterol, and 0.5-20% of the PEG
or PEG-modified lipid on a molar basis.
[0855] In some embodiments, lipid nanoparticle formulations include
35-65% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), 3-12%
of the neutral lipid, 15-45% of the sterol, and 0.5-10% of the PEG
or PEG-modified lipid on a molar basis.
[0856] In some embodiments, lipid nanoparticle formulations include
45-65% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), 5-10%
of the neutral lipid, 25-40% of the sterol, and 0.5-10% of the PEG
or PEG-modified lipid on a molar basis.
[0857] In some embodiments, lipid nanoparticle formulations include
60% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), 7.5% of
the neutral lipid, 31% of the sterol, and 1.5% of the PEG or
PEG-modified lipid on a molar basis.
[0858] In some embodiments, lipid nanoparticle formulations include
50% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), 10% of
the neutral lipid, 38.5% of the sterol, and 1.5% of the PEG or
PEG-modified lipid on a molar basis.
[0859] In some embodiments, lipid nanoparticle formulations include
50% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), 10% of
the neutral lipid, 35% of the sterol, 4.5% or 5% of the PEG or
PEG-modified lipid, and 0.5% of the targeting lipid on a molar
basis.
[0860] In some embodiments, lipid nanoparticle formulations include
40% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), 15% of
the neutral lipid, 40% of the sterol, and 5% of the PEG or
PEG-modified lipid on a molar basis.
[0861] In some embodiments, lipid nanoparticle formulations include
57.2% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), 7.1% of
the neutral lipid, 34.3% of the sterol, and 1.4% of the PEG or
PEG-modified lipid on a molar basis.
[0862] In some embodiments, lipid nanoparticle formulations include
57.5% of a cationic lipid selected from the PEG lipid is PEG-cDMA
(PEG-cDMA is further discussed in Reyes et al. (J. Controlled
Release, 107, 276-287 (2005), the contents of which are herein
incorporated by reference in their entirety), 7.5% of the neutral
lipid, 31.5% of the sterol, and 3.5% of the PEG or PEG-modified
lipid on a molar basis.
[0863] In some embodiments, lipid nanoparticle formulations consist
essentially of a lipid mixture in molar ratios of 20-70% cationic
lipid: 5-45% neutral lipid: 20-55% cholesterol: 0.5-15%
PEG-modified lipid. In some embodiments, lipid nanoparticle
formulations consist essentially of a lipid mixture in a molar
ratio of 20-60% cationic lipid:5-25% neutral lipid:25-55%
cholesterol:0.5-15% PEG-modified lipid.
[0864] In some embodiments, the molar lipid ratio is 50/10/38.5/1.5
(mol % cationic lipid/neutral lipid, e.g., DSPC/Chol/PEG-modified
lipid, e.g., PEG-DMG, PEG-DSG or PEG-DPG), 57.2/7.1134.3/1.4 (mol %
cationic lipid/neutral lipid, e.g., DPPC/Chol/PEG-modified lipid,
e.g., PEG-cDMA), 40/15/40/5 (mol % cationic lipid/neutral lipid,
e.g., DSPC/Chol/PEG-modified lipid, e.g., PEG-DMG),
50/10/35/4.5/0.5 (mol % cationic lipid/neutral lipid, e.g.,
DSPC/Chol/PEG-modified lipid, e.g., PEG-DSG), 50/10/35/5 (cationic
lipid/neutral lipid, e.g., DSPC/Chol/PEG-modified lipid, e.g.,
PEG-DMG), 40/10/40/10 (mol % cationic lipid/neutral lipid, e.g.,
DSPC/Chol/PEG-modified lipid, e.g., PEG-DMG or PEG-cDMA),
35/15/40/10 (mol % cationic lipid/neutral lipid, e.g.,
DSPC/Chol/PEG-modified lipid, e.g., PEG-DMG or PEG-cDMA) or
52/13/30/5 (mol % cationic lipid/neutral lipid, e.g.,
DSPC/Chol/PEG-modified lipid, e.g., PEG-DMG or PEG-cDMA).
[0865] Non-limiting examples of lipid nanoparticle compositions and
methods of making them are described, for example, in Semple et al.
(2010) Nat. Biotechnol. 28:172-176; Jayarama et al. (2012), Angew.
Chem. Int. Ed., 51: 8529-8533; and Maier et al. (2013) Molecular
Therapy 21, 1570-1578 (the contents of each of which are
incorporated herein by reference in their entirety).
[0866] In some embodiments, lipid nanoparticle formulations may
comprise a cationic lipid, a PEG lipid and a structural lipid and
optionally comprise a non-cationic lipid. As a non-limiting
example, a lipid nanoparticle may comprise 40-60% of cationic
lipid, 5-15% of a non-cationic lipid, 1-2% of a PEG lipid and
30-50% of a structural lipid. As another non-limiting example, the
lipid nanoparticle may comprise 50% cationic lipid, 10%
non-cationic lipid, 1.5% PEG lipid and 38.5% structural lipid. As
yet another non-limiting example, a lipid nanoparticle may comprise
55% cationic lipid, 10% non-cationic lipid, 2.5% PEG lipid and
32.5% structural lipid. In some embodiments, the cationic lipid may
be any cationic lipid described herein such as, but not limited to,
DLin-KC2-DMA, DLin-MC3-DMA and L319.
[0867] In some embodiments, the lipid nanoparticle formulations
described herein may be 4 component lipid nanoparticles. The lipid
nanoparticle may comprise a cationic lipid, a non-cationic lipid, a
PEG lipid and a structural lipid. As a non-limiting example, the
lipid nanoparticle may comprise 40-60% of cationic lipid, 5-15% of
a non-cationic lipid, 1-2% of a PEG lipid and 30-50% of a
structural lipid. As another non-limiting example, the lipid
nanoparticle may comprise 50% cationic lipid, 10% non-cationic
lipid, 1.5% PEG lipid and 38.5% structural lipid. As yet another
non-limiting example, the lipid nanoparticle may comprise 55%
cationic lipid, 10% non-cationic lipid, 2.5% PEG lipid and 32.5%
structural lipid. In some embodiments, the cationic lipid may be
any cationic lipid described herein such as, but not limited to,
DLin-KC2-DMA, DLin-MC3-DMA and L319.
[0868] In some embodiments, the lipid nanoparticle formulations
described herein may comprise a cationic lipid, a non-cationic
lipid, a PEG lipid and a structural lipid. As a non-limiting
example, the lipid nanoparticle comprises 50% of the cationic lipid
DLin-KC2-DMA, 10% of the non-cationic lipid DSPC, 1.5% of the PEG
lipid PEG-DOMG and 38.5% of the structural lipid cholesterol. As a
non-limiting example, the lipid nanoparticle comprises 50% of the
cationic lipid DLin-MC3-DMA, 10% of the non-cationic lipid DSPC,
1.5% of the PEG lipid PEG-DOMG and 38.5% of the structural lipid
cholesterol. As a non-limiting example, the lipid nanoparticle
comprises 50% of the cationic lipid DLin-MC3-DMA, 10% of the
non-cationic lipid DSPC, 1.5% of the PEG lipid PEG-DMG and 38.5% of
the structural lipid cholesterol. As yet another non-limiting
example, the lipid nanoparticle comprises 55% of the cationic lipid
L319, 10% of the non-cationic lipid DSPC, 2.5% of the PEG lipid
PEG-DMG and 32.5% of the structural lipid cholesterol.
[0869] Relative amounts of the active ingredient, the
pharmaceutically acceptable excipient, and/or any additional
ingredients in a vaccine composition may vary, depending upon the
identity, size, and/or condition of the subject being treated and
further depending upon the route by which the composition is to be
administered. For example, the composition may comprise between
0.1% and 99% (w/w) of the active ingredient. By way of example, the
composition may comprise between 0.1% and 100%, e.g., between 0.5%
and 50%, between 1-30%, between 5-80%, at least 80% (w/w) active
ingredient.
[0870] In some embodiments, the tropical disease RNA (e.g. mRNA)
vaccine composition may comprise the polynucleotide described
herein, formulated in a lipid nanoparticle comprising MC3,
Cholesterol, DSPC and PEG2000-DMG, the buffer trisodium citrate,
sucrose and water for injection. As a non-limiting example, the
composition comprises: 2.0 mg/mL of drug substance, 21.8 mg/mL of
MC3, 10.1 mg/mL of cholesterol, 5.4 mg/mL of DSPC, 2.7 mg/mL of
PEG2000-DMG, 5.16 mg/mL of trisodium citrate, 71 mg/mL of sucrose
and 1.0 mL of water for injection.
[0871] In some embodiments, a nanoparticle (e.g., a lipid
nanoparticle) has a mean diameter of 10-500 nm, 20-400 nm, 30-300
nm, or 40-200 nm. In some embodiments, a nanoparticle (e.g., a
lipid nanoparticle) has a mean diameter of 50-150 nm, 50-200 nm,
80-100 nm or 80-200 nm.
Liposomes, Lipoplexes, and Lipid Nanoparticles
[0872] The RNA (e.g., mRNA) vaccines of the disclosure can be
formulated using one or more liposomes, lipoplexes, or lipid
nanoparticles. In some embodiments, pharmaceutical compositions of
RNA (e.g., mRNA) vaccines include liposomes. Liposomes are
artificially-prepared vesicles which may primarily be composed of a
lipid bilayer and may be used as a delivery vehicle for the
administration of nutrients and pharmaceutical formulations.
Liposomes can be of different sizes such as, but not limited to, a
multilamellar vesicle (MLV) which may be hundreds of nanometers in
diameter and may contain a series of concentric bilayers separated
by narrow aqueous compartments, a small unicellular vesicle (SUV)
which may be smaller than 50 nm in diameter, and a large
unilamellar vesicle (LUV) which may be between 50 and 500 nm in
diameter. Liposome design may include, but is not limited to,
opsonins or ligands in order to improve the attachment of liposomes
to unhealthy tissue or to activate events such as, but not limited
to, endocytosis. Liposomes may contain a low or a high pH in order
to improve the delivery of the pharmaceutical formulations.
[0873] The formation of liposomes may depend on the physicochemical
characteristics such as, but not limited to, the pharmaceutical
formulation entrapped and the liposomal ingredients, the nature of
the medium in which the lipid vesicles are dispersed, the effective
concentration of the entrapped substance and its potential
toxicity, any additional processes involved during the application
and/or delivery of the vesicles, the optimization size,
polydispersity and the shelf-life of the vesicles for the intended
application, and the batch-to-batch reproducibility and possibility
of large-scale production of safe and efficient liposomal
products.
[0874] In some embodiments, pharmaceutical compositions described
herein may include, without limitation, liposomes such as those
formed from 1,2-dioleyloxy-N,N-dimethylaminopropane (DODMA)
liposomes, DiLa2 liposomes from Marina Biotech (Bothell, Wash.),
1,2-dilinoleyloxy-3-dimethylaminopropane (DLin-DMA),
2,2-dilinoleyl-4-(2-dimethylaminoethyl)-[1,3]-dioxolane
(DLin-KC2-DMA), and MC3 (US20100324120; herein incorporated by
reference in its entirety) and liposomes which may deliver small
molecule drugs such as, but not limited to, DOXIL.RTM. from Janssen
Biotech, Inc. (Horsham, Pa.).
[0875] In some embodiments, pharmaceutical compositions described
herein may include, without limitation, liposomes such as those
formed from the synthesis of stabilized plasmid-lipid particles
(SPLP) or stabilized nucleic acid lipid particle (SNALP) that have
been previously described and shown to be suitable for
oligonucleotide delivery in vitro and in vivo (see Wheeler et al.
Gene Therapy. 1999 6:271-281; Zhang et al. Gene Therapy. 1999
6:1438-1447; Jeffs et al. Pharm Res. 2005 22:362-372; Morrissey et
al., Nat Biotechnol. 2005 2:1002-1007; Zimmermann et al., Nature.
2006 441:111-114; Heyes et al. J Contr Rel. 2005 107:276-287;
Semple et al. Nature Biotech. 2010 28:172-176; Judge et al. J Clin
Invest. 2009 119:661-673; deFougerolles Hum Gene Ther. 2008
19:125-132; U.S. Patent Publication No US20130122104; all of which
are incorporated herein in their entireties). The original
manufacture method by Wheeler et al. was a detergent dialysis
method, which was later improved by Jeffs et al. and is referred to
as the spontaneous vesicle formation method. The liposome
formulations are composed of 3 to 4 lipid components in addition to
the polynucleotide. As an example a liposome can contain, but is
not limited to, 55% cholesterol, 20% disteroylphosphatidyl choline
(DSPC), 10% PEG-S-DSG, and 15%
1,2-dioleyloxy-N,N-dimethylaminopropane (DODMA), as described by
Jeffs et al. As another example, certain liposome formulations may
contain, but are not limited to, 48% cholesterol, 20% DSPC, 2%
PEG-c-DMA, and 30% cationic lipid, where the cationic lipid can be
1,2-distearloxy-N,N-dimethylaminopropane (DSDMA), DODMA, DLin-DMA,
or 1,2-dilinolenyloxy-3-dimethylaminopropane (DLenDMA), as
described by Heyes et al.
[0876] In some embodiments, liposome formulations may comprise from
about 25.0% cholesterol to about 40.0% cholesterol, from about
30.0% cholesterol to about 45.0% cholesterol, from about 35.0%
cholesterol to about 50.0% cholesterol and/or from about 48.5%
cholesterol to about 60% cholesterol. In some embodiments,
formulations may comprise a percentage of cholesterol selected from
the group consisting of 28.5%, 31.5%, 33.5%, 36.5%, 37.0%, 38.5%,
39.0% and 43.5%. In some embodiments, formulations may comprise
from about 5.0% to about 10.0% DSPC and/or from about 7.0% to about
15.0% DSPC.
[0877] In some embodiments, the RNA (e.g., mRNA) vaccine
pharmaceutical compositions may be formulated in liposomes such as,
but not limited to, DiLa2 liposomes (Marina Biotech, Bothell,
Wash.), SMARTICLES.RTM. (Marina Biotech, Bothell, Wash.), neutral
DOPC (1,2-dioleoyl-sn-glycero-3-phosphocholine) based liposomes
(e.g., siRNA delivery for ovarian cancer (Landen et al. Cancer
Biology & Therapy 2006 5(12)1708-1713); herein incorporated by
reference in its entirety) and hyaluronan-coated liposomes (Quiet
Therapeutics, Israel).
[0878] In some embodiments, the cationic lipid may be a low
molecular weight cationic lipid such as those described in U.S.
Patent Application No. 20130090372, the contents of which are
herein incorporated by reference in their entirety.
[0879] In some embodiments, the RNA (e.g., mRNA) vaccines may be
formulated in a lipid vesicle, which may have crosslinks between
functionalized lipid bilayers.
[0880] In some embodiments, the RNA (e.g., mRNA) vaccines may be
formulated in a lipid-polycation complex. The formation of the
lipid-polycation complex may be accomplished by methods known in
the art and/or as described in U.S. Pub. No. 20120178702, herein
incorporated by reference in its entirety. As a non-limiting
example, the polycation may include a cationic peptide or a
polypeptide such as, but not limited to, polylysine, polyornithine
and/or polyarginine. In some embodiments, the RNA (e.g., mRNA)
vaccines may be formulated in a lipid-polycation complex, which may
further include a non-cationic lipid such as, but not limited to,
cholesterol or dioleoyl phosphatidylethanolamine (DOPE).
[0881] In some embodiments, the ratio of PEG in the lipid
nanoparticle (LNP) formulations may be increased or decreased
and/or the carbon chain length of the PEG lipid may be modified
from C14 to C18 to alter the pharmacokinetics and/or
biodistribution of the LNP formulations. As a non-limiting example,
LNP formulations may contain from about 0.5% to about 3.0%, from
about 1.0% to about 3.5%, from about 1.5% to about 4.0%, from about
2.0% to about 4.5%, from about 2.5% to about 5.0% and/or from about
3.0% to about 6.0% of the lipid molar ratio of PEG-c-DOMG
(R-3-[(o-methoxy-poly(ethyleneglycol)2000)carbamoyl)]-1,2-dimyristyloxypr-
opyl-3-amine) (also referred to herein as PEG-DOMG) as compared to
the cationic lipid, DSPC and cholesterol. In some embodiments, the
PEG-c-DOMG may be replaced with a PEG lipid such as, but not
limited to, PEG-DSG (1,2-Distearoyl-sn-glycerol,
methoxypolyethylene glycol), PEG-DMG (1,2-Dimyristoyl-sn-glycerol)
and/or PEG-DPG (1,2-Dipalmitoyl-sn-glycerol, methoxypolyethylene
glycol). The cationic lipid may be selected from any lipid known in
the art such as, but not limited to, DLin-MC3-DMA, DLin-DMA,
C12-200 and DLin-KC2-DMA.
[0882] In some embodiments, the RNA (e.g., mRNA) vaccines may be
formulated in a lipid nanoparticle.
[0883] In some embodiments, the RNA (e.g., mRNA) vaccine
formulation comprising the polynucleotide is a nanoparticle which
may comprise at least one lipid. The lipid may be selected from,
but is not limited to, DLin-DMA, DLin-K-DMA, 98N12-5, C12-200,
DLin-MC3-DMA, DLin-KC2-DMA, DODMA, PLGA, PEG, PEG-DMG, PEGylated
lipids and amino alcohol lipids. In another aspect, the lipid may
be a cationic lipid such as, but not limited to, DLin-DMA,
DLin-D-DMA, DLin-MC3-DMA, DLin-KC2-DMA, DODMA and amino alcohol
lipids. The amino alcohol cationic lipid may be the lipids
described in and/or made by the methods described in U.S. Patent
Publication No. US20130150625, herein incorporated by reference in
its entirety. As a non-limiting example, the cationic lipid may be
2-amino-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-2-{[(9Z,2Z)-octadeca-9,12-
-dien-1-yloxy]methyl}propan-1-ol (Compound 1 in US20130150625);
2-amino-3-[(9Z)-octadec-9-en-1-yloxy]-2-{[(9Z)-octadec-9-en-1-yloxy]methy-
l}propan-1-ol (Compound 2 in US20130150625);
2-amino-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-2-[(octyloxy)methyl]propa-
n-1-ol (Compound 3 in US20130150625); and
2-(dimethylamino)-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-2-{[(9Z,12Z)-oc-
tadeca-9,12-dien-1-yloxy]methyl}propan-1-ol (Compound 4 in
US20130150625); or any pharmaceutically acceptable salt or
stereoisomer thereof.
[0884] Lipid nanoparticle formulations typically comprise a lipid,
in particular, an ionizable cationic lipid, for example,
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), or
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), and
further comprise a neutral lipid, a sterol and a molecule capable
of reducing particle aggregation, for example a PEG or PEG-modified
lipid.
[0885] In some embodiments, the lipid nanoparticle formulation
consists essentially of (i) at least one lipid selected from the
group consisting of
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319); (ii) a
neutral lipid selected from DSPC, DPPC, POPC, DOPE and SM; (iii) a
sterol, e.g., cholesterol; and (iv) a PEG-lipid, e.g., PEG-DMG or
PEG-cDMA, in a molar ratio of about 20-60% cationic lipid:5-25%
neutral lipid:25-55% sterol; 0.5-15% PEG-lipid.
[0886] In some embodiments, the formulation includes from about 25%
to about 75% on a molar basis of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), e.g.,
from about 35 to about 65%, from about 45 to about 65%, about 60%,
about 57.5%, about 50% or about 40% on a molar basis.
[0887] In some embodiments, the formulation includes from about
0.5% to about 15% on a molar basis of the neutral lipid e.g., from
about 3 to about 12%, from about 5 to about 10% or about 15%, about
10%, or about 7.5% on a molar basis. Examples of neutral lipids
include, but are not limited to, DSPC, POPC, DPPC, DOPE and SM. In
some embodiments, the formulation includes from about 5% to about
50% on a molar basis of the sterol (e.g., about 15 to about 45%,
about 20 to about 40%, about 40%, about 38.5%, about 35%, or about
31% on a molar basis. An exemplary sterol is cholesterol. In some
embodiments, the formulation includes from about 0.5% to about 20%
on a molar basis of the PEG or PEG-modified lipid (e.g., about 0.5
to about 10%, about 0.5 to about 5%, about 1.5%, about 0.5%, about
1.5%, about 3.5%, or about 5% on a molar basis). In some
embodiments, the PEG or PEG modified lipid comprises a PEG molecule
of an average molecular weight of 2,000 Da. In other embodiments,
the PEG or PEG modified lipid comprises a PEG molecule of an
average molecular weight of less than 2,000, for example around
1,500 Da, around 1,000 Da, or around 500 Da. Examples of
PEG-modified lipids include, but are not limited to, PEG-distearoyl
glycerol (PEG-DMG) (also referred herein as PEG-C14 or C14-PEG),
PEG-cDMA (further discussed in Reyes et al. J. Controlled Release,
107, 276-287 (2005) the contents of which are herein incorporated
by reference in their entirety)
[0888] In some embodiments, the formulations of the present
disclosure include 25-75% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), 0.5-15%
of the neutral lipid, 5-50% of the sterol, and 0.5-20% of the PEG
or PEG-modified lipid on a molar basis.
[0889] In some embodiments, the formulations of the present
disclosure include 35-65% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), 3-12%
of the neutral lipid, 15-45% of the sterol, and 0.5-10% of the PEG
or PEG-modified lipid on a molar basis.
[0890] In some embodiments, the formulations of the present
disclosure include 45-65% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), 5-10%
of the neutral lipid, 25-40% of the sterol, and 0.5-10% of the PEG
or PEG-modified lipid on a molar basis.
[0891] In some embodiments, the formulations of the present
disclosure include about 60% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), about
7.5% of the neutral lipid, about 31% of the sterol, and about 1.5%
of the PEG or PEG-modified lipid on a molar basis.
[0892] In some embodiments, the formulations of the present
disclosure include about 50% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), about
10% of the neutral lipid, about 38.5% of the sterol, and about 1.5%
of the PEG or PEG-modified lipid on a molar basis.
[0893] In some embodiments, the formulations of the present
disclosure include about 50% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), about
10% of the neutral lipid, about 35% of the sterol, about 4.5% or
about 5% of the PEG or PEG-modified lipid, and about 0.5% of the
targeting lipid on a molar basis.
[0894] In some embodiments, the formulations of the present
disclosure include about 40% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), about
15% of the neutral lipid, about 40% of the sterol, and about 5% of
the PEG or PEG-modified lipid on a molar basis.
[0895] In some embodiments, the formulations of the present
disclosure include about 57.2% of a cationic lipid selected from
2,2-dilinoleyl-4-dimethylaminoethyl-[1,3]-dioxolane (DLin-KC2-DMA),
dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and
di((Z)-non-2-en-1-yl)
9-((4-(dimethylamino)butanoyl)oxy)heptadecanedioate (L319), about
7.1% of the neutral lipid, about 34.3% of the sterol, and about
1.4% of the PEG or PEG-modified lipid on a molar basis.
[0896] In some embodiments, the formulations of the present
disclosure include about 57.5% of a cationic lipid selected from
the PEG lipid is PEG-cDMA (PEG-cDMA is further discussed in Reyes
et al. (J. Controlled Release, 107, 276-287 (2005), the contents of
which are herein incorporated by reference in their entirety),
about 7.5% of the neutral lipid, about 31.5% of the sterol, and
about 3.5% of the PEG or PEG-modified lipid on a molar basis.
[0897] In some embodiments, lipid nanoparticle formulation consists
essentially of a lipid mixture in molar ratios of about 20-70%
cationic lipid:5-45% neutral lipid:20-55% cholesterol:0.5-15%
PEG-modified lipid; more preferably in a molar ratio of about
20-60% cationic lipid:5-25% neutral lipid:25-55%
cholesterol:0.5-15% PEG-modified lipid.
[0898] In some embodiments, the molar lipid ratio is approximately
50/10/38.5/1.5 (mol % cationic lipid/neutral lipid, e.g.,
DSPC/Chol/PEG-modified lipid, e.g., PEG-DMG, PEG-DSG or PEG-DPG),
57.2/7.1134.3/1.4 (mol % cationic lipid/neutral lipid, e.g.,
DPPC/Chol/PEG-modified lipid, e.g., PEG-cDMA), 40/15/40/5 (mol %
cationic lipid/neutral lipid, e.g., DSPC/Chol/PEG-modified lipid,
e.g., PEG-DMG), 50/10/35/4.5/0.5 (mol % cationic lipid/neutral
lipid, e.g., DSPC/Chol/PEG-modified lipid, e.g., PEG-DSG),
50/10/35/5 (cationic lipid/neutral lipid, e.g.,
DSPC/Chol/PEG-modified lipid, e.g., PEG-DMG), 40/10/40/10 (mol %
cationic lipid/neutral lipid, e.g., DSPC/Chol/PEG-modified lipid,
e.g., PEG-DMG or PEG-cDMA), 35/15/40/10 (mol % cationic
lipid/neutral lipid, e.g., DSPC/Chol/PEG-modified lipid, e.g.,
PEG-DMG or PEG-cDMA) or 52/13/30/5 (mol % cationic lipid/neutral
lipid, e.g., DSPC/Chol/PEG-modified lipid, e.g., PEG-DMG or
PEG-cDMA).
[0899] Examples of lipid nanoparticle compositions and methods of
making same are described, for example, in Semple et al. (2010)
Nat. Biotechnol. 28:172-176; Jayarama et al. (2012), Angew. Chem.
Int. Ed., 51: 8529-8533; and Maier et al. (2013) Molecular Therapy
21, 1570-1578 (the contents of each of which are incorporated
herein by reference in their entirety).
[0900] In some embodiments, the LNP formulations of the RNA (e.g.,
mRNA) vaccines may contain PEG-c-DOMG at 3% lipid molar ratio. In
some embodiments, the LNP formulations of the RNA (e.g., mRNA)
vaccines may contain PEG-c-DOMG at 1.5% lipid molar ratio.
[0901] In some embodiments, the pharmaceutical compositions of the
RNA (e.g., mRNA) vaccines may include at least one of the PEGylated
lipids described in International Publication No. WO2012099755, the
contents of which are herein incorporated by reference in their
entirety.
[0902] In some embodiments, the LNP formulation may contain PEG-DMG
2000
(1,2-dimyristoyl-sn-glycero-3-phophoethanolamine-N-[methoxy(polyethylene
glycol)-2000). In some embodiments, the LNP formulation may contain
PEG-DMG 2000, a cationic lipid known in the art and at least one
other component. In some embodiments, the LNP formulation may
contain PEG-DMG 2000, a cationic lipid known in the art, DSPC and
cholesterol. As a non-limiting example, the LNP formulation may
contain PEG-DMG 2000, DLin-DMA, DSPC and cholesterol. As another
non-limiting example the LNP formulation may contain PEG-DMG 2000,
DLin-DMA, DSPC and cholesterol in a molar ratio of 2:40:10:48 (see
e.g., Geall et al., Nonviral delivery of self-amplifying RNA (e.g.,
mRNA) vaccines, PNAS 2012; PMID: 22908294, the contents of each of
which are herein incorporated by reference in their entirety).
[0903] The lipid nanoparticles described herein may be made in a
sterile environment.
[0904] In some embodiments, the LNP formulation may be formulated
in a nanoparticle such as a nucleic acid-lipid particle. As a
non-limiting example, the lipid particle may comprise one or more
active agents or therapeutic agents; one or more cationic lipids
comprising from about 50 mol % to about 85 mol % of the total lipid
present in the particle; one or more non-cationic lipids comprising
from about 13 mol % to about 49.5 mol % of the total lipid present
in the particle; and one or more conjugated lipids that inhibit
aggregation of particles comprising from about 0.5 mol % to about 2
mol % of the total lipid present in the particle.
[0905] The nanoparticle formulations may comprise a phosphate
conjugate. The phosphate conjugate may increase in vivo circulation
times and/or increase the targeted delivery of the nanoparticle. As
a non-limiting example, the phosphate conjugates may include a
compound of any one of the formulas described in International
Application No. WO2013033438, the contents of which are herein
incorporated by reference in its entirety.
[0906] The nanoparticle formulation may comprise a polymer
conjugate. The polymer conjugate may be a water-soluble conjugate.
The polymer conjugate may have a structure as described in U.S.
Patent Application No. 20130059360, the contents of which are
herein incorporated by reference in its entirety. In some
embodiments, polymer conjugates with the polynucleotides of the
present disclosure may be made using the methods and/or segmented
polymeric reagents described in U.S. Patent Application No.
20130072709, the contents of which are herein incorporated by
reference in its entirety. In some embodiments, the polymer
conjugate may have pendant side groups comprising ring moieties
such as, but not limited to, the polymer conjugates described in
U.S. Patent Publication No. US20130196948, the contents which are
herein incorporated by reference in its entirety.
[0907] The nanoparticle formulations may comprise a conjugate to
enhance the delivery of nanoparticles of the present disclosure in
a subject. Further, the conjugate may inhibit phagocytic clearance
of the nanoparticles in a subject. In one aspect, the conjugate may
be a "self" peptide designed from the human membrane protein CD47
(e.g., the "self" particles described by Rodriguez et al. (Science
2013 339, 971-975), herein incorporated by reference in its
entirety). As shown by Rodriguez et al., the self peptides delayed
macrophage-mediated clearance of nanoparticles which enhanced
delivery of the nanoparticles. In another aspect, the conjugate may
be the membrane protein CD47 (e.g., see Rodriguez et al. Science
2013 339, 971-975, herein incorporated by reference in its
entirety). Rodriguez et al. showed that, similarly to "self"
peptides, CD47 can increase the circulating particle ratio in a
subject as compared to scrambled peptides and PEG coated
nanoparticles.
[0908] In some embodiments, the RNA (e.g., mRNA) vaccines of the
present disclosure are formulated in nanoparticles which comprise a
conjugate to enhance the delivery of the nanoparticles of the
present disclosure in a subject. The conjugate may be the CD47
membrane or the conjugate may be derived from the CD47 membrane
protein, such as the "self" peptide described previously. In some
embodiments, the nanoparticle may comprise PEG and a conjugate of
CD47 or a derivative thereof. In some embodiments, the nanoparticle
may comprise both the "self" peptide described above and the
membrane protein CD47.
[0909] In some embodiments, a "self" peptide and/or CD47 protein
may be conjugated to a virus-like particle or pseudovirion, as
described herein for delivery of the RNA (e.g., mRNA) vaccines of
the present disclosure.
[0910] In some embodiments, RNA (e.g., mRNA) vaccine pharmaceutical
compositions comprising the polynucleotides of the present
disclosure and a conjugate that may have a degradable linkage.
Non-limiting examples of conjugates include an aromatic moiety
comprising an ionizable hydrogen atom, a spacer moiety, and a
water-soluble polymer. As a non-limiting example, pharmaceutical
compositions comprising a conjugate with a degradable linkage and
methods for delivering such pharmaceutical compositions are
described in U.S. Patent Publication No. US20130184443, the
contents of which are herein incorporated by reference in their
entirety.
[0911] The nanoparticle formulations may be a carbohydrate
nanoparticle comprising a carbohydrate carrier and a RNA (e.g.,
mRNA) vaccine. As a non-limiting example, the carbohydrate carrier
may include, but is not limited to, an anhydride-modified
phytoglycogen or glycogen-type material, phytoglycogen octenyl
succinate, phytoglycogen beta-dextrin, anhydride-modified
phytoglycogen beta-dextrin. (See e.g., International Publication
No. WO2012109121; the contents of which are herein incorporated by
reference in their entirety).
