Glycan-based Antibody-drug Conjugates

Davidson; Robert ;   et al.

Patent Application Summary

U.S. patent application number 17/658731 was filed with the patent office on 2022-08-04 for glycan-based antibody-drug conjugates. This patent application is currently assigned to Merck Sharp & Dohme Corp.. The applicant listed for this patent is Merck Sharp & Dohme Corp.. Invention is credited to Robert Davidson, Bing Gong.

Application Number20220242970 17/658731
Document ID /
Family ID1000006272156
Filed Date2022-08-04

United States Patent Application 20220242970
Kind Code A1
Davidson; Robert ;   et al. August 4, 2022

GLYCAN-BASED ANTIBODY-DRUG CONJUGATES

Abstract

Genetically engineered antibodies containing non-native N-glycosylated sites, preparation of the antibodies in yeast and fungi, site-specific conjugation of drugs to these antibodies, and methods of treatment utilizing these antibodies are described herein.


Inventors: Davidson; Robert; (Enfield, NH) ; Gong; Bing; (North Reading, MA)
Applicant:
Name City State Country Type

Merck Sharp & Dohme Corp.

Rahway

NJ

US
Assignee: Merck Sharp & Dohme Corp.
Rahway
NJ

Family ID: 1000006272156
Appl. No.: 17/658731
Filed: April 11, 2022

Related U.S. Patent Documents

Application Number Filing Date Patent Number
15493720 Apr 21, 2017 11332544
17658731
62325497 Apr 21, 2016

Current U.S. Class: 1/1
Current CPC Class: C07K 2317/52 20130101; C07K 2317/14 20130101; A61K 47/6811 20170801; A61K 47/6851 20170801; A61K 47/6803 20170801; C07K 2317/24 20130101; A61K 2039/505 20130101; A61K 47/6889 20170801; C07K 2317/41 20130101; C07K 2317/21 20130101; C07K 16/32 20130101; C07K 16/00 20130101; C12P 21/005 20130101
International Class: C07K 16/32 20060101 C07K016/32; C12P 21/00 20060101 C12P021/00; A61K 47/68 20060101 A61K047/68; C07K 16/00 20060101 C07K016/00

Claims



1. An engineered IgG antibody or heavy chain constant domain fragment comprising an S134N mutation in the heavy chain constant domain, which forms a first non-native N-glycosylation site having the amino acid sequence NTS over positions 134-136 of the heavy chain constant domain and a G161T or G161S mutation, which forms a second non-native N-glycosylation site in the heavy chain constant domain having the amino acid sequence NST over positions 159-161 of the heavy chain constant domain, said non-native N-glycosylation sites having an N-glycan attached to the N at position 134 and 159, wherein the N-glycans have a Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 or GalGlcNAcMan.sub.3GlcNAc.sub.2 glycoform in which the terminal galactose residues have been oxidized to a C-6 aldehyde group, which is conjugated to a reactive amine group of a derivatized drug by oxime bonds, and wherein the amino acid positions of the heavy chain contant domain are according to Eu numbering.

2. An engineered IgG antibody or heavy chain constant domain fragment of claim 1, wherein N-glycan comprises a Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 glycoform.

3. An engineered IgG antibody or heavy chain constant domain fragment of claim 1, wherein N-glycan comprises a Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 glycoform.

4. An engineered IgG antibody or heavy chain constant domain fragment of claim 1, wherein the engineered IgG antibody or heavy chain constant domain fragment further comprises one to ten amino acid mutations or pairs of mutations are selected from the group consisting of N203 T, N203S, V363T, V363S, Q438N, S176N, A118N, S132N, K133N, A162N, T195N, K210T, Y391T, F423T, F423S, Y436T, Y436S, L193N, K392T, K392S, F423T, S176N/G178T, S176N/G178S, Q419N/N421T, Q419N/N421S, S191N/L193T, S191N/L193S, G194N/Q196T, and G194N/Q196S, wherein the amino acid positions of the heavy chain contant domain are according to Eu numbering.

5. An engineered IgG antibody or heavy chain constant domain fragment of claim 1, wherein the derivatized drug is selected from the group consisting of a polymer, cytotoxic agent, a radionuclide, fluorescent or chemiluminescent labels, steroid, steroid receptor agonist, signal transduction inhibitor, a peptide and scFv.

6. An engineered IgG antibody or heavy chain constant domain fragment of claim 1, wherein the derivatized drug comprises a cytotoxic agent.

7. The engineered IgG antibody or antigen binding fragment of claim 1, wherein the IgG antibody further comprises one or two N-glycosylation sites in the variable domain that have been generated by amino acid mutations selected from the group consisting of Q105N and S113N, wherein the numbering is according to the Kabat numbering system.

8. The engineered IgG antibody or constant domain fragment of claim 1, wherein the IgG antibody is selected from the group consisting of anti-Her2, anti-Her2/neu, anti-glycoprotein IIb/IIIa, anti-TNF-.alpha., anti-CD52, anti-CD25, anti-BAFF, anti-Vascularendothelial growth factor, anti-CD30, anti-IL-1.beta., anti-epidermal growth factor receptor, anti-RANK Ligand, anti-Complement C5, anti-CD11a, anti-CD33, anti-CD20, anti-CTLA-4, anti-T cell CD3 Receptor, anti-.alpha.-4 (.alpha.4) integrin, anti, anti-Immunoglobulin E, anti-RSV F protein, anti-epidermal growth factor receptor, anti-VEGF-A, anti-ErbB2, anti-IL-12/IL-23, anti-integrin .alpha.4.beta.7, anti-CD274, anti-3-amyloid, anti-4-1BB, anti-SAC, anti-5T4, anti-ACVR2B, anti-adenocarcinomaantigen, anti-AGS-22M6, anti-.alpha.-fetoprotein, anti-angiopoietin 2, anti-angiopoietin 3, anti-anthrax toxin, anti-AOC3, anti-, anti-B7-H3, anti-Bacillus anthracia, anti-.beta. amyloid, anti-B-lymphoma cell, anti-C242 antigen, anti-05, anti-CA-125, anti-carbonic anhydrase 9, anti-cardiac myosin, anti-CCL11, anti-CCR4, anti-CCR5, anti-CD11/CD18, anti-CD125, anti-CD140a, anti-CD147, anti-CD15, anti-CD152, anti-CD154, anti-CD19, anti-CD2, anti-CD200, anti-CD22, anti-CD221, anti-CD23, anti-CD27, anti-CD28, anti-CD3, anti-CD3 epsilon, anti-CD30, anti-CD37, anti-CD38, anti-CD4, anti-CD40, anti-CD41, anti-CD44, anti-CD5, anti-CD51, anti-CD52, anti-CD56, anti-CD6, anti-CD70, anti-CD74, anti-CD79B, anti-CD80, anti-CEA, anti-CFD, anti-ch4D5, anti-CLDN18.2, anti-C. difficile, anti-clumping factor A, anti-CSF2, anti-cytomegalovirus, anti-CMV gp B, anti-DLL4, anti-DRS, anti-E. coli shiga toxin type-1 or 2, anti-EGFL7, anti-endotoxin, anti-EpCAM, anti-EpCAM/CD3, anti-episialin, anti-ERBB3, anti-Escherichia coli, anti-F protein, anti-FAP, anti-fibrin II, anti-.beta.chain, anti-fibronectin extra domain-B, anti-folate receptor 1, anti-Frizzled receptor, anti-GD2 ganglioside, anti-GD3 ganglioside, anti-GMCSF receptor .alpha.-chain, anti-GPNMB, anti-Influenza, anti-Influenza hemagglutinin, anti-hepatitis B, anti-surface antigen, anti-HER1, anti-HER3, anti-HGF, anti-HHGFR, anti-HIV-1, anti-HLA-DR, anti-HNGF, anti-Hsp90, anti-human scatter factor receptor kinase, anti-human TNF, anti-human .beta.-amyloid, anti-CD54, anti-IFN-.alpha., anti-IFN-.gamma., anti-IgE Fc region, anti-IGF-1 receptor, anti-IGF-I, anti-IgG4, anti-IGHE, anti-IL-13, anti-IL-17, anti-IL-17A, anti-IL-10, anti-IL-22, anti-IL-23, anti-IL-4, anti-IL-5, anti-IL-6, anti-IL-6 receptor, anti-IL9, anti-ILGF2, anti-insulin-like growth factor I receptor anti-integrin .alpha.4, anti-integrin .alpha.5.beta.1, anti-integrin .alpha.7.beta.7, anti-integrin .alpha.IIb.beta.3, anti-integrin .alpha.v.beta.3, anti-interferon receptor, anti-interferon .alpha./.beta. receptor, anti-interferon .gamma.-induced protein, anti-ITGA2, anti-KIR2D, anti-Lewis-Y antigen, anti-lipoteichoic acid, anti-LOXL2, anti-L-selectin (CD62L), anti-LTA, anti-MCP-1, anti-mesothelin, anti-MS4A1, anti-MUC1, anti-mucin CanAg, anti-myostatin, anti-NARP-1, anti-NCA-90, anti-NGF, anti-N-glycolylneuraminic acid, anti-NOGO-A, anti-Notch receptor, anti-NRP1, anti-Oryctolagus cuniculus, anti-OX-40, anti-oxLDL, anti-PCSK9, anti-PD-1, anti-PDCD1, anti-PDGF-R .alpha., anti-phosphate-sodium co-transporter, anti-phosphatidylserine, anti-prostatic carcinoma cells, anti-Pseudomonas aeruginosa, anti-rabies virus, anti-rabies virus glycoprotein, anti-respiratory syncytial virus, anti-RHD, anti-Rhesus factor, anti-RON, anti-RTN4, anti-sclerostin, anti-SDC1, anti-selectin P, anti-SLAMF7, anti-SOST, anti-sphingosine-1-phosphate, anti-TAG-72, anti-T-cell receptor, anti-TEM1, anti-tenascin C, anti-TFPI, anti-TGF.beta.1, anti-TGF.beta.2, anti-TGF-.beta., anti-TRAIL-R1, anti-TRAIL-R2, anti-tumor antigen CTAA16.88, anti-TWEAK receptor, anti-TYRP1, anti-VEGF-A, anti-VEGFR-1, anti-VEGFR2, anti-vimentin, anti-VWF, anti-IL-1, anti-IL-2, anti-IL-5, anti-IL-8, anti-IL-12, anti-IL-15, anti-IL-18, anti-IL-20, anti-IL-21, anti-IL-23R, anti-IL-25, anti-IL-27, anti-IL-33, anti-CD14, anti-CD18, anti-CD64, anti-CD200, anti-CD200R, anti-TSLP, anti-TSLPR, anti-PDL1, anti-VLA-4, anti-E-selectin, anti-Fact II, anti-ICAM-3, anti-.beta.2-integrin, anti-CBL, anti-LCAT, anti-CR3, anti-MDL-1, anti-GITR, anti-CGRP, anti-TRKA, anti-IGF1R, and anti-GTC.

9. The engineered IgG antibody or constant domain fragment of claim 1, wherein the IgG antibody is selected from the group consisting of abciximab, adalimumab, certolizumab pegol, golimumab, infliximab, alemtuzumab, basiliximab), belimumab, bevacizumab, brentuximab, canakinumab, cetuximab, daclizumab, denosumab, eculizumab, efalizumab, gemtuzumab, ibritumomab tiuxetan, ipilimumab, muromonab-cd3, natalizumab, ofatumumab, omalizumab, palivizumab, panitumumab, ranibizumab, rituximab, tocilizumab, atlizumab, tositumomab, trastuzumab, ustekinumab, and vedolizumab.

10. A method of preparing a conjugated N-glycosylated IgG antibody or fragment thereof comprising an N-glycan attached to the N at position 134, wherein the N-glycan has a Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 or GalGlcNAcMan.sub.3GlcNAc.sub.2 glycoform in which the terminal galactose residues are conjugated to a reactive amine group of a derivatized drug by an oxime bond, the method comprising: (a) transforming a yeast or filamentous fungus host cell genetically engineered to produce N-glycans comprising terminal galactose residues of the structure Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2 or the structure Gal.sub.(1-2)GlcNAc.sub.(1-2)Man.sub.5GlcNAc.sub.2 with a nucleic acid encoding an IgG heavy chain constant domain having the amino acid sequence NTS over positions 134-136 of the heavy chain constant domain; b) culturing the transformed host cell under conditions that allow the expression of the IgG heavy chain constant domain comprising terminal galactose residues; (c) contacting the expressed IgG heavy chain constant domain with a reagent that oxidizes the terminal galactose residues to a C-6 aldehyde group; and (d) conjugating the reactive amine group of a derivatized drug to the C-6 aldehyde group to produce the conjugated N-glycosylated IgG antibody or fragment thereof, wherein the amino acid positions of the heavy chain contant domain are according to Eu numbering.

11. The method of claim 10, wherein the IgG heavy chain further comprising a G161 T mutation, which forms a second non-native N-glycosylation site in the heavy chain constant domain having the amino acid sequence NST over positions 159-161 of the heavy chain constant domain, wherein the amino acid positions of the heavy chain contant domain are according to Eu numbering.

12. The method of claim 10, wherein the engineered IgG antibody or heavy chain constant domain fragment further comprises one to ten amino acid mutations or pairs of mutations are selected from the group consisting of N203 T, N203 S, V363T, V363S, Q438N, S176N, A118N, S132N, K133N, A162N, T195N, K2l10T, Y391T, F423T, F423S, Y436T, Y436S, L193N, K392T, K392S, F423 T, S176N/G178T, S176N/G178S, Q419N/N421T, Q419N/N421S, S191N/L193T, S191N/L193S, G194N/Q196T, and G194N/Q196S, whereinthe amino acid positions of the heavy chain contant domain are according to Eu numbering.

13. The method of claim 10, wherein the nucleic acid encodes an IgG antibody and further comprises one or two N-glycosylation sites in the variable domain that have been generated by amino acid mutations selected from the group consisting of Q105N and S113N, wherein the numbering is according to the Kabat numbering system.

14. The method of claim 11, wherein the engineered IgG antibody or heavy chain constant domain fragment further comprises one to ten amino acid mutations or pairs of mutations are selected from the group consisting of N203 T, N203 S, V363T, V363S, Q438N, S176N, A118N, S132N, K133N, A162N, T195N, K210T, Y391T, F423T, F423S, Y436T, Y436S, L193N, K392T, K392S, F423T, S176N/G178T, S176N/G178S, Q419N/N421T, Q419N/N421S, S191N/L193T, S191N/L193S, G194N/Q196T, andG194N/Q196S, wherein the amino acid positions of the heavy chain contant domain are according to Eu numbering.

15. The method of claim 11, wherein the nucleic acid encodes an IgG antibody and further comprises one or two N-glycosylation sites in the variable domain that have been generated by amino acid mutations selected from the group consisting of Q105N and S113N, wherein the numbering is according to the Kabat numbering system.

16. The method of claim 10, wherein the yeast host cell is selected from the group consisting of Pichia pastoris (Komagataella pastoris), Pichia finlandica, Pichia trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia opuntiae, Pichiathermotolerans, Pichia salictaria, Pichia guercuum, Pichia pijperi, Pichia stiptis, Pichia methanolica, Pichia minuta (Ogataea minuta, Pichia lindneri), Pichia sp., Saccharomyces cerevisiae, Saccharomyces sp., Hansenula polymorphs, Kluyveromyces sp., Kluyveromyces lactis, Candida albicans, Aspergillus nidulans, Aspergillus niger, Aspergillus oryzae, Trichodermareesei, Chrysosporium lucknowense, Fusarium sp., Fusarium gramineum, Fusarium venenatum, and Neurospora crassa.