[0912] Nanoparticle formulations of the present disclosure may be
coated with a surfactant or polymer in order to improve the
delivery of the particle. In some embodiments, the nanoparticle may
be coated with a hydrophilic coating such as, but not limited to,
PEG coatings and/or coatings that have a neutral surface charge.
The hydrophilic coatings may help to deliver nanoparticles with
larger payloads such as, but not limited to, RNA (e.g., mRNA)
vaccines within the central nervous system. As a non-limiting
example nanoparticles comprising a hydrophilic coating and methods
of making such nanoparticles are described in U.S. Patent
Publication No. US20130183244, the contents of which are herein
incorporated by reference in their entirety.
[0913] In some embodiments, the lipid nanoparticles of the present
disclosure may be hydrophilic polymer particles. Non-limiting
examples of hydrophilic polymer particles and methods of making
hydrophilic polymer particles are described in U.S. Patent
Publication No. US20130210991, the contents of which are herein
incorporated by reference in their entirety.
[0914] In some embodiments, the lipid nanoparticles of the present
disclosure may be hydrophobic polymer particles.
[0915] Lipid nanoparticle formulations may be improved by replacing
the cationic lipid with a biodegradable cationic lipid which is
known as a rapidly eliminated lipid nanoparticle (reLNP). Ionizable
cationic lipids, such as, but not limited to, DLinDMA,
DLin-KC2-DMA, and DLin-MC3-DMA, have been shown to accumulate in
plasma and tissues over time and may be a potential source of
toxicity. The rapid metabolism of the rapidly eliminated lipids can
improve the tolerability and therapeutic index of the lipid
nanoparticles by an order of magnitude from a 1 mg/kg dose to a 10
mg/kg dose in rat. Inclusion of an enzymatically degraded ester
linkage can improve the degradation and metabolism profile of the
cationic component, while still maintaining the activity of the
reLNP formulation. The ester linkage can be internally located
within the lipid chain or it may be terminally located at the
terminal end of the lipid chain. The internal ester linkage may
replace any carbon in the lipid chain.
[0916] In some embodiments, the internal ester linkage may be
located on either side of the saturated carbon.
[0917] In some embodiments, an immune response may be elicited by
delivering a lipid nanoparticle which may include a nanospecies, a
polymer and an immunogen. (U.S. Publication No. 20120189700 and
International Publication No. WO2012099805; each of which is herein
incorporated by reference in their entirety). The polymer may
encapsulate the nanospecies or partially encapsulate the
nanospecies. The immunogen may be a recombinant protein, a modified
RNA and/or a polynucleotide described herein. In some embodiments,
the lipid nanoparticle may be formulated for use in a vaccine such
as, but not limited to, against a pathogen.
[0918] Lipid nanoparticles may be engineered to alter the surface
properties of particles so the lipid nanoparticles may penetrate
the mucosal barrier. Mucus is located on mucosal tissue such as,
but not limited to, oral (e.g., the buccal and esophageal membranes
and tonsil tissue), ophthalmic, gastrointestinal (e.g., stomach,
small intestine, large intestine, colon, rectum), nasal,
respiratory (e.g., nasal, pharyngeal, tracheal and bronchial
membranes), genital (e.g., vaginal, cervical and urethral
membranes). Nanoparticles larger than 10-200 nm which are preferred
for higher drug encapsulation efficiency and the ability to provide
the sustained delivery of a wide array of drugs have been thought
to be too large to rapidly diffuse through mucosal barriers. Mucus
is continuously secreted, shed, discarded or digested and recycled
so most of the trapped particles may be removed from the mucosa
tissue within seconds or within a few hours. Large polymeric
nanoparticles (200 nm-500 nm in diameter) which have been coated
densely with a low molecular weight polyethylene glycol (PEG)
diffused through mucus only 4- to 6-fold lower than the same
particles diffusing in water (Lai et al. PNAS 2007 104:1482-487;
Lai et al. Adv Drug Deliv Rev. 2009 61: 158-171; each of which is
herein incorporated by reference in its entirety). The transport of
nanoparticles may be determined using rates of permeation and/or
fluorescent microscopy techniques including, but not limited to,
fluorescence recovery after photobleaching (FRAP) and high
resolution multiple particle tracking (MPT). As a non-limiting
example, compositions which can penetrate a mucosal barrier may be
made as described in U.S. Pat. No. 8,241,670 or International
Patent Publication No. WO2013110028, the contents of each of which
are herein incorporated by reference in its entirety.
[0919] The lipid nanoparticle engineered to penetrate mucus may
comprise a polymeric material (i.e. a polymeric core) and/or a
polymer-vitamin conjugate and/or a tri-block co-polymer. The
polymeric material may include, but is not limited to, polyamines,
polyethers, polyamides, polyesters, polycarbamates, polyureas,
polycarbonates, poly(styrenes), polyimides, polysulfones,
polyurethanes, polyacetylenes, polyethylenes, polyethyeneimines,
polyisocyanates, polyacrylates, polymethacrylates,
polyacrylonitriles, and polyarylates. The polymeric material may be
biodegradable and/or biocompatible. Non-limiting examples of
biocompatible polymers are described in International Patent
Publication No. WO2013116804, the contents of which are herein
incorporated by reference in their entirety. The polymeric material
may additionally be irradiated. As a non-limiting example, the
polymeric material may be gamma irradiated (see e.g., International
App. No. WO201282165, herein incorporated by reference in its
entirety). Non-limiting examples of specific polymers include
poly(caprolactone) (PCL), ethylene vinyl acetate polymer (EVA),
poly(lactic acid) (PLA), poly(L-lactic acid) (PLLA), poly(glycolic
acid) (PGA), poly(lactic acid-co-glycolic acid) (PLGA),
poly(L-lactic acid-co-glycolic acid) (PLLGA), poly(D,L-lactide)
(PDLA), poly(L-lactide) (PLLA), poly(D,L-lactide-co-caprolactone),
poly(D,L-lactide-co-caprolactone-co-glycolide),
poly(D,L-lactide-co-PEO-co-D,L-lactide),
poly(D,L-lactide-co-PPO-co-D,L-lactide), polyalkyl cyanoacralate,
polyurethane, poly-L-lysine (PLL), hydroxypropyl methacrylate
(HPMA), polyethyleneglycol, poly-L-glutamic acid, poly(hydroxy
acids), polyanhydrides, polyorthoesters, poly(ester amides),
polyamides, poly(ester ethers), polycarbonates, polyalkylenes such
as polyethylene and polypropylene, polyalkylene glycols such as
poly(ethylene glycol) (PEG), polyalkylene oxides (PEO),
polyalkylene terephthalates such as poly(ethylene terephthalate),
polyvinyl alcohols (PVA), polyvinyl ethers, polyvinyl esters such
as poly(vinyl acetate), polyvinyl halides such as poly(vinyl
chloride) (PVC), polyvinylpyrrolidone, polysiloxanes, polystyrene
(PS), polyurethanes, derivatized celluloses such as alkyl
celluloses, hydroxyalkyl celluloses, cellulose ethers, cellulose
esters, nitro celluloses, hydroxypropylcellulose,
carboxymethylcellulose, polymers of acrylic acids, such as
poly(methyl(meth)acrylate) (PMMA), poly(ethyl(meth)acrylate),
poly(butyl(meth)acrylate), poly(isobutyl(meth)acrylate),
poly(hexyl(meth)acrylate), poly(isodecyl(meth)acrylate),
poly(lauryl(meth)acrylate), poly(phenyl(meth)acrylate), poly(methyl
acrylate), poly(isopropyl acrylate), poly(isobutyl acrylate),
poly(octadecyl acrylate) and copolymers and mixtures thereof,
polydioxanone and its copolymers, polyhydroxyalkanoates,
polypropylene fumarate, polyoxymethylene, poloxamers,
poly(ortho)esters, poly(butyric acid), poly(valeric acid),
poly(lactide-co-caprolactone), PEG-PLGA-PEG and trimethylene
carbonate, polyvinylpyrrolidone. The lipid nanoparticle may be
coated or associated with a co-polymer such as, but not limited to,
a block co-polymer (such as a branched polyether-polyamide block
copolymer described in International Publication No. WO2013012476,
herein incorporated by reference in its entirety), and
(poly(ethylene glycol))-(poly(propylene oxide))-(poly(ethylene
glycol)) triblock copolymer (see e.g., U.S. Publication 20120121718
and U.S. Publication 20100003337 and U.S. Pat. No. 8,263,665, the
contents of each of which is herein incorporated by reference in
their entirety). The co-polymer may be a polymer that is generally
regarded as safe (GRAS) and the formation of the lipid nanoparticle
may be in such a way that no new chemical entities are created. For
example, the lipid nanoparticle may comprise poloxamers coating
PLGA nanoparticles without forming new chemical entities which are
still able to rapidly penetrate human mucus (Yang et al. Angew.
Chem. Int. Ed. 2011 50:2597-2600; the contents of which are herein
incorporated by reference in their entirety). A non-limiting
scalable method to produce nanoparticles which can penetrate human
mucus is described by Xu et al. (see, e.g., J Control Release 2013,
170:279-86; the contents of which are herein incorporated by
reference in their entirety).
[0920] The vitamin of the polymer-vitamin conjugate may be vitamin
E. The vitamin portion of the conjugate may be substituted with
other suitable components such as, but not limited to, vitamin A,
vitamin E, other vitamins, cholesterol, a hydrophobic moiety, or a
hydrophobic component of other surfactants (e.g., sterol chains,
fatty acids, hydrocarbon chains and alkylene oxide chains).
[0921] The lipid nanoparticle engineered to penetrate mucus may
include surface altering agents such as, but not limited to,
polynucleotides, anionic proteins (e.g., bovine serum albumin),
surfactants (e.g., cationic surfactants such as for example
dimethyldioctadecyl-ammonium bromide), sugars or sugar derivatives
(e.g., cyclodextrin), nucleic acids, polymers (e.g., heparin,
polyethylene glycol and poloxamer), mucolytic agents (e.g.,
N-acetylcysteine, mugwort, bromelain, papain, clerodendrum,
acetylcysteine, bromhexine, carbocisteine, eprazinone, mesna,
ambroxol, sobrerol, domiodol, letosteine, stepronin, tiopronin,
gelsolin, thymosin 34 dornase alfa, neltenexine, erdosteine) and
various DNases including rhDNase. The surface altering agent may be
embedded or enmeshed in the particle's surface or disposed (e.g.,
by coating, adsorption, covalent linkage, or other process) on the
surface of the lipid nanoparticle. (see e.g., U.S. Publication
20100215580 and U.S. Publication 20080166414 and US20130164343; the
contents of each of which are herein incorporated by reference in
their entirety).
[0922] In some embodiments, the mucus penetrating lipid
nanoparticles may comprise at least one polynucleotide described
herein. The polynucleotide may be encapsulated in the lipid
nanoparticle and/or disposed on the surface of the particle. The
polynucleotide may be covalently coupled to the lipid nanoparticle.
Formulations of mucus penetrating lipid nanoparticles may comprise
a plurality of nanoparticles. Further, the formulations may contain
particles which may interact with the mucus and alter the
structural and/or adhesive properties of the surrounding mucus to
decrease mucoadhesion, which may increase the delivery of the mucus
penetrating lipid nanoparticles to the mucosal tissue.
[0923] In some embodiments, the mucus penetrating lipid
nanoparticles may be a hypotonic formulation comprising a mucosal
penetration enhancing coating. The formulation may be hypotonic for
the epithelium to which it is being delivered. Non-limiting
examples of hypotonic formulations may be found in International
Patent Publication No. WO2013110028, the contents of which are
herein incorporated by reference in their entirety.
[0924] In some embodiments, in order to enhance the delivery
through the mucosal barrier the RNA (e.g., mRNA) vaccine
formulation may comprise or be a hypotonic solution. Hypotonic
solutions were found to increase the rate at which mucoinert
particles such as, but not limited to, mucus-penetrating particles,
were able to reach the vaginal epithelial surface (see e.g., Ensign
et al. Biomaterials 2013 34(28):6922-9, the contents of which are
herein incorporated by reference in their entirety).
[0925] In some embodiments, the RNA (e.g., mRNA) vaccine is
formulated as a lipoplex, such as, without limitation, the
ATUPLEXTM.RTM. system, the DACC system, the DBTC system and other
siRNA-lipoplex technology from Silence Therapeutics (London, United
Kingdom), STEMFECT.TM. from STEMGENT.RTM. (Cambridge, Mass.), and
polyethylenimine (PEI) or protamine-based targeted and non-targeted
delivery of nucleic acids (Aleku et al. Cancer Res. 2008
68:9788-9798; Strumberg et al. Int J Clin Pharmacol Ther 2012
50:76-78; Santel et al., Gene Ther 2006 13:1222-1234; Santel et
al., Gene Ther 2006 13:1360-1370; Gutbier et al., Pulm Pharmacol.
Ther. 2010 23:334-344; Kaufmann et al. Microvasc Res 2010
80:286-293Weide et al. J Immunother. 2009 32:498-507; Weide et al.
J Immunother. 2008 31:180-188; Pascolo Expert Opin. Biol. Ther.
4:1285-1294; Fotin-Mleczek et al., 2011 J. Immunother. 34:1-15;
Song et al., Nature Biotechnol. 2005, 23:709-717; Peer et al., Proc
Natl Acad Sci USA. 2007 6; 104:4095-4100; deFougerolles Hum Gene
Ther. 2008 19:125-132, the contents of each of which are
incorporated herein by reference in their entirety).
[0926] In some embodiments, such formulations may also be
constructed or compositions altered such that they passively or
actively are directed to different cell types in vivo, including
but not limited to hepatocytes, immune cells, tumor cells,
endothelial cells, antigen presenting cells, and leukocytes (Akinc
et al. Mol Ther. 2010 18:1357-1364; Song et al., Nat Biotechnol.
2005 23:709-717; Judge et al., J Clin Invest. 2009 119:661-673;
Kaufmann et al., Microvasc Res 2010 80:286-293; Santel et al., Gene
Ther 2006 13:1222-1234; Santel et al., Gene Ther 2006 13:1360-1370;
Gutbier et al., Pulm Pharmacol. Ther. 2010 23:334-344; Basha et
al., Mol. Ther. 2011 19:2186-2200; Fenske and Cullis, Expert Opin
Drug Deliv. 2008 5:25-44; Peer et al., Science. 2008 319:627-630;
Peer and Lieberman, Gene Ther. 2011 18:1127-1133, the contents of
each of which are incorporated herein by reference in their
entirety). One example of passive targeting of formulations to
liver cells includes the DLin-DMA, DLin-KC2-DMA and
DLin-MC3-DMA-based lipid nanoparticle formulations, which have been
shown to bind to apolipoprotein E and promote binding and uptake of
these formulations into hepatocytes in vivo (Akinc et al. Mol Ther.
2010 18:1357-1364, the contents of which are incorporated herein by
reference in their entirety). Formulations can also be selectively
targeted through expression of different ligands on their surface
as exemplified by, but not limited by, folate, transferrin,
N-acetylgalactosamine (GalNAc), and antibody targeted approaches
(Kolhatkar et al., Curr Drug Discov Technol. 2011 8:197-206;
Musacchio and Torchilin, Front Biosci. 2011 16:1388-1412; Yu et
al., Mol Membr Biol. 2010 27:286-298; Patil et al., Crit Rev Ther
Drug Carrier Syst. 2008 25:1-61; Benoit et al., Biomacromolecules.
2011 12:2708-2714; Zhao et al., Expert Opin Drug Deliv. 2008
5:309-319; Akinc et al., Mol Ther. 2010 18:1357-1364; Srinivasan et
al., Methods Mol Biol. 2012 820:105-116; Ben-Arie et al., Methods
Mol Biol. 2012 757:497-507; Peer 2010 J Control Release. 20:63-68;
Peer et al., Proc Natl Acad Sci USA. 2007 104:4095-4100; Kim et
al., Methods Mol Biol. 2011 721:339-353; Subramanya et al., Mol
Ther. 2010 18:2028-2037; Song et al., Nat Biotechnol. 2005
23:709-717; Peer et al., Science. 2008 319:627-630; Peer and
Lieberman, Gene Ther. 2011 18:1127-1133, the contents of each of
which are incorporated herein by reference in their entirety).
[0927] In some embodiments, the RNA (e.g., mRNA) vaccine is
formulated as a solid lipid nanoparticle. A solid lipid
nanoparticle (SLN) may be spherical with an average diameter
between 10 to 1000 nm. SLNs possess a solid lipid core matrix that
can solubilize lipophilic molecules and may be stabilized with
surfactants and/or emulsifiers. In some embodiments, the lipid
nanoparticle may be a self-assembly lipid-polymer nanoparticle (see
Zhang et al., ACS Nano, 2008, 2, pp 1696-1702; the contents of
which are herein incorporated by reference in their entirety). As a
non-limiting example, the SLN may be the SLN described in
International Patent Publication No. WO2013105101, the contents of
which are herein incorporated by reference in their entirety. As
another non-limiting example, the SLN may be made by the methods or
processes described in International Patent Publication No.
WO2013105101, the contents of which are herein incorporated by
reference in their entirety.
[0928] Liposomes, lipoplexes, or lipid nanoparticles may be used to
improve the efficacy of polynucleotides directed protein production
as these formulations may be able to increase cell transfection by
the RNA (e.g., mRNA) vaccine; and/or increase the translation of
encoded protein. One such example involves the use of lipid
encapsulation to enable the effective systemic delivery of polyplex
plasmid DNA (Heyes et al., Mol Ther. 2007 15:713-720; the contents
of which are incorporated herein by reference in their entirety).
The liposomes, lipoplexes, or lipid nanoparticles may also be used
to increase the stability of the polynucleotide.
[0929] In some embodiments, the RNA (e.g., mRNA) vaccines of the
present disclosure can be formulated for controlled release and/or
targeted delivery. As used herein, "controlled release" refers to a
pharmaceutical composition or compound release profile that
conforms to a particular pattern of release to effect a therapeutic
outcome. In some embodiments, the RNA (e.g., mRNA) vaccines may be
encapsulated into a delivery agent described herein and/or known in
the art for controlled release and/or targeted delivery. As used
herein, the term "encapsulate" means to enclose, surround or
encase. As it relates to the formulation of the compounds of the
disclosure, encapsulation may be substantial, complete or partial.
The term "substantially encapsulated" means that at least greater
than 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99, 99.9, 99.99 or
greater than 99.999% of the pharmaceutical composition or compound
of the disclosure may be enclosed, surrounded or encased within the
delivery agent. "Partially encapsulation" means that less than 10,
10, 20, 30, 40, 50% or less of the pharmaceutical composition or
compound of the disclosure may be enclosed, surrounded or encased
within the delivery agent. Advantageously, encapsulation may be
determined by measuring the escape or the activity of the
pharmaceutical composition or compound of the disclosure using
fluorescence and/or electron micrograph. For example, at least 1,
5, 10, 20, 30, 40, 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99,
99.9, 99.99 or greater than 99.999% of the pharmaceutical
composition or compound of the disclosure are encapsulated in the
delivery agent.
[0930] In some embodiments, the controlled release formulation may
include, but is not limited to, tri-block co-polymers. As a
non-limiting example, the formulation may include two different
types of tri-block co-polymers (International Pub. No. WO2012131104
and WO2012131106, the contents of each of which are incorporated
herein by reference in their entirety).
[0931] In some embodiments, the RNA (e.g., mRNA) vaccines may be
encapsulated into a lipid nanoparticle or a rapidly eliminated
lipid nanoparticle and the lipid nanoparticles or a rapidly
eliminated lipid nanoparticle may then be encapsulated into a
polymer, hydrogel and/or surgical sealant described herein and/or
known in the art. As a non-limiting example, the polymer, hydrogel
or surgical sealant may be PLGA, ethylene vinyl acetate (EVAc),
poloxamer, GELSITE.RTM. (Nanotherapeutics, Inc. Alachua, Fla.),
HYLENEX.RTM. (Halozyme Therapeutics, San Diego Calif.), surgical
sealants such as fibrinogen polymers (Ethicon Inc. Cornelia, Ga.),
TISSELL.RTM. (Baxter International, Inc Deerfield, Ill.), PEG-based
sealants, and COSEAL.RTM. (Baxter International, Inc Deerfield,
Ill.).
[0932] In some embodiments, the lipid nanoparticle may be
encapsulated into any polymer known in the art which may form a gel
when injected into a subject. As another non-limiting example, the
lipid nanoparticle may be encapsulated into a polymer matrix which
may be biodegradable.
[0933] In some embodiments, the RNA (e.g., mRNA) vaccine
formulation for controlled release and/or targeted delivery may
also include at least one controlled release coating. Controlled
release coatings include, but are not limited to, OPADRY.RTM.,
polyvinylpyrrolidone/vinyl acetate copolymer, polyvinylpyrrolidone,
hydroxypropyl methylcellulose, hydroxypropyl cellulose,
hydroxyethyl cellulose, EUDRAGIT RL.RTM., EUDRAGIT RS.RTM. and
cellulose derivatives such as ethylcellulose aqueous dispersions
(AQUACOAT.RTM. and SURELEASE.RTM.).
[0934] In some embodiments, the RNA (e.g., mRNA) vaccine controlled
release and/or targeted delivery formulation may comprise at least
one degradable polyester which may contain polycationic side
chains. Degradeable polyesters include, but are not limited to,
poly(serine ester), poly(L-lactide-co-L-lysine),
poly(4-hydroxy-L-proline ester), and combinations thereof. In some
embodiments, the degradable polyesters may include a PEG
conjugation to form a PEGylated polymer.
[0935] In some embodiments, the RNA (e.g., mRNA) vaccine controlled
release and/or targeted delivery formulation comprising at least
one polynucleotide may comprise at least one PEG and/or PEG related
polymer derivatives as described in U.S. Pat. No. 8,404,222, the
contents of which are incorporated herein by reference in their
entirety.
[0936] In some embodiments, the RNA (e.g., mRNA) vaccine controlled
release delivery formulation comprising at least one polynucleotide
may be the controlled release polymer system described in
US20130130348, the contents of which are incorporated herein by
reference in their entirety.
[0937] In some embodiments, the RNA (e.g., mRNA) vaccines of the
present disclosure may be encapsulated in a therapeutic
nanoparticle, referred to herein as "therapeutic nanoparticle RNA
(e.g., mRNA) vaccines." Therapeutic nanoparticles may be formulated
by methods described herein and known in the art such as, but not
limited to, International Pub Nos. WO2010005740, WO2010030763,
WO2010005721, WO2010005723, WO2012054923, U.S. Publication Nos.
US20110262491, US20100104645, US20100087337, US20100068285,
US20110274759, US20100068286, US20120288541, US20130123351 and
US20130230567 and U.S. Pat. Nos. 8,206,747, 8,293,276, 8,318,208
and 8,318,211; the contents of each of which are herein
incorporated by reference in their entirety. In some embodiments,
therapeutic polymer nanoparticles may be identified by the methods
described in US Pub No. US20120140790, the contents of which are
herein incorporated by reference in their entirety.
[0938] In some embodiments, the therapeutic nanoparticle RNA (e.g.,
mRNA) vaccine may be formulated for sustained release. As used
herein, "sustained release" refers to a pharmaceutical composition
or compound that conforms to a release rate over a specific period
of time. The period of time may include, but is not limited to,
hours, days, weeks, months and years. As a non-limiting example,
the sustained release nanoparticle may comprise a polymer and a
therapeutic agent such as, but not limited to, the polynucleotides
of the present disclosure (see International Pub No. 2010075072 and
US Pub No. US20100216804, US20110217377 and US20120201859, the
contents of each of which are incorporated herein by reference in
their entirety). In another non-limiting example, the sustained
release formulation may comprise agents which permit persistent
bioavailability such as, but not limited to, crystals,
macromolecular gels and/or particulate suspensions (see U.S. Patent
Publication No. US20130150295, the contents of each of which are
incorporated herein by reference in their entirety).
[0939] In some embodiments, the therapeutic nanoparticle RNA (e.g.,
mRNA) vaccines may be formulated to be target specific. As a
non-limiting example, the therapeutic nanoparticles may include a
corticosteroid (see International Pub. No. WO2011084518, the
contents of which are incorporated herein by reference in their
entirety). As a non-limiting example, the therapeutic nanoparticles
may be formulated in nanoparticles described in International Pub
No. WO2008121949, WO2010005726, WO2010005725, WO2011084521 and US
Pub No. US20100069426, US20120004293 and US20100104655, the
contents of each of which are incorporated herein by reference in
their entirety.
[0940] In some embodiments, the nanoparticles of the present
disclosure may comprise a polymeric matrix. As a non-limiting
example, the nanoparticle may comprise two or more polymers such
as, but not limited to, polyethylenes, polycarbonates,
polyanhydrides, polyhydroxyacids, polypropylfumerates,
polycaprolactones, polyamides, polyacetals, polyethers, polyesters,
poly(orthoesters), polycyanoacrylates, polyvinyl alcohols,
polyurethanes, polyphosphazenes, polyacrylates, polymethacrylates,
polycyanoacrylates, polyureas, polystyrenes, polyamines,
polylysine, poly(ethylene imine), poly(serine ester),
poly(L-lactide-co-L-lysine), poly(4-hydroxy-L-proline ester) or
combinations thereof.
[0941] In some embodiments, the therapeutic nanoparticle comprises
a diblock copolymer. In some embodiments, the diblock copolymer may
include PEG in combination with a polymer such as, but not limited
to, polyethylenes, polycarbonates, polyanhydrides,
polyhydroxyacids, polypropylfumerates, polycaprolactones,
polyamides, polyacetals, polyethers, polyesters, poly(orthoesters),
polycyanoacrylates, polyvinyl alcohols, polyurethanes,
polyphosphazenes, polyacrylates, polymethacrylates,
polycyanoacrylates, polyureas, polystyrenes, polyamines,
polylysine, poly(ethylene imine), poly(serine ester),
poly(L-lactide-co-L-lysine), poly(4-hydroxy-L-proline ester) or
combinations thereof. In yet another embodiment, the diblock
copolymer may be a high-X diblock copolymer such as those described
in International Patent Publication No. WO2013120052, the contents
of which are incorporated herein by reference in their
entirety.
[0942] As a non-limiting example the therapeutic nanoparticle
comprises a PLGA-PEG block copolymer (see U.S. Publication No.
US20120004293 and U.S. Pat. No. 8,236,330, each of which is herein
incorporated by reference in their entirety). In another
non-limiting example, the therapeutic nanoparticle is a stealth
nanoparticle comprising a diblock copolymer of PEG and PLA or PEG
and PLGA (see U.S. Pat. No. 8,246,968 and International Publication
No. WO2012166923, the contents of each of which are herein
incorporated by reference in their entirety). In yet another
non-limiting example, the therapeutic nanoparticle is a stealth
nanoparticle or a target-specific stealth nanoparticle as described
in U.S. Patent Publication No. US20130172406, the contents of which
are herein incorporated by reference in their entirety.
[0943] In some embodiments, the therapeutic nanoparticle may
comprise a multiblock copolymer (see e.g., U.S. Pat. Nos. 8,263,665
and 8,287,910 and U.S. Patent Pub. No. US20130195987, the contents
of each of which are herein incorporated by reference in their
entirety).
[0944] In yet another non-limiting example, the lipid nanoparticle
comprises the block copolymer PEG-PLGA-PEG (see e.g., the
thermosensitive hydrogel (PEG-PLGA-PEG) was used as a TGF-beta1
gene delivery vehicle in Lee et al. Thermosensitive Hydrogel as a
TGF-.beta.1 Gene Delivery Vehicle Enhances Diabetic Wound Healing.
Pharmaceutical Research, 2003 20(12): 1995-2000; as a controlled
gene delivery system in Li et al. Controlled Gene Delivery System
Based on Thermosensitive Biodegradable Hydrogel. Pharmaceutical
Research 2003 20:884-888; and Chang et al., Non-ionic amphiphilic
biodegradable PEG-PLGA-PEG copolymer enhances gene delivery
efficiency in rat skeletal muscle. J Controlled Release. 2007
118:245-253, the contents of each of which are herein incorporated
by reference in their entirety). The RNA (e.g., mRNA) vaccines of
the present disclosure may be formulated in lipid nanoparticles
comprising the PEG-PLGA-PEG block copolymer.
[0945] In some embodiments, the therapeutic nanoparticle may
comprise a multiblock copolymer (see e.g., U.S. Pat. Nos. 8,263,665
and 8,287,910 and U.S. Patent Pub. No. US20130195987, the contents
of each of which are herein incorporated by reference in their
entirety).
[0946] In some embodiments, the block copolymers described herein
may be included in a polyion complex comprising a non-polymeric
micelle and the block copolymer. (see e.g., U.S. Publication No.
20120076836, the contents of which are herein incorporated by
reference in their entirety).
[0947] In some embodiments, the therapeutic nanoparticle may
comprise at least one acrylic polymer. Acrylic polymers include but
are not limited to, acrylic acid, methacrylic acid, acrylic acid
and methacrylic acid copolymers, methyl methacrylate copolymers,
ethoxyethyl methacrylates, cyanoethyl methacrylate, amino alkyl
methacrylate copolymer, poly(acrylic acid), poly(methacrylic acid),
polycyanoacrylates and combinations thereof.
[0948] In some embodiments, the therapeutic nanoparticles may
comprise at least one poly(vinyl ester) polymer. The poly(vinyl
ester) polymer may be a copolymer such as a random copolymer. As a
non-limiting example, the random copolymer may have a structure
such as those described in International Application No.
WO2013032829 or U.S. Patent Publication No US20130121954, the
contents of each of which are herein incorporated by reference in
their entirety. In some embodiments, the poly(vinyl ester) polymers
may be conjugated to the polynucleotides described herein.
[0949] In some embodiments, the therapeutic nanoparticle may
comprise at least one diblock copolymer. The diblock copolymer may
be, but it not limited to, a poly(lactic) acid-poly(ethylene)glycol
copolymer (see, e.g., International Patent Publication No.
WO2013044219, the contents of which are herein incorporated by
reference in their entirety). As a non-limiting example, the
therapeutic nanoparticle may be used to treat cancer (see
International publication No. WO2013044219, the contents of which
are herein incorporated by reference in their entirety).
[0950] In some embodiments, the therapeutic nanoparticles may
comprise at least one cationic polymer described herein and/or
known in the art.
[0951] In some embodiments, the therapeutic nanoparticles may
comprise at least one amine-containing polymer such as, but not
limited to polylysine, polyethylene imine, poly(amidoamine)
dendrimers, poly(beta-amino esters) (see, e.g., U.S. Pat. No.
8,287,849, the contents of which are herein incorporated by
reference in their entirety) and combinations thereof.
[0952] In some embodiments, the nanoparticles described herein may
comprise an amine cationic lipid such as those described in
International Patent Application No. WO2013059496, the contents of
which are herein incorporated by reference in their entirety. In
some embodiments, the cationic lipids may have an amino-amine or an
amino-amide moiety.