17. An engineered IgG antibody or heavy chain constant domain fragment comprising a G161 T mutation, which forms a second non-native N-glycosylation site in the heavy chain constant domain having the amino acid sequence NST over positions 159-161 of the heavy chain constant domain, said non-native N-glycosylation site having an N-glycan attached to the N at position 134, wherein the N-glycan has a Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 glycoform or GalGlcNAcMan.sub.3GlcNAc.sub.2 glycoform in which the terminal galactose residues have been oxidized to a C-6 aldehyde group, which is conjugated to a reactive amine group of a derivatized drug by an oxime bond, and wherein the amino acid positions of the heavy chain contant domain are according to Eu numbering.

18. The engineered IgG antibody or constant domain fragment of claim 17, wherein the engineered IgG antibody or heavy chain constant domain fragment further comprises one to ten amino acid mutations or pairs of mutations are selected from the group consisting of N203 T, N203S, V363T, V363S, Q438N, S176N, A118N, S132N, K133N, A162N, T195N, K210T, Y391T, F423T, F423S, Y436T, Y436S, L193N, K392T, K392S, F423T, S176N/G178T, S176N/G178S, Q419N/N421T, Q419N/N421S, S191N/L193T, S191N/L193S, G194N/Q196T, and G194N/Q196S, wherein the amino acid positions of the heavy chain contant domain are according to Eu numbering.

19. The engineered IgG antibody or constant domain fragment of claim 17, wherein the IgG antibody and further comprises one or two N-glycosylation sites in the variable domain that have been generated by amino acid mutations selected from the group consisting of Q105N and S113N, wherein the numbering is according to the Kabat numbering system.

20. The engineered IgG antibody or constant domain fragment of claim 17, wherein the IgG antibody is (a) selected from the group consisting of anti-Her2, anti-Her2/neu, anti-glycoprotein IIb/IIIa, anti-TNF-.alpha., anti-CD52, anti-CD25, anti-BAFF, anti-Vascularendothelial growth factor, anti-CD30, anti-IL-1.beta., anti-epidermal growth factor receptor, anti-RANK Ligand, anti-Complement C5, anti-CD11a, anti-CD33, anti-CD20, anti-CTLA-4, anti-T cell CD3 Receptor, anti-.alpha.-4 (a4) integrin, anti, anti-Immunoglobulin E, anti-RSV F protein, anti-epidermal growth factor receptor, anti-VEGF-A, anti-ErbB2, anti-IL-12/IL-23, anti-integrin .alpha.407, anti-CD274, anti-3-amyloid, anti-4-1BB, anti-SAC, anti-5T4, anti-ACVR2B, anti-adenocarcinomaantigen, anti-AGS-22M6, anti-.alpha.-fetoprotein, anti-angiopoietin 2, anti-angiopoietin 3, anti-anthrax toxin, anti-AOC3, anti-, anti-B7-H3, anti-Bacillus anthracia, anti-.beta. amyloid, anti-B-lymphoma cell, anti-C242 antigen, anti-05, anti-CA-125, anti-carbonic anhydrase 9, anti-cardiac myosin, anti-CCL11, anti-CCR4, anti-CCR5, anti-CD11/CD18, anti-CD125, anti-CD140a, anti-CD147, anti-CD15, anti-CD152, anti-CD154, anti-CD19, anti-CD2, anti-CD200, anti-CD22, anti-CD221, anti-CD23, anti-CD27, anti-CD28, anti-CD3, anti-CD3 epsilon, anti-CD30, anti-CD37, anti-CD38, anti-CD4, anti-CD40, anti-CD41, anti-CD44, anti-CD5, anti-CD51, anti-CD52, anti-CD56, anti-CD6, anti-CD70, anti-CD74, anti-CD79B, anti-CD80, anti-CEA, anti-CFD, anti-ch4D5, anti-CLDN18.2, anti-C. difficile, anti-clumping factor A, anti-CSF2, anti-cytomegalovirus, anti-CMV gp B, anti-DLL4, anti-DRS, anti-E. coli shiga toxin type-1 or 2, anti-EGFL7, anti-endotoxin, anti-EpCAM, anti-EpCAM/CD3, anti-episialin, anti-ERBB3, anti-Escherichia coli, anti-F protein, anti-FAP, anti-fibrin II, anti-.beta. chain, anti-fibronectin extra domain-B, anti-folate receptor 1, anti-Frizzled receptor, anti-GD2 ganglioside, anti-GD3 ganglioside, anti-GMCSF receptor .alpha.-chain, anti-GPNMB, anti-Influenza, anti-Influenza hemagglutinin, anti-hepatitis B, anti-surface antigen, anti-HER1, anti-HER3, anti-HGF, anti-HHGFR, anti-HIV-1, anti-HLA-DR, anti-HNGF, anti-Hsp90, anti-human scatter factor receptor kinase, anti-human TNF, anti-human .beta.-amyloid, anti-CD54, anti-IFN-.alpha., anti-IFN-.gamma., anti-IgE Fc region, anti-IGF-1 receptor, anti-IGF-I, anti-IgG4, anti-IGHE, anti-IL-13, anti-IL-17, anti-IL-17A, anti-IL-10, anti-IL-22, anti-IL-23, anti-IL-4, anti-IL-5, anti-IL-6, anti-IL-6 receptor, anti-IL9, anti-ILGF2, anti-insulin-like growth factor I receptor, anti-integrin .alpha.4, anti-integrin .alpha.5.beta.1, anti-integrin .alpha.7.beta.7, anti-integrin .alpha.IIb.beta.3, anti-integrin .alpha.v.beta.3, anti-interferon receptor, anti-interferon .alpha./.beta. receptor, anti-interferon 7-induced protein, anti-ITGA2, anti-KIR2D, anti-Lewis-Y antigen, anti-lipoteichoic acid, anti-LOXL2, anti-L-selectin (CD62L), anti-LTA, anti-MCP-1, anti-mesothelin, anti-MS4A1, anti-MUC1, anti-mucin CanAg, anti-myostatin, anti-NARP-1, anti-NCA-90, anti-NGF, anti-N-glycolylneuraminic acid, anti-NOGO-A, anti-Notch receptor, anti-NRP1, anti-Oryctolagus cuniculus, anti-OX-40, anti-oxLDL, anti-PCSK9, anti-PD-1, anti-PDCD1, anti-PDGF-R .alpha., anti-phosphate-sodium co-transporter, anti-phosphatidylserine, anti-prostatic carcinoma cells, anti-Pseudomonas aeruginosa, anti-rabies virus, anti-rabies virus glycoprotein, anti-respiratory syncytial virus, anti-RHD, anti-Rhesus factor, anti-RON, anti-RTN4, anti-sclerostin, anti-SDC1, anti-selectin P, anti-SLAMF7, anti-SOST, anti-sphingosine-1-phosphate, anti-TAG-72, anti-T-cell receptor, anti-TEM1, anti-tenascin C, anti-TFPI, anti-TGF.beta.1, anti-TGF.beta.2, anti-TGF-.beta., anti-TRAIL-R1, anti-TRAIL-R2, anti-tumor antigen CTAA16.88, anti-TWEAK receptor, anti-TYRP1, anti-VEGF-A, anti-VEGFR-1, anti-VEGFR2, anti-vimentin, anti-VWF, anti-IL-1, anti-IL-2, anti-IL-5, anti-IL-8, anti-IL-12, anti-IL-15, anti-IL-18, anti-IL-20, anti-IL-21, anti-IL-23R, anti-IL-25, anti-IL-27, anti-IL-33, anti-CD14, anti-CD18, anti-CD64, anti-CD200, anti-CD200R, anti-TSLP, anti-TSLPR, anti-PDL1, anti-VLA-4, anti-E-selectin, anti-Fact II, anti-ICAM-3, anti-02-integrin, anti-CBL, anti-LCAT, anti-CR3, anti-MDL-1, anti-GITR, anti-CGRP, anti-TRKA, anti-IGF1R, and anti-GTC; or (b) selected from the group consisting of abciximab, adalimumab, certolizumab pegol, golimumab, infliximab, alemtuzumab, basiliximab), belimumab, bevacizumab, brentuximab, canakinumab, cetuximab, daclizumab, denosumab, eculizumab, efalizumab, gemtuzumab, ibritumomab tiuxetan, ipilimumab, muromonab-cd3, natalizumab, ofatumumab, omalizumab, palivizumab, panitumumab, ranibizumab, rituximab, tocilizumab, atlizumab, tositumomab, trastuzumab, ustekinumab, and vedolizumab.
Description



CROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This application is a divisional application of U.S. patent application Ser. No. 15/493,720, filed Apr. 21, 2017, which claims the benefit of U.S. Provisional Patent Application No. 62/325,497, filed Apr. 21, 2016, which is herein incorporated by referenced in its entirety.

REFERENCE TO SEQUENCE LISTING SUBMITTED ELECTRONICALLY

[0002] The sequence listing of the present application is submitted electronically via EFS-Web as an ASCII formatted sequence listing with a file name "24059-US-DIV-SEQTXT-07APRIL2022.txt", creation date of Apr. 7, 2022, and a size of 229 Kb. This sequence listing submitted via EFS-Web is part of the specification and is herein incorporated by reference in its entirety.

FIELD OF THE INVENTION

[0003] The present invention relates to engineered immunoglobulin comprising mutations in the constant domains useful in antibody-drug conjugates (ADCs), methods of treatment utilizing the ADCs and methods of preparing the ADCs.

BACKGROUND

[0004] Monoclonal antibodies (mAbs) represent one of the fastest growing and most important sectors of the pharmaceutical market (Walsh, 2014). Antibodies (Abs) are unique molecules that provide the ability to target cell-associated and soluble antigens in a highly specific manner. This targeting can be used to block activities such as receptor-ligand interactions, influence or induce target-specific biological processes such as complement activities and immune cell-mediated cytotoxic activities, or modulate inflammation. However, efficient target cell killing, especially in the context of a solid tumor remains a limitation for many conventional mAbs (Schrama et al, 2006; Ricart, 2007). Increasing the versatility and effectiveness of these molecules will be a crucial focus as the next generation of antibody-based therapeutics is developed. One of the primary advancements in recent years is the resurgence of ADCs, particularly in the area of oncology (Flygare, 2013; Mullard, 2013). ADCs are comprised of a targeting vehicle and a linker that provides a stable support for the drug to prevent off-target release but allow effective release at the target location (Alley et al, 2010). Using the same strategy, Abs can also be conjugated to radioisotopes, peptides, or other macromolecules such as RNA (Ricart, 2011). However, to date, ADCs have been most often used for the delivery of drug payloads to improve cytotoxicity of a mAb to a known target (e.g. trastuzumab in the case of Her2; also known as Herceptin), which concomitantly increases the therapeutic index of an otherwise intolerable cytotoxic therapy (Burris, 2013).

[0005] While important technical challenges such as an optimal drug:antibody ratio (DAR) and methods of linker attachment (cleavable vs. non-cleavable) have been addressed to improve the characteristics of the current generation of ADCs, important limitations still exist (Panowski, 2013; Boylan, 2013). These hurdles include more efficient manufacture of ADCs, increased product homogeneity, and improving the sophistication of the chemistry available to allow broadening the scope of ADCs to include combining Abs with peptides and hormones.

[0006] It has been shown that site-specific targeting of a cytotoxic agent to an Ab not only improves the homogeneity of the drug product but also the therapeutic index and efficacy of the ADC (Junutula, 2008; Junutula, 2012). However, all current site-specific targeting technologies have significant limitations. Using engineered Cysteine (Cys) residues allows for a large degree of site specificity but does not prevent targeting to native Cys residues within the Ab protein, thus resulting in residual heterogeneity while likely decreasing the stability of the molecule through the disruption of native disulfide bonds, as well as complicating manufacture of an Ab that now contains free thiol residues (native Abs typically only contain paired Cys residues that are engaged in disulfide bonds). Recent technologies that rely on the incorporation of non-native amino acids are a step forward from engineered Cys residues because they allow for unique chemistry that is notpresent in the 20 amino acid code (Axup, 2012; Zimmerman, 2014). Incorporation of non-native amino acids also allows for more discrete control of the number of sites of conjugation. However scale-up and the subsequent manufacture of mAbs in mammalian cell lines, e.g., CHO cells, expressing non-native amino acids and efficient incorporation of these non-native amino acids introduces new challenges. Several other new technologies have emerged, but each with its own limitations, including introducing site specific tags in the mAb, which could promote immunogenicity, or modifying the N-297 glycan, which limits or abolishes immune effector function (Panowski, 2013). Also, in each case, scalability is either challenging or an unknown. Thus, an opportunity remains for a practical and scalable site-specific modification technology that would permit linking Abs to a range of different payloads.

SUMMARY OF THE INVENTION

[0007] The present invention relates to engineered Abs or fragments thereof, and in particular IgG Abs possessing one to ten mutations within the heavy chain constant domains, e.g, C.sub.H1, hinge, C.sub.H2, C.sub.H3, and Fc. These mutations create non-native N-glycosylation sites in the heavy chain constant domain. In one embodiment, the engineered Abs of the invention are expressed in yeast or filamentous fungal host cells, for example Pichia pastoris host cells. When the engineered Abs are expressed in yeast and filamentous fungi host cells genetically engineered to produce human N-glycans, N-glycans are efficiently incorporated into the non-native N-glycosylation site(s) of the heavy chain constant domain. The engineered Abs expressed in genetically engineered yeast and filamentous fungal host cells possess a high degree ofN-glycan occupancy without disrupting the normal folding or function of the Ab, and allow conjugation of a suitable amount of payload/drug to the Ab to form an ADC. In particular, the engineered Abs of the invention comprise galactose-terminated N-glycans, which can be oxidized by an oxidizing reagent to produce aldehyde groups. The reactive aldehyde groups, in the presence of a derivatized drug containing a reactive amine form a bond (e.g., the reactive amine, alkoxyamine, reacts with aldehyde groups to form an oxime bond), thereby conjugating the drug to the Ab. In one embodiment, the engineered IgG Ab or fragment thereof comprises a human IgG1 constant domain.

[0008] In one embodiment, the present invention provides an engineered IgG Ab or fragment thereof comprising one to ten mutations (or pairs of mutations) in the heavy chain constant domain which generate one to ten non-native N-glycosylation sites, the mutations being selected from the group consisting of S134N, G161T, G161S, N203 T, N203 S, V363T, V363S, Q438N, S176N, A118N, S132N, K133N, A162N, T195N, K210T, Y391T, F423T, F423S, Y436T, Y436S, L193N, K392T, K392S, F423T, S176N/G178T, S176N/G178S, Q419N/N421T, Q419N/N421S, S191N/L193T, S191N/L193S, G194N/Q196T, and G194N/Q196S, according to EU numbering. In one embodiment, the engineered IgG Ab or fragment thereof comprises a human IgG1 constant domain.

[0009] In one embodiment, the engineered IgG Ab or fragment thereof comprises at least one or two amino acid mutations (or a pair of mutations) in the heavy chain constant domain selected from S134N, G161T and S134N/G161T. In one embodiment, the engineered IgG Ab or fragment thereof comprises a human IgG1 constant domain.

[0010] In another embodiment, the engineered IgG Ab or fragment thereof comprises at least two amino acid mutations in the heavy chain constant domain selected from G161T/S134T and G161S/S134T. In one embodiment, the engineered Ab comprises a human IgG1 constant domain.

[0011] In another embodiment, the N-glycosylated non-native site of the engineered IgG Ab or fragment thereof is conjugated to a drug selected from the group consisting of a polymer, cytotoxic agent, a radionuclide, fluorescent or chemiluminescent labels, steroid, steroid receptor agonist, signal transduction inhibitor, a peptide and scFv.

[0012] The present invention also relates to engineered IgG Abs or fragments thereof, and in particular Abs possessing one to two mutations in the heavy chain variable framework domain which generate one to two non-native N-glycosylation sites, the mutations being selected from the group consisting of Q105N and S113N, according to Kabat numbering.

[0013] In an embodiment, the engineered IgG Ab or fragment comprising one to two mutations in the heavy chain variable framework domain is conjugated to a drug and is selected from the group consisting of a polymer, cytotoxic agent, a radionuclide, fluorescent or chemiluminescent labels, steroid, signal transduction inhibitor, a peptide and scFv.

[0014] In another embodiment, a method of treating a disease or cancer in a patient suffering from the disease or cancer is provided, the method comprising administering to the patient a therapeutically effective amount of any of the aforementioned engineered IgG Abs or fragments thereof which are conjugated to a drug.

[0015] In another embodiment, a method of preparing a conjugated N-glycosylated IgG Ab or fragment thereof containing one to ten non-native N-glycosylation sites (or pairing of mutations) in the heavy chain constant domain is provided, the method comprising: [0016] (a) transforming a yeast or filamentous fungus host cell genetically engineered to produce N-glycans comprising terminal galactose residues of the structure Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2 or the structure Gal.sub.(1-2)GlcNAc.sub.(1-2)Man.sub.5GlcNAc.sub.2 with a nucleic acid encoding an IgG heavy chain constant domain or fragment thereof, wherein the IgG heavy chain constant domain comprises one to ten amino acid mutations, and wherein the one to ten amino acid mutations generate at least one N-glycosylation site in the IgG heavy chain constant domain; [0017] (b) culturing the transformed host cell under conditions that allow the expression of the IgG heavy chain constant domain comprising terminal galactose residues, [0018] (c) contacting the expressed IgG heavy chain constant domain with a reagent that oxidizes the terminal galactose residues; and [0019] (d) conjugating a drug to the oxidized moiety of the terminal galactose residues.

[0020] In one embodiment, the yeast host cell used in the method of preparing a conjugated N-glycosylated IgG Ab or fragment thereof containing one to ten non-native N-glycosylation sites in the heavy chain constant domain is selected from the group consisting of Pichia pastoris (Komagataella pastoris), Pichia finlandica, Pichia trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia opuntiae, Pichia thermotolerans, Pichia salictaria, Pichia guercuum, Pichia piperi, Pichia stiptis, Pichia methanolica, Pichia minuta (Ogataea minuta, Pichia lindneri), Pichia sp., Saccharomyces cerevisiae, Saccharomyces sp., Hansenula polymorpha, Kluyveromyces sp., Kluyveromyces lactis, Candida albicans, Aspergillus nidulans, Aspergillus niger, Aspergillus oryzae, Trichoderma reesei, Chrysosporium lucknowense, Fusarium sp., Fusarium gramineum, Fusarium venenatum, Neurospora crassa and Yarrowia lipolytica. In another embodiment, the yeast host cell is Pichia pastoris.

[0021] In another embodiment, the IgG Ab or fragment thereof prepared by the aforementioned method comprises one to ten mutations (or pairs of mutations) in the heavy chain constant domain polypeptide selected from the group consisting of S134N, G161T, G161S, N203T, N203S, V363T, V363S, Q438N, S176N, A118N, S132N, K133N, A162N, T195N, K210T, Y391T, F423T, F423S, Y436T, Y436S, L193N, K392T, K392S, F423T, S176N/G178T, S176N/G178S, Q419N/N421T, Q419N/N421S, S191N/L193T, S191N/L193S, G194N/Q196T, and G194N/Q196S, according to EU numbering. In one embodiment, the IgG heavy chain is a human IgG1 constant domain.

[0022] In another embodiment, methods of preparing a conjugated N-glycosylated IgG Ab or fragment thereof containing one to two non-native N-glycosylation sites in the heavy chain variable framework domain are also provided.

[0023] In another embodiment, a method of preparing a conjugated N-glycosylated IgG Ab or fragment thereof containing one to ten non-native N-glycosylation sites in the heavy chain constant domain is provided, the method comprising: [0024] (a) transforming a yeast or filamentous fungus host cell genetically engineered to produce N-glycans comprising terminal sialic acid residues of the structure NANA.sub.(1-4)Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2 with a nucleic acid encoding an IgG heavy chain contain domain, wherein the IgG heavy chain comprises one to ten amino acid mutations (or pairs of mutations), and wherein the one to ten amino acid mutation generates at least one non-native N-glycosylation site in the IgG heavy chain constant domain; [0025] (b) culturing the transformed host cell under conditions that allow the expression of the IgG heavy chain constant domain comprising terminal sialic acid residues, [0026] (c) contacting the expressed IgG heavy chain constant domain with neuraminidase to remove the terminal sialic acid residues to form N-glycosylated heavy chain constant domain comprising terminal galactose residues; [0027] (d) contacting the expressed glycosylated heavy chain constant domain comprising terminal galactose residues of step (c), with a reagent that oxidizes the terminal galactose residues; and [0028] (e) conjugating a drug to the oxidized moiety of the terminal galactose residues.

[0029] In one embodiment, the IgG heavy chain is a human IgG1 constant domain.

BRIEF DESCRIPTION OF THE FIGURES

[0030] FIG. 1. A comparison of the N-glycosylation machinery between yeast and mammals. Yeast and mammals initiate glycosylation similarly via the secretory pathway, both resulting in a Man.sub.8GlcNAc.sub.2 N-glycan following protein folding and ER maturation. N-glycosylation pathways differ in the Golgi with mammals trimming mannose residues and adding GlcNAc to produce hybrid and complex N-gly cans in bi-, tri-, or tetra-antennary form, which are then terminated with varying amounts of galactose and sialic acid. In contrast, fungi, such as P. pastoris, add additional mannose with various linkages, including an outer chain initiated by the Och1p .alpha.-1,6-mannosyltransferase, resulting in glycans that in total can be comprised of dozens of mannose residues. Man, mannose; GlcNAc, N-acetyl glucosamine; Gal, galactose; MnT, mannosyltransferase; MNS, mannosidase; GnT, GlcNAc transferase; GalT, galactosyl transferase.

[0031] FIG. 2. A flow diagram of an example of the basic molecular genetic steps of yeast N-glycan engineering. OCH1 is knocked out and, depending on the yeast species, other yeast N-glycan machinery encoding genes are also knocked out. Mannosidases and glycosyl transferases responsible for the successive steps in human N-glycan biosynthesis are introduced, wherein each intermediate step can be isolated via a strain producing that particular glycan structure (GS). Man, mannose; GlcNAc, N-acetyl glucosamine; Gal, galactose; MnT, mannosyltransferase; MNS, mannosidase; GnT, GlcNAc transferase; GalT, galactosyl transferase; UDP, Uridine diphosphate; CMP, Cytidine monophosphate.

[0032] FIG. 3: Restriction map of plasmid pGLY5883. The E. coli/P. pastoris shuttle vector is depicted circularly as it is maintained in E. coli. The plasmid contains the pUC19 Ori and AmpR region for E. coli maintenance as well as the Sh ble gene encoding Zeocin resistance (ZeoR) and the P. pastoris TRP2 gene, used as an integration site. The genes encoding the trastuzumab anti-Her2 H (heavy) chain and L (light) chain are contained as separate cassettes, each with the P. pastoris AOX1 promoter and S. cerevisiae CYC1 transcriptional terminator.

[0033] FIG. 4(A-B): Capillary electrophoretic analysis of N-glycan modified antibodies. Gel animation image depicting protein bands following separation by capillary electrophoresis of glycan-engineered versions of the trastuzumab anti-Her2 antibody under denatured non-reduced conditions. Antibodies are described in Table 1 and were expressed in GS5.0 (FIG. 2) glycoengineered Pichia, then resulting clones cultivated in 96 deep well plates, and culture supernatant protein A purified. Arrows indicate the presence of an antibody tetramer band. Sizes are indicated by the markers at the far left and right.

[0034] FIG. 5(A-D): Capillary electrophoresis analysis of N-glycan modified antibodies cultivated in micro24. Clones expressing indicated plasmids were cultivated in micro24 5 ml fermenter vessels. Following protein A purification, purified protein was analyzed by Caliper GXII under denatured non-reducing conditions and reducing conditions. Arrows indicate the presence of an antibody tetramer band in the non-reduced samples and the antibody H chain monomer in the reduced samples. C, control samples, are samples from cultivation of strain YGLY13979, expressing the wild type trastuzumab antibody sequence. Sizes are indicated by the markers at the far left and right.

[0035] FIG. 6(A-G): Q-ToF Mass spectrometry analysis of N-glycan modified antibodies. Deconvoluted mass spectra of reduced antibodies isolated from the strains indicated after cultivation in micro24 5 ml fermenters. The expected mass range for H chain with 0, 1, and 2 N-glycans is indicated. Where actual masses agree closely with a predicted size for a modified glycosylated antibody, the structure is indicated for the peak representing expected modified protein. GS, glycan structure (see FIG. 2).

[0036] FIG. 7: Capillary electrophoretic analysis of N-glycan modified antibodies cultivated in Dasgip 1 L fermenters. Clones expressing the plasmids indicated in Table 3 were cultivated in Dasgip (Shrewsbury, Mass.) 1 L fermenter vessels. Following protein A purification, purified protein was analyzed by Caliper GXII under denatured non-reducing and reducing conditions. Arrows indicate the presence of an antibody tetramer band in the non-reduced samples and the antibody H and L chain monomers in the reduced samples. Sizes are indicated by the markers at the far left.

[0037] FIG. 8(A-C): Q-ToF Mass spectrometry analysis of N-glycan engineered antibodies cultivated in Dasgip 1 L fermenters. Deconvoluted mass spectra of reduced antibodies isolated and purified by small scale high throughput protein A from strains cultivated in Dasgip 1 L fermenters. The strain cultivated in each fermenter and associated plasmid/antibody information is indicated in Table 3. The expected mass range for H chain with 0, 1, and 2 N-glycans is indicated. Where actual masses agree closely with a predicted size for a modified glycosylated antibody, the structure is indicated for the peak representing expected modified protein. A, samples D133201-08; B, samples D133401-04; C, samples D133405-08. GS, glycan structure (see FIG. 2).

[0038] FIG. 9(A-B): Mass spectrometry analysis of highly purified N-glycan engineered antibodies cultivated in Dasgip 1 L fermenters. Deconvoluted mass spectra are shown for reduced antibodies isolated and purified by larger scale protein A purification (Zha, 2013) from 1 L fermentation samples D133202, D133203, D133208, D133404, and D133406 (see Table 3). A) Mass spectra are gated to include expectedL and H chain masses. The expected mass ranges for L chain (LC) and glycosylated H chain (HC+glycans) are indicated. B) Mass spectra gated to zoom in on H chain expected mass. Where actual masses agree closely with a predicted size for a modified glycosylated antibody, the structure is indicated for the peak representing expected modified protein. GS, glycan structure (see FIG. 2).

[0039] FIG. 10: Glycosidase digestion and analysis of N-glycan modified antibodies. Purified antibody from batch D133404 (trastuzumab, S134N) was analyzed directly by Q-ToF MS, as previously shown, then subjected to EndoS glycosidase digestion to remove the N-297 glycan. The released N-glycans were analyzed by MALDI-ToF MS and the remaining intact protein analyzed by Q-ToF MS and deconvoluted. Finally, the Endo S digested protein was further subjected to PNGase F glycosidase digestion and N-glycans and protein were again separately analyzed by MALDI-TOF MS and Q-ToF, respectively.

[0040] FIG. 11(A-F): Analysis of binding of glycan modified anti-Her2 antibodies to Her2 antigen. Protein A purified N-glycan modified antibodies analyzed for binding to Her2 protein using surface plasmon resonance. Anti-human Fc antibody was immobilized and used to capture purified glycoengineered Pichia-produced mutant trastuzumab variants (A) S134N, (B) G161T, (C) N203T, and (D) V363T as well as (E) commercial Herceptin (trastuzumab) and (F) S134N conjugated with DM1 cytotoxin.

[0041] FIG. 12: Conjugation of a fluorescent dye to native N-glycans on commercial trastuzumab by galactose oxidase treatment. Commercial trastuzumab was subjected to galactose oxidase enzyme treatment for 48 h in the presence of aminooxy CF633 fluorophore and 50 mM aniline and the resulting protein was reduced and analyzed by Q-ToF MS. The deconvoluted mass spectrum is shown with the mass range expected for unconjugated (H chain) and conjugated (H chain+CF633) indicated. Peaks corresponding to the expected mass of trastuzumab glycan-containing heavy chain variants are labeled with the canonical glycan structures.

[0042] FIG. 13: Glycan-mediated conjugation of a fluorescent dye glycan-engineered antibodies using galactose oxidase. Pichia-produced glycan-engineered versions of trastuzumab were subjected to galactose oxidase enzyme treatment in the presence of aminooxy CF633 fluorophore and the resulting protein was reduced and analyzed by Q-ToF MS. The deconvoluted mass spectra are shown with the mass range expected for unconjugated (HC), singly conjugated (+1.times.CF633), and doubly conjugated (+2.times.CF633) antibody indicated. The predominant peak corresponding to the expected mass of the glycosylated mutated trastuzumab heavy chain is labeled (HC+GS4.0+GS5.0) with glycan structures referenced in FIG. 2.

[0043] FIG. 14: Q-ToF Mass spectrometry analysis of sialylated N-glycan engineered antibodies. Deconvoluted mass spectra are shown for reduced glycan engineered trastuzumab antibodies isolated and purified by small scale high throughput protein A expressed in GS6.0 glycoengineered Pichia strains cultivated in Dasgip 1 L fermenters with batch numbers shown. The predominant peaks corresponding to the expected masses of the glycosylated mutated trastuzumab heavy chain is labeled (HC+2 GS6.0) with glycan structures referenced in FIG. 2.

[0044] FIG. 15: Glycan-mediated conjugation of a fluorophore to glycan-engineered antibodies with galactose oxidase in the presence of reaction catalysts. Pichia-produced glycan-engineered versions of trastuzumab were conjugated with an aminooxy activated CF633 fluorophore using galactose oxidase in the presence of reaction catalysts 2-Amino-5-methoxybenzoic acid (AMB), 3,5-diaminobenzoic acid (DAB), and aniline. The resulting conjugated protein was reduced and analyzed by Q-ToF MS and deconvoluted mass spectra are shown with the mass range expected for unconjugated (HC), singly conjugated (+1.times.CF633), and doubly conjugated (+2.times.CF633) antibody indicated. The predominant peak corresponding to the expected mass of the glycosylated mutated trastuzumab heavy chain is labeled (HC+GS4.0+GS5.0) with glycan structures referenced in FIG. 2.

[0045] FIG. 16: Glycan-mediated conjugation of a fluorescent dye at multiple different sites on glycan-engineered antibodies. Multiple Pichia-produced glycan-engineered versions of trastuzumab (Sample IDs and mutations as described in Table 2) were conjugated with an aminooxy activated CF633 fluorophore in the presence of aniline as a reaction catalyst. The resulting conjugated protein was reduced and analyzed by Q-ToF MS and deconvoluted mass spectra are shown with the mass range expected for unconjugated (HC), singly conjugated (+1 Alexa488), and doubly conjugated (+2 Alexa488) antibody indicated as well as triply conjugated (+3 Alexa488).