[0953] In some embodiments, the therapeutic nanoparticles may
comprise at least one degradable polyester which may contain
polycationic side chains. Degradeable polyesters include, but are
not limited to, poly(serine ester), poly(L-lactide-co-L-lysine),
poly(4-hydroxy-L-proline ester), and combinations thereof. In some
embodiments, the degradable polyesters may include a PEG
conjugation to form a PEGylated polymer.
[0954] In some embodiments, the synthetic nanocarriers may contain
an immunostimulatory agent to enhance the immune response from
delivery of the synthetic nanocarrier. As a non-limiting example,
the synthetic nanocarrier may comprise a Th1 immunostimulatory
agent, which may enhance a Th1-based response of the immune system
(see International Pub No. WO2010123569 and U.S. Publication No.
US20110223201, the contents of each of which are herein
incorporated by reference in their entirety).
[0955] In some embodiments, the synthetic nanocarriers may be
formulated for targeted release. In some embodiments, the synthetic
nanocarrier is formulated to release the polynucleotides at a
specified pH and/or after a desired time interval. As a
non-limiting example, the synthetic nanoparticle may be formulated
to release the RNA (e.g., mRNA) vaccines after 24 hours and/or at a
pH of 4.5 (see International Publication Nos. WO2010138193 and
WO2010138194 and US Pub Nos. US20110020388 and US20110027217, each
of which is herein incorporated by reference in their
entireties).
[0956] In some embodiments, the synthetic nanocarriers may be
formulated for controlled and/or sustained release of the
polynucleotides described herein. As a non-limiting example, the
synthetic nanocarriers for sustained release may be formulated by
methods known in the art, described herein and/or as described in
International Pub No. WO2010138192 and US Pub No. 20100303850, each
of which is herein incorporated by reference in their entirety.
[0957] In some embodiments, the RNA (e.g., mRNA) vaccine may be
formulated for controlled and/or sustained release wherein the
formulation comprises at least one polymer that is a crystalline
side chain (CYSC) polymer. CYSC polymers are described in U.S. Pat.
No. 8,399,007, herein incorporated by reference in its
entirety.
[0958] In some embodiments, the synthetic nanocarrier may be
formulated for use as a vaccine. In some embodiments, the synthetic
nanocarrier may encapsulate at least one polynucleotide which
encode at least one antigen. As a non-limiting example, the
synthetic nanocarrier may include at least one antigen and an
excipient for a vaccine dosage form (see International Publication
No. WO2011150264 and U.S. Publication No. US20110293723, the
contents of each of which are herein incorporated by reference in
their entirety). As another non-limiting example, a vaccine dosage
form may include at least two synthetic nanocarriers with the same
or different antigens and an excipient (see International
Publication No. WO2011150249 and U.S. Publication No.
US20110293701, the contents of each of which are herein
incorporated by reference in their entirety). The vaccine dosage
form may be selected by methods described herein, known in the art
and/or described in International Publication No. WO2011150258 and
U.S. Publication No. US20120027806, the contents of each of which
are herein incorporated by reference in their entirety).
[0959] In some embodiments, the synthetic nanocarrier may comprise
at least one polynucleotide which encodes at least one adjuvant. As
non-limiting example, the adjuvant may comprise
dimethyldioctadecylammonium-bromide,
dimethyldioctadecylammonium-chloride,
dimethyldioctadecylammonium-phosphate or
dimethyldioctadecylammonium-acetate (DDA) and an apolar fraction or
part of said apolar fraction of a total lipid extract of a
Mycobacterium (see, e.g., U.S. Pat. No. 8,241,610, the content of
which is herein incorporated by reference in its entirety). In some
embodiments, the synthetic nanocarrier may comprise at least one
polynucleotide and an adjuvant. As a non-limiting example, the
synthetic nanocarrier comprising and adjuvant may be formulated by
the methods described in International Publication No. WO2011150240
and U.S. Publication No. US20110293700, the contents of each of
which are herein incorporated by reference in their entirety.
[0960] In some embodiments, the synthetic nanocarrier may
encapsulate at least one polynucleotide that encodes a peptide,
fragment or region from a virus. As a non-limiting example, the
synthetic nanocarrier may include, but is not limited to, any of
the nanocarriers described in International Publication No.
WO2012024621, WO201202629, WO2012024632 and U.S. Publication No.
US20120064110, US20120058153 and US20120058154, the contents of
each of which are herein incorporated by reference in their
entirety.
[0961] In some embodiments, the synthetic nanocarrier may be
coupled to a polynucleotide which may be able to trigger a humoral
and/or cytotoxic T lymphocyte (CTL) response (see, e.g.,
International Publication No. WO2013019669, the contents of which
are herein incorporated by reference in their entirety).
[0962] In some embodiments, the RNA (e.g., mRNA) vaccine may be
encapsulated in, linked to and/or associated with zwitterionic
lipids. Non-limiting examples of zwitterionic lipids and methods of
using zwitterionic lipids are described in U.S. Patent Publication
No. US20130216607, the contents of which are herein incorporated by
reference in their entirety. In some aspects, the zwitterionic
lipids may be used in the liposomes and lipid nanoparticles
described herein.
[0963] In some embodiments, the RNA (e.g., mRNA) vaccine may be
formulated in colloid nanocarriers as described in U.S. Patent
Publication No. US20130197100, the contents of which are herein
incorporated by reference in their entirety.
[0964] In some embodiments, the nanoparticle may be optimized for
oral administration. The nanoparticle may comprise at least one
cationic biopolymer such as, but not limited to, chitosan or a
derivative thereof. As a non-limiting example, the nanoparticle may
be formulated by the methods described in U.S. Publication No.
20120282343, the contents of which are herein incorporated by
reference in their entirety.
[0965] In some embodiments, LNPs comprise the lipid KL52 (an
amino-lipid disclosed in U.S. Application Publication No.
2012/0295832, the contents of which are herein incorporated by
reference in their entirety. Activity and/or safety (as measured by
examining one or more of ALT/AST, white blood cell count and
cytokine induction, for example) of LNP administration may be
improved by incorporation of such lipids. LNPs comprising KL52 may
be administered intravenously and/or in one or more doses. In some
embodiments, administration of LNPs comprising KL52 results in
equal or improved mRNA and/or protein expression as compared to
LNPs comprising MC3.
[0966] In some embodiments, RNA (e.g., mRNA) vaccine may be
delivered using smaller LNPs. Such particles may comprise a
diameter from below 0.1 um up to 100 nm such as, but not limited
to, less than 0.1 um, less than 1.0 um, less than 5 um, less than
10 um, less than 15 um, less than 20 um, less than 25 um, less than
30 um, less than 35 um, less than 40 um, less than 50 um, less than
55 um, less than 60 um, less than 65 um, less than 70 um, less than
75 um, less than 80 um, less than 85 um, less than 90 um, less than
95 um, less than 100 um, less than 125 um, less than 150 um, less
than 175 um, less than 200 um, less than 225 um, less than 250 um,
less than 275 um, less than 300 um, less than 325 um, less than 350
um, less than 375 um, less than 400 um, less than 425 um, less than
450 um, less than 475 um, less than 500 um, less than 525 um, less
than 550 um, less than 575 um, less than 600 um, less than 625 um,
less than 650 um, less than 675 um, less than 700 um, less than 725
um, less than 750 um, less than 775 um, less than 800 um, less than
825 um, less than 850 um, less than 875 um, less than 900 um, less
than 925 um, less than 950 um, less than 975 um, or less than 1000
um.
[0967] In some embodiments, RNA (e.g., mRNA) vaccines may be
delivered using smaller LNPs, which may comprise a diameter from
about 1 nm to about 100 nm, from about 1 nm to about 10 nm, about 1
nm to about 20 nm, from about 1 nm to about 30 nm, from about 1 nm
to about 40 nm, from about 1 nm to about 50 nm, from about 1 nm to
about 60 nm, from about 1 nm to about 70 nm, from about 1 nm to
about 80 nm, from about 1 nm to about 90 nm, from about 5 nm to
about from 100 nm, from about 5 nm to about 10 nm, about 5 nm to
about 20 nm, from about 5 nm to about 30 nm, from about 5 nm to
about 40 nm, from about 5 nm to about 50 nm, from about 5 nm to
about 60 nm, from about 5 nm to about 70 nm, from about 5 nm to
about 80 nm, from about 5 nm to about 90 nm, about 10 to about 50
nm, from about 20 to about 50 nm, from about 30 to about 50 nm,
from about 40 to about 50 nm, from about 20 to about 60 nm, from
about 30 to about 60 nm, from about 40 to about 60 nm, from about
20 to about 70 nm, from about 30 to about 70 nm, from about 40 to
about 70 nm, from about 50 to about 70 nm, from about 60 to about
70 nm, from about 20 to about 80 nm, from about 30 to about 80 nm,
from about 40 to about 80 nm, from about 50 to about 80 nm, from
about 60 to about 80 nm, from about 20 to about 90 nm, from about
30 to about 90 nm, from about 40 to about 90 nm, from about 50 to
about 90 nm, from about 60 to about 90 nm and/or from about 70 to
about 90 nm.
[0968] In some embodiments, such LNPs are synthesized using methods
comprising microfluidic mixers. Examples of microfluidic mixers may
include, but are not limited to, a slit interdigital micromixer
including, but not limited to those manufactured by Microinnova
(Allerheiligen bei Wildon, Austria) and/or a staggered herringbone
micromixer (SHM) (Zhigaltsev, T. V. et al., Bottom-up design and
synthesis of limit size lipid nanoparticle systems with aqueous and
triglyceride cores using millisecond microfluidic mixing have been
published (Langmuir. 2012. 28:3633-40; Belliveau, N. M. et al.,
Microfluidic synthesis of highly potent limit-size lipid
nanoparticles for in vivo delivery of siRNA. Molecular
Therapy-Nucleic Acids. 2012. 1:e37; Chen, D. et al., Rapid
discovery of potent siRNA-containing lipid nanoparticles enabled by
controlled microfluidic formulation. J Am Chem Soc. 2012.
134(16):6948-51, the contents of each of which are herein
incorporated by reference in their entirety). In some embodiments,
methods of LNP generation comprising SHM, further comprise the
mixing of at least two input streams wherein mixing occurs by
microstructure-induced chaotic advection (MICA). According to this
method, fluid streams flow through channels present in a
herringbone pattern, causing rotational flow and folding the fluids
around each other. This method may also comprise a surface for
fluid mixing wherein the surface changes orientations during fluid
cycling. Methods of generating LNPs using SHM include those
disclosed in U.S. Application Publication Nos. 2004/0262223 and
2012/0276209, the contents of each of which are herein incorporated
by reference in their entirety.
[0969] In some embodiments, the RNA (e.g., mRNA) vaccine of the
present disclosure may be formulated in lipid nanoparticles created
using a micromixer such as, but not limited to, a Slit Interdigital
Microstructured Mixer (SIMM-V2) or a Standard Slit Interdigital
Micro Mixer (SSIMM) or Caterpillar (CPMM) or Impinging-jet (IJMM)
from the Institut fur Mikrotechnik Mainz GmbH, Mainz Germany.
[0970] In some embodiments, the RNA (e.g., mRNA) vaccines of the
present disclosure may be formulated in lipid nanoparticles created
using microfluidic technology (see, e.g., Whitesides, George M. The
Origins and the Future of Microfluidics. Nature, 2006 442: 368-373;
and Abraham et al. Chaotic Mixer for Microchannels. Science, 2002
295: 647-651; each of which is herein incorporated by reference in
its entirety). As a non-limiting example, controlled microfluidic
formulation includes a passive method for mixing streams of steady
pressure-driven flows in micro channels at a low Reynolds number
(see, e.g., Abraham et al. Chaotic Mixer for Microchannels.
Science, 2002 295: 647-651, the contents of which are herein
incorporated by reference in their entirety).
[0971] In some embodiments, the RNA (e.g., mRNA) vaccines of the
present disclosure may be formulated in lipid nanoparticles created
using a micromixer chip such as, but not limited to, those from
Harvard Apparatus (Holliston, Mass.) or Dolomite Microfluidics
(Royston, UK). A micromixer chip can be used for rapid mixing of
two or more fluid streams with a split and recombine mechanism.
[0972] In some embodiments, the RNA (e.g., mRNA) vaccines of the
disclosure may be formulated for delivery using the drug
encapsulating microspheres described in International Patent
Publication No. WO2013063468 or U.S. Pat. No. 8,440,614, the
contents of each of which are herein incorporated by reference in
their entirety. The microspheres may comprise a compound of the
formula (I), (II), (III), (IV), (V) or (VI) as described in
International Patent Publication No. WO2013063468, the contents of
which are herein incorporated by reference in their entirety. In
some embodiments, the amino acid, peptide, polypeptide, and/or
lipids are useful in delivering the RNA (e.g., mRNA) vaccines of
the disclosure to cells (see International Patent Publication No.
WO2013063468, the contents of which are herein incorporated by
reference in their entirety).
[0973] In some embodiments, the RNA (e.g., mRNA) vaccines of the
disclosure may be formulated in lipid nanoparticles having a
diameter from about 10 to about 100 nm such as, but not limited to,
about 10 to about 20 nm, about 10 to about 30 nm, about 10 to about
40 nm, about 10 to about 50 nm, about 10 to about 60 nm, about 10
to about 70 nm, about 10 to about 80 nm, about 10 to about 90 nm,
about 20 to about 30 nm, about 20 to about 40 nm, about 20 to about
50 nm, about 20 to about 60 nm, about 20 to about 70 nm, about 20
to about 80 nm, about 20 to about 90 nm, about 20 to about 100 nm,
about 30 to about 40 nm, about 30 to about 50 nm, about 30 to about
60 nm, about 30 to about 70 nm, about 30 to about 80 nm, about 30
to about 90 nm, about 30 to about 100 nm, about 40 to about 50 nm,
about 40 to about 60 nm, about 40 to about 70 nm, about 40 to about
80 nm, about 40 to about 90 nm, about 40 to about 100 nm, about 50
to about 60 nm, about 50 to about 70 nm about 50 to about 80 nm,
about 50 to about 90 nm, about 50 to about 100 nm, about 60 to
about 70 nm, about 60 to about 80 nm, about 60 to about 90 nm,
about 60 to about 100 nm, about 70 to about 80 nm, about 70 to
about 90 nm, about 70 to about 100 nm, about 80 to about 90 nm,
about 80 to about 100 nm and/or about 90 to about 100 nm.
[0974] In some embodiments, the lipid nanoparticles may have a
diameter from about 10 to 500 nm.
[0975] In some embodiments, the lipid nanoparticle may have a
diameter greater than 100 nm, greater than 150 nm, greater than 200
nm, greater than 250 nm, greater than 300 nm, greater than 350 nm,
greater than 400 nm, greater than 450 nm, greater than 500 nm,
greater than 550 nm, greater than 600 nm, greater than 650 nm,
greater than 700 nm, greater than 750 nm, greater than 800 nm,
greater than 850 nm, greater than 900 nm, greater than 950 nm or
greater than 1000 nm.
[0976] In some embodiments, the lipid nanoparticle may be a limit
size lipid nanoparticle described in International Patent
Publication No. WO2013059922, the contents of which are herein
incorporated by reference in their entirety. The limit size lipid
nanoparticle may comprise a lipid bilayer surrounding an aqueous
core or a hydrophobic core; where the lipid bilayer may comprise a
phospholipid such as, but not limited to,
diacylphosphatidylcholine, a diacylphosphatidylethanolamine, a
ceramide, a sphingomyelin, a dihydrosphingomyelin, a cephalin, a
cerebroside, a C8-C20 fatty acid diacylphophatidylcholine, and
1-palmitoyl-2-oleoyl phosphatidylcholine (POPC). In some
embodiments, the limit size lipid nanoparticle may comprise a
polyethylene glycol-lipid such as, but not limited to, DLPE-PEG,
DMPE-PEG, DPPC-PEG and DSPE-PEG.
[0977] In some embodiments, the RNA (e.g., mRNA) vaccines may be
delivered, localized and/or concentrated in a specific location
using the delivery methods described in International Patent
Publication No. WO2013063530, the contents of which are herein
incorporated by reference in their entirety. As a non-limiting
example, a subject may be administered an empty polymeric particle
prior to, simultaneously with or after delivering the RNA (e.g.,
mRNA) vaccines to the subject. The empty polymeric particle
undergoes a change in volume once in contact with the subject and
becomes lodged, embedded, immobilized or entrapped at a specific
location in the subject.
[0978] In some embodiments, the RNA (e.g., mRNA) vaccines may be
formulated in an active substance release system (see, e.g., U.S.
Patent Publication No. US20130102545, the contents of which are
herein incorporated by reference in their entirety). The active
substance release system may comprise 1) at least one nanoparticle
bonded to an oligonucleotide inhibitor strand which is hybridized
with a catalytically active nucleic acid and 2) a compound bonded
to at least one substrate molecule bonded to a therapeutically
active substance (e.g., polynucleotides described herein), where
the therapeutically active substance is released by the cleavage of
the substrate molecule by the catalytically active nucleic
acid.
[0979] In some embodiments, the RNA (e.g., mRNA) vaccines may be
formulated in a nanoparticle comprising an inner core comprising a
non-cellular material and an outer surface comprising a cellular
membrane. The cellular membrane may be derived from a cell or a
membrane derived from a virus. As a non-limiting example, the
nanoparticle may be made by the methods described in International
Patent Publication No. WO2013052167, the contents of which are
herein incorporated by reference in their entirety. As another
non-limiting example, the nanoparticle described in International
Patent Publication No. WO2013052167, the contents of which are
herein incorporated by reference in their entirety, may be used to
deliver the RNA (e.g., mRNA) vaccines described herein.
[0980] In some embodiments, the RNA (e.g., mRNA) vaccines may be
formulated in porous nanoparticle-supported lipid bilayers
(protocells). Protocells are described in International Patent
Publication No. WO2013056132, the contents of which are herein
incorporated by reference in their entirety.
[0981] In some embodiments, the RNA (e.g., mRNA) vaccines described
herein may be formulated in polymeric nanoparticles as described in
or made by the methods described in U.S. Pat. Nos. 8,420,123 and
8,518,963 and European Patent No. EP2073848B1, the contents of each
of which are herein incorporated by reference in their entirety. As
a non-limiting example, the polymeric nanoparticle may have a high
glass transition temperature such as the nanoparticles described in
or nanoparticles made by the methods described in U.S. Pat. No.
8,518,963, the contents of which are herein incorporated by
reference in their entirety. As another non-limiting example, the
polymer nanoparticle for oral and parenteral formulations may be
made by the methods described in European Patent No. EP2073848B1,
the contents of which are herein incorporated by reference in their
entirety.
[0982] In some embodiments, the RNA (e.g., mRNA) vaccines described
herein may be formulated in nanoparticles used in imaging. The
nanoparticles may be liposome nanoparticles such as those described
in U.S. Patent Publication No US20130129636, herein incorporated by
reference in its entirety. As a non-limiting example, the liposome
may comprise
gadolinium(III)2-{4,7-bis-carboxymethyl-10-[(N,N-distearylamidomethyl-N'--
amido-methyl]-1,4,7,10-tetra-azacyclododec-1-yl}-acetic acid and a
neutral, fully saturated phospholipid component (see, e.g., U.S.
Patent Publication No US20130129636, the contents of which are
herein incorporated by reference in their entirety).
[0983] In some embodiments, the nanoparticles which may be used in
the present disclosure are formed by the methods described in U.S.
Patent Application No. US20130130348, the contents of which are
herein incorporated by reference in their entirety.
[0984] The nanoparticles of the present disclosure may further
include nutrients such as, but not limited to, those which
deficiencies can lead to health hazards from anemia to neural tube
defects (see, e.g., the nanoparticles described in International
Patent Publication No WO2013072929, the contents of which are
herein incorporated by reference in their entirety). As a
non-limiting example, the nutrient may be iron in the form of
ferrous, ferric salts or elemental iron, iodine, folic acid,
vitamins or micronutrients.
[0985] In some embodiments, the RNA (e.g., mRNA) vaccines of the
present disclosure may be formulated in a swellable nanoparticle.
The swellable nanoparticle may be, but is not limited to, those
described in U.S. Pat. No. 8,440,231, the contents of which are
herein incorporated by reference in their entirety. As a
non-limiting embodiment, the swellable nanoparticle may be used for
delivery of the RNA (e.g., mRNA) vaccines of the present disclosure
to the pulmonary system (see, e.g., U.S. Pat. No. 8,440,231, the
contents of which are herein incorporated by reference in their
entirety).
[0986] The RNA (e.g., mRNA) vaccines of the present disclosure may
be formulated in polyanhydride nanoparticles such as, but not
limited to, those described in U.S. Pat. No. 8,449,916, the
contents of which are herein incorporated by reference in their
entirety.
[0987] The nanoparticles and microparticles of the present
disclosure may be geometrically engineered to modulate macrophage
and/or the immune response. In some embodiments, the geometrically
engineered particles may have varied shapes, sizes and/or surface
charges in order to incorporated the polynucleotides of the present
disclosure for targeted delivery such as, but not limited to,
pulmonary delivery (see, e.g., International Publication No
WO2013082111, the contents of which are herein incorporated by
reference in their entirety).
[0988] Other physical features the geometrically engineering
particles may have include, but are not limited to, fenestrations,
angled arms, asymmetry and surface roughness, and charge which can
alter the interactions with cells and tissues. As a non-limiting
example, nanoparticles of the present disclosure may be made by the
methods described in International Publication No WO2013082111, the
contents of which are herein incorporated by reference in their
entirety.
[0989] In some embodiments, the nanoparticles of the present
disclosure may be water soluble nanoparticles such as, but not
limited to, those described in International Publication No.
WO2013090601, the contents of which are herein incorporated by
reference in their entirety. The nanoparticles may be inorganic
nanoparticles which have a compact and zwitterionic ligand in order
to exhibit good water solubility. The nanoparticles may also have
small hydrodynamic diameters (HD), stability with respect to time,
pH, and salinity and a low level of non-specific protein
binding.
[0990] In some embodiments the nanoparticles of the present
disclosure may be developed by the methods described in U.S. Patent
Publication No. US20130172406, the contents of which are herein
incorporated by reference in their entirety.
[0991] In some embodiments, the nanoparticles of the present
disclosure are stealth nanoparticles or target-specific stealth
nanoparticles such as, but not limited to, those described in U.S.
Patent Publication No. US20130172406, the contents of which are
herein incorporated by reference in their entirety. The
nanoparticles of the present disclosure may be made by the methods
described in U.S. Patent Publication No. US20130172406, the
contents of which are herein incorporated by reference in their
entirety.
[0992] In some embodiments, the stealth or target-specific stealth
nanoparticles may comprise a polymeric matrix. The polymeric matrix
may comprise two or more polymers such as, but not limited to,
polyethylenes, polycarbonates, polyanhydrides, polyhydroxyacids,
polypropylfumerates, polycaprolactones, polyamides, polyacetals,
polyethers, polyesters, poly(orthoesters), polycyanoacrylates,
polyvinyl alcohols, polyurethanes, polyphosphazenes, polyacrylates,
polymethacrylates, polycyanoacrylates, polyureas, polystyrenes,
polyamines, polyesters, polyanhydrides, polyethers, polyurethanes,
polymethacrylates, polyacrylates, polycyanoacrylates or
combinations thereof.
[0993] In some embodiments, the nanoparticle may be a
nanoparticle-nucleic acid hybrid structure having a high density
nucleic acid layer. As a non-limiting example, the
nanoparticle-nucleic acid hybrid structure may made by the methods
described in U.S. Patent Publication No. US20130171646, the
contents of which are herein incorporated by reference in their
entirety. The nanoparticle may comprise a nucleic acid such as, but
not limited to, polynucleotides described herein and/or known in
the art.
[0994] At least one of the nanoparticles of the present disclosure
may be embedded in the core of a nanostructure or coated with a low
density porous 3-D structure or coating which is capable of
carrying or associating with at least one payload within or on the
surface of the nanostructure. Non-limiting examples of the
nanostructures comprising at least one nanoparticle are described
in International Patent Publication No. WO2013123523, the contents
of which are herein incorporated by reference in their
entirety.
[0995] In some embodiments the RNA (e.g., mRNA) vaccine may be
associated with a cationic or polycationic compounds, including
protamine, nucleoline, spermine or spermidine, or other cationic
peptides or proteins, such as poly-L-lysine (PLL), polyarginine,
basic polypeptides, cell penetrating peptides (CPPs), including
HIV-binding peptides, HIV-1 Tat (HIV), Tat-derived peptides,
Penetratin, VP.sup.22 derived or analog peptides, Pestivirus Erns,
HSINV, VP.sup.22 (Herpes simplex), MAP, KALA or protein
transduction domains (PTDs), PpT620, prolin-rich peptides,
arginine-rich peptides, lysine-rich peptides, MPG-peptide(s),
Pep-1, L-oligomers, Calcitonin peptide(s), Antennapedia-derived
peptides (particularly from Drosophila antennapedia), pAntp, pIs1,
FGF, Lactoferrin, Transportan, Buforin-2, Bac715-24, SynB, SynB,
pVEC, hCT-derived peptides, SAP, histones, cationic
polysaccharides, for example chitosan, polybrene, cationic
polymers, e.g. polyethyleneimine (PEI), cationic lipids, e.g.
DOTMA: [1-(2,3-sioleyloxy)propyl)]-N,N,N-trimethylammonium
chloride, DMRIE, di-C14-amidine, DOTIM, SAINT, DC-Chol, BGTC, CTAP,
DOPC, DODAP, DOPE: Dioleyl phosphatidylethanol-amine, DOSPA, DODAB,
DOIC, DMEPC, DOGS: Dioctadecylamidoglicylspermin, DIMRI:
Dimyristooxypropyl dimethyl hydroxyethyl ammonium bromide, DOTAP:
dioleoyloxy-3-(trimethylammonio)propane, DC-6-14:
O,O-ditetradecanoyl-N-.alpha.-trimethylammonioacetyl)diethanolamine
chloride, CLIP 1:
rac-[(2,3-dioctadecyloxypropyl)(2-hydroxyethyl)]-dimethylammonium
chloride, CLIP6:
rac-[2(2,3-dihexadecyloxypropyloxymethyloxy)ethyl]-trimethylammonium,
CLIP9:
rac-[2(2,3-dihexadecyloxypropyloxysuccinyloxy)ethyl]-trimethylammo-
-nium, oligofectamine, or cationic or polycationic polymers, e.g.
modified polyaminoacids, such as beta-aminoacid-polymers or
reversed polyamides, etc., modified polyethylenes, such as PVP
(poly(N-ethyl-4-vinylpyridinium bromide)), etc., modified
acrylates, such as pDMAEMA (poly(dimethylaminoethyl
methylacrylate)), etc., modified amidoamines such as pAMAM
(poly(amidoamine)), etc., modified polybetaminoester (PBAE), such
as diamine end modified 1,4 butanediol
diacrylate-co-5-amino-1-pentanol polymers, etc., dendrimers, such
as polypropylamine dendrimers or pAMAM based dendrimers, etc.,
polyimine(s), such as PEI: poly(ethyleneimine),
poly(propyleneimine), etc., polyallylamine, sugar backbone based
polymers, such as cyclodextrin based polymers, dextran based
polymers, chitosan, etc., silan backbone based polymers, such as
PMOXA-PDMS copolymers, etc., blockpolymers consisting of a
combination of one or more cationic blocks (e.g. selected from a
cationic polymer as mentioned above) and of one or more hydrophilic
or hydrophobic blocks (e.g. polyethyleneglycole), etc.
[0996] In other embodiments the RNA (e.g., mRNA) vaccine is not
associated with a cationic or polycationic compounds.
[0997] In some embodiments, a nanoparticle comprises compounds of
Formula (I):
##STR00003##
[0998] or a salt or isomer thereof, wherein:
[0999] R.sub.1 is selected from the group consisting of C.sub.5-30
alkyl, C.sub.5-20 alkenyl, --R*YR'', --YR'', and --R''M'R';
[1000] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.1-14 alkyl, C.sub.2-14 alkenyl,
--R*YR'', --YR'', and --R*OR'', or R.sub.2 and R.sub.3, together
with the atom to which they are attached, form a heterocycle or
carbocycle;
[1001] R.sub.4 is selected from the group consisting of a C.sub.3-6
carbocycle, --(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nCHQR,
[1002] --CHQR, --CQ(R).sub.2, and unsubstituted C.sub.1-6 alkyl,
where Q is selected from a carbocycle, heterocycle, --OR,
--O(CH.sub.2),N(R).sub.2, --C(O)OR, --OC(O)R, --CX.sub.3,
--CX.sub.2H, --CXH.sub.2, --CN, --N(R).sub.2, --C(O)N(R).sub.2,
--N(R)C(O)R, --N(R)S(O).sub.2R, --N(R)C(O)N(R).sub.2,
--N(R)C(S)N(R).sub.2, --N(R)R.sub.8, --O(CH.sub.2)nOR,
--N(R)C(.dbd.NR.sub.9)N(R).sub.2,
--N(R)C(.dbd.CHR.sub.9)N(R).sub.2, --OC(O)N(R).sub.2, --N(R)C(O)OR,
--N(OR)C(O)R, --N(OR)S(O).sub.2R, --N(OR)C(O)OR,
--N(OR)C(O)N(R).sub.2, --N(OR)C(S)N(R).sub.2,
--N(OR)C(.dbd.NR.sub.9)N(R).sub.2,
--N(OR)C(.dbd.CHR.sub.9)N(R).sub.2, --C(.dbd.NR.sub.9)N(R).sub.2,
--C(.dbd.NR.sub.9)R, --C(O)N(R)OR, and --C(R)N(R).sub.2C(O)OR, and
each n is independently selected from 1, 2, 3, 4, and 5;
[1003] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[1004] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[1005] M and M' are independently selected from --C(O)O--,
--OC(O)--, --C(O)N(R')--,
[1006] --N(R')C(O)--, --C(O)--, --C(S)--, --C(S)S--, --SC(S)--,
--CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--, --S--S--, an aryl
group, and a heteroaryl group;
[1007] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[1008] R.sub.8 is selected from the group consisting of C.sub.3-6
carbocycle and heterocycle;
[1009] R.sub.9 is selected from the group consisting of H, CN,
NO.sub.2, C.sub.1-6 alkyl, --OR, --S(O).sub.2R,
--S(O).sub.2N(R).sub.2, C.sub.2-6 alkenyl, C.sub.3-6 carbocycle and
heterocycle;
[1010] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[1011] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.2-18 alkenyl, --R*YR'', --YR'', and
H;
[1012] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl;
[1013] each R* is independently selected from the group consisting
of C.sub.1-12 alkyl and C.sub.2-12 alkenyl;
[1014] each Y is independently a C.sub.3-6 carbocycle;
[1015] each X is independently selected from the group consisting
of F, Cl, Br, and I; and
[1016] m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13.
[1017] In some embodiments, a subset of compounds of Formula (I)
includes those in which when R.sub.4 is --(CH.sub.2).sub.nQ,
--(CH.sub.2).sub.nCHQR, --CHQR, or --CQ(R).sub.2, then (i) Q is not
--N(R).sub.2 when n is 1, 2, 3, 4 or 5, or (ii) Q is not 5, 6, or
7-membered heterocycloalkyl when n is 1 or 2.