[0046] FIG. 17: Scale-up and quantification of conjugation to glycan-engineered antibodies. Pichia-produced glycan-engineered versions of trastuzumab were conjugated with an alkoxyamine activated Biotin and an alkoxyamine activated fluorophore (Alexa488) in the presence of aniline then reduced and the resulting reaction products analyzed by Q-ToF MS. The peak areas were then calculated and ratioed to determine the average number of conjugates per whole mAb (Drug-antibody-ratio, DAR).

[0047] FIG. 18(A-B): IdeS digestion and mass spectrometry analysis of a conjugated, glycan-engineered antibody. Glycan-engineered (G161T) trastuzumab that was produced in glycoengineered Pichia and conjugated with CF633 fluorescent dye was digested with IdeS enzyme to separate the F(ab')2 and Fc domains and the resulting protein analyzed by Q-ToF MS. Expected mass ranges for glycosylated, conjugated Fab fragments (F(ab')2+3 CF633 and F(ab')2+4 CF633) and glycosylated unconjuguated (Fc+GS4.0) as well as conjugated Fc fragments (Fc+GS3.5+CF633) are identified.

[0048] FIG. 19: Size Exclusion Chromatography of a glycan-engineered and conjugated antibody. Glycan-engineered (G161T) trastuzumab that was produced in glycoengineered Pichia and then conjugated with CF633 fluorescent dye was analyzed by native size exclusion chromatography prior to and after conjugation compared to the commercially available trastuzumab as a control.

[0049] FIG. 20: Temperature stability of glycan-conjugated antibodies. Glycan-engineered trastuzumab variants produced in glycoengineered Pichia were analyzed by native size exclusion chromatography compared commercially available trastuzumab as a control prior to and after a two week incubation at 45.degree. C. in 100 mM sodium phosphate pH 7.0.

[0050] FIG. 21(A-C): Conjugation of exendin-4 peptide to a glycan-engineered antibody. A, Illustration of the site-specific conjugation of alkoxyamine activated exendin-4 peptide to the Fab glycan of the GS5.0 Pichia produced glycan-engineered antibody. B, A deconvoluted Q-ToF mass spectrum of reduced antibody (H chain) after conjugation with exendin-4 peptide, which was used as the basis calculating the peptide:mAb ratio (DAR). C, GLP1-receptor agonist activity assay demonstrating the activity of the mAb/exendin-4 conjugate compared to native GLP-1 peptide, calculated as the EC50 of intracellular cAMP change in GLP-1R recombinant CHO cells.

[0051] FIG. 22(A-B): Conjugation of a modified DM1 cytotoxin to a glycan-engineered antibody. A, Illustration of the conjugation reaction of alkoxy-labeled, C5-linked, Mertansine (DM1) to the galactose residues of the Fab glycans on a glycan-engineered anti-Her2 antibody in one-pot with FgGalOx. B, Deconvoluted Q-ToF mass spectrum of reduced antibody (H chain) after conjugation with DM1 for two different glycan-engineered anti-Her2 antibodies.

[0052] FIG. 23(A-B): Q-ToF Mass spectrometry analysis of DM1-conjugated antibodies. A, Deconvoluted Q-ToF mass spectrum of reduced DM1-conjugated anti-Her2 G161T glycan-engineered antibody, gated to include predicted heavy (Hc) and light (Lc) chain masses, with conjugation efficiency calculated (DAR) based on integrated peak areas. B, Deconvoluted Q-ToF mass spectrum of reduced DM1-conjugated anti-Her2 (ado-trastuzumab emtansine) antibody, gated to include predicted H and L chain masses.

[0053] FIG. 24(A-B): Q-ToF Mass spectrometry analysis of glycan-engineered antibodies isolated from microfermenter cultivation. Deconvoluted Q-ToF mass spectra of reduced antibodies for A) one set of 7 glycan-engineered anti-Her2 antibodies with F.sub.ab and C.sub.H1-localized muteins, and B) an additional set of 7 diverse glycan-engineered anti-Her2 antibodies including CH3-located and double mutant sequences. All spectra are gated to include predicted heavy (H) chain masses. Unglycosylated, singly glycosylated (+1 N-glycan) and doubly glycosylated (+2 N-glycans) predicted masses are identified, while specific masses differ slightly depending on the mutational change(s) made to incorporate the respective N-glycan sequon. Sequence-related information for each mutation is found in Table 4.

[0054] FIG. 25(A-B): Q-ToF Mass spectrometry analysis of glycan-engineered antibodies with two additional N-glycan sites. Deconvoluted Q-ToF mass spectra of reduced antibodies that have been glycan-engineered to incorporate two non-native N-glycosylation sites, in each case located on the C.sub.H1 domain of the heavy chain. The spectra are gated to include: A) predicted light and heavy chain masses, and B) zoomed to observe the predicted H chain masses.

[0055] FIG. 26(A-F): Glycan-engineered antibodies with three or more additional N-glycan sites. A, Illustration depicting the single position glycan-engineered antibody (shown here in the C.sub.H1 region), which may or may not also contain the C.sub.H2 Fc-297 N-glycan and B, single position glyco-conjugation, leading to a distinct DAR of 2 or 4 depending the N-glycan chosen (or 6 or 8 if multiantennary N-glycans are employed). C, Illustration showing a multi-position glycan-engineered antibody. D, Capillary electrophoresis profile showing several non-reduced multi-position glycan engineered antibodies compared to the one position-modified and control (anti-Her2 Trasutuzmab sequence) antibodies. E, MALDI-TOF MS of released N-glycans from multi-position glycan-engineered antibody modified with ten additional N-glycan sites and expressed in a GS5.0 glycoform strain (see FIG. 2). F, Illustration showing conjugation to the exposed galactose residues of a multi-position glycan-engineered mAb to achieve higher DAR (Drug to Ab Ratio).

[0056] FIG. 27: Restriction map of plasmid pGLY11576. The E. coli/P. pastoris shuttle vector is depicted circularly as it is maintained in E. coli. The plasmid contains the pUC19 Ori and AmpR region for E. coli maintenance as well as the Sh ble gene encoding Zeocin resistance (ZeoR) and the P. pastoris TRP2 gene, used as an integration site. The genes encoding the modified trastuzumab-based "null-Her2" H chain and L chain that have been modified to no longer bind the Her2 receptor are contained as separate cassettes. Each antibody gene cassette is flanked with the P. pastoris AOX1 promoter and a transcriptional terminator, that from S. cerevisiae CYC1 for the H chain and that from P. pastoris AOX1 for the L chain.

[0057] FIG. 28(A-B): Q-ToF Mass spectrometry analysis of glycan-engineered antibodies with more than two additional N-glycan sites. Deconvoluted Q-ToF mass spectra of reduced antibodies that have been glycan-engineered to incorporate from three to ten non-native N-glycosylation sites resulting from transformation of plasmids: A, pGLY14172-14175 or B, pGLY14176, 14177, and 14179 (see Table 5) into a GS5.0 glycoengineered Pichia strain (see FIG. 2). The resulting spectra are gated to include the predicted H chain masses.

[0058] FIG. 29(A-B): Capillary electrophoresis analysis of sialylated N-glycan modified antibodies containing three to ten additional N-glycans. The plasmids indicated in Table 5 were transformed into GS6.0 (see FIG. 2) glycoengineered strain YGLY36472 and Zeocin resistant clones were cultivated in 96 deep well plates. Protein A purified protein was analyzed by capillary electrophoresis under denatured, non-reducing conditions. Arrows indicate the presence of an antibody tetramer band in the non-reduced samples and the antibody H and L chain monomers in the reduced samples. Sizes are indicated by the markers at the far left.

[0059] FIG. 30: MALDI-TOF MS of released N-glycans from a multi-position glycan-engineered antibody. A MALDI-TOF mass spectrum in negative ion mode of released N-glycans from an antibody protein A purified from a clone of plasmid pGLY14179 expressed in GS6.0 strain YGLY36472 (see FIG. 2 and Table 5), following cultivation of the clone in a 1 L fermenter. The spectrum is gated to include masses consistent with N-glycans and the masses representative of predicted GS6.0 and a singly sialylated version are identified.

[0060] FIG. 31(A-D): Q-ToF Mass spectrometry analysis of glycan-engineered antibodies with more than two additional N-glycan sites expressed with GS6.0 N-glycans. Deconvoluted Q-ToF mass spectra of reduced antibodies that have been glycan-engineered to incorporate from three to ten non-native N-glycosylation sites resulting from transformation of plasmids: A, pGLY14172 and 14173; B, pGLY14174 and 14175; C, pGLY14176 and 14177; or D, pGLY14178 and 14179 (see Table 5) into a GS6.0 glycoengineered Pichia strain (see FIG. 2), and following 1 L fermentation and protein A purification. The resulting spectra are paired and gated to include first both the predicted L and H chain masses and then zoomed to include only the predicted H chain masses. Where individual peaks closely match predicted masses, these glycosylated species are identified.

[0061] FIG. 32: Restriction map of plasmid pGLY13649. The E. coli/P. pastoris shuttle vector is depicted circularly as it is maintained in E. coli. The plasmid contains the pUC19 Ori and AmpR region for E. coli maintenance as well as the Sh ble gene encoding Zeocin resistance (not marked) and the P. pastoris TRP2 gene, used as an integration site. The genes encoding an anti-murine PD1 antibody H chain and L chain are contained as separate cassettes, each initiated with the P. pastoris AOX1 promoter.

[0062] FIG. 33: Q-ToF Mass spectrometry analysis of an N-glycan engineered anti-PD1 antibody. Deconvoluted mass spectra of reduced glycan-engineered anti-murine PD1 antibodies modified to incorporate one or two non-native N-glycosylation sites, then isolated and purified by protein A from clones cultivated in 1 L fermenters. The incorporated mutations (EU numbering) are noted for each modified antibody and the expected mass range for H chain with two, three, and four N-glycans is indicated (the anti-murine mAb clone contains a H chain CDR N-glycan in addition to the Fc-297 N-glycan in the native sequence).

[0063] FIG. 34: Restriction map of plasmid pGLY8040. The E. coli/P. pastoris shuttle vector is depicted circularly as it is maintained in E. coli. The plasmid contains the pUC19 Ori and AmpR region for E. coli maintenance as well as the Sh ble gene encoding Zeocin resistance (not marked) and the P. pastoris TRP2 gene, used as an integration site. The genes encoding an anti-CS1 antibody H chain and L chain are contained as separate cassettes, each flanked with the P. pastoris AOX1 promoter and a transcriptional terminator (not marked).

[0064] FIG. 35: Q-ToF Mass spectrometry analysis of an N-glycan engineered anti-CS1 antibody. Deconvoluted mass spectra of reduced glycan-engineered anti-murine PD1 antibodies modified to incorporate two separate non-native N-glycosylation sites, then isolated and purified by protein A from clones cultivated in 1 L fermenters. The incorporated mutations (EU numbering) are noted for each modified antibody and the expected mass range for H chain with one or two N-glycans is indicated.

[0065] FIG. 36: Restriction map of plasmid pGLY5730. The E. coli/P. pastoris shuttle vector is depicted circularly as itis maintained in E. coli. The plasmid contains the pUC19 Ori and AmpR region for E. coli maintenance as well as the Sh ble gene encoding Zeocin resistance (not marked) and the P. pastoris TRP2 gene, used as an integration site. The genes encoding an antibody H chain and L chain (with the D2E7 anti-TNF.alpha. variable regions from commercial antibody adalimumab) are contained as separate cassettes, each flanked with the P. pastoris AOX1 promoter and a transcriptional terminator (not marked).

[0066] FIG. 37: Restriction map of plasmid pGLY14148. The E. coli/P. pastoris shuttle vector is depicted circularly as itis maintained in E. coli. The plasmid contains the pUC19 Ori and AmpR region for E. coli maintenance as well as the Sh ble gene encoding Zeocin resistance (ZeocinR) and the P. pastoris TRP2 gene, used as an integration site. The genes encoding an anti-CD70 antibody H chain and L chain are contained as separate cassettes, each flanked with the P. pastoris AOX1 promoter and a transcriptional terminator (TT).

[0067] FIG. 38: Q-ToF Mass spectrometry analysis of an N-glycan engineered anti-CD70 antibody. Deconvoluted mass spectra of reduced glycan-engineered anti-CD70 antibodies modified to incorporate two separate non-native N-glycosylation sites, then isolated and purified by protein A from clones cultivated in 1 L fermenters. The incorporated mutations (EU numbering) are noted for each modified antibody and the expected mass range for H chain with one or two N-glycans is indicated.

DESCRIPTION OF THE INVENTION

[0068] Patents, patent applications, publications, product descriptions, and protocols are cited throughout this application, the disclosures of which are incorporated herein by reference in their entireties for all purposes. All references cited herein are incorporated by reference to the same extent as if each individual publication, database entry (e.g. GenBank sequences or GeneID entries), patent application, or patent, was specifically and individually indicated to be incorporated by reference. Citation of the references herein is not intended as an admission that the reference is pertinent prior art, nor does it constitute any admission as to the contents or date of these publications or documents.

Definitions

[0069] So that the invention may be more readily understood, certain technical and scientific terms are specifically defined below. Unless specifically defined elsewhere in this document, all other technical and scientific terms used herein have the meaning commonly understood by one of ordinary skill in the art to which this invention belongs.

[0070] As used herein, including the appended claims, the singular forms of words such as "a," "an," and "the," include their corresponding plural references unless the context clearly dictates otherwise.

[0071] By "position" as used herein is meant a location in the sequence of a protein. Positions may be numbered sequentially, or according to an established format, for example the EU index for antibody numbering or the Kabat numbering.

[0072] Amino acid positions in a heavy chain constant domain include amino acid positions in the C.sub.H1, hinge, C.sub.H2, C.sub.H3, Fc, and are numbered according to the EU index numbering system (also referred as the "EU index of Kabat" or the "EU index for antibody numbering" or "EU numbering). See Kabat et al., "Sequence of proteins of Immunological interest", 5.sup.th edition, U.S. Dept Health and Human Services, U.S. Gov. Printing Office, 1991.

[0073] Amino acid positions in a variable domain (for example, in framework4 of the heavy chain) are numbered according to the Kabat numbering system (Kabat 1991).

[0074] Kabat numbering is based on the seminal work of Kabat et al. (1991) Sequences of Proteins of Immunological Interest, Publication No. 91-3242, published as a three volume set by the National Institutes of Health, National Technical Information Service (hereinafter "Kabat"). Kabat provides multiple sequence alignments of immunoglobulin chains from numerous species antibody isotypes. The aligned sequences are numbered according to a single numbering system, the Kabat numbering system. The Kabat sequences have been updated since the 1991 publication and are available as an electronic sequence database (latest downloadable version 1997). Any immunoglobulin sequence can be numbered according to Kabat by performing an alignment with the Kabat reference sequence. Herein the heavy chain variable sequences are numbered according to the Kabat reference sequence.

[0075] The term "C.sub.H1" domain as used herein refers to the first constant domain of an IgG heavy chain that extends from about amino acid position 118-215 of the EU numbering system.

[0076] The term "hinge region" as used herein refers to the portion of a heavy chain that attaches the C.sub.H1 domain to the C.sub.H2 domain and comprises about 25 amino acid residues.

[0077] The term "C.sub.H2 domain" as used herein refers to the portion of a heavy chain IgG constant domain that extends from about amino acid positions 231-340 of the EU numbering system.

[0078] The term "C.sub.H3 domain" as used herein refers to the heavy chain IgG constant domain that extends from the N-terminus of the C.sub.H2 domain from about amino acid positions 341-445 of the EU numbering system.

[0079] The term "cytotoxic agent" as used herein refers to the effect of an agent that has a cytotoxic effect on a cell (i.e., an agent that can cause cell death).

[0080] The term "drug" as used herein refers to a compound including a compound, a pharmaceutically active compound, element, agent, pharmaceutically active peptide or protein, or molecular entity.

[0081] In general, the basic Ab structural unit comprises a tetramer. Each tetramer includes two identical pairs of polypeptide chains, each pair having one "light" (about 25 kDa) and one "heavy" chain (about 50-70 kDa). The amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The carboxy-terminal portion of the heavy chain may define a constant region primarily responsible for effector function.

[0082] As used herein "fragment" with respect to "antibody" or "IgG" or "monoclonal antibody" refers to those fragments produced by digestion with various proteases, those produced by chemical cleavage and/or chemical dissociation and those produced by recombination or recombinant DNA technology so long as the fragment remains capable of specific binding to a target molecule. Examples of fragments include, but are not limited to, Fc, Fab, Fab', F(ab').sub.2, Fv, and scFv fragments.

[0083] In an embodiment, the Ab or fragment thereof comprises a heavy chain constant region, e.g. a human constant region, such as .gamma.1, .gamma.2, .gamma.3, or .gamma.4 human heavy chain constant region or a variant thereof. In another embodiment, the Ab or antigen binding fragment comprises a light chain constant region, e.g. a human light chain constant region, such as lambda or kappa human light chain region or variant thereof. By way of example, and not limitation the human heavy chain constant region can be .gamma.1 and the human light chain constant region can be kappa.

[0084] A "Fab fragment" is comprised of one light chain and the C.sub.H1 and variable regions of one heavy chain. The heavy chain of a Fab molecule cannot form a disulfide bond with another heavy chain molecule. A "Fab fragment" can be the product of papain cleavage of an Ab.

[0085] A "Fab' fragment" contains one light chain and a portion or fragment of one heavy chain that contains the V.sub.H domain and the C.sub.H1 domain and also the region between the C.sub.H1 and C.sub.H2 domains, such that an interchain disulfide bond can be formed between the two heavy chains of two Fab' fragments to form a F(ab').sub.2 molecule.

[0086] A "F(ab').sub.2 fragment" contains two light chains and two heavy chains containing a portion of the constant region between the C.sub.H1 and C.sub.H2 domains, such that an interchain disulfide bond is formed between the two heavy chains. A F(ab')2 fragment thus is composed of two Fab' fragments that are held together by a disulfide bond between the two heavy chains. An "F(ab').sub.2 fragment" can be the product of pepsin cleavage of an Ab.

[0087] The term "Fe domain" as used herein refers to the portion of a heavy chain constant domain contains the hinge region (i.e., residue 216 in IgG, taking the first amino acid residue of the heavy chain constant domain to be 114), and C.sub.H2, and C.sub.H3 domains and ending at the C-terminus of the Ab.

[0088] The "Fv region" comprises the variable regions from both the heavy and light chains, but lacks the constant regions.

[0089] As used herein, a "chimeric Ab" is an Ab having the variable domain from a first Ab and the constant domain from a second Ab, where the first and second Abs are from different species. (U.S. Pat. No. 4,816,567; and Morrison et al., (1984) Proc. Natl. Acad. Sci. USA 81: 6851-6855). Typically the variable domains are obtained from an antibody from an experimental animal (the "parental Ab"), such as a rodent, and the constant domain sequences are obtained from human Ab, so that the resulting chimeric Ab will be less likely to elicit an adverse immune response in a human subject than the parental (e.g. rodent) antibody.

[0090] Typically, human light chains are classified as kappa and lambda light chains. Furthermore, human heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively. Within light and heavy chains, the variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D" region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989).

[0091] The variable regions of each light/heavy chain pair form the Ab binding site. Thus, in general, an intact Ab has two binding sites. Except in bifunctional or bispecific Abs, the two binding sites are, in general, the same.

[0092] Typically, the variable domains of both the heavy and light chains comprise three hypervariable regions, also called complementarity determining regions (CDRs), located within relatively conserved framework regions (FR). The CDRs are usually aligned by the framework regions, enabling binding to a specific epitope. In general, from N-terminal to C-terminal, both light and heavy chains variable domains comprise FR1, CDR1, FR2, CDR2, FR3, CDR3 andFR4. The assignment of amino acids to each domain is, generally, in accordance with the definitions of Sequences of Proteins of Immunological Interest, Kabat, et al.; National Institutes of Health, Bethesda, Md.; 5.sup.th ed.; NIH Publ. No. 91-3242 (1991); Kabat (1978) Adv. Prot. Chem. 32:1-75; Kabat, et al., (1977) J. Biol. Chem. 252:6609-6616; Chothia, et al., (1987) J Mol. Biol. 196:901-917 or Chothia, et al., (1989) Nature 342:878-883.

[0093] As used herein, the term "IgG" refers to IgG1, IgG2, IgG3 and IgG4. In an embodiment, IgG is IgG1. In one embodiment, the IgG1 is human IgG1.

[0094] As used herein, the term "hypervariable region" refers to the amino acid residues of an Ab that are responsible for antigen-binding. The hypervariable region comprises amino acid residues from a "complementarity determining region" or "CDR" (i.e. CDRL1, CDRL2 and CDRL3 in the light chain variable domain and CDRH1, CDRH2 and CDRH3 in the heavy chain variable domain). See Kabat et al. (1991); see also Chothia and Lesk (1987) J Mol. Biol. 196: 901-917 (defining the CDR regions of an Ab by structure).

[0095] As used herein, the term "framework" or "FR" residues refers to those variable domain residues other than the hypervariable region residues defined herein as CDR residues.

[0096] The phrase "control sequences" refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism. The control sequences that are suitable for prokaryotes, for example, include a promoter, optionally an operator sequence, and a ribosome binding site. Eukaryotic cells are known to use promoters, polyadenylation signals, and enhancers.

[0097] A nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, "operably linked" means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.

[0098] As used herein, the expressions "cell," "cell line," and "cell culture" are used interchangeably and all such designations include progeny. Thus, the words "transformants" and "transformed cells" include the primary subject cell and cultures derived therefrom without regard for the number of transfers. It is also understood that not all progeny will have precisely identical DNA content, due to deliberate or inadvertent mutations. Mutant progeny that have the same function or biological activity as screened for in the originally transformed cell are included. Where distinct designations are intended, it will be clear from the context.

[0099] "Treat" or "treating" means to administer a therapeutic agent, such as a composition containing any of the genetically engineered Abs of the present invention, internally or externally to a subject or patient having one or more disease symptoms, or being suspected of having a disease, for which the agent has therapeutic activity. Typically, the agent is administered in an amount effective to alleviate one or more disease symptoms in the treated subject or population, whether by inducing the regression of or inhibiting the progression of such symptom(s) by any clinically measurable degree. The term further includes a postponement of development of the symptoms associated with a disorder and/or a reduction in the severity of the symptoms of such disorder. The terms further include ameliorating existing uncontrolled or unwanted symptoms, preventing additional symptoms, and ameliorating or preventing the underlying causes of such symptoms. Thus, the terms denote that a beneficial result has been conferred on a vertebrate subject with a disorder, disease or symptom, or with the potential to develop such a disorder, disease or symptom.

[0100] As used herein, the term "therapeutically effective amount" or "effective amount" refers to an amount of an engineered Ab drug conjugate or engineered Ab fragment thereof, that when administered alone or in combination with an additional therapeutic agent to a cell, tissue, or subject is effective to prevent or ameliorate the disease or condition to be treated. A therapeutically effective dose further refers to that amount of the compound sufficient to result in amelioration of symptoms, e.g., treatment, healing, prevention or amelioration of the relevant medical condition, or an increase in rate of treatment, healing, prevention or amelioration of such conditions. When applied to an individual active ingredient administered alone, a therapeutically effective dose refers to that ingredient alone. When applied to a combination, a therapeutically effective dose refers to combined amounts of the active ingredients that result in the therapeutic effect, whether administered in combination, serially or simultaneously.

[0101] As used herein, the terms "N-glycan" refers to an N-linked oligosaccharide, for example, one that is attached by an asparagine-N-acetylglucosamine linkage to an asparagine residue of a polypeptide. N-linked glycoproteins contain an N-acetylglucosamine residue linked to the amide nitrogen of an asparagine residue in the protein. The predominant sugars found on glycoproteins are glucose, galactose, mannose, fucose, N-acetylgalactosamine (GalNAc), N-acetylglucosamine (GlcNAc) and sialic acid (e.g., N-acetyl-neuraminic acid (NANA)). The processing of the sugar groups occurs co-translationally in the lumen of the ER and continues post-translationally in the Golgi apparatus for N-linked glycoproteins.

[0102] Typically, N-glycans have a common pentasaccharide core of Man.sub.3GlcNAc.sub.2 ("Man" refers to mannose; "Glc" refers to glucose; and "NAc" refers to N-acetyl; GlcNAc refers to N-acetylglucosamine). Usually, N-glycan structures are presented with the non-reducing end to the left and the reducing end to the right. The reducing end of the N-glycan is the end that is attached to the Asn residue comprising the glycosylation site on the protein. N-glycans differ with respect to the number of branches (antennae) comprising peripheral sugars (e.g., GlcNAc, galactose, fucose and sialic acid) that are added to the Man..sub.3GlcNAc.sub.2 ("Man3") core structure which is also referred to as the "triammnose core", the "pentasaccharide core" or the "paucimannose core". N-glycans are classified according to their branched constituents (e.g., high mannose, complex or hybrid). A "high mannose" type N-glycan has five or more mannose residues. A "complex" type N-glycan typically has at least one GlcNAc attached to the 1,3 mannose arm and at least one GlcNAc attached to the 1,6 mannose arm of a "trimannose" core. ComplexN-glycans may also have galactose ("Gal") or N-acetylgalactosamine ("GalNAc") residues that are optionally modified with sialic acid or derivatives (e.g., "NANA" or "NeuAc", where "Neu" refers to neuraminic acid and "Ac" refers to acetyl). ComplexN-glycans may also have intrachain substitutions comprising bisecting GlcNAc and core fucose ("Fuc"). Complex N-glycans may also have multiple antennae on the "trimannose core," often referred to as "multiple antennary glycans." A "hybrid" N-glycan has at least one GlcNAc on the terminal of the 1.3 mannose arm of the trimannose core and zero or more mannoses on the 1,6 mannose arm of the trimannose core. The various N-glycans are also referred to as "glycoforms."

[0103] With respect to complex N-glycans, the terms "G-2", "G-1", "G0", "G1", "G2", "A1", and "A2" mean the following. "G-2" refers to an N-glycan structure that can be characterized as Man.sub.3GlcNAc.sub.2; the term "G-1" refers to an N-glycan structure that can be characterized as GlcNAcMan.sub.3GlcNAc.sub.2; the term "G0" refers to an N-glycan structure that can be characterized as GlcNAc.sub.2Man.sub.3GlcNAc.sub.2; the term "G1" refers to an N-glycan structure that can be characterized as GalGlcNAc.sub.2Man.sub.3GlcNAc.sub.2; the term "G2" refers to an N-glycan structure that can be characterized as Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2; the term "A1" refers to an N-glycan structure that can be characterized as NANAGal.sub.2Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2; and, the term "A2" refers to an N-glycan structure that can be characterized as NANA.sub.2Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2. Unless otherwise indicated, the terms G-2", "G-1", "G0", "G1", "G2", "A1", and "A2" refer to N-glycan species that lack fucose attached to the GlcNAc residue at the reducing end of the N-glycan.

[0104] With respect to multiantennary N-glycans, the term "multiantennary N-glycan" refers to N-glycans that further comprise a GlcNAc residue on the mannose residue comprising the non-reducing end of the 1,6 arm or the 1,3 arm of the N-glycan or a GlcNAc residue on each of the mannose residues comprising the non-reducing end of the 1,6 arm and the 1,3 arm of the N-glycan. Thus, multiantennary N-glycans can be characterized by the formulas GlcNAc.sub.(2-4)Man.sub.3GlcNAc.sub.2, Gal.sub.(1-4)GlcNAc.sub.(2-4)Man.sub.3GlcNAc.sub.2, or NANA.sub.(1-4)Gal.sub.(1-4)GlcNAc.sub.(2-4)Man.sub.3GlcNAc.sub.2. The term "1-4" refers to 1, 2, 3, or 4 residues.

[0105] The term "GS3.5", when used herein refers to the N-glycosylation structure GalGlcNAcMan.sub.5GlcNAc.sub.2.

[0106] The term "GS4.0", when used herein refers to the N-glycosylation structure GlcNAc.sub.2Man.sub.3GlcNAc.sub.2.

[0107] The term "GS5.0", when used herein refers to the N-glycosylation structure Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2.

[0108] The term "GS6.0", when used herein refers to the N-glycosylation structure NANA.sub.2Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2.

[0109] The term "non-native N-glycosylation site" as used herein refers to any consensus (N-X-S/T, wherein X is any amino acid except proline) N-glycosylation site incorporated by mutation into an IgG that is not observed on naturally occurring IgG molecules (e.g. N-297). Moreover, while Asn-297 is the N-glycosylation site typically found in murine and human IgG molecules (Kabat et al, Sequences of Proteins of Immunological Interest, 1991), this site doesn't necessarily have to be maintained for function. Using known methods for mutagenesis, the skilled artisan can alter a DNA molecule encoding an Ig of the present invention so that the N-glycosylation site at Asn-297 is deleted.

[0110] As used herein, the term "predominantly" or variations such as "the predominant" or "which is predominant" will be understood to mean the glycan species or collective species that has the highest mole percent (%) of total N-glycans after the glycoprotein has been analyzed by mass spectrometry (e.g. Q-ToF) or enzymatically released N-glycans analyzed by mass spectroscopy (e.g. MALDI-TOF MS) or HPLC. For example, if a composition consists of species A in 40 mole percent, species B in 35 mole percent and species C in 25 mole percent, the composition comprises predominantly species A, and species B would be the next most predominant species. Furthermore, if a composition contains a mixture of species where 60% contain terminal galactose and 40% contain terminal sialic acid the composition will be defined has having predominantly terminal galactose.

[0111] As used herein, a glycoprotein composition "lacks" or "is lacking" a particular sugar residue, such as fucose or galactose, when no detectable amount of such sugar residue is present on the N-glycan structures at any time. For example, in preferred embodiments of the present invention, the glycoprotein compositions are produced by lower eukaryotic organisms, as defined above, including yeast and fungi [e.g., Pichia sp.; Saccharomyces sp.; Kluyveromyces sp.; Aspergillus sp.], and will "lack fucose," because the cells of these organisms do not have the enzymes needed to produce fucosylated N-glycan structures. Thus, the term "essentially free of fucose" encompasses the term "lacking fucose." However, a composition may be "essentially free of fucose" even if the composition at one time contained fucosylated N-glycan structures or contains limited, but detectable amounts of fucosylated N-glycan structures.