[1018] In some embodiments, another subset of compounds of Formula
(I) includes those in which
[1019] R.sub.1 is selected from the group consisting of C.sub.5-30
alkyl, C.sub.5-20 alkenyl, --R*YR'', --YR'', and --R''M'R';
[1020] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.1-14 alkyl, C.sub.2-14 alkenyl,
--R*YR'', --YR'', and --R*OR'', or R.sub.2 and R.sub.3, together
with the atom to which they are attached, form a heterocycle or
carbocycle;
[1021] R.sub.4 is selected from the group consisting of a C.sub.3-6
carbocycle, --(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nCHQR, --CHQR,
--CQ(R).sub.2, and unsubstituted C.sub.1-6 alkyl, where Q is
selected from a C.sub.3-6 carbocycle, a 5- to 14-membered
heteroaryl having one or more heteroatoms selected from N, O, and
S, --OR, --O(CH.sub.2),N(R).sub.2, --C(O)OR, --OC(O)R, --CX.sub.3,
--CX.sub.2H, --CXH.sub.2, --CN, --C(O)N(R).sub.2, --N(R)C(O)R,
--N(R)S(O).sub.2R, --N(R)C(O)N(R).sub.2, --N(R)C(S)N(R).sub.2,
--CRN(R).sub.2C(O)OR, --N(R)R.sub.8, --O(CH.sub.2).sub.nOR,
--N(R)C(.dbd.NR.sub.9)N(R).sub.2,
--N(R)C(.dbd.CHR.sub.9)N(R).sub.2, --OC(O)N(R).sub.2, --N(R)C(O)OR,
--N(OR)C(O)R, --N(OR)S(O).sub.2R, --N(OR)C(O)OR,
--N(OR)C(O)N(R).sub.2, --N(OR)C(S)N(R).sub.2,
--N(OR)C(.dbd.NR.sub.9)N(R).sub.2,
--N(OR)C(.dbd.CHR.sub.9)N(R).sub.2, --C(.dbd.NR.sub.9)N(R).sub.2,
--C(.dbd.NR.sub.9)R, --C(O)N(R)O R, and a 5- to 14-membered
heterocycloalkyl having one or more heteroatoms selected from N, O,
and S which is substituted with one or more substituents selected
from oxo (.dbd.O), OH, amino, mono- or di-alkylamino, and C.sub.1-3
alkyl, and each n is independently selected from 1, 2, 3, 4, and
5;
[1022] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[1023] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[1024] M and M' are independently selected from --C(O)O--,
--OC(O)--, --C(O)N(R')--, --N(R')C(O)--, --C(O)--, --C(S)--,
--C(S)S--, --SC(S)--, --CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--,
--S--S--, an aryl group, and a heteroaryl group;
[1025] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[1026] R.sub.8 is selected from the group consisting of C.sub.3-6
carbocycle and heterocycle;
[1027] R.sub.9 is selected from the group consisting of H, CN,
NO.sub.2, C.sub.1-6 alkyl, --OR, --S(O).sub.2R,
--S(O).sub.2N(R).sub.2, C.sub.2-6 alkenyl, C.sub.3-6 carbocycle and
heterocycle;
[1028] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[1029] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.2-18 alkenyl, --R*YR'', --YR'', and
H;
[1030] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl;
[1031] each R* is independently selected from the group consisting
of C.sub.1-12 alkyl and C.sub.2-12 alkenyl;
[1032] each Y is independently a C.sub.3-6 carbocycle;
[1033] each X is independently selected from the group consisting
of F, Cl, Br, and I; and
[1034] m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
[1035] or salts or isomers thereof.
[1036] In some embodiments, another subset of compounds of Formula
(I) includes those in which
[1037] R.sub.1 is selected from the group consisting of C.sub.5-30
alkyl, C.sub.5-20 alkenyl, --R*YR'', --YR'', and --R''M'R';
[1038] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.1-14 alkyl, C.sub.2-14 alkenyl,
--R*YR'', --YR'', and --R*OR'', or R.sub.2 and R.sub.3, together
with the atom to which they are attached, form a heterocycle or
carbocycle;
[1039] R.sub.4 is selected from the group consisting of a C.sub.3-6
carbocycle, --(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nCHQR, --CHQR,
--CQ(R).sub.2, and unsubstituted C.sub.1-6 alkyl, where Q is
selected from a C.sub.3-6 carbocycle, a 5- to 14-membered
heterocycle having one or more heteroatoms selected from N, O, and
S, --OR, --O(CH.sub.2),N(R).sub.2, --C(O)OR, --OC(O)R, --CX.sub.3,
--CX.sub.2H, --CXH.sub.2, --CN, --C(O)N(R).sub.2, --N(R)C(O)R,
--N(R)S(O).sub.2R, --N(R)C(O)N(R).sub.2, --N(R)C(S)N(R).sub.2,
--CRN(R).sub.2C(O)OR, --N(R)R.sub.8, --O(CH.sub.2).sub.nOR,
--N(R)C(.dbd.NR.sub.9)N(R).sub.2,
--N(R)C(.dbd.CHR.sub.9)N(R).sub.2, --OC(O)N(R).sub.2, --N(R)C(O)OR,
--N(OR)C(O)R, --N(OR)S(O).sub.2R, --N(OR)C(O)OR,
--N(OR)C(O)N(R).sub.2, --N(OR)C(S)N(R).sub.2,
--N(OR)C(.dbd.NR.sub.9)N(R).sub.2,
--N(OR)C(.dbd.CHR.sub.9)N(R).sub.2, --C(.dbd.NR.sub.9)R,
--C(O)N(R)OR, and --C(.dbd.NR.sub.9)N(R).sub.2, and each n is
independently selected from 1, 2, 3, 4, and 5; and when Q is a 5-
to 14-membered heterocycle and (i) R.sub.4 is --(CH.sub.2),Q in
which n is 1 or 2, or (ii) R.sub.4 is --(CH.sub.2).sub.nCHQR in
which n is 1, or (iii) R.sub.4 is --CHQR, and --CQ(R).sub.2, then Q
is either a 5- to 14-membered heteroaryl or 8- to 14-membered
heterocycloalkyl;
[1040] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[1041] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[1042] M and M' are independently selected from --C(O)O--,
--OC(O)--, --C(O)N(R')--, --N(R')C(O)--, --C(O)--, --C(S)--,
--C(S)S--, --SC(S)--, --CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--,
--S--S--, an aryl group, and a heteroaryl group;
[1043] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[1044] R.sub.8 is selected from the group consisting of C.sub.3-6
carbocycle and heterocycle;
[1045] R.sub.9 is selected from the group consisting of H, CN,
NO.sub.2, C.sub.1-6 alkyl, --OR, --S(O).sub.2R,
--S(O).sub.2N(R).sub.2, C.sub.2-6 alkenyl, C.sub.3-6 carbocycle and
heterocycle;
[1046] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[1047] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.2-18 alkenyl, --R*YR'', --YR'', and
H;
[1048] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl;
[1049] each R* is independently selected from the group consisting
of C.sub.1-12 alkyl and C.sub.2-12 alkenyl;
[1050] each Y is independently a C.sub.3-6 carbocycle;
[1051] each X is independently selected from the group consisting
of F, Cl, Br, and I; and
[1052] m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
[1053] or salts or isomers thereof.
[1054] In some embodiments, another subset of compounds of Formula
(I) includes those in which
[1055] R.sub.1 is selected from the group consisting of C.sub.5-30
alkyl, C.sub.5-20 alkenyl, --R*YR'', --YR'', and --R''M'R';
[1056] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.1-14 alkyl, C.sub.2-14 alkenyl,
--R*YR'', --YR'', and --R*OR'', or R.sub.2 and R.sub.3, together
with the atom to which they are attached, form a heterocycle or
carbocycle;
[1057] R.sub.4 is selected from the group consisting of a C.sub.3-6
carbocycle, --(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nCHQR, --CHQR,
--CQ(R).sub.2, and unsubstituted C.sub.1-6 alkyl, where Q is
selected from a C.sub.3-6 carbocycle, a 5- to 14-membered
heteroaryl having one or more heteroatoms selected from N, O, and
S, --OR, --O(CH.sub.2),N(R).sub.2, --C(O)OR, --OC(O)R, --CX.sub.3,
--CX.sub.2H, --CXH.sub.2, --CN, --C(O)N(R).sub.2, --N(R)C(O)R,
--N(R)S(O).sub.2R, --N(R)C(O)N(R).sub.2, --N(R)C(S)N(R).sub.2,
--CRN(R).sub.2C(O)OR, --N(R)R.sub.8, --O(CH.sub.2).sub.nOR,
--N(R)C(.dbd.NR.sub.9)N(R).sub.2,
--N(R)C(.dbd.CHR.sub.9)N(R).sub.2, --OC(O)N(R).sub.2, --N(R)C(O)OR,
--N(OR)C(O)R, --N(OR)S(O).sub.2R, --N(OR)C(O)OR,
--N(OR)C(O)N(R).sub.2, --N(OR)C(S)N(R).sub.2,
--N(OR)C(.dbd.NR.sub.9)N(R).sub.2,
--N(OR)C(.dbd.CHR.sub.9)N(R).sub.2, --C(.dbd.NR.sub.9)R,
--C(O)N(R)OR, and --C(.dbd.NR.sub.9)N(R).sub.2, and each n is
independently selected from 1, 2, 3, 4, and 5;
[1058] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[1059] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[1060] M and M' are independently selected from --C(O)O--,
--OC(O)--, --C(O)N(R')--, --N(R')C(O)--, --C(O)--, --C(S)--,
--C(S)S--, --SC(S)--, --CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--,
--S--S--, an aryl group, and a heteroaryl group;
[1061] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[1062] R.sub.8 is selected from the group consisting of C.sub.3-6
carbocycle and heterocycle;
[1063] R.sub.9 is selected from the group consisting of H, CN,
NO.sub.2, C.sub.1-6 alkyl, --OR, --S(O).sub.2R,
--S(O).sub.2N(R).sub.2, C.sub.2-6 alkenyl, C.sub.3-6 carbocycle and
heterocycle;
[1064] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[1065] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.2-18 alkenyl, --R*YR'', --YR'', and
H;
[1066] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl;
[1067] each R* is independently selected from the group consisting
of C.sub.1-12 alkyl and C.sub.2-12 alkenyl;
[1068] each Y is independently a C.sub.3-6 carbocycle;
[1069] each X is independently selected from the group consisting
of F, Cl, Br, and I; and
[1070] m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
[1071] or salts or isomers thereof.
[1072] In some embodiments, another subset of compounds of Formula
(I) includes those in which
[1073] R.sub.1 is selected from the group consisting of C.sub.5-30
alkyl, C.sub.5-20 alkenyl, --R*YR'', --YR'', and --R''M'R';
[1074] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.2-14 alkyl, C.sub.2-14 alkenyl,
--R*YR'', --YR'', and --R*OR'', or R.sub.2 and R.sub.3, together
with the atom to which they are attached, form a heterocycle or
carbocycle;
[1075] R.sub.4 is --(CH.sub.2).sub.nQ or --(CH.sub.2).sub.nCHQR,
where Q is --N(R).sub.2, and n is selected from 3, 4, and 5;
[1076] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[1077] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[1078] M and M' are independently selected from --C(O)O--,
--OC(O)--, --C(O)N(R')--, --N(R')C(O)--, --C(O)--, --C(S)--,
--C(S)S--, --SC(S)--, --CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--,
--S--S--, an aryl group, and a heteroaryl group;
[1079] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[1080] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[1081] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.2-18 alkenyl, --R*YR'', --YR'', and
H;
[1082] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl;
[1083] each R* is independently selected from the group consisting
of C1-12 alkyl and C1-12 alkenyl;
[1084] each Y is independently a C.sub.3-6 carbocycle;
[1085] each X is independently selected from the group consisting
of F, Cl, Br, and I; and
[1086] m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
[1087] or salts or isomers thereof.
[1088] In some embodiments, another subset of compounds of Formula
(I) includes those in which
[1089] R.sub.1 is selected from the group consisting of C.sub.5-30
alkyl, C.sub.5-20 alkenyl, --R*YR'', --YR'', and --R''M'R';
[1090] R.sub.2 and R.sub.3 are independently selected from the
group consisting of C.sub.1-14 alkyl, C.sub.2-14 alkenyl, --R*YR'',
--YR'', and --R*OR'', or R.sub.2 and R.sub.3, together with the
atom to which they are attached, form a heterocycle or
carbocycle;
[1091] R.sub.4 is selected from the group consisting of
--(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nCHQR, --CHQR, and
--CQ(R).sub.2, where Q is --N(R).sub.2, and n is selected from 1,
2, 3, 4, and 5;
[1092] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[1093] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[1094] M and M' are independently selected from --C(O)O--,
--OC(O)--, --C(O)N(R')--, --N(R')C(O)--, --C(O)--, --C(S)--,
--C(S)S--, --SC(S)--, --CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--,
--S--S--, an aryl group, and a heteroaryl group;
[1095] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[1096] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[1097] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.2-18 alkenyl, --R*YR'', --YR'', and
H;
[1098] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl;
[1099] each R* is independently selected from the group consisting
of C.sub.1-12 alkyl and C.sub.1-12 alkenyl;
[1100] each Y is independently a C.sub.3-6 carbocycle;
[1101] each X is independently selected from the group consisting
of F, Cl, Br, and I; and
[1102] m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
[1103] or salts or isomers thereof.
[1104] In some embodiments, a subset of compounds of Formula (I)
includes those of Formula (IA):
##STR00004##
[1105] or a salt or isomer thereof, wherein 1 is selected from 1,
2, 3, 4, and 5; m is selected from 5, 6, 7, 8, and 9; M.sub.1 is a
bond or M'; R.sub.4 is unsubstituted C.sub.1-3 alkyl, or
--(CH.sub.2).sub.nQ, in which Q is OH, --NHC(S)N(R).sub.2,
--NHC(O)N(R).sub.2, --N(R)C(O)R, --N(R)S(O).sub.2R, --N(R)R.sub.8,
--NHC(.dbd.NR.sub.9)N(R).sub.2, --NHC(.dbd.CHR.sub.9)N(R).sub.2,
--OC(O)N(R).sub.2, --N(R)C(O)OR, heteroaryl or heterocycloalkyl; M
and M' are independently selected from --C(O)O--, --OC(O)--,
--C(O)N(R')--, --P(O)(OR')O--, --S--S--, an aryl group, and a
heteroaryl group; and R.sub.2 and R.sub.3 are independently
selected from the group consisting of H, C.sub.1-14 alkyl, and
C.sub.2-14 alkenyl.
[1106] In some embodiments, a subset of compounds of Formula (I)
includes those of Formula (II):
##STR00005##
or a salt or isomer thereof, wherein 1 is selected from 1, 2, 3, 4,
and 5; M.sub.1 is a bond or M'; R.sub.4 is unsubstituted C.sub.1-3
alkyl, or --(CH.sub.2).sub.nQ, in which n is 2, 3, or 4, and Q is
OH, --NHC(S)N(R).sub.2, --NHC(O)N(R).sub.2, --N(R)C(O)R,
--N(R)S(O).sub.2R, --N(R)R.sub.8, --NHC(.dbd.NR.sub.9)N(R).sub.2,
--NHC(.dbd.CHR.sub.9)N(R).sub.2, --OC(O)N(R).sub.2, --N(R)C(O)OR,
heteroaryl or heterocycloalkyl; M and M' are independently selected
from --C(O)O--, --OC(O)--, --C(O)N(R')--, --P(O)(OR')O--, --S--S--,
an aryl group, and a heteroaryl group; and R.sub.2 and R.sub.3 are
independently selected from the group consisting of H, C.sub.1-14
alkyl, and C.sub.2-14 alkenyl.
[1107] In some embodiments, a subset of compounds of Formula (I)
includes those of Formula (IIa), (IIb), (IIc), or (IIe):
##STR00006##
[1108] or a salt or isomer thereof, wherein R.sub.4 is as described
herein.
[1109] In some embodiments, a subset of compounds of Formula (I)
includes those of Formula (IId):
##STR00007##
[1110] or a salt or isomer thereof, wherein n is 2, 3, or 4; and m,
R', R'', and R.sub.2 through R.sub.6 are as described herein. For
example, each of R.sub.2 and R.sub.3 may be independently selected
from the group consisting of C.sub.5-14 alkyl and C.sub.5-14
alkenyl.
[1111] In some embodiments, the compound of Formula (I) is selected
from the group consisting of:
##STR00008## ##STR00009## ##STR00010## ##STR00011## ##STR00012##
##STR00013## ##STR00014## ##STR00015## ##STR00016##
##STR00017##
[1112] In further embodiments, the compound of Formula (I) is
selected from the group consisting of:
##STR00018##
[1113] In some embodiments, the compound of Formula (I) is selected
from the group consisting of:
##STR00019## ##STR00020## ##STR00021## ##STR00022## ##STR00023##
##STR00024## ##STR00025## ##STR00026## ##STR00027## ##STR00028##
##STR00029## ##STR00030## ##STR00031## ##STR00032## ##STR00033##
##STR00034## ##STR00035## ##STR00036## ##STR00037## ##STR00038##
##STR00039## ##STR00040## ##STR00041## ##STR00042## ##STR00043##
##STR00044## ##STR00045## ##STR00046## ##STR00047## ##STR00048##
##STR00049##
and salts and isomers thereof.
[1114] In some embodiments, a nanoparticle comprises the following
compound:
##STR00050##
or salts and isomers thereof.
[1115] In some embodiments, the disclosure features a nanoparticle
composition including a lipid component comprising a compound as
described herein (e.g., a compound according to Formula (I), (IA),
(II), (IIa), (IIb), (IIc), (IId) or (IIe)).
[1116] In some embodiments, the disclosure features a
pharmaceutical composition comprising a nanoparticle composition
according to the preceding embodiments and a pharmaceutically
acceptable carrier. For example, the pharmaceutical composition is
refrigerated or frozen for storage and/or shipment (e.g., being
stored at a temperature of 4.degree. C. or lower, such as a
temperature between about -150.degree. C. and about 0.degree. C. or
between about -80.degree. C. and about -20.degree. C. (e.g., about
-5.degree. C., -10.degree. C., -15.degree. C., -20.degree. C.,
-25.degree. C., -30.degree. C., -40.degree. C., -50.degree. C.,
-60.degree. C., -70.degree. C., -80.degree. C., -90.degree. C.,
-130.degree. C. or -150.degree. C.). For example, the
pharmaceutical composition is a solution that is refrigerated for
storage and/or shipment at, for example, about -20.degree. C.,
-30.degree. C., -40.degree. C., -50.degree. C., -60.degree. C.,
-70.degree. C., or -80.degree. C.
[1117] In some embodiments, the disclosure provides a method of
delivering a therapeutic and/or prophylactic (e.g., RNA, such as
mRNA) to a cell (e.g., a mammalian cell). This method includes the
step of administering to a subject (e.g., a mammal, such as a
human) a nanoparticle composition including (i) a lipid component
including a phospholipid (such as a polyunsaturated lipid), a PEG
lipid, a structural lipid, and a compound of Formula (I), (IA),
(II), (IIa), (IIb), (IIc), (IId) or (IIe) and (ii) a therapeutic
and/or prophylactic, in which administering involves contacting the
cell with the nanoparticle composition, whereby the therapeutic
and/or prophylactic is delivered to the cell.
[1118] In some embodiments, the disclosure provides a method of
producing a polypeptide of interest in a cell (e.g., a mammalian
cell). The method includes the step of contacting the cell with a
nanoparticle composition including (i) a lipid component including
a phospholipid (such as a polyunsaturated lipid), a PEG lipid, a
structural lipid, and a compound of Formula (I), (IA), (II), (IIa),
(IIb), (IIc), (IId) or (IIe) and (ii) an mRNA encoding the
polypeptide of interest, whereby the mRNA is capable of being
translated in the cell to produce the polypeptide.
[1119] In some embodiments, the disclosure provides a method of
treating a disease or disorder in a mammal (e.g., a human) in need
thereof. The method includes the step of administering to the
mammal a therapeutically effective amount of a nanoparticle
composition including (i) a lipid component including a
phospholipid (such as a polyunsaturated lipid), a PEG lipid, a
structural lipid, and a compound of Formula (I), (IA), (II), (IIa),
(IIb), (IIc), (IId) or (IIe) and (ii) a therapeutic and/or
prophylactic (e.g., an mRNA). In some embodiments, the disease or
disorder is characterized by dysfunctional or aberrant protein or
polypeptide activity. For example, the disease or disorder is
selected from the group consisting of rare diseases, infectious
diseases, cancer and proliferative diseases, genetic diseases
(e.g., cystic fibrosis), autoimmune diseases, diabetes,
neurodegenerative diseases, cardio- and reno-vascular diseases, and
metabolic diseases.
[1120] In some embodiments, the disclosure provides a method of
delivering (e.g., specifically delivering) a therapeutic and/or
prophylactic to a mammalian organ (e.g., a liver, spleen, lung, or
femur). This method includes the step of administering to a subject
(e.g., a mammal) a nanoparticle composition including (i) a lipid
component including a phospholipid, a PEG lipid, a structural
lipid, and a compound of Formula (I), (IA), (II), (IIa), (IIb),
(IIc), (IId) or (IIe) and (ii) a therapeutic and/or prophylactic
(e.g., an mRNA), in which administering involves contacting the
cell with the nanoparticle composition, whereby the therapeutic
and/or prophylactic is delivered to the target organ (e.g., a
liver, spleen, lung, or femur).
[1121] In some embodiments, the disclosure features a method for
the enhanced delivery of a therapeutic and/or prophylactic (e.g.,
an mRNA) to a target tissue (e.g., a liver, spleen, lung, or
femur). This method includes administering to a subject (e.g., a
mammal) a nanoparticle composition, the composition including (i) a
lipid component including a compound of Formula (I), (IA), (II),
(IIa), (IIb), (IIc), (IId) or (IIe), a phospholipid, a structural
lipid, and a PEG lipid; and (ii) a therapeutic and/or prophylactic,
the administering including contacting the target tissue with the
nanoparticle composition, whereby the therapeutic and/or
prophylactic is delivered to the target tissue.
[1122] In some embodiments, the disclosure features a method of
lowering immunogenicity comprising introducing the nanoparticle
composition of the disclosure into cells, wherein the nanoparticle
composition reduces the induction of the cellular immune response
of the cells to the nanoparticle composition, as compared to the
induction of the cellular immune response in cells induced by a
reference composition which comprises a reference lipid instead of
a compound of Formula (I), (IA), (II), (IIa), (IIb), (IIc), (IId)
or (IIe). For example, the cellular immune response is an innate
immune response, an adaptive immune response, or both.
[1123] The disclosure also includes methods of synthesizing a
compound of Formula (I), (IA), (II), (IIa), (IIb), (IIc), (IId) or
(IIe) and methods of making a nanoparticle composition including a
lipid component comprising the compound of Formula (I), (IA), (II),
(IIa), (IIb), (IIc), (IId) or (IIe).
Modes of Vaccine Administration
[1124] Tropical disease RNA (e.g. mRNA) vaccines may be
administered by any route which results in a therapeutically
effective outcome. These include, but are not limited, to
intradermal, intramuscular, intranasal and/or subcutaneous
administration. The present disclosure provides methods comprising
administering RNA (e.g., mRNA) vaccines to a subject in need
thereof. The exact amount required will vary from subject to
subject, depending on the species, age, and general condition of
the subject, the severity of the disease, the particular
composition, its mode of administration, its mode of activity, and
the like. Tropical disease RNA (e.g., mRNA) vaccines compositions
are typically formulated in dosage unit form for ease of
administration and uniformity of dosage. It will be understood,
however, that the total daily usage of RNA (e.g., mRNA) vaccine
compositions may be decided by the attending physician within the
scope of sound medical judgment. The specific therapeutically
effective, prophylactically effective, or appropriate imaging dose
level for any particular patient will depend upon a variety of
factors including the disorder being treated and the severity of
the disorder; the activity of the specific compound employed; the
specific composition employed; the age, body weight, general
health, sex and diet of the patient; the time of administration,
route of administration, and rate of excretion of the specific
compound employed; the duration of the treatment; drugs used in
combination or coincidental with the specific compound employed;
and like factors well known in the medical arts.
[1125] In some embodiments, tropical disease RNA (e.g. mRNA)
vaccines compositions may be administered at dosage levels
sufficient to deliver 0.0001 mg/kg to 100 mg/kg, 0.001 mg/kg to
0.05 mg/kg, 0.005 mg/kg to 0.05 mg/kg, 0.001 mg/kg to 0.005 mg/kg,
0.05 mg/kg to 0.5 mg/kg, 0.01 mg/kg to 50 mg/kg, 0.1 mg/kg to 40
mg/kg, 0.5 mg/kg to 30 mg/kg, 0.01 mg/kg to 10 mg/kg, 0.1 mg/kg to
10 mg/kg, or 1 mg/kg to 25 mg/kg, of subject body weight per day,
one or more times a day, per week, per month, etc. to obtain the
desired therapeutic, diagnostic, prophylactic, or imaging effect
(see, e.g., the range of unit doses described in International
Publication No WO2013078199, the contents of which are herein
incorporated by reference in their entirety). The desired dosage
may be delivered three times a day, two times a day, once a day,
every other day, every third day, every week, every two weeks,
every three weeks, every four weeks, every 2 months, every three
months, every 6 months, etc. In some embodiments, the desired
dosage may be delivered using multiple administrations (e.g., two,
three, four, five, six, seven, eight, nine, ten, eleven, twelve,
thirteen, fourteen, or more administrations). When multiple
administrations are employed, split dosing regimens such as those
described herein may be used. In exemplary embodiments, tropical
disease RNA (e.g., mRNA) vaccines compositions may be administered
at dosage levels sufficient to deliver 0.0005 mg/kg to 0.01 mg/kg,
e.g., about 0.0005 mg/kg to about 0.0075 mg/kg, e.g., about 0.0005
mg/kg, about 0.001 mg/kg, about 0.002 mg/kg, about 0.003 mg/kg,
about 0.004 mg/kg or about 0.005 mg/kg.
[1126] In some embodiments, tropical disease RNA (e.g., mRNA)
vaccine compositions may be administered once or twice (or more) at
dosage levels sufficient to deliver 0.025 mg/kg to 0.250 mg/kg,
0.025 mg/kg to 0.500 mg/kg, 0.025 mg/kg to 0.750 mg/kg, or 0.025
mg/kg to 1.0 mg/kg.
[1127] In some embodiments, tropical disease RNA (e.g., mRNA)
vaccine compositions may be administered twice (e.g., Day 0 and Day
7, Day 0 and Day 14, Day 0 and Day 21, Day 0 and Day 28, Day 0 and
Day 60, Day 0 and Day 90, Day 0 and Day 120, Day 0 and Day 150, Day
0 and Day 180, Day 0 and 3 months later, Day 0 and 6 months later,
Day 0 and 9 months later, Day 0 and 12 months later, Day 0 and 18
months later, Day 0 and 2 years later, Day 0 and 5 years later, or
Day 0 and 10 years later) at a total dose of or at dosage levels
sufficient to deliver a total dose of 0.0100 mg, 0.025 mg, 0.050
mg, 0.075 mg, 0.100 mg, 0.125 mg, 0.150 mg, 0.175 mg, 0.200 mg,
0.225 mg, 0.250 mg, 0.275 mg, 0.300 mg, 0.325 mg, 0.350 mg, 0.375
mg, 0.400 mg, 0.425 mg, 0.450 mg, 0.475 mg, 0.500 mg, 0.525 mg,
0.550 mg, 0.575 mg, 0.600 mg, 0.625 mg, 0.650 mg, 0.675 mg, 0.700
mg, 0.725 mg, 0.750 mg, 0.775 mg, 0.800 mg, 0.825 mg, 0.850 mg,
0.875 mg, 0.900 mg, 0.925 mg, 0.950 mg, 0.975 mg, or 1.0 mg. Higher
and lower dosages and frequency of administration are encompassed
by the present disclosure. For example, a tropical disease RNA
(e.g., mRNA) vaccine composition may be administered three or four
times.
[1128] In some embodiments, tropical disease RNA (e.g., mRNA)
vaccine compositions may be administered twice (e.g., Day 0 and Day
7, Day 0 and Day 14, Day 0 and Day 21, Day 0 and Day 28, Day 0 and
Day 60, Day 0 and Day 90, Day 0 and Day 120, Day 0 and Day 150, Day
0 and Day 180, Day 0 and 3 months later, Day 0 and 6 months later,
Day 0 and 9 months later, Day 0 and 12 months later, Day 0 and 18
months later, Day 0 and 2 years later, Day 0 and 5 years later, or
Day 0 and 10 years later) at a total dose of or at dosage levels
sufficient to deliver a total dose of 0.010 mg, 0.025 mg, 0.100 mg
or 0.400 mg.
[1129] In some embodiments, the tropical disease RNA (e.g., mRNA)
vaccine for use in a method of vaccinating a subject is
administered to the subject as a single dosage of between 10
.mu.g/kg and 400 .mu.g/kg of the nucleic acid vaccine (in an
effective amount to vaccinate the subject). In some embodiments the
RNA (e.g., mRNA) vaccine for use in a method of vaccinating a
subject is administered to the subject as a single dosage of
between 10 .mu.g and 400 .mu.g of the nucleic acid vaccine (in an
effective amount to vaccinate the subject). In some embodiments, a
tropical disease RNA (e.g., mRNA) vaccine for use in a method of
vaccinating a subject is administered to the subject as a single
dosage of 25-1000 .mu.g (e.g., a single dosage of mRNA encoding
Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
antigen). In some embodiments, a tropical disease RNA (e.g., mRNA)
vaccine is administered to the subject as a single dosage of 25,
50, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650,
700, 750, 800, 850, 900, 950 or 1000 .mu.g. For example, a tropical
disease RNA (e.g., mRNA) vaccine may be administered to a subject
as a single dose of 25-100, 25-500, 50-100, 50-500, 50-1000,
100-500, 100-1000, 250-500, 250-1000, or 500-1000 .mu.g. In some
embodiments, a tropical disease RNA (e.g., mRNA) vaccine for use in
a method of vaccinating a subject is administered to the subject as
two dosages, the combination of which equals 25-1000 .mu.g of the
tropical disease RNA (e.g., mRNA) vaccine.
[1130] A tropical disease RNA (e.g. mRNA) vaccine pharmaceutical
composition described herein can be formulated into a dosage form
described herein, such as an intranasal, intratracheal, or
injectable (e.g., intravenous, intraocular, intravitreal,
intramuscular, intradermal, intracardiac, intraperitoneal,
intranasal and subcutaneous).
Tropical Disease RNA (e.g., mRNA) Vaccine Formulations and Methods
of Use
[1131] Some aspects of the present disclosure provide formulations
of the tropical disease RNA (e.g., mRNA) vaccine, wherein the RNA
(e.g., mRNA) vaccine is formulated in an effective amount to
produce an antigen specific immune response in a subject (e.g.,
production of antibodies specific to an Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV antigenic polypeptide). An
"effective amount" is a dose of an RNA (e.g., mRNA) vaccine
effective to produce an antigen-specific immune response. Also
provided herein are methods of inducing an antigen-specific immune
response in a subject.
[1132] In some embodiments, the antigen-specific immune response is
characterized by measuring an anti-Malaria (e.g., P. falciparum, P.
vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV,
CHIKV, DENV, ZIKV and/or YFV antigenic polypeptide antibody titer
produced in a subject administered a tropical disease RNA (e.g.,
mRNA) vaccine as provided herein. An antibody titer is a
measurement of the amount of antibodies within a subject, for
example, antibodies that are specific to a particular antigen
(e.g., an Malaria (e.g., P. falciparum, P. vivax, P. malariae
and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV
and/or YFV antigenic polypeptide) or epitope of an antigen.
Antibody titer is typically expressed as the inverse of the
greatest dilution that provides a positive result. Enzyme-linked
immunosorbent assay (ELISA) is a common assay for determining
antibody titers, for example.
[1133] In some embodiments, an antibody titer is used to assess
whether a subject has had an infection or to determine whether
immunizations are required. In some embodiments, an antibody titer
is used to determine the strength of an autoimmune response, to
determine whether a booster immunization is needed, to determine
whether a previous vaccine was effective, and to identify any
recent or prior infections. In accordance with the present
disclosure, an antibody titer may be used to determine the strength
of an immune response induced in a subject by the tropical disease
RNA (e.g., mRNA) vaccine.
[1134] In some embodiments, an anti-antigenic polypeptide (e.g., an
anti-Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
antigenic polypeptide) antibody titer produced in a subject is
increased by at least 1 log relative to a control. For example,
anti-antigenic polypeptide antibody titer produced in a subject may
be increased by at least 1.5, at least 2, at least 2.5, or at least
3 log relative to a control. In some embodiments, the
anti-antigenic polypeptide antibody titer produced in the subject
is increased by 1, 1.5, 2, 2.5 or 3 log relative to a control. In
some embodiments, the anti-antigenic polypeptide antibody titer
produced in the subject is increased by 1-3 log relative to a
control. For example, the anti-antigenic polypeptide antibody titer
produced in a subject may be increased by 1-1.5, 1-2, 1-2.5, 1-3,
1.5-2, 1.5-2.5, 1.5-3, 2-2.5, 2-3, or 2.5-3 log relative to a
control.
[1135] In some embodiments, the anti-antigenic polypeptide (e.g.,
an anti-Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or
P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
antigenic polypeptide) antibody titer produced in a subject is
increased at least 2 times relative to a control. For example, the
anti-antigenic polypeptide antibody titer produced in a subject may
be increased at least 3 times, at least 4 times, at least 5 times,
at least 6 times, at least 7 times, at least 8 times, at least 9
times, or at least 10 times relative to a control. In some
embodiments, the anti-antigenic polypeptide antibody titer produced
in the subject is increased 2, 3, 4, 5,6, 7, 8, 9, or 10 times
relative to a control. In some embodiments, the anti-antigenic
polypeptide antibody titer produced in a subject is increased 2-10
times relative to a control. For example, the anti-antigenic
polypeptide antibody titer produced in a subject may be increased
2-10, 2-9, 2-8, 2-7, 2-6, 2-5, 2-4, 2-3, 3-10, 3-9, 3-8, 3-7, 3-6,
3-5, 3-4, 4-10, 4-9, 4-8, 4-7, 4-6, 4-5, 5-10, 5-9, 5-8, 5-7, 5-6,
6-10, 6-9, 6-8, 6-7, 7-10, 7-9, 7-8, 8-10, 8-9, or 9-10 times
relative to a control.
[1136] A control, in some embodiments, is the anti-antigenic
polypeptide (e.g., an anti-Malaria (e.g., P. falciparum, P. vivax,
P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV,
DENV, ZIKV and/or YFV antigenic polypeptide) antibody titer
produced in a subject who has not been administered a tropical
disease RNA (e.g., mRNA) vaccine of the present disclosure. In some
embodiments, a control is an anti-antigenic polypeptide (e.g., an
anti-Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
antigenic polypeptide) antibody titer produced in a subject who has
been administered a live attenuated Malaria (e.g., P. falciparum,
P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV,
CHIKV, DENV, ZIKV and/or YFV vaccine. An attenuated vaccine is a
vaccine produced by reducing the virulence of a viable (live)
virus. An attenuated virus is altered in a manner that renders it
harmless or less virulent relative to a live, unmodified virus. In
some embodiments, a control is an anti-antigenic polypeptide (e.g.,
an anti-Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or
P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
antigenic polypeptide) antibody titer produced in a subject
administered inactivated Malaria (e.g., P. falciparum, P. vivax, P.
malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV,
ZIKV and/or YFV vaccine. In some embodiments, a control is an
anti-antigenic polypeptide (e.g., an anti-Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV antigenic polypeptide)
antibody titer produced in a subject administered a recombinant or
purified Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or
P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
protein vaccine. Recombinant protein vaccines typically include
protein antigens that either have been produced in a heterologous
expression system (e.g., bacteria or yeast) or purified from large
amounts of the pathogenic organism. In some embodiments, a control
is an anti-antigenic polypeptide (e.g., an anti-Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV antigenic polypeptide)
antibody titer produced in a subject who has been administered an
Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
virus-like particle (VLP) vaccine.
[1137] In some embodiments, an effective amount of a tropical
disease RNA (e.g., mRNA) vaccine is a dose that is reduced compared
to the standard of care dose of a recombinant Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV protein vaccine. A
"standard of care," as provided herein, refers to a medical or
psychological treatment guideline and can be general or specific.
"Standard of care" specifies appropriate treatment based on
scientific evidence and collaboration between medical professionals
involved in the treatment of a given condition. It is the
diagnostic and treatment process that a physician/clinician should
follow for a certain type of patient, illness or clinical
circumstance. A "standard of care dose," as provided herein, refers
to the dose of a recombinant or purified Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV protein vaccine, or a live
attenuated or inactivated Malaria (e.g., P. falciparum, P. vivax,
P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV,
DENV, ZIKV and/or YFV vaccine, that a physician/clinician or other
medical professional would administer to a subject to treat or
prevent Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or
P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or
YFV, or a related condition, while following the standard of care
guideline for treating or preventing Malaria (e.g., P. falciparum,
P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV,
CHIKV, DENV, ZIKV and/or YFV, or a related condition.
[1138] In some embodiments, the anti-antigenic polypeptide (e.g.,
an anti-Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or
P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
antigenic polypeptide) antibody titer produced in a subject
administered an effective amount of a tropical disease RNA (e.g.,
mRNA) vaccine is equivalent to an anti-antigenic polypeptide (e.g.,
an anti-Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or
P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
antigenic polypeptide) antibody titer produced in a control subject
administered a standard of care dose of a recombinant or purified
Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or P.
ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
protein vaccine or a live attenuated or inactivated Malaria (e.g.,
P. falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV,
EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV vaccine.
[1139] In some embodiments, an effective amount of a tropical
disease RNA (e.g., mRNA) vaccine is a dose equivalent to an at
least 2-fold reduction in a standard of care dose of a recombinant
or purified Malaria (e.g., P. falciparum, P. vivax, P. malariae
and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV
and/or YFV protein vaccine. For example, an effective amount of a
tropical disease RNA (e.g., mRNA) vaccine may be a dose equivalent
to an at least 3-fold, at least 4-fold, at least 5-fold, at least
6-fold, at least 7-fold, at least 8-fold, at least 9-fold, or at
least 10-fold reduction in a standard of care dose of a recombinant
or purified Malaria (e.g., P. falciparum, P. vivax, P. malariae
and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV
and/or YFV protein vaccine. In some embodiments, an effective
amount of a tropical disease RNA (e.g., mRNA) vaccine is a dose
equivalent to an at least at least 100-fold, at least 500-fold, or
at least 1000-fold reduction in a standard of care dose of a
recombinant or purified Malaria (e.g., P. falciparum, P. vivax, P.
malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV,
ZIKV and/or YFV protein vaccine. In some embodiments, an effective
amount of a tropical disease RNA (e.g., mRNA) vaccine is a dose
equivalent to a 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 20-, 50-,
100-, 250-, 500-, or 1000-fold reduction in a standard of care dose
of a recombinant or purified Malaria (e.g., P. falciparum, P.
vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV,
CHIKV, DENV, ZIKV and/or YFV protein vaccine. In some embodiments,
the anti-antigenic polypeptide antibody titer produced in a subject
administered an effective amount of a tropical disease RNA (e.g.,
mRNA) vaccine is equivalent to an anti-antigenic polypeptide
antibody titer produced in a control subject administered the
standard of care dose of a recombinant or protein Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV protein vaccine or a live
attenuated or inactivated Malaria (e.g., P. falciparum, P. vivax,
P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV,
DENV, ZIKV and/or YFV vaccine. In some embodiments, an effective
amount of a tropical disease RNA (e.g., mRNA) vaccine is a dose
equivalent to a 2-fold to 1000-fold (e.g., 2-fold to 100-fold,
10-fold to 1000-fold) reduction in the standard of care dose of a
recombinant or purified Malaria (e.g., P. falciparum, P. vivax, P.
malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV,
ZIKV and/or YFV protein vaccine, wherein the anti-antigenic
polypeptide antibody titer produced in the subject is equivalent to
an anti-antigenic polypeptide antibody titer produced in a control
subject administered the standard of care dose of a recombinant or
purified Malaria (e.g., P. falciparum, P. vivax, P. malariae and/or
P. ovale), JEV, WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV
protein vaccine or a live attenuated or inactivated Malaria (e.g.,
P. falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV,
EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV vaccine.
[1140] In some embodiments, the effective amount of a tropical
disease RNA (e.g., mRNA) vaccine is a dose equivalent to a 2 to
1000-, 2 to 900-, 2 to 800-, 2 to 700-, 2 to 600-, 2 to 500-, 2 to
400-, 2 to 300-, 2 to 200-, 2 to 100-, 2 to 90-, 2 to 80-, 2 to
70-, 2 to 60-, 2 to 50-, 2 to 40-, 2 to 30-, 2 to 20-, 2 to 10-, 2
to 9-, 2 to 8-, 2 to 7-, 2 to 6-, 2 to 5-, 2 to 4-, 2 to 3-, 3 to
1000-, 3 to 900-, 3 to 800-, 3 to 700-, 3 to 600-, 3 to 500-, 3 to
400-, 3 to 3 to 00-, 3 to 200-, 3 to 100-, 3 to 90-, 3 to 80-, 3 to
70-, 3 to 60-, 3 to 50-, 3 to 40-, 3 to 30-, 3 to 20-, 3 to 10-, 3
to 9-, 3 to 8-, 3 to 7-, 3 to 6-, 3 to 5-, 3 to 4-, 4 to 1000-, 4
to 900-, 4 to 800-, 4 to 700-, 4 to 600-, 4 to 500-, 4 to 400-, 4
to 4 to 00-, 4 to 200-, 4 to 100-, 4 to 90-, 4 to 80-, 4 to 70-, 4
to 60-, 4 to 50-, 4 to 40-, 4 to 30-, 4 to 20-, 4 to 10-, 4 to 9-,
4 to 8-, 4 to 7-, 4 to 6-, 4 to 5-, 4 to 4-, 5 to 1000-, 5 to 900-,
5 to 800-, 5 to 700-, 5 to 600-, 5 to 500-, 5 to 400-, 5 to 300-, 5
to 200-, 5 to 100-, 5 to 90-, 5 to 80-, 5 to 70-, 5 to 60-, 5 to
50-, 5 to 40-, 5 to 30-, 5 to 20-, 5 to 10-, 5 to 9-, 5 to 8-, 5 to
7-, 5 to 6-, 6 to 1000-, 6 to 900-, 6 to 800-, 6 to 700-, 6 to
600-, 6 to 500-, 6 to 400-, 6 to 300-, 6 to 200-, 6 to 100-, 6 to
90-, 6 to 80-, 6 to 70-, 6 to 60-, 6 to 50-, 6 to 40-, 6 to 30-, 6
to 20-, 6 to 10-, 6 to 9-, 6 to 8-, 6 to 7-, 7 to 1000-, 7 to 900-,
7 to 800-, 7 to 700-, 7 to 600-, 7 to 500-, 7 to 400-, 7 to 300-, 7
to 200-, 7 to 100-, 7 to 90-, 7 to 80-, 7 to 70-, 7 to 60-, 7 to
50-, 7 to 40-, 7 to 30-, 7 to 20-, 7 to 10-, 7 to 9-, 7 to 8-, 8 to
1000-, 8 to 900-, 8 to 800-, 8 to 700-, 8 to 600-, 8 to 500-, 8 to
400-, 8 to 300-, 8 to 200-, 8 to 100-, 8 to 90-, 8 to 80-, 8 to
70-, 8 to 60-, 8 to 50-, 8 to 40-, 8 to 30-, 8 to 20-, 8 to 10-, 8
to 9-, 9 to 1000-, 9 to 900-, 9 to 800-, 9 to 700-, 9 to 600-, 9 to
500-, 9 to 400-, 9 to 300-, 9 to 200-, 9 to 100-, 9 to 90-, 9 to
80-, 9 to 70-, 9 to 60-, 9 to 50-, 9 to 40-, 9 to 30-, 9 to 20-, 9
to 10-, 10 to 1000-, 10 to 900-, 10 to 800-, 10 to 700-, 10 to
600-, 10 to 500-, 10 to 400-, 10 to 300-, 10 to 200-, 10 to 100-,
10 to 90-, 10 to 80-, 10 to 70-, 10 to 60-, 10 to 50-, 10 to 40-,
10 to 30-, 10 to 20-, 20 to 1000-, 20 to 900-, 20 to 800-, 20 to
700-, 20 to 600-, 20 to 500-, 20 to 400-, 20 to 300-, 20 to 200-,
20 to 100-, 20 to 90-, 20 to 80-, 20 to 70-, 20 to 60-, 20 to 50-,
20 to 40-, 20 to 30-, 30 to 1000-, 30 to 900-, 30 to 800-, 30 to
700-, 30 to 600-, 30 to 500-, 30 to 400-, 30 to 300-, 30 to 200-,
30 to 100-, 30 to 90-, 30 to 80-, 30 to 70-, 30 to 60-, 30 to 50-,
30 to 40-, 40 to 1000-, 40 to 900-, 40 to 800-, 40 to 700-, 40 to
600-, 40 to 500-, 40 to 400-, 40 to 300-, 40 to 200-, 40 to 100-,
40 to 90-, 40 to 80-, 40 to 70-, 40 to 60-, 40 to 50-, 50 to 1000-,
50 to 900-, 50 to 800-, 50 to 700-, 50 to 600-, 50 to 500-, 50 to
400-, 50 to 300-, 50 to 200-, 50 to 100-, 50 to 90-, 50 to 80-, 50
to 70-, 50 to 60-, 60 to 1000-, 60 to 900-, 60 to 800-, 60 to 700-,
60 to 600-, 60 to 500-, 60 to 400-, 60 to 300-, 60 to 200-, 60 to
100-, 60 to 90-, 60 to 80-, 60 to 70-, 70 to 1000-, 70 to 900-, 70
to 800-, 70 to 700-, 70 to 600-, 70 to 500-, 70 to 400-, 70 to
300-, 70 to 200-, 70 to 100-, 70 to 90-, 70 to 80-, 80 to 1000-, 80
to 900-, 80 to 800-, 80 to 700-, 80 to 600-, 80 to 500-, 80 to
400-, 80 to 300-, 80 to 200-, 80 to 100-, 80 to 90-, 90 to 1000-,
90 to 900-, 90 to 800-, 90 to 700-, 90 to 600-, 90 to 500-, 90 to
400-, 90 to 300-, 90 to 200-, 90 to 100-, 100 to 1000-, 100 to
900-, 100 to 800-, 100 to 700-, 100 to 600-, 100 to 500-, 100 to
400-, 100 to 300-, 100 to 200-, 200 to 1000-, 200 to 900-, 200 to
800-, 200 to 700-, 200 to 600-, 200 to 500-, 200 to 400-, 200 to
300-, 300 to 1000-, 300 to 900-, 300 to 800-, 300 to 700-, 300 to
600-, 300 to 500-, 300 to 400-, 400 to 1000-, 400 to 900-, 400 to
800-, 400 to 700-, 400 to 600-, 400 to 500-, 500 to 1000-, 500 to
900-, 500 to 800-, 500 to 700-, 500 to 600-, 600 to 1000-, 600 to
900-, 600 to 800-, 600 to 700-, 700 to 1000-, 700 to 900-, 700 to
800-, 800 to 1000-, 800 to 900-, or 900 to 1000-fold reduction in
the standard of care dose of a recombinant Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV protein vaccine. In some
embodiments, the anti-antigenic polypeptide antibody titer produced
in the subject is equivalent to an anti-antigenic polypeptide
antibody titer produced in a control subject administered the
standard of care dose of a recombinant or purified Malaria (e.g.,
P. falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV,
EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV protein vaccine or a
live attenuated or inactivated Malaria (e.g., P. falciparum, P.
vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV,
CHIKV, DENV, ZIKV and/or YFV vaccine. In some embodiments, the
effective amount is a dose equivalent to (or equivalent to an at
least) 2-, 3-,4-,5-,6-, 7-, 8-, 9-, 10-, 20-, 30-, 40-, 50-, 60-,
70-, 80-, 90-, 100-, 110-, 120-, 130-, 140-, 150-, 160-, 170-,
1280-, 190-, 200-, 210-, 220-, 230-, 240-, 250-, 260-, 270-, 280-,
290-, 300-, 310-, 320-, 330-, 340-, 350-, 360-, 370-, 380-, 390-,
400-, 410-, 420-, 430-, 440-, 450-, 4360-, 470-, 480-, 490-, 500-,
510-, 520-, 530-, 540-, 550-, 560-, 5760-, 580-, 590-, 600-, 610-,
620-, 630-, 640-, 650-, 660-, 670-, 680-, 690-, 700-, 710-, 720-,
730-, 740-, 750-, 760-, 770-, 780-, 790-, 800-, 810-, 820--, 830-,
840-, 850-, 860-, 870-, 880-, 890-, 900-, 910-, 920-, 930-, 940-,
950-, 960-, 970-, 980-, 990-, or 1000-fold reduction in the
standard of care dose of a recombinant Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV protein vaccine. In some
embodiments, an anti-antigenic polypeptide antibody titer produced
in the subject is equivalent to an anti-antigenic polypeptide
antibody titer produced in a control subject administered the
standard of care dose of a recombinant or purified Malaria (e.g.,
P. falciparum, P. vivax, P. malariae and/or P. ovale), JEV, WNV,
EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV protein vaccine or a
live attenuated or inactivated Malaria (e.g., P. falciparum, P.
vivax, P. malariae and/or P. ovale), JEV, WNV, EEEV, VEEV, SINV,
CHIKV, DENV, ZIKV and/or YFV vaccine.
[1141] In some embodiments, the effective amount of a tropical
disease RNA (e.g., mRNA) vaccine is a total dose of 50-1000 .mu.g.
In some embodiments, the effective amount of a tropical disease RNA
(e.g., mRNA) vaccine is a total dose of 50-1000, 50-900, 50-800,
50-700, 50-600, 50-500, 50-400, 50-300, 50-200, 50-100, 50-90,
50-80, 50-70, 50-60, 60-1000, 60-900, 60-800, 60-700, 60-600,
60-500, 60-400, 60-300, 60-200, 60-100, 60-90, 60-80, 60-70,
70-1000, 70-900, 70-800, 70-700, 70-600, 70-500, 70-400, 70-300,
70-200, 70-100, 70-90, 70-80, 80-1000, 80-900, 80-800, 80-700,
80-600, 80-500, 80-400, 80-300, 80-200, 80-100, 80-90, 90-1000,
90-900, 90-800, 90-700, 90-600, 90-500, 90-400, 90-300, 90-200,
90-100, 100-1000, 100-900, 100-800, 100-700, 100-600, 100-500,
100-400, 100-300, 100-200, 200-1000, 200-900, 200-800, 200-700,
200-600, 200-500, 200-400, 200-300, 300-1000, 300-900, 300-800,
300-700, 300-600, 300-500, 300-400, 400-1000, 400-900, 400-800,
400-700, 400-600, 400-500, 500-1000, 500-900, 500-800, 500-700,
500-600, 600-1000, 600-900, 600-900, 600-700, 700-1000, 700-900,
700-800, 800-1000, 800-900, or 900-1000 .mu.g. In some embodiments,
the effective amount of a tropical disease RNA (e.g., mRNA) vaccine
is a total dose of 50, 100, 150, 200, 250, 300, 350, 400, 450, 500,
550, 600, 650, 700, 750, 800, 850, 900, 950 or 1000 .mu.g. In some
embodiments, the effective amount is a dose of 25-500 .mu.g
administered to the subject a total of two times. In some
embodiments, the effective amount of a tropical disease RNA (e.g.,
mRNA) vaccine is a dose of 25-500, 25-400, 25-300, 25-200, 25-100,
25-50, 50-500, 50-400, 50-300, 50-200, 50-100, 100-500, 100-400,
100-300, 100-200, 150-500, 150-400, 150-300, 150-200, 200-500,
200-400, 200-300, 250-500, 250-400, 250-300, 300-500, 300-400,
350-500, 350-400, 400-500 or 450-500 ug administered to the subject
a total of two times. In some embodiments, the effective amount of
a tropical disease RNA (e.g., mRNA) vaccine is a total dose of 25,
50, 100, 150, 200, 250, 300, 350, 400, 450, or 500 .mu.g
administered to the subject a total of two times.
Examples of Additional Embodiments of the Disclosure
[1142] 1. A tropical disease vaccine, comprising:
[1143] at least one messenger ribonucleic acid (mRNA)
polynucleotide having a 5' terminal cap, an open reading frame
encoding at least one tropical disease antigenic polypeptide, and a
3' polyA tail.
2. The vaccine of paragraph 1, wherein the at least one tropical
disease antigenic polypeptide is selected from a Malaria (e.g., P.
falciparum, P. vivax, P. malariae and/or P. ovale) antigenic
polypeptide, a JEV antigenic polypeptide, a WNV antigenic
polypeptide, a EEEV antigenic polypeptide, a VEEV antigenic
polypeptide, a SINV antigenic polypeptide, a CHIKV antigenic
polypeptide, a DENV antigenic polypeptide, a ZIKV antigenic
polypeptide and a YFV antigenic polypeptide. 3. The vaccine of
paragraph 1, wherein the at least one mRNA polynucleotide is
encoded by a sequence identified by any one of SEQ ID NO: 1-6, 18,
19, 30-34, 48, 49, 55, 56, 65-80, 118-136, 223-239 or 376-388, or a
fragment of a sequence identified by any one of SEQ ID NO: 1-6, 18,
19, 30-34, 48, 49, 55, 56, 65-80, 118-136, 223-239 or 376-388. 4.
The vaccine of paragraph 1, wherein the at least one mRNA
polynucleotide comprises a sequence identified by any one of SEQ ID
NO: 7-12, 20-21, 35-39, 50-51, 57-58, 81-96, 137-155, 240-256, or
389-401, or a fragment of a sequence identified by any one of SEQ
ID NO: 7-12, 20-21, 35-39, 50-51, 57-58, 81-96, 137-155, 240-256,
or 389-401. 5. The vaccine of paragraph 1, wherein the at least one
antigenic polypeptide comprises a sequence identified by any one of
SEQ ID NO: 13-17, 22-29, 44-47, 52-54, 59-64, 97-117, 156-222, 469,
259-291 or 402-413, or a fragment of a sequence identified by any
one of SEQ ID NO: 13-17, 22-29, 44-47, 52-54, 59-64, 97-117,
156-222, 469, 259-291 or 402-413. 6. The vaccine of any one of
paragraphs 1-5, wherein the 5' terminal cap is or comprises
7mG(5')ppp(5')NlmpNp. 7. The vaccine of any one of paragraphs 1-6,
wherein 100% of the uracil in the open reading frame is modified to
include N1-methyl pseudouridine at the 5-position of the uracil. 8.
The vaccine of any one of paragraphs 1-7, wherein the vaccine is
formulated in a lipid nanoparticle comprising: DLin-MC3-DMA;
cholesterol; 1,2-Distearoyl-sn-glycero-3-phosphocholine (DSPC); and
polyethylene glycol (PEG)2000-DMG. 9. The vaccine of paragraph 8,
wherein the lipid nanoparticle further comprises trisodium citrate
buffer, sucrose and water.
[1144] This disclosure is not limited in its application to the
details of construction and the arrangement of components set forth
in the following description or illustrated in the drawings. The
disclosure is capable of other embodiments and of being practiced
or of being carried out in various ways. Also, the phraseology and
terminology used herein is for the purpose of description and
should not be regarded as limiting. The use of "including,"
"comprising," or "having," "containing," "involving," and
variations thereof herein, is meant to encompass the items listed
thereafter and equivalents thereof as well as additional items.
EXAMPLES
Example 1: Manufacture of Polynucleotides
[1145] According to the present disclosure, the manufacture of
polynucleotides and/or parts or regions thereof may be accomplished
utilizing the methods taught in International Publication
WO2014/152027, entitled "Manufacturing Methods for Production of
RNA Transcripts," the contents of which is incorporated herein by
reference in its entirety.
[1146] Purification methods may include those taught in
International Publication WO2014/152030 and International
Publication WO2014/152031, each of which is incorporated herein by
reference in its entirety.
[1147] Detection and characterization methods of the
polynucleotides may be performed as taught in International
Publication WO2014/144039, which is incorporated herein by
reference in its entirety.
[1148] Characterization of the polynucleotides of the disclosure
may be accomplished using polynucleotide mapping, reverse
transcriptase sequencing, charge distribution analysis, detection
of RNA impurities, or any combination of two or more of the
foregoing. "Characterizing" comprises determining the RNA
transcript sequence, determining the purity of the RNA transcript,
or determining the charge heterogeneity of the RNA transcript, for
example. Such methods are taught in, for example, International
Publication WO2014/144711 and International Publication
WO2014/144767, the content of each of which is incorporated herein
by reference in its entirety.
Example 2: Chimeric Polynucleotide Synthesis
[1149] According to the present disclosure, two regions or parts of
a chimeric polynucleotide may be joined or ligated using
triphosphate chemistry. A first region or part of 100 nucleotides
or less is chemically synthesized with a 5' monophosphate and
terminal 3'desOH or blocked OH, for example. If the region is
longer than 80 nucleotides, it may be synthesized as two strands
for ligation.
[1150] If the first region or part is synthesized as a
non-positionally modified region or part using in vitro
transcription (IVT), conversion the 5'monophosphate with subsequent
capping of the 3' terminus may follow.
[1151] Monophosphate protecting groups may be selected from any of
those known in the art.
[1152] The second region or part of the chimeric polynucleotide may
be synthesized using either chemical synthesis or IVT methods. IVT
methods may include an RNA polymerase that can utilize a primer
with a modified cap. Alternatively, a cap of up to 130 nucleotides
may be chemically synthesized and coupled to the IVT region or
part.
[1153] For ligation methods, ligation with DNA T4 ligase, followed
by treatment with DNase should readily avoid concatenation.
[1154] The entire chimeric polynucleotide need not be manufactured
with a phosphate-sugar backbone. If one of the regions or parts
encodes a polypeptide, then such region or part may comprise a
phosphate-sugar backbone.
[1155] Ligation is then performed using any known click chemistry,
orthoclick chemistry, solulink, or other bioconjugate chemistries
known to those in the art.
[1156] Synthetic Route
[1157] The chimeric polynucleotide may be made using a series of
starting segments. Such segments include:
[1158] (a) a capped and protected 5' segment comprising a normal
3'OH (SEG. 1)
[1159] (b) a 5' triphosphate segment, which may include the coding
region of a polypeptide 25 and a normal 3'OH (SEG. 2)
[1160] (c) a 5' monophosphate segment for the 3' end of the
chimeric polynucleotide (e.g., the tail) comprising cordycepin or
no 3'OH (SEG. 3)
[1161] After synthesis (chemical or IVT), segment 3 (SEG. 3) may be
treated with cordycepin and then with pyrophosphatase to create the
5' monophosphate.
[1162] Segment 2 (SEG. 2) may then be ligated to SEG. 3 using RNA
ligase. The ligated polynucleotide is then purified and treated
with pyrophosphatase to cleave the diphosphate. The treated
SEG.2-SEG. 3 construct may then be purified and SEG. 1 is ligated
to the 5' terminus. A further purification step of the chimeric
polynucleotide may be performed.
[1163] Where the chimeric polynucleotide encodes a polypeptide, the
ligated or joined segments may be represented as: 5'UTR (SEG. 1),
open reading frame or ORF (SEG. 2) and 3'UTR+PolyA (SEG. 3).
[1164] The yields of each step may be as much as 90-95%.
Example 3: PCR for cDNA Production
[1165] PCR procedures for the preparation of cDNA may be performed
using 2x KAPA HIFI.TM. HotStart ReadyMix by Kapa Biosystems
(Woburn, Mass.). This system includes 2x KAPA ReadyMix 12.5 .mu.l;
Forward Primer (10 .mu.M) 0.75 .mu.l; Reverse Primer (10 PM) 0.75
.mu.l; Template cDNA 100 ng; and dH.sub.20 diluted to 25.0 .mu.l.
The reaction conditions may be at 95.degree. C. for 5 min. The
reaction may be performed for 25 cycles of 98.degree. C. for 20
sec, then 58.degree. C. for 15 sec, then 72.degree. C. for 45 sec,
then 72.degree. C. for 5 min, then 4.degree. C. to termination.
[1166] The reaction may be cleaned up using Invitrogen's
PURELINK.TM. PCR Micro Kit (Carlsbad, Calif.) per manufacturer's
instructions (up to 5 .mu.g). Larger reactions may require a
cleanup using a product with a larger capacity. Following the
cleanup, the cDNA may be quantified using the NANODROP.TM. and
analyzed by agarose gel electrophoresis to confirm that the cDNA is
the expected size. The cDNA may then be submitted for sequencing
analysis before proceeding to the in vitro transcription
reaction.
Example 4: In Vitro Transcription (IVT)
[1167] The in vitro transcription reaction generates RNA
polynucleotides. Such polynucleotides may comprise a region or part
of the polynucleotides of the disclosure, including chemically
modified RNA (e.g., mRNA) polynucleotides. The chemically modified
RNA polynucleotides can be uniformly modified polynucleotides. The
in vitro transcription reaction utilizes a custom mix of nucleotide
triphosphates (NTPs). The NTPs may comprise chemically modified
NTPs, or a mix of natural and chemically modified NTPs, or natural
NTPs.
[1168] A typical in vitro transcription reaction includes the
following:
TABLE-US-00001 1) Template cDNA 1.0 .mu.g 2) 10.times.
transcription buffer 2.0 .mu.l (400 mM Tris-HCl pH 8.0, 190 mM
MgCl.sub.2, 50 mM DTT, 10 mM Spermidine) 3) Custom NTPs (25 mM
each) 0.2 .mu.l 4) RNase Inhibitor 20 U 5) T7 RNA polymerase 3000 U
6) dH.sub.20 up to 20.0 .mu.l. and 7) Incubation at 37.degree. C.
for 3 hr-5 hrs.
[1169] The crude IVT mix may be stored at 4.degree. C. overnight
for cleanup the next day. 1 U of RNase-free DNase may then be used
to digest the original template. After 15 minutes of incubation at
37.degree. C., the mRNA may be purified using Ambion's
MEGACLEAR.TM. Kit (Austin, Tex.) following the manufacturer's
instructions. This kit can purify up to 500 .mu.g of RNA. Following
the cleanup, the RNA polynucleotide may be quantified using the
NANODROP.TM. and analyzed by agarose gel electrophoresis to confirm
the RNA polynucleotide is the proper size and that no degradation
of the RNA has occurred.