[0112] The term "mole percent" of a glycan present in a preparation of a N-glycosylated Ab refers to the molar percent of a particular glycan present in the pool of N-linked oligosaccharides released when the N-glycosylated Ab preparation is treated with PNGase and then quantified by a method that is not affected by glycoform composition, for instance, labeling a PNGase released glycan pool with a fluorescent tag such as 2-aminobenzamide and then separating by high performance liquid chromatography or capillary electrophoresis and then quantifying glycans by fluorescence intensity, or MALDI-TOF mass spectrometry. For example, 50 mole percent NANA.sub.2Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 means that 50 percent of the released glycans are NANA.sub.2Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 and the remaining 50 percent are comprised of other N-linked oligosaccharides. In embodiments, the mole percent of a particular glycan in a preparation of glycoprotein will be between 20% and 100%, preferably above 25%, 30%, 35%, 40% or 45%, more preferably above 50%, 55%, 60%, 65% or 70% and most preferably above 75%, 80% 85%, 90% or 95%.

Overview

[0113] The present invention provides engineered Abs, in particular IgG Abs or fragments thereof comprising one to ten mutations (or pairs of mutations) in the heavy chain constant domain which generate one to ten non-native N-glycosylation sites. As shown in the Examples (see Example 1 and Example 14), the non-native N-glycosylation sites provide specific targeting sites for drug conjugates. In one embodiment, the engineered Abs, or fragments thereof of the invention are expressed in yeast and filamentous fungi host cells that have been engineered to produce human like N-glycans of the structure: Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2, Gal.sub.(1-2)GlcNAc.sub.(1-2)Man.sub.5GlcNAc.sub.2 or NANA.sub.(1-4)Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2. In some embodiments, engineered Abs or fragments thereof expressed in these engineered yeast and filamentous fungi host cells comprise N-glycans where the predominant glycoform comprise the following structures: Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2 or Gal.sub.(1-2)GlcNAc.sub.(1-2)Man.sub.5GlcNAc.sub.2. In some embodiments, engineered Abs or fragments thereof expressed in glycoengineered yeast and filamentous fungi host cells comprise N-glycans in the non-native N-glycosylation sites comprising predominantly terminal sialylated residues (NANA.sub.(1-4)Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.- 2), which in turn, can be converted into terminal galactose residues by an enzymatic reaction.

[0114] In some embodiments, the engineered Abs comprise N-glycans at the non-native N-glycosylation sites which do not disrupt the normal folding or function of the mAb, and allow the efficient, uniform conjugation of drugs such as toxins, peptides or bioactive sugar moieties. The DAR of the conjugated Ab can be modulated through the number of non-native N-glycosylation sites engineered into the Ab at specific sites as specified by the invention examples and the number of terminal galactose residues, which is driven by the N-glycan machinery of the recombinant host strain.

[0115] As background, the N-glycans are important molecules in biology that participate in a wide-range of different activities, from protein folding and trafficking to immune cell and host-pathogen interactions, owing in large part to the heterogeneity available from the modular, non-template nature of this protein modification, leading to an impressive breadth of potential forms that can be produced from a single core structure. N-glycans are also a key factor in biotherapeutic discovery and manufacture and limit the choice of expression system in many cases (Hossler, 2009; Schirrmann, 2008; Sethuraman, 2006). Examples of the differences in N-glycan pathways between humans and yeast can be found in FIG. 1. A unique biotherapeutic platform has been developed in yeast, in particular, in the species Pichia pastoris, in which the N-glycosylation pathway has been modified to generate human-like N-glycans (See, e.g., Bobrowicz et al., 2004; Sethuraman, 2006; Hamilton, 2006; Li et al., 2006; Nett et al., 2010; Choi et al., 2009; U.S. Pat. Nos. 7,029,872 and 7,449,308). Glycoengineered Pichia allows for unprecedented uniformity, specificity and control of N-glycans on recombinantly produced proteins, including Abs. A summary of glycoengineered Pichia can be found in FIG. 2. The unique nature of this genetically engineered system and process versatility allows for a tremendous level of freedom over what sugars can be attached and in what arrangements, ultimately allowing for modifications both prior to and after addition to the growing N-glycan chain.

[0116] Directed and specific control of N-glycosylation can provide unique control over biology (e.g. modulation of inflammation, tissue and cell type targeting) but can also provide an opportunity for creating unique macromolecule chemistry, particularly in the case of the terminal sugars galactose and sialic acid (Ramya et al, 2013). Galactose oxidase (GO) is an enzyme that can specifically modify terminal galactose sugars present on an N-glycan, thus allowing for highly versatile and specific aldehyde-based chemistry that is not otherwise available in the 20 amino acid repetoire. However, the gly can heterogeneity that is confronted with conventional expression systems such as mammalian cells could complicate such an approach. For example, as demonstrated for human Erythropoietin (Nett et al, 2010; Restelli et al, 2006), proteins with exposed N-glycans can have huge variability in numbers of antennae (bi-, tri-, and tetra-) and amount of terminal sialic acid, whereas antibodies can contain differing amounts of fucose and galactose in addition to trace amounts of sialic acid (Li et al, 2006), all of which contributes to the considerable heterogeneity of mammalian N-glycans.

[0117] In one embodiment, the present invention provides an engineered IgG Ab or fragment thereof comprising one to ten mutations (or pairs of mutations) in the heavy chain constant domain, which generate one to ten non-native N-glycosylation sites, the mutations being selected from the group consisting of S134N, G161T, G161S, N203T, N203S, V363T, V363S, Q438N, S176N, A118N, S132N, K133N, A162N, T195N, K210T, Y391T, F423T, F423S, Y436T, Y436S, L193N, K392T, K392S, F423T, S176N/G178T, S176N/G178S, Q419N/N421T, Q419N/N421S, S191N/L193T, S191N/L193S, G194N/Q196T, and G194N/Q196S, according to EU numbering.

[0118] In one embodiment, the engineered IgG Ab or fragment thereof comprises at least one or two amino acid mutations in the heavy chain constant polypeptide selected from S134N, G161T and S134N/G161T.

[0119] In another embodiment, the engineered IgG Ab or fragment thereof comprises at least two amino acid mutations in the heavy chain constant domain selected from G161T/S134T and G161 S/S134T.

[0120] In one embodiment, the engineered heavy chain constant domains comprise, at the non-native N-glycosylated sites, predominantly complex N-glycans having the structure Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2. In one embodiment, engineered heavy chain constant domains comprise, at the non-native N-glycosylation sites, predominantly complex N-gly cans having the structure Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 (also referred to as GS5.0 N-glycans in FIG. 2 and Example 3).

[0121] In another embodiment, the engineered heavy chain constant domains comprise, atthe non-native N-glycosylated sites, predominantly hybrid N-glycans having the structure Gal.sub.(1-2)GlcNAc.sub.(1-2)Man.sub.5GlcNAc.sub.2.

[0122] In another embodiment, the engineered heavy chain constant domains comprise, at the non-native N-glycosylated sites, predominantly N-glycans having the structure NANA.sub.(1-4)Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2.

[0123] In another embodiment, the engineered IgG Abs or fragments thereof having non-native N-glycosylation sites comprise N-glycans wherein about 50 to about 100 mole % of the N-glycans comprise the structure: Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2Gal.sub.(1-2)GlcNAc.sub.(1-2)Ma- n.sub.5GlcNAc.sub.2 or NANA.sub.(1-4)Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2. In another embodiment, the engineered IgG Abs or fragments thereof having non-native N-glycosylation sites comprise N-glycans where about 80 to about 100 mole % of the N-glycans comprise the structure: Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2, Gal.sub.(1-2)GlcNAc.sub.(1-2)Man.sub.5GlcNAc.sub.2 or NANA.sub.(1-4)Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2.

[0124] In one embodiment, the engineered Abs or fragments thereof are expressed in host cells capable of producing a composition of Abs or fragments thereof comprising N-glycans where the predominant glycoform comprise a Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 N-glycan structure lacking fucose, wherein said structure is present at a level that is at least about 5 mole percent more than the next predominant N-glycan structure in the composition. In one embodiment, the engineered IgG Ab or fragments thereof comprise a predominant Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2N-glycan structure lacking fucose, wherein said structure is present at a level of at least about 10 mole percent to about 25 mole percent more than the next predominantN-glycan structure in the composition. In one embodiment, the engineered IgG Abs or fragments thereof comprise a predominant Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 N-glycan structure lacking fucose, wherein said structure is present at a level that is at least about 25 mole percent to about 50 mole percent more than the next predominant N-glycan structure in the composition. In one embodiment, the engineered IgG Abs or fragments thereof comprise a predominant Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 glycan structure lacking fucose, wherein said structure is present at a level that is greater than about 50 mole percent more than the next predominant glycan structure in the composition. In one embodiment, the engineered IgG Abs or fragments thereof comprise a predominant Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 N-glycan structure lacking fucose, wherein said structure is present at a level that is greater than about 75 mole percent more than the next predominant glycan structure in the composition. In still another embodiment, the engineered IgG Abs or fragments thereof comprise a predominant Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 N-glycan structure lacking fucose wherein said structure is present at a level that is greater than about 90 mole percent more than the next predominant glycan structure in the composition. MALDI-TOF analysis of N-glycans of an IgG having a predominant (greater than 95 mole %) Gal2GlcNAc2Man3GlcNAc2 lacking fucose is shown in FIG. 26.

[0125] In another embodiment, the aforementioned IgG Ab or fragment thereof used for genetic engineering in its heavy chain constant domain is selected from the group consisting of anti-Her2, anti-Her2/neu (Herceptin), anti-glycoprotein IIb/IIIa (Abciximab), anti-TNF-.alpha. (Adalimumab, Certolizumab pegol, Golimumab, Infliximab), anti-CD52 (Alemtuzumab), anti-IL-2R.alpha. (CD25) (Basiliximab), anti-BAFF (Belimumab), anti-Vascular endothelial growth factor (VEGF) (Bevacizumab), anti-CD30 (Brentuximab vedotin), anti-IL-1.beta. (Canakinumab), anti-epidermal growth factor receptor (EGFR) (Cetuximab), anti-IL-2R.alpha. receptor (CD25) (Daclizumab), anti-RANK Ligand (Denosumab), anti-Complement C5 (Eculizumab), anti-CD11a (Efalizumab), anti-CD33 (Gemtuzumab), anti-CD20 (Ibritumomab tiuxetan), anti-CTLA-4 (Ipilimumab (MDX-101)), anti-T cell CD3 Receptor (Muromonab-CD3), anti-alpha-4 (.alpha.4) integrin, anti-(Natalizumab), anti-CD20 (Ofatumumab), anti-Immunoglobulin E (IgE) (Omalizumab), anti-RSV F protein (Palivizumab), anti-epidermal growth factor receptor (Panitumumab), anti-VEGF-A (Ranibizumab), anti-CD20 (Rituximab), anti-Anti-IL-6R (Tocilizumab, Atlizumab), anti-CD20 (Tositumomab), anti-ErbB2 (Trastuzumab), anti-IL-12/IL-23 (Ustekinumab), anti-integrin .alpha.4.beta.7 (Vedolizumab), anti-CD274, anti-.beta.-amyloid, anti-4-1BB, anti-5AC, anti-5T4, anti-ACVR2B, anti-adenocarcinomaantigen, anti-AGS-22M6, anti-alpha-fetoprotein, anti-angiopoietin 2, anti-angiopoietin 3, anti-anthrax toxin, anti-AOC3 (VAP-1), anti-, anti-B7-H3, anti-Bacillus anthracis, anti-BAFF, anti-beta amyloid, anti-B-lymphoma cell, anti-C242 antigen, anti-C5, anti-CA-125, anti-carbonic anhydrase 9 (CA-IX), anti-cardiac myosin, anti-CCL11 (eotaxin-1), anti-CCR4, anti-CCR5, anti-CD11/CD18, anti-CD125, anti-CD140a, anti-CD147 (basigin), anti-CD15, anti-CD152, anti-CD154 (CD40L), anti-CD19, anti-CD2, anti-CD20, anti-CD200, anti-CD22, anti-CD221, anti-CD23, anti-CD25, anti-CD27, anti-CD28, anti-CD28, anti-CD3, anti-CD3 epsilon, anti-CD30 (TNFRSF8), anti-CD33, anti-CD37, anti-CD38, anti-CD4, anti-CD40, anti-CD41, anti-CD44, anti-CD5, anti-CD51, anti-CD52, anti-CD56, anti-CD6, anti-CD70, anti-CD74, anti-CD79B, anti-CD80, anti-CEA, anti-CFD, anti-ch4D5, anti-CLDN18.2, anti-C. difficile, anti-clumping factor A, anti-CSF2, anti-CTLA-4, anti-cytomegalovirus, anti-CMV gp B, anti-DLL4, anti-DR5, anti-E. coli shiga toxin type-1 or 2, anti-EGFL7, anti-EGFR, anti-endotoxin, anti-EpCAM, anti-EpCAM/CD3, anti-episialin, anti-ERBB3, anti-Escherichia coli, anti-F protein RSV, anti-FAP, anti-fibrin II, beta chain, anti-fibronectin extra domain-B, anti-folate receptor 1, anti-Frizzled receptor, anti-ganglioside GD2, anti-GD2, anti-GD3 ganglioside, anti-GD3 ganglioside, anti-GMCSF receptor .alpha.-chain, anti-GPNMB, anti-Influenza, anti-Influenza hemagglutinin, anti-hepatitis B, anti-hepatitis B, anti-surface antigen, HER1, anti-HER2/neu, anti-HER2, CD3, anti-HER3, anti-HGF, anti-HGF, anti-HHGFR, anti-HIV-1, anti-HLA-DR, anti-HNGF, anti-Hsp90, anti-human scatter factor receptor kinase, anti-human TNF, anti-human beta-amyloid, anti-ICAM-1 (CD54), anti-IFN-.alpha., anti-IFN-.gamma., anti-IgE, anti-IgE Fc region, anti-IGF-1 receptor, anti-IGF-I, anti-IgG4, anti-IGHE, anti-IL20, anti-IL-1beta, anti-IL-12/IL-23, anti-IL-13, anti-IL-17, anti-IL-17A, anti-IL-1.beta., anti-IL-22, anti-IL-23, anti-IL-4, anti-IL-5, anti-IL-6, anti-IL-6 receptor, anti-IL9, anti-ILGF2, anti-insulin-like growth factor I receptor (IGF-1R), anti-integrin .alpha.4.beta.7, anti-integrin .alpha.4, anti-integrin .alpha.4.beta.7, anti-integrin .alpha.5.beta.1, anti-integrin .alpha.7.beta.7, anti-integrin .alpha.IIb.beta.3, anti-integrin .alpha.v.beta., anti-interferon receptor, anti-interferon .alpha./.beta. receptor, anti-interferon gamma-induced protein, anti-ITGA2, anti-ITGB2 (CD18), anti-KIR2D, anti-Lewis-Y antigen, anti-LFA-1 (CD11a), anti-lipoteichoic acid, anti-LOXL2, anti-L-selectin (CD62L), anti-LTA, anti-MCP-1, anti-mesothelin, anti-MS4A1, anti-MUC1, anti-mucin CanAg, anti-myostatin, anti-NARP-1, anti-NCA-90, anti-NGF, anti-N-glycolylneuraminic acid (NGNA), anti-NOGO-A, anti-Notch receptor, anti-NRP1, anti-Oryctolagus cuniculus, anti-OX-40, anti-oxLDL, anti-PCSK9, anti-PD-1, anti-PDCD1, anti-PDCD1, anti-PDGF-R .alpha., anti-phosphate-sodium co-transporter, anti-phosphatidylserine, anti-prostatic carcinoma cells, anti-Pseudomonas aeruginosa, anti-rabies virus, anti-rabies virus glycoprotein, anti-RANKL, anti-respiratory syncytial virus, anti-RHD, anti-Rhesus factor, anti-RON, anti-RTN4, anti-sclerostin, anti-SDC1, anti-selectin P, anti-SLAMF7, anti-SOST, anti-sphingosine-1-phosphate, anti-TAG-72, anti-T-cell receptor, anti-TEM1, anti-tenascin C, anti-TFPI, anti-TGF beta 1, anti-TGF beta 2, anti-TGF-0, anti-TNF-.alpha., anti-TRAIL-R1, anti-TRAIL-R2, anti-tumor antigen CTAA16.88, anti-MUC1 (tumor-specific glycan), anti-TWEAK receptor, anti-TYRP1 (glycoprotein 75), anti-VEGF-A, anti-VEGFR-1, anti-VEGFR2, anti-vimentin, anti-VWF, anti-IL-1, anti-IL-2, anti-IL-4, anti-IL-5, anti-IL-6, anti-IL-8, anti-IL-9, anti-IL-10, anti-IL-12, anti-IL-15, anti-IL-17, anti-IL-18, anti-IL-20, anti-IL-21, anti-IL-22, anti-IL-23, anti-IL-23R, anti-IL-25, anti-IL-27, anti-IL-33, anti-CD2, anti-CD4, anti-CD 11A, anti-CD14, anti-CD18, anti-CD19, anti-CD23, anti-CD25, anti-CD40, anti-CD40L, anti-CD20, anti-CD52, anti-CD64, anti-CD80, anti-CD147, anti-CD200, anti-CD200R, anti-TSLP, anti-TSLPR, anti-PD-1, anti-PDL1, anti-CTLA4, anti-VLA-4, anti-VEGF, anti-PCSK9, anti-.alpha.4.beta.7-integrin, anti-E-selectin, anti-Fact II, anti-ICAM-3, anti-beta2-integrin, anti-IFN.gamma., anti-C5, anti-CBL, anti-LCAT, anti-CR3, anti-MDL-1, anti-GITR, anti-CGRP, anti-TRKA, anti-IGF1R, anti-GTC.