Example 5: Enzymatic Capping
[1170] Capping of a RNA polynucleotide is performed as follows
where the mixture includes: IVT RNA 60 .mu.g-180 .mu.g and
dH.sub.20 up to 72 .mu.l. The mixture is incubated at 65.degree. C.
for 5 minutes to denature RNA, and then is transferred immediately
to ice.
[1171] The protocol then involves the mixing of 10.times. Capping
Buffer (0.5 M Tris-HCl (pH 8.0), 60 mM KCl, 12.5 mM MgCl.sub.2)
(10.0 .mu.l); 20 mM GTP (5.0 .mu.l); 20 mM S-Adenosyl Methionine
(2.5 .mu.l); RNase Inhibitor (100 U); 2'-O-Methyltransferase
(400U); Vaccinia capping enzyme (Guanylyl transferase) (40 U);
dH.sub.20 (Up to 28 .mu.l); and incubation at 37.degree. C. for 30
minutes for 60 .mu.g RNA or up to 2 hours for 180 .mu.g of RNA.
[1172] The RNA polynucleotide may then be purified using Ambion's
MEGACLEAR.TM. Kit (Austin, Tex.) following the manufacturer's
instructions. Following the cleanup, the RNA may be quantified
using the NANODROP.TM. (ThermoFisher, Waltham, Mass.) and analyzed
by agarose gel electrophoresis to confirm the RNA polynucleotide is
the proper size and that no degradation of the RNA has occurred.
The RNA polynucleotide product may also be sequenced by running a
reverse-transcription-PCR to generate the cDNA for sequencing.
Example 6: PolyA Tailing Reaction
[1173] Without a poly-T in the cDNA, a poly-A tailing reaction must
be performed before cleaning the final product. This is done by
mixing capped IVT RNA (100 .mu.l); RNase Inhibitor (20 U);
10.times. Tailing Buffer (0.5 M Tris-HCl (pH 8.0), 2.5 M NaCl, 100
mM MgCl.sub.2) (12.0 .mu.l); 20 mM ATP (6.0 .mu.l); Poly-A
Polymerase (20 U); dH.sub.20 up to 123.5 .mu.l and incubation at
37.degree. C. for 30 min. If the poly-A tail is already in the
transcript, then the tailing reaction may be skipped and proceed
directly to cleanup with Ambion's MEGACLEAR.TM. kit (Austin, Tex.)
(up to 500 .mu.g). Poly-A Polymerase may be a recombinant enzyme
expressed in yeast.
[1174] It should be understood that the processivity or integrity
of the polyA tailing reaction may not always result in an exact
size polyA tail. Hence, polyA tails of approximately between 40-200
nucleotides, e.g., about 40, 50, 60, 70, 80, 90, 91, 92, 93, 94,
95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108,
109, 110, 150-165, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164
or 165 are within the scope of the present disclosure.
Example 7: Natural 5' Caps and 5' Cap Analogues
[1175] 5'-capping of polynucleotides may be completed concomitantly
during the in vitro-transcription reaction using the following
chemical RNA cap analogs to generate the 5'-guanosine cap structure
according to manufacturer protocols: 3'-O-Me-m7G(5')ppp(5') G [the
ARCA cap]; G(5')ppp(5')A; G(5')ppp(5')G; m7G(5')ppp(5')A;
m7G(5')ppp(5')G (New England BioLabs, Ipswich, Mass.). 5'-capping
of modified RNA may be completed post-transcriptionally using a
Vaccinia Virus Capping Enzyme to generate the "Cap 0" structure:
m7G(5')ppp(5')G (New England BioLabs, Ipswich, Mass.). Cap 1
structure may be generated using both Vaccinia Virus Capping Enzyme
and a 2'-O methyl-transferase to generate:
m7G(5')ppp(5')G-2'-O-methyl. Cap 2 structure may be generated from
the Cap 1 structure followed by the 2'-O-methylation of the
5'-antepenultimate nucleotide using a 2'-O methyl-transferase. Cap
3 structure may be generated from the Cap 2 structure followed by
the 2'-O-methylation of the 5'-preantepenultimate nucleotide using
a 2'-O methyl-transferase. Enzymes are preferably derived from a
recombinant source.
[1176] When transfected into mammalian cells, the modified mRNAs
have a stability of between 12-18 hours or more than 18 hours,
e.g., 24, 36, 48, 60, 72 or greater than 72 hours.
Example 8: Capping Assays
Protein Expression Assay
[1177] Polynucleotides (e.g., mRNA) encoding a polypeptide,
containing any of the caps taught herein, can be transfected into
cells at equal concentrations. The amount of protein secreted into
the culture medium can be assayed by ELISA at 6, 12, 24 and/or 36
hours post-transfection. Synthetic polynucleotides that secrete
higher levels of protein into the medium correspond to a synthetic
polynucleotide with a higher translationally-competent cap
structure.
Purity Analysis Synthesis
[1178] RNA (e.g., mRNA) polynucleotides encoding a polypeptide,
containing any of the caps taught herein can be compared for purity
using denaturing Agarose-Urea gel electrophoresis or HPLC analysis.
RNA polynucleotides with a single, consolidated band by
electrophoresis correspond to the higher purity product compared to
polynucleotides with multiple bands or streaking bands. Chemically
modified RNA polynucleotides with a single HPLC peak also
correspond to a higher purity product. The capping reaction with a
higher efficiency provides a more pure polynucleotide
population.
Cytokine Analysis
[1179] RNA (e.g., mRNA) polynucleotides encoding a polypeptide,
containing any of the caps taught herein can be transfected into
cells at multiple concentrations. The amount of pro-inflammatory
cytokines, such as TNF-alpha and IFN-beta, secreted into the
culture medium can be assayed by ELISA at 6, 12, 24 and/or 36 hours
post-transfection. RNA polynucleotides resulting in the secretion
of higher levels of pro-inflammatory cytokines into the medium
correspond to a polynucleotides containing an immune-activating cap
structure.
Capping Reaction Efficiency
[1180] RNA (e.g., mRNA) polynucleotides encoding a polypeptide,
containing any of the caps taught herein can be analyzed for
capping reaction efficiency by LC-MS after nuclease treatment.
Nuclease treatment of capped polynucleotides yield a mixture of
free nucleotides and the capped 5'-5-triphosphate cap structure
detectable by LC-MS. The amount of capped product on the LC-MS
spectra can be expressed as a percent of total polynucleotide from
the reaction and correspond to capping reaction efficiency. The cap
structure with a higher capping reaction efficiency has a higher
amount of capped product by LC-MS.
Example 9: Agarose Gel Electrophoresis of Modified RNA or RT PCR
Products
[1181] Individual RNA polynucleotides (200-400 ng in a 20 .mu.l
volume) or reverse transcribed PCR products (200-400 ng) may be
loaded into a well on a non-denaturing 1.2% Agarose E-Gel
(Invitrogen, Carlsbad, Calif.) and run for 12-15 minutes, according
to the manufacturer protocol.
Example 10: NANODROP.TM. Modified RNA Quantification and UV
Spectral Data
[1182] Chemically modified RNA polynucleotides in TE buffer (1
.mu.l) are used for NANODROP.TM. UV absorbance readings to
quantitate the yield of each polynucleotide from an chemical
synthesis or in vitro transcription reaction.
Example 11: Formulation of Modified mRNA Using Lipidoids
[1183] RNA (e.g., mRNA) polynucleotides may be formulated for in
vitro experiments by mixing the polynucleotides with the lipidoid
at a set ratio prior to addition to cells. In vivo formulation may
require the addition of extra ingredients to facilitate circulation
throughout the body. To test the ability of these lipidoids to form
particles suitable for in vivo work, a standard formulation process
used for siRNA-lipidoid formulations may be used as a starting
point. After formation of the particle, polynucleotide is added and
allowed to integrate with the complex. The encapsulation efficiency
is determined using a standard dye exclusion assays.
Example 12: Immunogenicity Study
[1184] The instant study is designed to test the immunogenicity in
mice of candidate Malaria vaccines comprising a mRNA polynucleotide
encoding CS protein, LSA1, MSP1, AMA1, TRAP or a combination
thereof obtained from Plasmodium.
[1185] Mice are immunized intramuscularly (IM), or intradermally
(ID) with mRNA encoding CS protein, LSA1, MSP1, TRAP and AMA1. Up
to three immunizations are given at 3-week intervals (i.e., at
weeks 0, 3, and 6), and sera are collected after each immunization
until weeks 33-51. Serum antibody titers against CS protein, LSA1,
MSP1 and AMA1 are determined by ELISA. Responses against Plasmodium
sporozoites, asexual blood-stage parasites, and gametocytes were
determined by using an indirect immunofluorescence assay (IFA). T
cell responses were analyzed by Elispot using splenocytes from
immunized mice and stimulated with peptide pools from the relevant
antigens.
Example 13: Plasmodium Non-Human Primate Challenge
[1186] The instant study is designed to test the efficacy in
simians of candidate Malaria vaccines against a lethal challenge
using a Malaria vaccine comprising mRNA encoding CS protein, LSA1,
MSP1, AMA1, TRAP or a combination thereof obtained from Plasmodium.
Simians are challenged with a lethal dose of Plasmodium.
[1187] Simians are immunized intramuscularly (IM) or intradermally
(ID) at week 0, week 3 and week 6 with candidate Malaria
vaccines.
[1188] Serum antibody titers against CS protein, LSA1, MSP1 and
AMA1 are determined by ELISA. Responses against Plasmodium
sporozoites, asexual blood-stage parasites, and gametocytes were
determined by using an indirect immunofluorescence assay (IFA). T
cell responses were analyzed by Elispot using PBMCs from immunized
primates and stimulated with peptide pools from the relevant
antigens.
[1189] In experiments where a lipid nanoparticle (LNP) formulation
is used, the formulation may include a cationic lipid, non-cationic
lipid, PEG lipid and structural lipid in the ratios 50:10:1.5:38.5.
The cationic lipid may be DLin-KC2-DMA (50 mol %), the non-cationic
lipid may be DSPC (10 mol %), the PEG lipid may be PEG-DOMG (1.5
mol %) and the structural lipid may be cholesterol (38.5 mol %),
for example.
Example 14: Plasmodium Human Challenge
[1190] The instant study is designed to test the efficacy in human
subjects of candidate Malaria vaccines against an attenuated
challenge (Controlled Human Malaria Infection (CHMI) Study) using a
Malaria vaccine comprising mRNA encoding CS protein, LSA1, MSP1,
AMA1, TRAP or a combination thereof obtained from Plasmodium.
Subjects are challenged with an attenuated (non-lethal) dose of
Plasmodium.
[1191] Subjects are immunized intramuscularly (IM) or intradermally
(ID) at week 0 and week 3 with candidate Malaria vaccines. Serum is
tested for microneutralization (see Example 16). The subjects are
then challenged with an attenuated dose of Plasmodium on week 7 via
IV, IM or ID. Endpoint is day 13 post infection. Body temperature
and weight are assessed and recorded daily.
[1192] In experiments where a lipid nanoparticle (LNP) formulation
is used, the formulation may include a cationic lipid, non-cationic
lipid, PEG lipid and structural lipid in the ratios 50:10:1.5:38.5.
The cationic lipid may be DLin-KC2-DMA (50 mol %), the non-cationic
lipid may be DSPC (10 mol %), the PEG lipid may be PEG-DOMG (1.5
mol %) and the structural lipid may be cholesterol (38.5 mol %),
for example.
Example 15: Microneutralization Assay
[1193] Nine serial 2-fold dilutions (1:50-1:12,800) of simian or
human serum are made in 50 .mu.l virus growth medium (VGM) with
trypsin in 96 well microtiter plates. Fifty microliters of
Plasmodium are added to the serum dilutions and allowed to incubate
for 60 minutes at room temperature (RT). Positive control wells of
Plasmodium without sera and negative control wells without
Plasmodium or sera are included in triplicate on each plate. While
the serum-Plasmodium mixtures incubate, a single cell suspension of
cells is prepared by trypsinizing (Gibco 0.5% bovine pancrease
trypsin in EDTA) a confluent monolayer, and suspended cells are
transferred to a 50 ml centrifuge tube, topped with sterile PBS and
gently mixed. The cells are then pelleted at 200 g for 5 minutes,
supernatant aspirated and cells resuspended in PBS. This procedure
is repeated once and the cells are resuspended at a concentration
of 3.times.10.sup.5/ml in VGM with porcine trypsin. Then, 100 .mu.l
of cells are added to the serum-virus mixtures and the plates
incubated at 35.degree. C. in CO.sub.2 for 5 days. The plates are
fixed with 80% acetone in phosphate buffered saline (PBS) for 15
minutes at RT, air dried and then blocked for 30 minutes containing
PBS with 0.5% gelatin and 2% FCS. An antibody to CS protein, LSA1,
MSP1, AMA1 or TRAP is diluted in PBS with 0.5% gelatin/2% FCS/0.5%
Tween 20 and incubated at RT for 2 hours. Wells are washed and
horse radish peroxidase conjugated goat anti-mouse IgG added,
followed by another 2 hour incubation. After washing,
0-phenylenediamine dihydrochloride is added and the neutralization
titer is defined as the titer of serum that reduced color
development by 50% compared to the positive control wells.
Example 16: JEV Immunogenicity Study
[1194] This study was designed to test the immunogenicity of JEV
prME mRNA vaccines in Balb/c mice. Mice were 6-8 weeks old.
[1195] Mice were immunized intramuscularly at three different doses
(10 .mu.g, 2 .mu.g and 0.5 .mu.g). All mice were given two doses of
the vaccine, one at day 0 and another at day 28. Serum was
collected at days 0 and 56, and a plaque reduction neutralization
test was used to quantify neutralizing antibody titer. The
concentration of serum to reduce the number of plaques in the assay
by 50%, compared to the serum free virus, denoted as PRNT50 was
used as a measure of neutralizing antibodies and level of
protection against virus.
[1196] Results of this study is shown in FIG. 1. A PRNT50 titer of
greater than 1:10 is considered protective. JEV mRNA vaccine at 10
.mu.g doses results in a very high titer, indicative of a high
potency vaccine.
Example 17: Immunogenicity Cross-Neutralization Study
[1197] The instant study is designed to test the immunogenicity and
cross-neutralization in mice of candidate combination vaccines
comprising a mRNA polynucleotide encoding antigenic polypeptides
(e.g., envelope proteins) obtained from Plasmodium, JEV, WNV, EEEV,
VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV.
[1198] Mice are immunized intravenously (IV), intramuscularly (IM),
or intradermally (ID) with candidate combination vaccines. A total
of four immunizations are given at 3-week intervals (at weeks 0, 3,
6, and 9), and sera are collected after each immunization until
weeks 33-51. Serum antibody titers against envelope proteins are
determined by ELISA. Sera collected from each mouse during weeks
10-16 are pooled, and total IgGs are purified by using ammonium
sulfate (Sigma) precipitation followed by DEAE (Pierce) batch
purification. Following dialysis against PBS, the purified
antibodies are used for immunoelectron microscopy,
antibody-affinity testing, and an in vitro protection assay.
Example 18: Immunogenicity Studies for Combination RNA Vaccine
[1199] BALB/C mice are immunized with mRNA encoded Plasmodium, JEV,
WNV, EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV antigenic
polypeptides, for example, as shown in Table 7 below and according
to the following dosing/bleeding schedule: prime dose on day 0,
boost dose on day 28, bleeding on days 0, 28, 42 and 56.
[1200] The mice are administered a combination vaccine, combining
two or more of the Plasmodium, JEV, WNV, EEEV, VEEV, SINV, CHIKV,
DENV, ZIKV and/or YFV antigenic polypeptides, such that all
possible combinations are tested. Animals are challenged at day 56
with a second dose of any one of the antigenic polypeptides
included in the original dose.
[1201] An efficacy study using mRNA encoded West Nile prMEs and
Japanese Encephalitis prMEs antigens is also performed according to
the following schedule:
[1202] Non-human primates are also immunized with mRNA encoded
antigen using similar schedules shown in Tables 7 and 8. The
animals are tested for immunogenicity to Plasmodium, JEV, WNV,
EEEV, VEEV, SINV, CHIKV, DENV, ZIKV and/or YFV and combinations
thereof.
Example 19. YFV Immunogenicity Studies
[1203] The instant study is designed to test the immunogenicity in
Balb/c mice of candidate yellow fever virus (YFV) vaccines
comprising a mRNA polynucleotide encoding YFV prME. Four groups of
Balb/c mice (n=5) are immunized intramuscularly (IM) with 10 .mu.g
(n=2) or 2 .mu.g (n=2) of the candidate vaccine. One group of mice
is administered PBS intramuscularly as a control. All mice are
administered an initial dose of vaccine (Groups 1-4) or PBS (Group
5) on Day 0, and then the mice in Groups 1 and 3 are administered a
boost dose on Day 21, while the mice in Group 5 are administered
PBS on Day 21. All mice are bled on Day 41. See Table 1.
Anti-Yellow fever neutralization IgG titer is determined on Day -1,
Day 28 and Day 41.
Example 20. YFV Rodent Challenge
[1204] The instant study is designed to test the efficacy in AG129
mice of candidate yellow fever virus (YFV) vaccines against a
lethal challenge using a YFV vaccine comprising mRNA encoding YFV
prME. Four groups of AG129 mice (n=8) are immunized intramuscularly
(IM) with 10 .mu.g (n=2) or 2 .mu.g (n=2) of the candidate vaccine.
One group of mice is administered PBS intramuscularly as a control.
All mice are administered an initial dose of vaccine (Groups 1-4)
or PBS (Group 5) on Day 0, and then the mice in Groups 1 and 3 are
administered a boost dose on Day 21, while the mice in Group 5 are
administered PBS on Day 21. All mice are challenged with a lethal
dose of YFV in Day 42. All mice are then monitored for survival and
weight loss. Anti-Yellow fever neutralization IgG titer is
determined on Day -1, Day 28 and Day 41, and viral load is
determined 5 days post challenge.
Example 21. Expression of ZIKV prME Protein in Mammalian Cells
Using ZIKV mRNA Vaccine Construct
[1205] The Zika virus (ZIKV) prME mRNA vaccine construct were
tested in mammalian cells (239T cells) for the expression of ZIKV
prME protein. 293T cells were plated in 24-well plates and were
transfected with 2 .mu.g of ZIKV prME mRNA using a Lipofectamine
transfection reagent. The cells were incubated for the expression
of the ZIKV prME proteins before they were lysed in an
immunoprecipitation buffer containing protease inhibitor cocktails.
Reducing agent was not added to the lysis buffer to ensure that the
cellular proteins were in a non-reduced state. Cell lysates were
centrifuged at 8,000.times.g for 20 mins to collect lysed cell
precipitate. The cell precipitates were then stained with anti ZIKV
human serum and goat anti-human Alexa Fluor 647. Fluorescence was
detected as an indication of prME expression.
[1206] The expression of ZIKV prME protein was also detected by
fluorescence-activated cell sorting (FACS) using a flow cytometer.
293F cells (2.times.10.sup.6 cells/ml, 30 ml) were transfected with
120 .mu.g PEI, 1 ml of 150 mM NaCl, and 60 .mu.g prME mRNA.
Transfected cells were incubated for 48 hours at 37.degree. C. in a
shaker at 130 rpm and under 5% CO.sub.2. The cells were then washed
with PBS buffer containing 2% FBS and fixed in a fixation buffer
(PBS buffer containing formalin) for 20 minutes at room
temperature. The fixed cells were permeabilized in a
permeabilization buffer (PBS+1% Triton X100+1 .mu.l of Golgi
plug/ml of cells). The permeabilized cells were then stained with
anti-ZIKV human serum (1:20 dilution) and goat anti-human Alexa
Fluor 647 secondary antibody, before they were sorted on a flow
cytometer. As shown in FIG. 2, FIG. 3A and FIG. 3B, cells
transfected with prME mRNA and stained with the anti-ZIKA human
serum shifted to higher fluorescent intensity, indicating that prME
expressed from the ZIKV mRNA vaccine constructs in the transfected
cells.
Example 22. Expression, Purification and Characterization of ZIKV
VLPs
[1207] Zika virus (ZIKV) virus-like particles (VLPs) were made in
HeLa cells and in HEK293T cells and purified via PEG precipitation
or ultracentrifugation, respectively. Cells were cultured in
culture media. Prior to transfection, cells were passaged twice in
virus growth media plus 10% fetal bovine serum (FBS) to media
adaptation.
[1208] Cells were seeded the day before transfection into T-175
flask. 100 .mu.g of prME-encoding mRNA was transfected using 100
.mu.g pf lipofectamine as per manufacturer's protocol. 6 hours post
transfection, monolayers were washed twice with 1.times.PBS and 20
mL of virus growth media was added. Supernatant was collected 24-48
hours post transfection by centrifugation at 2000.times.g for 10
mins and 0.22 pm filtration.
[1209] For VLP purification via PEG precipitation, VLP's were
concentrated using Biovision PEG precipitation kit as per
manufacturer's protocol. In brief, supernatant with VLP's was mixed
with PEG8000 and incubated at 4.degree. C. for 16 hours. After
incubation, mixture was centrifuged at 3000.times.g for 30 mins.
Pellet containing concentrated VLP's was collected and suspended
into PBS. VLP's were further buffer exchanged into PBS (1:500)
using amicon ultra 100MWCO filter. Purified samples were negative
stained to show the presence of assembled VLP particles.
[1210] Expression of prME from the vaccine mRNA constructs was
demonstrated to result in the production of virus like particles
(VLPs) that are expected to present to the immune system as
identical to Zika virus particles. Negative stain electron
micrographs of supernatants from HeLa cells transfected with mRNA
encoding Zika prME showed that the virus-like particles (VLPs),
purified by PEG precipitation, have highly uniform size
(.about.35-40 nm) and morphology. The bumpy appearance of the VLP
surface appears to reflect mostly immature morphology due to
expression from HeLa cells, which have very low expression of
furin, a host protease that is required for maturation the viral
envelope. Upon maturation, these VLPs will have an exterior
structure essentially identical to wild type viral particles, thus
eliciting a broad immune response to future Zika virus
exposure.
[1211] For VLP purification via ultracentrifugation, 293T cells
were transfected with Zika prME mRNA as described herein.
Supernatant was collected 24 hours after changing the media as
described herein (30 hours post transfection). VLPs were
concentrated using Biovision PEG virus precipitation kit into 500
.mu.L volume. VLPs were further purified using a 10-50% sucrose
gradient. Sample layer was seen between 20-30% sucrose layers and
collected. VLPs were buffered exchanged into PBS by 1:1000 dilution
using a 100MWCO amicon ultra filter. VLPs were concentrated after
PEG precipitation, and ultracentrifuge-purified VLPs were analyzed
for purity on a reducing SDS-PAGE gel (FIG. 4).
Example 23: ZIKV mRNA Vaccine Immunogenicity Studies
[1212] The instant study was designed to test the immunogenicity in
Balb/c mice of candidate ZIKV vaccines comprising a mRNA
polynucleotide encoding ZIKV prME. Four groups of Balb/c mice (n=5)
were immunized intramuscularly (IM) with 10 .mu.g (n=2) or 2 .mu.g
(n=2) of the candidate vaccine. One group of mice was administered
PBS intramuscularly as a control. All mice were administered an
initial dose of vaccine (Groups 1-4) or PBS (Group 5) on Day 0, and
then the mice in Groups 1 and 3 were administered a boost dose on
Day 21, while the mice in Group 5 were administered PBS on Day 21.
All mice were bled on Day 41. See Table 29. Anti-Zika
neutralization IgG titer was determined on Day -1, Day 28 and Day
41 (FIG. 5).
[1213] Day 42 neutralizing titers reached EC50s of 427 for 2 g and
690 for 10 .mu.g. The control serum in this experiment was from
naturally infected immunocompromised mice (Ifnar1-/-, derived from
B/6 lineage) in which high viral loads would be achieved.
Example 24: ZIKV Rodent Challenge
[1214] The instant study was designed to test the efficacy in AG129
mice of candidate ZIKV vaccines against a lethal challenge using a
ZIKV vaccine comprising mRNA encoding ZIKV prME. Four groups of
AG129 mice (n=8) were immunized intramuscularly (IM) with 10 .mu.g
(n=2) or 2 .mu.g (n=2) of the candidate vaccine. One group of mice
was administered PBS intramuscularly as a control. All mice were
administered an initial dose of vaccine (Groups 1-4) or PBS (Group
5) on Day 0, and then the mice in Groups 1 and 3 were administered
a boost dose on Day 21, while the mice in Group 5 were administered
PBS on Day 21. All mice were challenged with a lethal dose of ZIKV
in Day 42. All mice were then monitored for survival and weight
loss. Anti-Zika neutralization IgG titer was determined on Day -1,
Day 28 and Day 41, and viral load was determined 5 days post
challenge. The 10 .mu.g dose provided 100% protection, even with a
single dose, and the 2 .mu.g dose provided 60% protection with a
single dose and 90% protection with prime-boost doses (see FIGS. 7A
and 7B).
[1215] In experiments where a lipid nanoparticle (LNP) formulation
is used, the formulation may include a cationic lipid, non-cationic
lipid, PEG lipid and structural lipid in the ratios 50:10:1.5:38.5.
The cationic lipid may be DLin-KC2-DMA or DLin-MC3-DMA (50 mol %),
the non-cationic lipid may be DSPC (10 mol %), the PEG lipid is
PEG-DOMG or PEG-DMG (1.5 mol %) and the structural lipid may be
cholesterol (38.5 mol %), for example.
Example 25: Exemplary Dengue Sequences
[1216] An exemplary Dengue virus (DENV) peptide epitope may include
two or more epitopes. The epitopes can be of the same sequence or
different sequence and can be all T-cell epitopes, all B-cell
epitopes or a combination of both. Furthermore, various end units
for enhancing MHC processing of the peptides are possible.
[1217] The following sequences represent exemplary DENV peptide
epitopes identified using a database screen (the sequences
correspond to SEQ ID NO: 357-360):
TABLE-US-00002 DenV1 1
MRCVGIGNRDFVEGLSGATNVDVVLEHGSCVTTMAKDKPTLDIELLKTEVTNPAVLRKLCIEA-
KISNTTTDSRCPTQGEA 80 DenV2 1
MRCIGISNRDFVEGVSGGSNVDIVLEHGSCVTTMAKNKPTLDFELIKTEAKQPATLRKYCIEAK-
LTNTTTESRCPTQGEP 80 DenV3 1
MRCVGVGNRDFVEGLSGATWVDVVLEHGGCVTTMAKNKPTLDIELQKTEATQLATLRKLCIEGK-
ITNITTDSRCPTQGEA 80 DenV4 1
MRCVGVGNRDFVEGVSGGAWVDLVLEHGGCVTTMAQGKPTLDFELTKTTAKEVALLRTYCIEAS-
ISNITTATRCPTQGEP 80 DenV1 81
TLVEEQDANFVCRRTFVCRGAGNGCGLFGKGSLLTCAKFKCVTKLEGKIVQYENLKYSVIVTVH-
TGDQHQVGNETTEHGT 160 DenV2 81
TLNEEQDKRFVCKHSMVDRGWGNGCGLFGKGGIVTCAMFTCKKNMEGKIVQPENLEYTVVITPH-
SGEEHAVGNDTGKHGK 160 DenV3 81
ILPEEQDQNYVCKHTYVDRGWGNGCGLFGKGSLVTCAKFQCLESIEGKIVQHENLKYTVIITVH-
TGDQHQVGNET--QGV 158 DenV4 81
YLKEEQDQQYICRRDVVDRGWGNGCGLFGKGGVVTCAKFSCSGKITGNLVQIENLEYTVVVTVH-
NGDTHAVGNDTSNHGV 160 DenV1 161
IATITPQAPTSEIQLTDYGALTLDCSPRTGLDFNFMVLLTMKEKSWLVHKQWFLDLPLPWTSGA-
STSQETWNRQDLLVTF 240 DenV2 161
EVKITPQSSITEAELTGYGTVTMECSPRTGLDFNFMVLLQMKDKAWLVHRQWFLDLPLPWLPGA-
DTQGSNWIQKETLVTF 240 DenV3 159
TAEITSQASTAEAILPEYGTLGLECSPRTGLDFNFMILLTMKDKAWMVHRQWFFDLPLPWTSGA-
TTKTPTWNRKELLVTF 238 DenV4 161
TAMITPRSPSVEVKLPDYGELTLDCEPRSGIDFNFMILMKNKKKTWLVHKQWFLDLPLPWTAGA-
DTSEVHWNYKERMVTF 240 DenV1 241
KTAHAKKQEAVVLGSQEGAMHTALTGATEIQTSGTTTIFAGHLKCRLKMDKLTLKGISYVMCTG-
SFKLEKEVAETQHGTV 320 DenV2 241
KNPHAKKQDVVVLGSQEGAMHTALTGATEIQMSSGNLLFTGHLKCALRMDKLQLKGMSYSMCTG-
KFKVVKEIAETQHGTI 320 DenV3 239
KNAHAKKQEVVVLGSQEGAMHTALTGATEIQTSGGTSIFAGHLKCRLKMDKLKLKGMSYAMCLN-
TFVLKKEVSETQHGTI 318 DenV4 241
KVPHAKRQDVTVLGSQEGAMHSALAGATEVDSGDGNHMFAGHLKCKVRMEKLRIKGMSYTMCSG-
KFSIDKEMAETQHGTT 320 DenV1 321
LVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLVTANPIVTDKEKPVNIEAEPPFGESYIVVGAGE-
KALKLSWFKKGSSIGK 400 DenV2 321
VIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEP-
DQLKLNWFKK------ 394 DenV3 319
LIKVEYKGEDAPCKIPFSTEDGQGKAHNGRLITANPVVTKKEEPVNIEAEPPFGESNIVIGIGD-
KALKINWYRK------ 392 DenV4 321
VVKVKYEGAGAPCKVPIEIRDVNKEKVVGRIISSTPLAENTNSVTNIELEPPFGDSYIVIGVGN-
SALTLHWFRKGSSIGK 400
[1218] Nucleic acid and amino acid sequences for each of DENV-1,
DENV-2, DENV-3, and DENV-4 are shown in Tables 28 and 29,
respectively.
Example 26: Dengue Virus RNA Vaccine Immunogenicity in Mice
[1219] This study provides a preliminary analysis of the
immunogenicity of a nucleic acid mRNA vaccine using a Dengue virus
(DENV) serotype 2 antigen in BALB/c mice. The study utilizes 44
groups of 10 BALB/c female (5) and male (5) mice (440 total, 6-8
weeks of age at study initiation, see Table 10 for design summary).
In this study, construct numbers used are referenced and found in
Table 28.
[1220] Mice were vaccinated on weeks 0 and 3 via intramuscular (IM)
or intradermal (ID) routes. One group remained unvaccinated and one
was administered 10.sup.5 plaque-forming units (PFU) live DENV2,
D2Y98P isolate via intravenous (IV) injection as a positive
control. Serum was collected from each mouse on weeks 1, 3, and 5;
bleeds on weeks 1 and 3 were in-life samples (tail vein or
submandibular bleeds) and week 5 will be a terminal (intracardiac)
bleed. Individual serum samples were stored at -80.degree. C. until
analysis by neutralization or microneutralization assay. Pooled
samples from each group at the week 5 time points were tested by
Western blot for reactivity with viral lysate.
[1221] Signal was detected in groups 5, 15, 39, and 44 (live virus
control) by a band that appeared between 50 and 60 kDa in the
Western blot data. The data suggests that a mRNA vaccine to a
single dengue viral antigen can produce antibody in preliminary
studies.
[1222] In order to provide a Dengue vaccine having enhanced
immunogenicity, RNA vaccines for concatemeric antigens were
designed and tested according to the invention. These vaccines,
which have significantly enhanced activity, in comparison to the
single protein antigens described herein, are described below.
Example 27: In Silico Prediction of T Cell Epitopes for RNA Vaccine
Design
[1223] Several peptide epitopes from Dengue virus were generated
and tested for antigenic activity. The peptide epitopes are
designed to maximize MHC presentation. In general the process of
MHC class I presentation is quite inefficient, with only 1 peptide
of 10,000 degraded molecules actually being presented. Additionally
the priming of CD8 T cell with APCs having insufficient densities
of surface peptide/MHC class I complexes results in weak responders
exhibiting impaired cytokine secretion and a decrease memory pool.
Thus, the process of designing highly effective peptide epitopes is
important to the immunogenicity of the ultimate vaccine.
[1224] In silico prediction of desirable peptide epitopes was
performed using Immune Epitope Database. Using this database
several immunogenic Dengue T cell epitopes showing strong homology
across all 4 Dengue serotypes were predicted. Examples of these
epitopes are shown in FIGS. 8A-8C and 9A-9C.
Example 28: Prediction of DENV T Cell Epitopes for RNA Vaccine
Design
[1225] The design of optimized vaccination systems to prevent or
treat conditions that have failed to respond to more traditional
treatments or early vaccination strategies relies on the
identification of the antigens or epitopes that play a role in
these conditions and which the immune system can effectively
target. T cell epitopes (e.g., MHC peptide binding) for the various
alleles shown in Table 32 were determined using Rapid Epitope
Discovery System (ProImmune REVEAL & ProVE.RTM.--see Tables
33-40 for peptides). This system is used to identify those
candidate epitopes that actually cause relevant immune responses
from the numerous other potential candidates identified using
algorithms to predict MHC-peptide binding. The REVEAL binding assay
determines the ability of each candidate peptide to bind to one or
more MHC I class alleles and stabilize the MHC-peptide complex. The
assay identifies the most likely immunogenic peptides in a protein
sequence by comparing the binding to that of a high affinity T cell
epitope and detecting the presence or absence of the native
conformation of the MHC-peptide complex. The epitope peptides are
further tested using the assays described herein to confirm their
immunogenic activity.
Example 29: Activity Testing for Predicted Peptide Epitopes
[1226] Exemplary peptide epitopes selected using the methods
described above were further characterized. These peptide epitopes
were confirmed to have activity using in vitro HLA binding assays
(human lymphocyte binding assays). Peptides (9 aa peptides from the
dengue antigen) were screened for their ability to bind to HLA. The
analysis of the homology, affinity, frequency and design of these
peptides is shown in FIGS. 8A-8C and 9A-9C.
Example 30: In Vivo Analysis of Mimectopes of Predicted Human
Epitopes RNA Vaccines Methods
[1227] IFN.gamma. ELISpot. Mouse IFN.gamma. ELISpot assays were
performed using IFN.gamma. coated Millipore IP Opaque plates
according to the manufacturer's mouse IFN.gamma. ELISPOT
guidelines.
[1228] Briefly, the plates were blocked using complete RPMI (R10)
and incubated for 30 minutes prior to plating cells. Peptides
(284-292, 408-419 or 540-548) were diluted to 5 different
concentrations for stimulation at 5, -6, -7, -8, or -9 from an
original stock concentration of 10 mM.sup.(-2). Mouse splenocytes
(200,000-250,000 cells) were plated in appropriate wells with
peptide, PMA+Ionomycin or R10 media alone. Cells were stimulated in
a total volume of 125 .mu.L per well. Plates were then incubated at
37.degree. C., 5% CO.sub.2 for 18-24 hrs. Plates were developed
following the manufacturer's instructions. Plates were counted and
quality controlled using the automated ELISPOT reader CTL
ImmunoSpot/FluoroSpot.
[1229] Intracellular Cytokine Staining (ICS). Intracellular
Cytokine Staining (ICS). For intracellular cytokine staining,
individual splenocytes, were resuspended at a concentration of
1.5.times.10.sup.6 cells per mL. Peptides (284-292, 408-419 or
540-548) were made into 5 dilutions from a stock concentration of
10 mM.sup.(-2). The final concentrations of each peptide were -5,
-6, -7, -8, or -9 in their respective wells. Cells were stimulated
in a final volume of 200 .mu.L within a 96 well culture plate.
After the addition of Golgi plug (0.2 .mu.L per well), cells were
incubated at 37.degree. C., 5% CO.sub.2 for 5 hours. Following
stimulation, cells were surface stained, fixed, washed and put at
4.degree. C. overnight. Intracellular staining was performed the
following day, resulting in full panel of Live/Dead (Invitrogen),
.alpha.CD3, .alpha.CD4, .alpha.CD8, .alpha.CD45, .alpha.CCR7,
.alpha.CD44, .alpha.CD25, .alpha.IL-2, .alpha.IFN.gamma., and
.alpha.TNF.alpha. (BD Biosciences). Cells were acquired in a 96-U
bottom plate using BD LSR Fortessa HTS (BD Biosciences).
Results
[1230] The exemplary peptide epitopes selected using the methods
described herein were used to produce tests mouse mimectopes of the
predicted human epitopes. These mimectopes were analyzed for in
vivo activity using restimulation assays during the acute phase of
Dengue infection (Day 7). The methods were performed on
dengue-infected IFN.alpha..beta./.gamma.-receptor-deficient mice
(AG129). Seven days post infection splenocytes were harvested and
subjected to an ELISPOT assay to quantify secretion of cytokines by
T cells (CD8) as described above. Briefly, the isolated splenocytes
were stimulated with the test peptides and tested for T cell
activation. If the peptide is an appropriate antigen, some cells
would be present antigen during infection and would be capable of
stimulating T cells. The methods for analyzing the T cell
activation were performed as follows: [1231] T cells (at a known
concentration) were incubated with a specific antigen in a cell
culture well [1232] the activated T cells were transferred to
ELISPOT plates (precoated with anti-cytokine antibody) [1233] the
cells were incubated such that cytokines could be secreted [1234]
the cells were washed off the plate and enzyme coupled secondary Ig
was added [1235] the plates were washed and substrate was added
[1236] positive spots were scored under microscope.
[1237] The data is shown in FIGS. 10 and 11. FIGS. 10 and 11 are
graphs depicting the results of an ELISPOT assay of dengue-specific
peptides measuring IFN-.gamma. (spots per million splenocytes).
[1238] A schematic of an assay on a BLT Mouse Model (Bone
Marrow/Liver/Thymus) is shown in FIG. 12. The results of a
histogram analysis of human CD8 T cells stimulated with peptide
epitope is also shown in FIG. 12.
The following two sequences were used as controls:
TABLE-US-00003 (V5)8-cathb: (SEQ ID NO: 361) Kozak Start
GKPIPNPLLGLDST-GFLG-GKPIPNPLLGLDST-
GFLG-GKPIPNPLLGLDST-GFLG-GKPIPNPLLGLDST-GFLG-
GKPIPNPLLGLDST-GFLG-GKPIPNPLLGLDST-GFLG-
GKPIPNPLLGLDST-GFLG-GKPIPNPLLGLDST Stop (v5)8-cathb + MHCi: (SEQ ID
NO: 362) Kozak Start GKPIPNPLLGLDST-GFLG-GKPIPNPLLGLDST-
GFLG-GKPIPNPLLGLDST-GFLG-GKPIPNPLLGLDST-GFLG-
GKPIPNPLLGLDST-GFLG-GKPIPNPLLGLDST-GFLG-
GKPIPNPLLGLDST-GFLG-GKPIPNPLLGLDST Stop
Some results are shown in Table 41.
Example 31: AG129 Mouse Challenge of Mimectopes of Predicted Human
Epitopes from DENV2
[1239] A study is performed on AG129 mouse using a cocktail of 2
peptide epitopes. The immunogenicity of the peptide epitopes is
determined in AG129 mice against challenge with a lethal dose of
mouse-adapted DENV 2 strain D2Y98P. AG129 mice, which lack IFN
.alpha./.beta. and .gamma. receptor signaling, injected
intradermally in the footpad with 10.sup.4 PFU of DENV do not
survive past day 5 post-injection. AG129 mice are vaccinated via
intramuscular (IM) injection with either 2 .mu.g or 10 .mu.g of a
cocktail of 2 peptide epitopes. The vaccines are given to AG129
mice with a prime and a boost (day 0 and day 28). The positive
control group is vaccinated with heat-inactivated DENV 2.
Phosphate-buffered saline (PBS) is used as a negative control. On
day 56, mice are challenged with mouse-adapted DENV 2 and monitored
for 10 days for weight loss, morbidity, and mortality. Mice that
display severe illness, defined as >30% weight loss, a health
score of 6 or above, extreme lethargy, and/or paralysis are
euthanized.
Example 32: "Humanized" DENV Peptides Mouse Immunogenicity
Study
[1240] A study analyzing immunogenicity of the peptide epitopes on
humanized mice is performed. A single-dose cocktail (30 .mu.g)
containing 3 different peptide epitopes are delivered by IM route
of immunization with prime and boost (day 0, day 28). A T cell
(ELISPOT and ICS) characterization may be performed on Day 7, Day
28, and Day 56.
Example 33: Testing of Non-Human Primate (NHP) Mimectopes of
Predicted DENV Human Epitopes
[1241] Non-human primate (NHP) mimectopes to the human epitopes may
also be developed and tested for activity in NHP assays. The NHP
mimectopes are designed based on the human antigen sequence. These
mimectopes may be analyzed for in vivo activity in an NHP model
using, for instance, restimulation assays. Once the NHPs have been
infected, immune cells may be isolated and tested for sensitivity
of activation by the particular mimectopes.
Example 34: Targeting of DENV Concatemeric Constructs Using
Cytoplasmic Domain of MHC 1
[1242] MHC-1_V5 concatemer constructs were developed and
transfected in HeLa cells. Triple immunofluorescence using
Mitotracker Red (mitochondria), anti-V5, and anti-MHC-1 antibodies
plus DAPI was performed. MHC-1_V5 concatemer transfection in HeLa
cells shows V5-MHC1 colocalization. MHC-1_V5 concatemer
transfection also shows V5 has homogeneous cytoplasmic distribution
and preferentially colocalizes with MHC1 and not with Mitotracker.
These data demonstrate that the V5 concatemer with the cytoplasmic
domain from MHC class I co-localizes with MHC class I expression,
while the V5 concatemer without this sequence is only found in the
cytoplasm following transfection in HeLa cells.
Example 35: In Vivo Analysis of DENV Concatemeric mRNA Epitope
Construct
[1243] The Dengue concatemers used in this study consist of 8
repeats of the peptide TALGATEI (SEQ ID NO: 363), a mouse CD8 T
cell epitope found in the DENV2 envelope. The peptide repeats were
linked via cathepsin B cleavage sites and modified with the various
sequences as follows: [1244] (1) TALGATEI (SEQ ID NO: 363) peptide
concatemer with no modification [1245] (2) TALGATEI (SEQ ID NO:
363) peptide concatemer with IgKappa signal peptide [1246] (3)
TALGATEI (SEQ ID NO: 363) peptide concatemer with PEST sequence
[1247] (4) TALGATEI (SEQ ID NO: 363) peptide concatemer with
IgKappa signal peptide and PEST sequence [1248] (5) TALGATEI (SEQ
ID NO: 363) peptide concatemer with MHC class I cytoplasmic domain
[1249] (6) TALGATEI (SEQ ID NO: 363) peptide concatemer with
IgKappa signal peptide and MHC class I cytoplasmic domain [1250]
(7) Heat-inactivated DENV2 (D2Y98P) [1251] (8) No immunization
[1252] The immunogenicity of the peptide concatemeric candidate
vaccines was determined in AG129 mice against challenge with a
lethal dose of DENV strain D2Y98P. AG129 mice, which lack IFN
.alpha./.beta. and .gamma. receptor signaling, injected
intradermally in the footpad with 10.sup.4 PFU of DENV do not
survive past day 5 post-injection. (In this study, the mice died
due to a problem with the heat-attenuation). The tested vaccines
included constructs (1)-(8) disclosed above. AG129 mice were
vaccinated via intramuscular (IM) injection with either 2 .mu.g or
10 .mu.g of the candidate vaccine. The vaccines were given to AG129
mice as a prime and a boost (second dose provided 28 days after the
first dose). The positive control group was vaccinated with
heat-inactivated DENV2. Phosphate-buffered saline (PBS) was used as
a negative control.
[1253] On day 56, mice were challenged with mouse-adapted DENV2 and
monitored for 10 days for weight loss, morbidity, and mortality.
Mice that displayed severe illness, defined as >30% weight loss,
a health score of 6 or above, extreme lethargy, and/or paralysis
were euthanized. Notably, mice "vaccinated" with heat-inactivated
DENV (positive control group) became morbid and died (they were not
included in the challenge portion of the study).
[1254] In addition, individual serum samples were collected prior
to challenge on day 54 and PBMCs were isolated and frozen for
subsequent testing.
[1255] The AG129 mice PBMCs were thawed and stimulated with
TALGATEI (SEQ ID NO: 363) peptide for 5 hours in a standard
intracellular cytokine assay. For intracellular cytokine staining,
PBMCs were thawed and suspended in media. The TALGATEI (SEQ ID NO:
363) peptide was administered to stimulate the cells. After the
addition of Golgi plug, cells were incubated at 37.degree. C., 5%
CO.sub.2 for 5 hours. Following stimulation, cells were surface
stained, fixed, washed and put at 4.degree. C. overnight.
Intracellular staining was performed the following day and assayed
via ELISPOT assay to quantify secretion of cytokines by T cells
(CD8) as described above to determine T cell activation. If the
peptide were an appropriate antigen, some cells would be present
antigen during infection and would be capable of stimulating T
cells. The results are shown in FIGS. 13A and 13B, which
demonstrate that each of the peptides (1)-(6) stimulate T cell
activation.
Example 36: Surface-Expressed DENV2 prME Antigens
[1256] The DENV2 prME polypeptide antigen sequences provided in
Tables 28 and 29 were tested to confirm that the DENV prME protein
antigen is translated, properly folded and expressed on the surface
of cells. For the polypeptide sequences, the bolded sequence is
Dengue signal sequence, the underlined sequence is DENV2 precursor
membrane sequence, and the unmarked sequence is DENV2 envelope
sequence. The sequences encoding the polypeptides are
codon-optimized. HeLa cells were transfected with DNA encoding the
prMEs from nine different DENV2 isolates. After 24 hours, surface
expression of the prME was detected using three different
antibodies followed by goat-anti-human AF700 secondary antibody and
subjecting the cells to FACS analyses. Each of the three antibodies
is broadly neutralizing DENV2 prME antibodies that have in vivo
efficacy against Dengue virus. D88 binds to DIII of Envelope
protein for all 4 DENV serotypes (US20150225474). 2D22 binds to
DIII of Envelope protein for DENV 2 serotype. 5J7 binds to 3
domains of Envelope protein for DENV 3 serotype. FIG. 14B shows
that the D88 and 2D22 antibodies recognize two of the DENV2 prME
antigens. These results show that the two DENV2 prME antigens
identified as Thailand/01 68/1979 and Peru/IQT29 13/1996 are
expressed at the cell surface in a conformationally correct form
and are excellent vaccine candidates (FIG. 14A). FIG. 14B shows a
repeat of staining in triplicate and in two different cell lines
(HeLa and 293T). These results confirm proper conformation of
expressed DENV2 prME antigens (in particular, the prME antigens
from Thailand/01 68/1979 and Peru/IQT29 13/1996) and also evidence
at least non-inferior and even superior DENV2 antigenicity as
compared to Dengvaxia (CYD-TDV), a live attenuated tetravalent
chimeric vaccine. Antigen expressed from the mRNA encoding DENV 2
prME from Peru/IQT2913/1996 shows the best binding to 2 different
DENV2 antibodies in 293T cells and in HeLa cells (D88-binds all 4
serotypes 2D22-binds DENV 2). This construct has a single amino
acid difference from the DENV 2 Envelope III Domain
immunodeterminant region (see bold, underline in SEQ ID NO: 273,
DENV 2 prME (Peru/IQT2913/1996) in Table 29).
Example 37: OVA Multitope In Vitro Screening Assay Kinetic
Analysis
[1257] Antigen surface presentation is an inefficient process in
the antigen presenting cells (APC). Peptides generated from
proteasome degradation of the antigens are presented with low
efficiency (only 1 peptide of 10000 degraded molecules is actually
presented). Thus, priming of CD8 T cells with APCs provides
insufficient densities of surface peptide/MHC I complexes,
resulting in weak responders exhibiting impaired cytokine secretion
and decreased memory pool. To improve DENV mRNA vaccines encoding
concatemeric DENV antigens, an in vitro assay was designed to test
the linkers used to connect peptide repeats, the number of peptide
repeats, and sequences known to enhance antigen presentation.
[1258] mRNA constructs encoding one or more OVA epitopes were
configured with different linker sequences, protease cleavage
sites, and antigen presentation enhancer sequences. Their
respective sequences were as shown in Table 43. To perform the
assay, 200 ng of each MC3-formulated mRNA construct was transfected
into JAWSII cells in a 24-well plate. Cells were isolated at 6, 24,
and 48 hours post transfection and stained with
fluorescently-labeled Anti-Mouse OVA257-264 (SIINFEKL (SEQ ID NO:
364)) peptide bound to H-2Kb. Staining was analyzed on a
LSRFortessa flow cytometer. Samples were run in triplicate. The
Mean Fluorescent Intensity (MFI) for each mRNA construct was
measured and shown in FIG. 15. Constructs 2, 3, 7, 9, and 10 showed
enhanced surface presentation of the OVA epitope, indicating that
the configurations of these constructs may be used for DENV mRNA
vaccine. Construct 5 comprises a single OVA peptide and a KDEL
sequence that is known to prevent the secretion of a protein.
Construct 5 showed little surface antigen presentation because the
secretion of the peptide was inhibited.
Example 38: Antibody Binding to DENV-1, 2, 3, and 4 prME
Epitopes
[1259] DENV mRNA vaccines encoding concatemeric antigen epitopes
were tested for binding to antibodies known to recognize one or
more DENV serotypes. To test antibody binding to the epitopes, 200
ng of DENV mRNA vaccines encoding different Dengue prME epitopes
were transfected into HeLa cells in 24-well plates using the
TransitIT-mRNA Transfection Kit (Mirus Bio). The DENV mRNA vaccine
constructs are shown in Table 28. Transfections were done in
triplicate. After 24 hours, surface expression was detected using
four different antibodies (10 .mu.g/mL) followed by either
goat-anti-human or anti-mouse AF700 secondary antibody (1/500).
Signal generated from antibody binding are shown as Mean
Fluorescent Intensity (MFI) (FIG. 16). Antibody D88 is known to
recognize all 4 serotypes and bound to all antigen epitopes encoded
by the DENV mRNA vaccine constructs tested. Antibody 2D22 is known
to recognize only DENV 2 and preferentially bound to construct 21,
which encodes DENV 2 antigen epitopes. Antibody 2D22 also showed
weak binding to epitopes of other DENV serotypes. Antibody 5J7 is
known to recognize only DENV 3 and only bound to antigen epitopes
encoded by constructs 13, 19, and 20, which encode DENV 3 antigen
epitopes. Antibody 1-11 is known to bind strongly to DENV 1 and 2,
to bind weakly to DENV 3 and to bind little DENV 4. Antibody 1-11
bound to DENV 1, 2, and 3, and binding to DENV 3 antigen epitopes
was stronger than binding to DENV 1 or 2 (FIG. 16).
Example 39: DENV prME Challenge Study in Cynomolgus (Cyno) Monkey
Model
[1260] Shown in Table 45 is the design of DENV prME challenge study
in cynomolgus (cyno) money. Indicated DENV mRNA vaccine encoding
prME antigen epitopes, or vaccines thereof, are used to immunize
cyno. The vaccines are formulated in lipid nanoparticles (e.g., MC3
formulation) and administered to the cyno monkeys intramuscularly
on day 0, 21, and 42. Dosages of the vaccines are 250 .mu.g or 5
.mu.g per immunization. In experiments where a combination of
different DENV mRNA vaccines are used, 250 .mu.g or 5 .mu.g of each
mRNA vaccine is used. FLAG-tagged H10N8 flu vaccine is used as
control at a dosage of 250 .mu.g per immunization. Naive cyno
monkeys without immunization are also used as control. Cyno monkey
sera are collected on days 20, 41, 62, and 92 post initial
immunization and used for serotype-specific neutralization
assays.
[1261] Immunized cyno monkeys are challenged on day 63 post initial
immunization with indicated DENV viruses. Cyno monkey sera are
collected on days 62 (pre-challenge), 63-66, 68, 70, 72, 76, and 92
(end of life) to determine serum viral load.
Example 40: Dengue 2 prME Challenge Study in AG129 Mice
[1262] The instant study was designed to evaluate the efficacy of
four DENV mRNA vaccine constructs (constructs 21-24 in Table 44) in
AG129 mice challenge assays. The schedule of the challenge study is
shown in FIG. 17A. The DENV mRNA vaccines were formulated in lipid
nanoparticles (e.g., MC3 formulation) and administered to the AG129
mice intramuscularly on days 0 and 21. Dosages of the vaccines were
2 .mu.g or 10 .mu.g per immunization. Heat inactivated D2Y98P
strain was used as a negative control to vaccinate the mice. Naive
AG129 mice without immunization were also used as control.
[1263] Immunized AG129 mice were challenged on day 42 post initial
immunization with Dengue D2Y98P virus (s.c., 1e5 PFU per mouse).
AG129 mice sera were collected on days 20 and 41 post initial
immunization and used for serotype-specific neutralization assays.
Mice immunized with any of the four DENV mRNA vaccine constructs
survived, while the control mice died. These data demonstrate that,
after lethal challenge, there was 100% protection provided by each
mRNA vaccine construct, regardless of dose. The weights and health
of the mice were monitored and the results were plotted in FIGS.
17C-17D.
[1264] Mice sera collected from mice immunized with 2 .mu.g of the
DENV mRNA vaccines were able to neutralize several DENV 2 strains
and variations in the neutralization ability between the tested
mRNA vaccines and between different DENV 2 strains were observed
(FIG. 18).
Example 41: DENV prME Challenge Study in AG129 Mouse Model
[1265] Shown in Table 46 is the design of a DENV prME challenge
study in AG129 mice, including the mRNA constructs tested, the
vaccination schedule, the dosage, the challenge strains, and the
serum collection schedule.
[1266] Indicated DENV mRNA vaccines encoding prME antigen epitopes,
or vaccines thereof, were used to immunize AG129 mice. The vaccines
were formulated in lipid nanoparticles (e.g., MC3 formulation) and
administered to the mice intramuscularly on days 0 and 21. Dosages
of the vaccines were 2 .mu.g or 10 .mu.g per immunization. In
experiments where a combination of different DENV mRNA vaccines was
used, 2 .mu.g of each mRNA vaccine was used. Naive AG129 mice
without immunization were used as control. AG129 mice sera were
collected on days 20 and 41 post initial immunization and used for
serotype-specific neutralization assays.
[1267] Immunized AG129 mice were challenged on day 42 post initial
immunization with Dengue D2Y98P virus (s.c., 1e5 PFU per mouse).
The weights and health of the mice were monitored for 14 days post
infection and the results were plotted in FIGS. 19A-19I.
Example 42: Virus-Like Particles
[1268] The antigens produced from the DENV prME mRNA vaccines of
the present disclosure, when expressed, are able to assemble into
virus-like particles (VLPs). The instant study was designed to
evaluate the immunogenicity of the VLPs by negative stain electron
microscope imaging. DENV mRNA vaccine constructs 21-24 were
expressed and VLPs were assembled an isolated. The VLPs were
visualized under negative stain electron microscopy.
[1269] Construct 23 is the vaccine construct used by Sanofi in its
DENV vaccines. Constructs 21, 22, and 24 produced more uniform
VLPs, suggesting that these VLPs may be more superior in their
immunogenicity than the VLPs produced from construct 23.
Example 43: Exemplary Nucleic Acids Encoding CHIKV RNA
Polynucleotides for Use in a RNA Vaccine
[1270] Exemplary sequences that can be used to encode CHIKV E1, E2,
E1-E2, and C-E3-E2-6K-E1 RNA polynucleotides for use in the CHIKV
RNA vaccine are given in Table 47.
Example 44: Protocol to Determine Efficacy of mRNA-Encoded
Chikungunya Antigen Candidates Against CHIKV
[1271] Chikungunya virus (CHIKV) has a polycistronic genome and
different antigens, based on the Chikungunya structural protein,
are possible. There are membrane-bound and secreted forms of E1 and
E2, as well as the full length polyprotein antigen, which retains
the protein's native conformation. Additionally, the different
CHIKV genotypes can also yield different antigens.
[1272] The efficacy of CHIKV candidate vaccines in AG129 mice
against challenge with a lethal dose of CHIKV strain 181/25 was
investigated. A129 mice, which lack IFN .alpha./.beta. receptor
signaling, injected intradermally in the footpad with 10.sup.4 PFU
of CHIKV 181/25 virus have a 100% survival rate post-injection. In
contrast, AG129 mice, which lack IFN .alpha./.beta. and .gamma.
receptor signaling, injected intradermally in the footpad with
10.sup.4 PFU of CHIKV 181/25 virus do not survive past day 5
post-injection. The tested vaccines included: MC3-LNP formulated
mRNA encoded CHIKV-E1, MC3-LNP formulated mRNA encoded CHIKV-E2,
and MC3-LNP formulated mRNA encoded CHIKV-E1/E2/E3/C. Fifteen
groups of five AG129 mice were vaccinated via intradermal (ID) or
intramuscular (IM) injection with either 2 .mu.g or 10 .mu.g of the
candidate vaccine. The vaccines were given to AG129 mice as single
or two doses (second dose provided 28 days after the first dose).
The positive control group was vaccinated via intranasal
instillation (20 .mu.L volume) with heat-inactivated CHIKV.
Phosphate-buffered saline (PBS) was used as a negative control.
[1273] On day 56, mice were challenged with 1.times.10.sup.4 PFU of
CHIKV via ID injection in a 50 .mu.L volume and monitored for 10
days for weight loss, morbidity, and mortality. Mice that displayed
severe illness, defined as >30% weight loss, a health score of 6
or above, extreme lethargy, and/or paralysis were euthanized.
Notably, mice "vaccinated" with heat-inactivated CHIKV (positive
control group) became morbid and were euthanized following the
second dose of HI-CHIKV (they were not included in the challenge
portion of the study).
[1274] In addition, individual samples were tested for reactivity
in a semi-quantitative ELISA for mouse IgG against either
Chikungunya-specific E1 (groups 1-4), Chikungunya-specific E2
(groups 5-8), or Chikungunya-specific E1 and E2 proteins (groups
9-15).
[1275] The health status is scored as indicated in Table 51.
Example 45: Efficacy of Chikungunya E1 Antigen mRNA Vaccine
Candidate
[1276] AG129 mice (n=5 per group) were vaccinated with 2 .mu.g or
10 .mu.g of MC-3-LNP formulated mRNA encoding CHIKV E1. The AG129
mice were vaccinated on either Day 0 or Days 0 and 28 via IM or ID
delivery. On Day 56 following final vaccination all mice were
challenged with a lethal dose of CHIKV. The survival curve, percent
weight loss, and health status of the mice vaccinated with 2 .mu.g
CHIKV E1 mRNA are shown in FIGS. 21A-21C. The survival results are
tabulated in Table 52. The survival curve, percent weight loss, and
health status of the mice vaccinated with 10 .mu.g CHIKV E1 mRNA
are shown in FIGS. 24A-24C. The survival results are tabulated in
Table 53.
[1277] As shown in Table 52, the 2 .mu.g dose of CHIKV E1 mRNA
vaccine gave no protection post-CHIKV infection challenge when
administered via IM or ID with either a single dose or two doses.
Likewise, the single dose of 10 .mu.g CHIKV E1 vaccine provided
little to no protection when administered via IM or ID. However, as
indicated in Table 53, the 10 .mu.g dose of CHIKV E1 mRNA vaccine
provided 60% protection post-CHIKV challenge when administered via
IM using two doses and provided 80% protection post-CHIKV challenge
when administered via ID using two doses.
[1278] In all experiments, the negative control mice had a
.about.0% survival rate, as did the positive control mice
(heat-inactivated CHIKV), which died before CHIKV challenge. Some
mice died during the vaccination period.
Example 46: Efficacy of Chikungunya E2 Antigen mRNA Vaccine
Candidate
[1279] AG129 mice (n=5 per group) were vaccinated with 2 .mu.g or
10 .mu.g of MC-3-LNP formulated mRNA encoding CHIKV E2. The mice
were vaccinated on either Day 0 or Days 0 and 28 via IM or ID
delivery. On Day 56 following final vaccination all mice were
challenged with a lethal dose of CHIKV. The survival curve, percent
weight loss, and health status of the mice vaccinated with 2 .mu.g
CHIKV E2 mRNA are shown in FIGS. 22A-22C. The survival results are
tabulated in Table 54 below. The survival curve, percent weight
loss, and health status of the mice vaccinated with 10 .mu.g CHIKV
E2 mRNA are shown in FIGS. 25A-25C. The survival results are
tabulated in Table 55.
[1280] As shown in Table 54, the 2 .mu.g dose of CHIKV E2 mRNA
vaccine gave no protection post-CHIKV infection challenge when
administered via IM or ID in a single dose. However, when provided
in two doses, the 2 .mu.g dose of CHIKV E2 mRNA vaccine provided
80% protection when administered via IM and 100% protection when
administered via ID post-CHIKV challenge. As indicated in Table 55,
the 10 .mu.g dose of CHIKV E2 mRNA mouse provided no protection
post-CHIKV challenge when administered via IM or ID in a single
dose. However, administration of CHIKV E2 mRNA via IM or ID using
two doses provided 100% protection post-CHIKV challenge.
[1281] In all experiments, the negative control mice had a
.about.0% survival rate, as did the positive control mice
(heat-inactivated CHIKV) which died prior to CHIKV challenge. Some
mice died during the vaccination period.
Example 47: Efficacy of Chikungunya C-E3-E2-6K-EJ Antigen mRNA
Vaccine Candidate
[1282] AG129 mice (n=5 per group) were vaccinated with 2 .mu.g or
10 .mu.g of MC-3-LNP formulated mRNA encoding CHIKV C-E3-E2-6K-E1
mRNA (SEQ ID NO: 388/401). The AG129 mice were vaccinated on either
Day 0 or Days 0 and 28 via IM or ID delivery. On Day 56 following
final vaccination all mice were challenged with a lethal dose of
CHIKV. The survival curve, percent weight loss, and health status
of the mice vaccinated with 2 .mu.g CHIKV C-E3-E2-6K-E1 mRNA are
shown in FIGS. 23A-23C. The survival results are tabulated in Table
56. The survival curve, percent weight loss, and health status of
the mice vaccinated with 10 .mu.g CHIKV C-E3-E2-6K-E1/E2/E3/C mRNA
are shown in FIGS. 26A-26C. The survival results are tabulated in
Table 57.