[0126] In one embodiment, the engineered IgG Ab or fragment thereof is human anti-Her2 Ab or a fragment thereof. In another embodiment, the engineered IgG Ab is human anti-PD-1 Ab or a fragment thereof.

[0127] In another embodiment, the engineered IgG Ab or fragment thereof is an anti-Her2 Ab comprising a heavy chain mutant polypeptide comprising an amino acid sequence selected from SEQ ID NOs: 4-29, 31, 32, 33, 34, 35, 36, 37, 38, 39 and 40.

[0128] In another embodiment, the engineered IgG Ab or fragment thereof is an anti-mouse-PD-1 Ab comprising a heavy chain mutant polypeptide comprising an amino acid sequence selected from SEQ ID NOs: 41-45.

[0129] In another embodiment, the engineered IgG Ab or fragment thereof is an anti-CS1 Ab comprising a heavy chain mutant polypeptide comprising an amino acid sequence selected from SEQ ID NOs: 46-50.

[0130] In another embodiment, the engineered IgG Ab or fragment thereof is an anti-CD70 Ab comprising a heavy chain mutant polypeptide comprising an amino acid sequence selected from SEQ ID NOs: 51-55.

[0131] In another embodiment, the present invention provides an engineered IgG Ab or fragment thereof comprising one to two mutations in the heavy chain framework domain which generate one to two non-native N-glycosylation sites, the mutations being selected from the group consisting of Q105N and S113N, according to Kabat numbering.

[0132] In one embodiment, the engineered heavy chain constant domain comprises, at the non-native N-glycosylated sites, predominantly complex N-glycans having the structure Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2. In one embodiment, engineered heavy chain constant domain comprise, at the non-native N-glycosylation sites, predominantly complex N-gly cans having the structure Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 (also referred to as GS5.0 N-glycans in FIG. 2 and Example 3).

[0133] In another embodiment, the engineered heavy chain constant domain comprises, at the non-native N-glycosylated sites, predominantly hybrid N-glycans having the structure Gal.sub.(1-2)GlcNAc.sub.(1-2)Man.sub.5GlcNAc.sub.2.

[0134] In another embodiment, the engineered heavy chain constant domain comprises, at the non-native N-glycosylated sites, predominantly N-glycans having the structure NANA.sub.(1-4)Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2

[0135] In another embodiment, the engineered IgG Ab having non-native N-glycosylation sites comprises N-glycans wherein about 50 to about 100 mole % of the N-gly cans comprise the structure: Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2, Gal.sub.(1-2)GlcNAc.sub.1-2Man.sub.5GlcNAc.sub.2 or NANA.sub.(1-4)Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2. In another embodiment, the engineered Ab having non-native N-glycosylation sites comprises N-glycans where about 80 to about 100 mole % of the N-glycans comprise the structure: Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2, Gal.sub.(1-2)GlcNAc.sub.1-2Man.sub.5GlcNAc.sub.2 or NANA.sub.(1-4)Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2.

[0136] In one embodiment, the aforementioned IgG Ab or fragment thereof used for genetic engineering in its heavy chain framework domain is selected from the Abs as described above.

Ab-Drug Conjugates

[0137] In another embodiment, the engineered IgG Ab or fragment thereof is conjugated to a drug via the Ab's non-native N-glycosylated site. The drug is selected from the group consisting of a polymer, cytotoxic agent, a radionuclide, fluorescent or chemiluminescent labels, steroid, steroid receptor agonist, signal transduction inhibitor, a peptide and scFv.

[0138] In one embodiment, the drug is a polymer which increases the half-life of the engineered Ab or fragment thereof in the body of a subject. Suitable polymers include, but are not limited to, hydrophilic polymers which include but are not limited to polyethylene glycol (PEG) (e.g., PEG with a molecular weight of 2 kDa, 5 kDa, 10 kDa, 12 kDa, 20 kDa, 30 kDa or 40 kDa), dextran and monomethoxypolyethylene glycol (mPEG). Methods for pegylating proteins are known in the art and can be applied to the Abs of the invention. See, e.g., EP 0 154 316 and EP 0 401 384. Lee, et al., (1999) (Bioconj. Chem. 10:973-981) discloses PEG conjugated single-chain Abs. Wen, et al., (2001) (Bioconj. Chem. 12:545-553) disclose conjugating antibodies with PEG which is attached to a radiometal chelator (diethylenetriaminpentaacetic acid (DTPA)). For example, to pegylate an Ab, the Ab, or fragment thereof, typically is reacted with a reactive form of polyethylene glycol (PEG), such as a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment. In particular embodiments, the pegylation is carried out via an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer). As used herein, the term "polyethylene glycol" is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C1-C10) alkoxy- or aryloxy-polyethylene glycol or polyethylene glycol-maleimide.

[0139] The engineered IgG Ab or fragments thereof may also be conjugated to a cytotoxic agent such as diptheria toxin, Pseudomonas aeruginosa exotoxin A chain, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins and compounds (e.g., fatty acids), dianthin proteins, Phytoiacca americana proteins PAPI, PAPII, and PAP-S, Momordica charantia inhibitor, curcin, crotin, Saponaria officinalis inhibitor, mitogellin, restrictocin, phenomycin, and enomycin.

[0140] The engineered IgG Ab and fragments thereof may also be conjugated with labels such as .sup.99Tc, .sup.90Y, .sup.111In, .sup.32P, .sup.14C, .sup.125I, .sup.3H, .sup.131I, .sup.11C, .sup.15O, .sup.13N, .sup.18F, .sup.35S, .sup.51Cr, .sup.57To, .sup.226Ra, .sup.60Co, .sup.59Fe, .sup.57Se, .sup.152Eu, .sup.67CU, .sup.217Ci, .sup.211At, .sup.212Pb, .sup.47Sc, .sup.109Pd, .sup.234Th, and .sup.40K, .sup.157Gd, .sup.55Mn, .sup.52Tr, and .sup.56Fe.

[0141] The engineered IgG Ab or fragment thereof may also be conjugated with fluorescent or chemilluminescent labels, including fluorophores such as rare earth chelates, fluorescein and its derivatives, rhodamine and its derivatives, isothiocyanate, phycoerythrin, phycocyanin, allophycocyanin, o-phthaladehyde, fluorescamine, .sup.152Eu, dansyl, umbelliferone, luciferin, luminal label, isoluminal label, an aromatic acridinium ester label, an imidazole label, an acridimium salt label, an oxalate ester label, an aequorin label, 2,3-dihydrophthalazinediones, biotin/avidin, spin labels and stable free radicals.

[0142] The engineered IgG Ab or fragment thereof may also be conjugated to a steroid such as glucocorticoid.

[0143] The engineered IgG Ab or fragment thereof may also be conjugated to a steroid receptor agonist such as a glucocorticoid receptor agonist (e.g., mapracorat).

[0144] The engineered IgGAb or fragment thereof may also be conjugated to a signal transduction inhibitor such as dasatinib (see Wang et al., 2015).

[0145] The engineered IgG Ab or fragment thereof may also be conjugated to a peptide, e.g., activated GLP-1 receptor agonistic peptide (see Example 9)

[0146] The engineered IgG Ab or fragment thereof may also be conjugated to a scFv.

[0147] Any method known in the art for conjugating the Ab molecules to the various moieties may be employed (see e.g., Axup, 2012; Tian, 2014; Jackson, 2014, WO2005047334, WO2005047336, WO200547337 and WO2006107124 (the disclosures of which are incorporated herein by reference) disclose chemically conjugating peptides or drug molecules to Fc fragment. Methods for conjugating Abs are conventional and very well known in the art.

[0148] ADC delivery of a drug moiety to its intracellular target occurs via a multistep sequence of events: binding to the cell surface, endocytosis, trafficking (within an endosome) to a lysosome, proteolytic degradation of the conjugate, and diffusion of the released drug moiety across the lysosomal or endosomal membrane toward its intracellular target and its interaction with the target. Therefore, the linker should be sufficiently stable while in circulation to allow delivery of the intact ADC to the target cell but, on the other hand, sufficiently labile to allow release of the drug moiety from the ADC once inside the targeted cell.

[0149] In an embodiment as described below in the method of preparing an engineered Ab-drug conjugate, the linker is comprised of an oxime linkage. In this regard, the terminal galactose residues of the human complex N-glycan or human hybrid N-glycan are specifically oxidized to produce chemically-reactive aldehyde groups utilizing an enzyme known as galactose oxidase (GO) as described e.g., in Cooper et al., 1959. The chemically reactive aldehyde group is receptive to direct conjugation with an alkoxyamine substrate forming a stable oxime bond as described e.g, in Ramya et al. 2013, and as described below and in Example 5.

Uses of Ab-Drug Conjugates

Immunoimaging

[0150] In another embodiment, the engineered IgG Ab-drug conjugates of the present invention can be used for in vivo immunoimaging. For this purpose, the Ab or fragment thereof is labeled by means which permit external visualization of its position or location within a subject or part thereof, such as an organ. Typically, an immunoimaging agent will be an Ab labeled directly (as with Technetium) or indirectly (as with chelated Indium) with a suitable radioisotope. After injection into the patient, the location of the conjugate may be tracked by a detector sensitive to particles emitted by the radiolabel, e.g., a gamma-scintillation camera in the case of a gamma emitter.

Immunotherapy

[0151] In another embodiment, the engineered IgG Ab-drug conjugate of the present invention can be used to treat cancer or a disease, such as an autoimmune disease or an infectious disease, in a patient, such as a human or an animal (e.g., a dog or a cat) suffering from the cancer or the disease. Accordingly, methods of treating a disease or cancer in a patient suffering from the cancer or disease are provided, the methods comprising administering to the patient a therapeutically effective amount of the engineered IgG Ab or fragment thereof, which is conjugated to a drug.

[0152] With respect to cancer, the engineered Ab-drug conjugates can be used for inhibiting the multiplication of a tumor cell or cancer cell, causing apoptosis in a tumor or cancer cell, or for treating cancer in a patient by delivering a drug to a tumor cell or cancer cell.

[0153] The specificity of the Ab for a particular tumor cell or cancer cell can be important for determining those tumors or cancers that are most effectively treated. For example, the anti-HER2 mAb trastuzumab is known to be useful in treating HER+ tumors such as breast cancer and brain cancer.

[0154] Examples of cancers that can be treated with the engineered Ab-drug conjugates include, but are not limited to, solid tumors, including but not limited to: fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon cancer, colorectal cancer, kidney cancer, pancreatic cancer, bone cancer, breast cancer, ovarian cancer, prostate cancer, esophogeal cancer, stomach cancer, oral cancer, nasal cancer, throat cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilms' tumor, cervical cancer, uterine cancer, testicular cancer, small cell lung carcinoma, bladder carcinoma, lung cancer, epithelial carcinoma, glioma, glioblastoma multiforme, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, meningioma, skin cancer, melanoma, neuroblastoma, retinoblastoma, blood-borne cancers (including but not limited to: acute lymphoblastic leukemia "ALL", acute lymphoblastic B-cell leukemia, acute lymphoblastic T-cell leukemia, acute myeloblastic leukemia "AML", acute promyelocytic leukemia "APL", acute monoblastic leukemia, acute erythroleukemic leukemia, acute megakaryoblastic leukemia, acute myelomonocytic leukemia, acute nonlymphocyctic leukemia, acute undifferentiated leukemia, chronic myelocytic leukemia "CML", chronic lymphocytic leukemia "CLL", hairy cell leukemia, multiple myeloma), acute and chronic leukemias (e.g., lymphoblastic, myelogenous, lymphocytic, and myelocytic leukemias), and Lymphomas (e.g., Hodgkin's disease, non-Hodgkin's Lymphoma, Multiple myeloma, Waldenstrom's macroglobulinemia, Heavy chain disease, and Polycythemia vera).

[0155] In another embodiment, the engineered Ab-drug conjugate can be administered concurrently with another anti-cancer agent such as a chemotherapeutic agent or with radiation therapy. In another embodiment, the chemotherapeutic agent or radiation therapy is administered prior or subsequent to administration of the engineered Ab-drug conjugate. Any one or a combination of the chemotherapeutic agents listed below can be administered. With respect to radiation, any radiation therapy protocol can be used depending upon the type of cancer to be treated. For example, but not by way of limitation, x-ray radiation can be administered; in particular, high-energy megavoltage (radiation of greater that 1 MeV energy) can be used for deep tumors, and electron beam and orthovoltage x-ray radiation can be used for skin cancers. Gamma-ray emitting radioisotopes, such as radioactive isotopes of radium, cobalt and other elements, can also be administered.