[1283] As shown in Table 56, the 2 .mu.g dose of C-E3-E2-6K-E1 mRNA
vaccine provided 100% protection post-CHIKV challenge when
administered via IM in a single dose and provided 80% protection
post-CHIKV challenge when administered via ID in a single dose. The
2 .mu.g dose of C-E3-E2-6K-E1 mRNA vaccine provided 100% protection
post-CHIKV challenge when administered via IM or ID in two doses.
As shown in Table 57, the 10 .mu.g dose of C-E3-E2-6K-E1 mRNA
vaccine provided 100% protection post-CHIKV infection challenge
when administered via IM or ID in either a single dose or in two
doses.
[1284] In all experiments, the negative control mice had a
.about.0% survival rate, as did the positive control mice
(heat-inactivated CHIKV) which died prior to CHIKV challenge. Some
mice died during the vaccination period.
Example 48: Summary of Survival Data Using Chikungunya Antigen mRNA
Vaccine Candidates CHIKV E1, CHIKV E2, and CHIKV C-E3-E2-6K-E1
[1285] Table 58 shows the survival data of the mice vaccinated with
the CHIKV mRNA antigens used in the studies reported in Examples
45-47.
Example 49: In Vitro Transfection of mRNA-Encoded Chikungunya Virus
Envelope Protein
[1286] The in vitro transfection of mRNA encoding Notch and a PBS
control were performed in 150k HeLa cells/well transfected with 1
.mu.g mRNA+2 .mu.L LF2000/well in a 24 well plate. Lysate
containing proteins expressed from the CHIKV envelope mRNAs
transfected in HeLa cells were collected 16 hours post-transfection
and then detected by Western blotting with a V5 tag-HRP antibody.
The successful detection of a CHIKV envelope protein is shown in
FIG. 20.
Example 50: Detection of Immunity (Mouse IgG) Against Either
Chikungunya-Specific E1, Chikungunya-Specific E2, or
Chikungunya-Specific E1 and E2 Proteins
[1287] Serum samples from mice vaccinated with the CHIKV E1, E2, or
E1-E2-E3-C vaccine described in Examples 45-47 were tested using a
semi-quantitative ELISA for the detection of mouse IgG against
either Chikungunya-specific E1, Chikungunya-specific E2, or
Chikungunya-specific E1 and E2 proteins.
[1288] Fifteen groups of five mice were vaccinated via intradermal
(ID) or intramuscular (IM) injection with either 2 .mu.g or 10
.mu.g of the candidate vaccine. The vaccines were given to AG129
mice as single or two doses (second dose provided 28 days after the
first dose). On day 56, mice were challenged with 1.times.104 PFU
of CHIKV via ID injection in 50 .mu.L volume and monitored for 10
days for weight loss, morbidity, and mortality. Mice were bled on
day 7 and day 28 post-vaccination via the peri-orbital sinus
(retro-orbital bleed). In addition, mice surviving the CHIKV
challenge were bled 10 days post-challenge.
[1289] The individual samples were tested for reactivity in a
semi-quantitative ELISA for mouse IgG against either
Chikungunya-specific E1, Chikungunya-specific E2, or
Chikungunya-specific E1 and E2 proteins. The results are shown in
FIGS. 34-36.
[1290] The data depicting the results of the ELISA assay to
identify the amount of antibodies produced in AG129 mice in
response to vaccination with mRNA encoding secreted CHIKV E1
structural protein, secreted CHIKV E2 structural protein, or CHIKV
full structural polyprotein C-E3-E2-6k-E1 at a dose of 10 .mu.g or
2 .mu.g at 28 days post immunization is shown in FIGS. 34-35. The
10 ug of mRNA encoding CHIKV polyprotein produced significant
levels of antibody in both studies. The data depicting a comparison
of ELISA titers from the data of FIG. 34 to survival in the data of
FIG. 35 left panel is shown in FIG. 36. As shown in the survival
results, the animals vaccinated with either dose (single or double
administration) of mRNA encoding CHIKV polyprotein had 100%
survival rates.
Example 51: Efficacy of Chikungunya Polyprotein (C-E3-E2-6K-E1)
mRNA Vaccine Candidate
[1291] AG129 mice (n=5 per group) were vaccinated with either 10
.mu.g, 2 .mu.g or 0.4 .mu.g of MC-3-LNP formulated mRNA encoded
CHIKV polyprotein (C-E3-E2-6K-E1) (SEQ ID NO: 388/401). The mice
were vaccinated on either Day 0 or Days 0 and 28 via IM delivery.
In one study, all mice were challenged on day 56 with a lethal dose
of CHIKV following final vaccination. In another study, all mice
were challenged on day 84 with a lethal dose of CHIKV following
final vaccination. The survival curve, percent weight loss, and
health status of the mice vaccinated with 10 .mu.g, 2 .mu.g or 0.4
.mu.g mRNA were determined as described previously in Examples
45-47. The survival rates, neutralizing antibodies and binding
antibodies were assessed. Neutralizing antibodies were also
identified against three different strains of CHIKV.
[1292] The survival rates of the mice vaccinated with mRNA encoding
CHIKV C-E3-E2-6k-E1 is shown in FIG. 37. The data depicts
vaccination at a dose of 10 .mu.g (left panels), 2 .mu.g (middle
panels) or 0.4 .mu.g (right panels) at 56 days (top panels) or 112
days (bottom panels) post immunization. These data demonstrate that
a single 2 .mu.g dose of the mRNA vaccine afforded 100% protection
for at least 112 days (16 weeks). Following the study out further,
the data demonstrated that a single 2 .mu.g dose of the mRNA
vaccine afforded 100% protection for at least 140 days (20
weeks.)
[1293] The neutralizing antibody and binding antibody produced in
treated mice is shown in FIGS. 38 and 39, respectively. As can be
seen in FIGS. 38 and 39, the levels of neutralizing antibody were
dependent or dose and regimen with the highest titers evident with
10 .mu.g dosed twice (days 0 and 28). Plaque reduction
neutralization tests (PRNT50 and PRNT80) were used to quantify the
titer of neutralizing antibody for the virus. Antigen-binding Ab
was determined by ELISA. The corresponding correlation between
binding Ab and neutralizing antibodies is shown in the bottom
panels of FIG. 39. Following the study out to 16 weeks showed that
the highest E1 titers were achieved when 10 .mu.g mRNA vaccine was
dosed twice.
[1294] The data depicting neutralizing antibodies against three
different strains of CHIKV is shown in FIG. 40. The neutralizing
antibodies were tested against three different strains of CHIKV,
African-Senegal (left panel), La Reunion (middle panel) and CDC CAR
(right panel). FIG. 40 shows that the polyprotein-encoding mRNA
vaccine elicited broadly neutralizing antibodies against the three
strains tested. Sera were further tested against Chik S27 strain
(Chikungunya virus (strain S27-African prototype). The data
depicting neutralizing antibodies against CHIKV S27 strain is shown
in FIG. 41. These data collectively show that the polyprotein
encoding mRNA vaccine elicited broadly neutralizing antibodies
against all four strains tested. The vaccine induced neutralizing
antibodies against multiple strains of Chikungunya. The prime and
boost with the 10 .mu.g dose produced the most robust neutralizing
antibody response followed by the single dose with 10 .mu.g.
Example 52: Transfection of mRNA Encoded CHIKV Structural
Proteins
[1295] In vitro transfection of mRNA encoding CHIKV structural
proteins and PBS control were performed in 400 k HeLa cells
transfected with 1.25 ug mRNA lipoplexed with 5 ul LF2000/well in 6
well plate. Protein detection in HeLa cell lysate 16h post
transfection was measured. Lysates which contain proteins expressed
from the CHIKV mRNAs transfected in HeLa were collected 16h post
transfection. Proteins were detected by WB with anti-Flag or and V5
antibody.
[1296] The mRNA encoded CHIKV structural proteins and protein
production in the HeLa cell lysate 16h post transfection was
detected.
Example 53: Exemplary CHIKV Polypeptides
[1297] The amino acids presented in the Table 48 are exemplary
CHIKV antigenic polypeptides. To the extent that any exemplary
antigenic peptide described herein includes a flag tag or V5, or a
polynucleotide encodes a flag tag or V5, the skilled artisan
understands that such flag tag or V5 is excluded from the antigenic
polynucleotide in a vaccine formulation. Thus, any of the
polynucleotides encoding proteins described herein are encompassed
within the compositions of the invention without the flag tag or V5
sequence.
Example 54: Efficacy of CHIKV mRNA Vaccine X Against CHIKV in AG129
Mice Study Design
[1298] Chikungunya virus (CHIKV) 181/25 strain is an attenuated
vaccine strain that was developed by the US Army via multiple
plaque-to-plaque passages of the 15561 Southeast Asian human
isolate (Levitt et al.). It is well tolerated in humans and is
highly immunogenic. It produces small plaques and has decreased
virulence in infant mice and nonhuman primates. When the attenuated
virus is administered to immunodeficient AG129 mice (lacking the
IFN-.alpha./.beta.and .gamma. receptors) the mice succumb to a
lethal disease within 3-4 days with ruffled fur and weight loss
(Partidos, et al. 2011 Vaccine).
[1299] This instant study was designed to evaluate the efficacy of
CHIKV candidate vaccines as described herein in AG129 mice (Table
59). The study included 14 groups of female 6-8 week old AG129 mice
(Table 59). Groups 1-4, 7-8, and 10-15 were vaccinated with CHIKV
vaccine X via the intramuscular (IM; 0.05 mL) route on Day 0 and
select groups received an additional boost on Day 28. Control
Groups 9 and 16 received vehicle (PBS) only on Days 0 and 28 via IM
route (0.05 mL). Regardless of vaccination schedule, Groups 1-4 and
7-9 were challenged on Day 56 while Groups 10-16 were challenged on
Day 112 using the CHIKV 181/25 strain (stock titer
3.97.times.10.sup.7 PFU/mL, challenge dose 1.times.10.sup.4
PFU/mouse). For virus challenge, all mice received a lethal dose
(1.times.10.sup.4 PFU) of Chikungunya (CHIK) strain 181/25 via
intradermal (ID) route (0.050 mL via footpad). All mice were
monitored for 10 days post infection for weight loss, morbidity,
and mortality. Each mice was assigned a heath score based on Table
51. Mice displaying severe illness as determined by >30% weight
loss, a health score of higher than 5, extreme lethargy, and/or
paralysis were euthanized with a study endpoint of day 10 post
virus challenge. Test bleeds via retro-orbital (RO) collection were
performed on mice from all groups on Days -3, 28, and 56. Mice from
Groups 10-16 were also bled on Days 84 & 112. Mice that
survived challenge were also terminally bled on Day 10 post
challenge. Serum samples from mice (Days -3, 28, 56, 84, 112 and
surviving mice) were kept frozen (-80.degree. C.) and stored until
they were tested for reactivity in a semi quantitative ELISA for
mouse IgG against either E1, E2 or CHIKV lysate.
Experimental Procedure
Intramuscular (IM) Injection of Mice
[1300] 1. Restrain the animal either manually, chemically, or with
a restraint device.
[1301] 2. Insert the needle into the muscle. Pull back slightly on
the plunger of the syringe to check proper needle placement. If
blood is aspirated, redirect the needle and recheck placement
again.
[1302] 3. Inject appropriate dose and withdraw needle. Do not
exceed maximum volume. If the required volume exceeds the maximum
volume allowed, multiple sites may be used with each receiving no
more than the maximum volume.
[1303] 4. The injection site may be massaged gently to disperse the
injected material.
Intradermal (ID) Injections of Mice
[1304] 1. Restrain the animal either manually, chemically, or with
a restraint device.
[1305] 2. Carefully clip the hair from the intended injection site.
This procedure can be done upon animals arriving or the day before
any procedures or treatments are required.
[1306] 3. Lumbar area is the most common site for ID injections in
all species, but other areas can be used as well.
[1307] 4. Pinch or stretch the skin between your fingers (or
tweezers) to isolate the injection site.
[1308] 5. With the beveled edge facing up, insert the needle just
under the surface between the layers of skin. Inject the
appropriate dose and withdraw needle. A small bleb will form when
an ID injection is given properly.
[1309] 6. If the required volume exceeds the maximum volume
allowed, multiple sites may be used with each receiving no more
than the maximum volume.
Retro-Orbital Bleeding in Mice
[1310] 1. Place the mice in the anesthesia chamber and open oxygen
line and set to 2.5% purge. Start flow of anesthesia at 5%
isoflurane.
[1311] 2. Once the animal becomes sedate, turn anesthesia to
2.5%-3% isoflurane and continue to expose the animal to the
anesthesia. Monitor the animal to avoid breathing becoming
slow.
[1312] 3. Remove the small rodent from anesthesia chamber and place
on its back while restraining with left hand and scruff the back of
the animal's neck, so it is easy to restrain and manipulate while
performing the procedure with the right hand.
[1313] 4. With a small motion movement, place the capillary tube in
the corner of the animal's eye close to the nostril, and rotate or
spin the Hematocrit glass pipette until blood start flowing out.
Collect the appropriate amount of blood needed into the appropriate
labeled vial.
[1314] 5. Monitor the animal after retro-orbital bleeding is done
for at least 10-15 seconds to ensure hemostasis.
[1315] 6. Place the animal back to its original cage and monitor
for any other problems or issues caused while manipulating animal
due to the procedure.
Observation of Mice
[1316] 1. Mice were observed through 10 days post infection (11
days total, 0-10 days post infection).
[1317] 2. Mice were weighed daily on an Ohause scale and the
weights are recorded.
[1318] 3. Survival and health of each mouse were evaluated once
time a day using a scoring system of 1-7 described in Table 51.
Infection
[1319] On either Day 56 (Groups 1-4, 7-9) or Day 112 (Groups 10-16)
groups of 5 female 6-8 week old AG129 mice were infected via
intradermal injection with 1.times.10.sup.4 PFU/mouse of the 181/25
strain of Chikungunya diluted in PBS. The total inoculation volume
was 0.05 mL administered in the rear footpad of each animal. Mice
were anesthetized lightly using 2-5% v/v of isoflurane at -2.5
L/min of 02 (VetEquip IMPAC6) immediately prior to infection.
Dose Administration
[1320] In this study mice were administered 0.04 .mu.g, 2 .mu.g, or
10 .mu.g of various formulations of the CHIKV vaccine X or vehicle
alone (PBS) on either Day 0 or on Days 0 and 28 via the
intramuscular route (0.05 mL). The material was pre-formulated and
diluted in PBS by IBT prior to dosing.
Results
[1321] Mice were immunized once (Day 0) or twice (Days 0 & 28)
with either 0.04 .mu.g, 2 .mu.g, or 10 .mu.g of Chikungunya mRNA
vaccine X and were challenged with CHIKV strain 181/25 on either
Day 56 (Groups 1-4, 7-9) or on Day 112 (Groups 10-16). Mice were
monitored for a total of 10 days post infection for health and
weight changes. Mice that received either 2 .mu.g or 10 .mu.g of
the CHIKV mRNA vaccine X either once (Day 0) or twice (Days 0 and
28) were fully protected (100%) regardless of whether the mice were
challenged 56 days or 112 days after the initial vaccination (FIGS.
27A-27B, Table 44). Mice receiving 0.04 .mu.g of the CHIKV mRNA
vaccine were not protected at all from lethal CHIKV infection. This
efficacy data is supported by the health scores observed in the
vaccinated mice in that the protected mice displayed little to no
adverse health effects of a CHIKV infection (FIGS. 29A-29B). Weight
loss is not a strong indicator of disease progression in the CHIKV
AG129 mouse model (FIGS. 28A-28B).
[1322] Mice immunized with the CHIKV mRNA vaccine X showed
increased antibody titers against CHIKV E1, E2 and CHIKV lysate as
compared to the vehicle only (PBS) treated groups. Serum binding
against the virus lysate yielded the highest antibody titers for
all vaccinated groups (FIGS. 30A-30C, 31A-31C, 32A-32C, 33A-33C).
Overall, the antibody titers were dose dependent with the highest
titers observed in serum from mice vaccinated with 10 .mu.g of
CHIKV mRNA vaccine X while the lowest titers were observed in serum
from mice vaccinated with 0.04 .mu.g of the CHIKV mRNA vaccine X.
Similarly, higher titers were observed in serum from mice
vaccinated twice (Days 0 and 28) as compared to serum from mice
vaccinated only once (Day 0). Serum obtained on Day 112 post
initial vaccination still yielded increased antibody titers in mice
that received either 10 .mu.g or 2 .mu.g of CHIKV mRNA vaccine X
(FIGS. 32A-32C).
[1323] Serum from mice groups 10-16, 112 days post immunization
were also tested in a Plaque Reduction Neutralization Test (PRNT).
Serum from each mice was diluted from 1/20 to 1/40960 and assessed
for its ability to reduce CHIKV plaque formation. The results were
shown in Table 64.
Example 55: Immunogenicity of Chikungunya Polyprotein
(C-E3-E2-6K-E1) mRNA Vaccine Candidate in Rats
[1324] Sprague Dawley rats (n=5) were vaccinated with 20 g of
MC-3-LNP formulated mRNA 30 encoded CHIKV polyprotein
(C-E3-E2-6K-E1) (SEQ ID NO: 388/401). The rats were vaccinated on
either Day 0 or Days 0 and 14 or Days 0, 14 and 28 via IM delivery.
Sera were collected on days -3, 14, 28 and 42 for ELISA testing.
FIG. 42 demonstrated that there was at least a two log increase in
antibody titer against CHIKV lysate post 3rd vaccination with the
mRNA vaccine in normal rats.
Example 56: Evaluation of T Cell Activation of Chikungunya P 5
Polyprotein (C-E3-E2-6K-E1) mRNA Vaccine Candidate
[1325] C57BL/6 mice (n=6 experimental group; n=3 control group)
were vaccinated with 10 .mu.g of MC-3-LNP formulated mRNA encoded
CHIKV polyprotein (C-E3-E2-6K-E1) (SEQ ID NO: 388/401). The mice
were vaccinated on either Day 0 or Days 0 and 28 (boost) via IM
delivery. Sera was collected on days 3, 28 and 42 for ELISA
testing. Animals were sacrificed on day 42 and spleens were
harvested for immunological evaluation of T cells. Splenic cells
were isolated and analyzed by FACS. Briefly, spleens were removed,
cells isolated, and stimulated in vitro with immunogenic peptides
found within either C, E1, or E2 region of CHIKV that are known to
be CD8 epitopes in B6 mice. The readout for this assay was cytokine
secretion (IFN-gamma and TNF-alpha), which reveals whether the
vaccine induced antigen-specific T cell responses. No CD8 T cell
responses were detected using the E2 or C peptide (baseline levels
of IFN-gamma and TNF-alpha), whereas there was a response to the
E1-corresponding peptide (average of about 0.4% IFN-gamma and 0.1%
TNF). The peptides were used to stimulate T cells used in the study
were E1=HSMTNAVTI (SEQ ID NO: 414), E2=IILYYYELY (SEQ ID NO: 415),
and C=ACLVGDKVM (SEQ ID NO: 416).
[1326] FIG. 43 shows that the polyprotein-encoding CHIKV
polyprotein vaccine elicited high antibody titers against the CHIKV
glycoproteins. FIGS. 44 and 45A-45B show T cell activation by E1
peptide.
Example 57: Proof-of-Concept of Immunogenicity in Non-Human
Primates
[1327] The mRNA vaccine was tested in Cynomolgus monkey subjects
(n=3 per experimental group, n=3 negative control). Subjects were
given an intramuscular (IM) immunization of 25 .mu.g or 75 .mu.g of
the vaccine on day 0 (prime), day 28 (boost), and day 56 (boost).
The negative control group was administered 75 .mu.g of
non-translated irrelevant mRNA (NTIX). The readout for this
experiment was serum antibody titers (binding and neutralizing) and
a CHIKV-specific T cell response.
[1328] As shown in FIG. 46, the vaccine induced a robust antibody
response. A response was detected after the priming dose, and then
increased with the boost, and increased slightly more following the
third immunization. Both the 25 .mu.g and 75 .mu.g vaccine groups
were immunogenic, and there was a small dose response. Neutralizing
titers were a few fold lower than those seen in mice, but were
still robust.
[1329] FIG. 47 shows a robust CD4 response in response to the
vaccine. Day 35 T cells, measured one week after the second
immunization, were assayed. The peptide pool consisted of 15mers
overlapping by 11. The response was measured through peptide
stimulation, followed by intracellular cytokine staining and flow
cytometry. A CHIKV-specific CD4 T cell response was detected,
mainly in IL-2 and TNF.alpha.. There was a minimal CD8 response as
well.
[1330] Each of the sequences described herein encompasses a
chemically modified sequence or an unmodified sequence (no modified
nucleotides), which includes no nucleotide modifications.
TABLE-US-00004 Lengthy table referenced here
US20220257746A1-20220818-T00001 Please refer to the end of the
specification for access instructions.
TABLE-US-00005 Lengthy table referenced here
US20220257746A1-20220818-T00002 Please refer to the end of the
specification for access instructions.
TABLE-US-00006 Lengthy table referenced here
US20220257746A1-20220818-T00003 Please refer to the end of the
specification for access instructions.
TABLE-US-00007 Lengthy table referenced here
US20220257746A1-20220818-T00004 Please refer to the end of the
specification for access instructions.
TABLE-US-00008 Lengthy table referenced here
US20220257746A1-20220818-T00005 Please refer to the end of the
specification for access instructions.
TABLE-US-00009 Lengthy table referenced here
US20220257746A1-20220818-T00006 Please refer to the end of the
specification for access instructions.
TABLE-US-00010 Lengthy table referenced here
US20220257746A1-20220818-T00007 Please refer to the end of the
specification for access instructions.
TABLE-US-00011 Lengthy table referenced here
US20220257746A1-20220818-T00008 Please refer to the end of the
specification for access instructions.
TABLE-US-00012 Lengthy table referenced here
US20220257746A1-20220818-T00009 Please refer to the end of the
specification for access instructions.
TABLE-US-00013 Lengthy table referenced here
US20220257746A1-20220818-T00010 Please refer to the end of the
specification for access instructions.
TABLE-US-00014 Lengthy table referenced here
US20220257746A1-20220818-T00011 Please refer to the end of the
specification for access instructions.
TABLE-US-00015 Lengthy table referenced here
US20220257746A1-20220818-T00012 Please refer to the end of the
specification for access instructions.
TABLE-US-00016 Lengthy table referenced here
US20220257746A1-20220818-T00013 Please refer to the end of the
specification for access instructions.
TABLE-US-00017 Lengthy table referenced here
US20220257746A1-20220818-T00014 Please refer to the end of the
specification for access instructions.
TABLE-US-00018 Lengthy table referenced here
US20220257746A1-20220818-T00015 Please refer to the end of the
specification for access instructions.
TABLE-US-00019 Lengthy table referenced here
US20220257746A1-20220818-T00016 Please refer to the end of the
specification for access instructions.
TABLE-US-00020 Lengthy table referenced here
US20220257746A1-20220818-T00017 Please refer to the end of the
specification for access instructions.
TABLE-US-00021 Lengthy table referenced here
US20220257746A1-20220818-T00018 Please refer to the end of the
specification for access instructions.
TABLE-US-00022 Lengthy table referenced here
US20220257746A1-20220818-T00019 Please refer to the end of the
specification for access instructions.
TABLE-US-00023 Lengthy table referenced here
US20220257746A1-20220818-T00020 Please refer to the end of the
specification for access instructions.
TABLE-US-00024 Lengthy table referenced here
US20220257746A1-20220818-T00021 Please refer to the end of the
specification for access instructions.
TABLE-US-00025 Lengthy table referenced here
US20220257746A1-20220818-T00022 Please refer to the end of the
specification for access instructions.
TABLE-US-00026 Lengthy table referenced here
US20220257746A1-20220818-T00023 Please refer to the end of the
specification for access instructions.
TABLE-US-00027 Lengthy table referenced here
US20220257746A1-20220818-T00024 Please refer to the end of the
specification for access instructions.
TABLE-US-00028 Lengthy table referenced here
US20220257746A1-20220818-T00025 Please refer to the end of the
specification for access instructions.
TABLE-US-00029 Lengthy table referenced here
US20220257746A1-20220818-T00026 Please refer to the end of the
specification for access instructions.
TABLE-US-00030 Lengthy table referenced here
US20220257746A1-20220818-T00027 Please refer to the end of the
specification for access instructions.
TABLE-US-00031 Lengthy table referenced here
US20220257746A1-20220818-T00028 Please refer to the end of the
specification for access instructions.
TABLE-US-00032 Lengthy table referenced here
US20220257746A1-20220818-T00029 Please refer to the end of the
specification for access instructions.
TABLE-US-00033 Lengthy table referenced here
US20220257746A1-20220818-T00030 Please refer to the end of the
specification for access instructions.
TABLE-US-00034 Lengthy table referenced here
US20220257746A1-20220818-T00031 Please refer to the end of the
specification for access instructions.
TABLE-US-00035 Lengthy table referenced here
US20220257746A1-20220818-T00032 Please refer to the end of the
specification for access instructions.
TABLE-US-00036 Lengthy table referenced here
US20220257746A1-20220818-T00033 Please refer to the end of the
specification for access instructions.
TABLE-US-00037 Lengthy table referenced here
US20220257746A1-20220818-T00034 Please refer to the end of the
specification for access instructions.
TABLE-US-00038 Lengthy table referenced here
US20220257746A1-20220818-T00035 Please refer to the end of the
specification for access instructions.
TABLE-US-00039 Lengthy table referenced here
US20220257746A1-20220818-T00036 Please refer to the end of the
specification for access instructions.
TABLE-US-00040 Lengthy table referenced here
US20220257746A1-20220818-T00037 Please refer to the end of the
specification for access instructions.
TABLE-US-00041 Lengthy table referenced here
US20220257746A1-20220818-T00038 Please refer to the end of the
specification for access instructions.
TABLE-US-00042 Lengthy table referenced here
US20220257746A1-20220818-T00039 Please refer to the end of the
specification for access instructions.
TABLE-US-00043 Lengthy table referenced here
US20220257746A1-20220818-T00040 Please refer to the end of the
specification for access instructions.
TABLE-US-00044 Lengthy table referenced here
US20220257746A1-20220818-T00041 Please refer to the end of the
specification for access instructions.
TABLE-US-00045 Lengthy table referenced here
US20220257746A1-20220818-T00042 Please refer to the end of the
specification for access instructions.
TABLE-US-00046 Lengthy table referenced here
US20220257746A1-20220818-T00043 Please refer to the end of the
specification for access instructions.
TABLE-US-00047 Lengthy table referenced here
US20220257746A1-20220818-T00044 Please refer to the end of the
specification for access instructions.
TABLE-US-00048 Lengthy table referenced here
US20220257746A1-20220818-T00045 Please refer to the end of the
specification for access instructions.
TABLE-US-00049 Lengthy table referenced here
US20220257746A1-20220818-T00046 Please refer to the end of the
specification for access instructions.
TABLE-US-00050 Lengthy table referenced here
US20220257746A1-20220818-T00047 Please refer to the end of the
specification for access instructions.
TABLE-US-00051 Lengthy table referenced here
US20220257746A1-20220818-T00048 Please refer to the end of the
specification for access instructions.
TABLE-US-00052 Lengthy table referenced here
US20220257746A1-20220818-T00049 Please refer to the end of the
specification for access instructions.
TABLE-US-00053 Lengthy table referenced here
US20220257746A1-20220818-T00050 Please refer to the end of the
specification for access instructions.
TABLE-US-00054 Lengthy table referenced here
US20220257746A1-20220818-T00051 Please refer to the end of the
specification for access instructions.
TABLE-US-00055 Lengthy table referenced here
US20220257746A1-20220818-T00052 Please refer to the end of the
specification for access instructions.
TABLE-US-00056 Lengthy table referenced here
US20220257746A1-20220818-T00053 Please refer to the end of the
specification for access instructions.
TABLE-US-00057 Lengthy table referenced here
US20220257746A1-20220818-T00054 Please refer to the end of the
specification for access instructions.
TABLE-US-00058 Lengthy table referenced here
US20220257746A1-20220818-T00055 Please refer to the end of the
specification for access instructions.
TABLE-US-00059 Lengthy table referenced here
US20220257746A1-20220818-T00056 Please refer to the end of the
specification for access instructions.
TABLE-US-00060 Lengthy table referenced here
US20220257746A1-20220818-T00057 Please refer to the end of the
specification for access instructions.
TABLE-US-00061 Lengthy table referenced here
US20220257746A1-20220818-T00058 Please refer to the end of the
specification for access instructions.
TABLE-US-00062 Lengthy table referenced here
US20220257746A1-20220818-T00059 Please refer to the end of the
specification for access instructions.
TABLE-US-00063 Lengthy table referenced here
US20220257746A1-20220818-T00060 Please refer to the end of the
specification for access instructions.
TABLE-US-00064 Lengthy table referenced here
US20220257746A1-20220818-T00061 Please refer to the end of the
specification for access instructions.
TABLE-US-00065 Lengthy table referenced here
US20220257746A1-20220818-T00062 Please refer to the end of the
specification for access instructions.
TABLE-US-00066 Lengthy table referenced here
US20220257746A1-20220818-T00063 Please refer to the end of the
specification for access instructions.
TABLE-US-00067 Lengthy table referenced here
US20220257746A1-20220818-T00064 Please refer to the end of the
specification for access instructions.
TABLE-US-00068 Lengthy table referenced here
US20220257746A1-20220818-T00065 Please refer to the end of the
specification for access instructions.
TABLE-US-00069 Lengthy table referenced here
US20220257746A1-20220818-T00066 Please refer to the end of the
specification for access instructions.
TABLE-US-00070 Lengthy table referenced here
US20220257746A1-20220818-T00067 Please refer to the end of the
specification for access instructions.
EQUIVALENTS
[1331] Those skilled in the art will recognize, or be able to
ascertain using no more than routine experimentation, many
equivalents to the specific embodiments of the disclosure described
herein. Such equivalents are intended to be encompassed by the
following claims.
[1332] All references, including patent documents, disclosed herein
are incorporated by reference in their entirety.
TABLE-US-LTS-00001 LENGTHY TABLES The patent application contains a
lengthy table section. A copy of the table is available in
electronic form from the USPTO web site
(https://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20220257746A1).
An electronic copy of the table will also be available from the
USPTO upon request and payment of the fee set forth in 37 CFR
1.19(b)(3).
Sequence CWU 0 SQTB SEQUENCE LISTING The patent application
contains a lengthy "Sequence Listing" section. A copy of the
"Sequence Listing" is available in electronic form from the USPTO
web site
(https://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20220257746A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
0 SQTB SEQUENCE LISTING The patent application contains a lengthy
"Sequence Listing" section. A copy of the "Sequence Listing" is
available in electronic form from the USPTO web site
(https://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20220257746A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
* * * * *
References