[0156] Examples of chemotherapeutic agents include, but are not limited to, methotrexate, taxol, L-asparaginase, mercaptopurine, thioguanine, hydroxyurea, cytarabine, cyclophosphamide, ifosfamide, nitrosoureas, cisplatin, carboplatin, mitomycin, dacarbazine, procarbizine, topotecan, nitrogen mustards, cytoxan, etoposide, 5-fluorouracil, BCNU, irinotecan, camptothecins, bleomycin, doxorubicin, idarubicin, daunorubicin, dactinomycin, plicamycin, mitoxantrone, asparaginase, vinblastine, vincristine, vinorelbine, paclitaxel, and docetaxel. drugs such as an alkylating agents such as a nitrogen mustard (e.g., cyclophosphamide, ifosfamide, trofosfamide, chlorambucil, melphalan), nitrosoureas (e.g., carmustine (BCNU), lomustine (CCNU)), alkylsulphonates (e.g., busulfan, treosulfan), triazenes (e.g., decarbazine), Platinum containing compounds (e.g., cisplatin, carboplatin); plant alkaloids, such as vinca alkaloids (e.g, vincristine, vinblastine, vindesine, vinorelbine), taxoids (e.g., paclitaxel, docetaxol); DNA topoisomerase inhibitors such as epipodophyllins (e.g., etoposide, teniposide, topotecan, 9-aminocamptothecin, camptothecin, crisnatol, mitomycins (e.g., mitomycin C); anti-metabolites such as anti-folates such as DHFR inhibitors (e.g., methotrexate, trimetrexate), IMP dehydrogenase inhibitors (mycophenolic acid, tiazofurin, ribavirin, EICAR) and ribonucleotide reductase inhibitors (e.g., hydroxyurea, deferoxamine), pyrimidine analogs such as uracil analogs (5-fluorouracil, floxuridine, doxifluridine, ratitrexed), cytosine analogs (e.g., cytarabine (ara C), cytosine arabinoside, fludarabine), and purine analogs (e.g., mercaptopurine, thioguanine); hormonal therapies, such as receptor antagonists, such as anti-estrogens (e.g., tamoxifen, raloxifene, megestrol), LHRH agonists (e.g., goscrclin, leuprolide acetate), and anti-androgens (e.g., flutamide, bicalutamide; retinoids/deltoids such as vitamin D3 analogs (e.g., EB 1089, CB 1093, KH 1060), photodynamic therapies (e.g., vertoporfin (BPD-MA), phthalocyanine, photosensitizer Pc4, demethoxy-hypocrellin A (2BA-2-DMHA)), cytokines (e.g., interferon-.alpha., interferon-.gamma., tumor necrosis factor), as well as other drugs, such as gemcitabine, velcade, revamid, thalamid, isoprenylation inhibitors (e.g., lovastatin), dopaminergic neurotoxins (e.g., 1-methyl-4-phenylpyridinium ion), cell cycle inhibitors (e.g., staurosporine), actinomycins (e.g., actinomycin D, dactinomycin), bleomycins, bleomycin A2, bleomycin B2, peplomycin), anthracyclines (daunorubicin, Doxorubicin (adriamycin), idarubicin, epirubicin, pirarubicin, zorubicin, mtoxantrone), MDRinhibitors (e.g., verapamil), and Ca.sup.2+ATPase inhibitors (e.g, thapsigargin)

[0157] The engineered Ab-drug conjugates can also be used for killing or inhibiting the replication of a cell that produces an autoimmune disease or for treating an autoimmune disease. Accordingly, the engineered Ab-drug conjugates can be used accordingly in a variety of settings for treating an autoimmune disease in a patient suffering from the autoimmune disease. For example, the conjugates can be used to deliver a drug to a target cell. Without being bound by theory, in one embodiment, the engineered Ab-drug conjugates associate with an antigen on the surface of a target cell, and the conjugate is then taken up inside a target-cell through receptor-mediated endocytosis. Once inside the cell, one or more specific peptide sequences (e.g., within a linker) are enzymatically or hydrolytically cleaved, resulting in release of a drug. The released drug is then free to migrate in the cytosol and induce cytotoxic or cytostatic activities. In another embodiment, the drug is cleaved from the engineered Ab-conjugate outside the target cell, and the drug subsequently penetrates the cell.

[0158] In another embodiment, the engineered Ab-drug conjugates bind to an autoimmune antigen which is on the surface of a cell. For example, the engineered Ab can bind to activated lymphocytes that are associated with the autoimmune disease state. In a further embodiment, the engineered Ab-drug conjugates kill or inhibit the multiplication of cells that produce an autoimmune antibody associated with a particular autoimmune disease.

[0159] Examples of autoimmune diseases that can be treated with the engineered Ab-drug conjugates include, but are not limited to, Th2 lymphocyte related disorders (e.g., atopic dermatitis, atopic asthma, rhinoconjunctivitis, allergic rhinitis, Omenn's syndrome, systemic sclerosis, and graft versus host disease); Th1 lymphocyte related disorders (e.g., rheumatoid arthritis, multiple sclerosis, psoriasis, Sjorgren's syndrome, Hashimoto's thyroiditis, Grave's disease, primary biliary cirrhosis, Wegener's granulomatosis and tuberculosis); and activated B lymphocyte related disorders (e.g., systemic lupus erythematosus, Goodpasture's syndrome, rheumatoid arthritis and type I diabetes). Other autoimmune diseasesinclude, butare notlimited to, active chronic hepatitis, Addison's disease, allergic alveolitis, allergic reaction, allergic rhinitis, Alport's Syndrome, anaphlaxis, ankylosing spondylitis, anti-phosholipid syndrome, arthritis, ascariasis, aspergillosis, atopic allergy, atropic dermatitis, atropic rhinitis, Behcet's disease, Bird-Fancier's Lung, bronchial asthma, Caplan's syndrome, cardiomyopathy, Celiac disease, Chagas' disease, chronic glomerulonephritis, Cogan's Syndrome, cold agglutinin disease, congenital rubella infection, CREST syndrome, Crohn's disease, cryoglobulinemia, Cushing's syndrome, dermatomyositis, discoid lupus, Dressler's syndrome, Eaton-Lambert syndrome, echovirus infection, encephalomyelitis, endocrine opthalmopathy, Epstein-Barr virus infection, equine heaves, erythematosis, Evan's syndrome, Felty's syndrome, fibromyalgia, Fuch's cyclitis, gastric atrophy, gastrointestinal allergy, giant cell arteritis, glomerulonephritis, goodpasture's syndrome, graft v. host disease, Graves' disease, Guillain-Barre disease, Hashimoto's thyroiditis, hemolytic anemia, Henoch-Schonlein Purpura, idiopathic adrenal atrophy, idiopathic pulmonary fibritis, IgA nephropathy, inflammatory bowel disease, insulin-dependent diabetes mellitus, juvenile arthritis, juvenile diabetes mellitus (Type I), Lambert-Eaton syndrome, laminitis, lichen planus, lupoid hepatitis, lupus, lymphopenia, Meniere's disease, mixed connective tissue disease, multiple sclerosis, myasthenia gravis, pernicious anemia, polyglandular syndromes, presenile dementia, primary agammaglobulinemia, primary biliary cirrhosis, psoriasis, psoriatic arthritis, Raynauds phenomenon, recurrent abortion, Reiter's syndrome, rheumatic fever, rheumatoid arthritis, Sampter's syndrome, schistosomiasis, Schmidt's syndrome, scleroderma, Shulman's syndrome, Sjorgen's syndrome, stiff-man syndrome, sympathetic ophthalmia, systemic lupus erythematosis, Takayasu's arteritis, temporal arteritis, thyroiditis, thrombocytopenia, thyrotoxicosis, toxic epidermalnecrolysis, TypeBinsulinresistance, Type Idiabetesmellitus, ulcerative colitis, uveitis, vitiligo, Waldenstrom's macroglobulemia, and Wegener's granulomatosis.

[0160] In another embodiment, methods for treating an autoimmune disease arealso provided that comprise administering to a patient in need thereof an effective amount of an engineered IgG Ab-drug conjugate alone or in combination another therapeutic agent known for the treatment of an autoimmune disease. Examples of anti-autoimmune disease agent include, but are not limited to, the following: cyclosporine, cyclosporine A, mycophenylate mofetil, sirolimus, tacrolimus, etanercept, prednisone, azathioprine, methotrexate, cyclophosphamide, aminocaproic acid, chloroquine, hydroxychloroquine, hydrocortisone, dexamethasone, chlorambucil, DHEA, danazol, bromocriptine, meloxicam and infliximab.

[0161] In another embodiment, methods for treating an infectious disease are provided which comprise administering to the patient suffering from the infectious disease a therapeutically effective amount of an engineered IgG Ab or fragment thereof conjugated to a drug. The engineered Ab-drug conjugates can be used accordingly in a variety of settings for the treatment of an infectious disease in a patient. The ADCs can be used to deliver a drug to a target cell. In one embodiment, the Ab binds to the infectious disease cell. In another embodiment, the engineered Ab-drug conjugate kills or inhibit the multiplication of cells that produce a particular infectious disease. Examples of infectious diseases that can be treated with the engineered Ab-drug conjugates include, but are not limited to, the following: bacterial diseases, such as diphtheria, pertussis, occult bacteremia, urinary tract infection, gastroenteritis, cellulites, epiglottitis, tracheitis, adenoid hypertrophy, retropharyngeal abcess, impetigo, ecthyma, pneumonia, endocarditis, septic arthritis, pneumococcal, peritonitis, bactermia, meningitis, acute purulent meningitis, urethritis, cervicitis, proctitis, pharyngitis, salpingitis, epididymitis, gonorrhea, syphilis, listeriosis, anthrax, nocardiosis, salmonella, typhoid fever, dysentery, conjunctivitis, sinusitis, brucellosis, tularemia, cholera, bubonic plague, tetanus, necrotizing enteritis, and actinomycosis; mixed anaerobic infections, such as syphilis, relapsing fever, leptospirosis, Lyme disease, rat bite fever, tuberculosis, lymphadenitis, leprosy, chlamydia, chlamydial pneumonia, trachoma, and inclusion conjunctivitis; systemic fungal diseases such as histoplamosis, coccidiodomycosis, blastomycosis, sporotrichosis, cryptococcsis, systemic candidiasis, aspergillosis, mucormycosis, mycetoma, and chromomycosis; rickettsial diseases such as typhus, Rocky Mountain Spotted Fever, ehrlichiosis, Eastern Tick-Borne Rickettsioses, rickettsialpox, Q fever and bartonellosis; parasitic diseases such as malaria, babesiosis, African sleeping sickness, Chagas' disease, leishmaniasis, Dum-Dum fever, toxoplasmosis, meningoencephalitis, keratitis, entamebiasis, giardiasis, cryptosporidiosis, isosporiasis, cyclosporiasis, microsporidiosis, ascariasis, whipworm infection, hookworm infection, threadworm infection, ocular larva migrans, trichinosis, Guinea worm disease, lymphatic Filariasis, loiasis, River Blindness, canine heartworm infection, schistosomiasis, swimmer's itch, Oriental lung fluke, Oriental liver fluke, fascioliasis, fasciolopsiasis, opisthorchiasis, tapeworm infections, hydatid disease, and alveolar hydatid disease; viral diseases such as measles, subacute sclerosing panencephalitis, common cold, mumps, rubella, roseola, Fifth Disease, chickenpox, respiratory syncytial virus infection, croup, bronchiolitis, infectious mononucleosis, poliomyelitis, herpangina, hand-foot-and-mouth disease, Bornholm disease, genital herpes, genital warts, aseptic meningitis, myocarditis, pericarditis, gastroenteritis, acquired immunodeficiency syndrome (AIDS), human immunodeficiency vims (HIV), Reye's syndrome, Kawasaki syndrome, influenza, bronchitis, viral "Walking" pneumonia, acute febrile respiratory disease, acute pharyngoconjunctival fever, epidemic keratoconjunctivitis, Herpes Simplex Virus 1 (HSV-1), Herpes Simplex Virus 2 (HSV-2), shingles, cytomegalic inclusion disease, rabies, progressive multifocal leukoencephalopathy, kuru, fatal familial insomnia, Creutzfeldt-Jakob disease, Gerstmann-Straussler-Scheinker disease, tropical spastic paraparesis, western equine encephalitis, California encephalitis, St. Louis encephalitis, Yellow Fever, Dengue, lymphocytic choriomeningitis, Lassa fever, hemorrhagic fever, Hantvims pulmonary syndrome, Marburg virus infections, Ebola virus infections and smallpox.

[0162] In yet another embodiment, methods for treating an infectious disease are provided which comprise administering to a patient suffering from the infectious disease an engineered IgG Ab-drug conjugate alone or in combination with another therapeutic agent that is an anti-infectious disease agent. Examples of anti-infectious disease agents include, but not limited to, beta.-lactam antibiotics, such as penicillin G, penicillin V, cloxacillin, dicloxacillin, methicillin, nafcillin, oxacillin, ampicillin, amoxicillin, bacampicillin, azlocillin, carbenicillin, mezlocillin, piperacillin and ticarcillin; aminoglycosides such as amikacin, gentamicin, kanamycin, neomycin, netilmicin, streptomycin and tobramycin; macrolides such as azithromycin, clarithromycin, erythromycin, lincomycin and clindamycin; tetracyclines such as demeclocycline, doxycycline, minocycline, oxytetracycline and tetracycline; quinolones such as cinoxacin, and nalidixic acid; fluoroquinolones such as ciprofloxacin, enoxacin, grepafloxacin, levofloxacin, lomefloxacin, norfloxacin, ofloxacin, sparfloxacin and trovafloxicin; polypeptides such as bacitracin, colistin and polymyxin B; sulfonamides such as sulfisoxazole, sulfamethoxazole, sulfadiazine, sulfamethizole and sulfacetamide; and other antibacterial agents, such as trimethoprim, sulfamethazole, chloramphenicol, vancomycin, metronidazole, quinupristin, dalfopristin, rifampin, spectinomycin and nitrofurantoin; and antiviral agents, such as general antiviral agents such as idoxuradine, vidarabine, trifluridine, acyclovir, famcicyclovir, pencicyclovir, valacyclovir, gancicyclovir, foscarnet, ribavirin, amantadine, rimantadine, cidofovir; antisense oligonucleotides, immunoglobulins and interferons; drugs for HIV infection such as tenofovir, emtricitabine, zidovudine, didanosine, zalcitabine, stavudine, lamivudine, nevirapine, delavirdine, saquinavir, ritonavir, indinavir, and drugs for treatment of metabolic disease such as nelfinavir.

Pharmaceutical Compositions Containing the Ab-Drug Conjugates

[0163] In another embodiment, pharmaceutical compositions are provided comprising an effective amount of the engineered IgG Ab-drug conjugate and a pharmaceutical acceptable carrier. The pharmaceutical compositions can be in various forms for administration to a patient. For example, the composition can be in the form of a solid, liquid or gas (aerosol). Typical routes of administration include, without limitation, oral, topical, parenteral, sublingual, rectal, vaginal, ocular, intra-tumor, and intranasal. Parenteral administration includes subcutaneous injections, intravenous, intramuscular, intrasternal injection or infusion techniques. In one embodiment, the compositions are administered parenterally. In another embodiment, the conjugate or compositions are administered intravenously. Such compositions are suitable for veterinary or human administration.

[0164] Pharmaceutical compositions can be formulated so as to allow a conjugate to be bioavailable upon administration of the composition to a patient. Compositions can take the form of one or more dosage units, where for example, a tablet can be a single dosage unit, and a container of a conjugate in injectable form can hold a plurality of dosage units.

[0165] Materials used in preparing the pharmaceutical compositions can be non-toxic in the amounts used. As evident to those of ordinary skill in the art that the optimal dosage of the active ingredient(s) in the pharmaceutical composition will depend on a variety of factors. Relevant factors include, without limitation, the type of patient, e.g., human or animal, the particular form of the engineered-Ab conjugate, the manner of administration, and the composition employed.

[0166] The pharmaceutically acceptable carrier or vehicle can be particulate, so that the compositions are, for example, in tablet or powder form. The carrier(s) can be liquid, with the compositions being, for example, an oral syrup or injectable liquid. In addition, the carrier(s) can be gaseous or particulate, so as to provide an aerosol composition useful in, e.g., inhalatory administration.

[0167] When intended for oral administration, the composition is preferably in solid or liquid form, where semi-solid, semi-liquid, suspension and gel forms are included within the forms considered herein as either solid or liquid.

[0168] As a solid composition for oral administration, the composition can be formulated into a powder, granule, compressed tablet, pill, capsule, chewing gum, wafer or the like. Such a solid composition typically contains one or more inert diluents. In addition, one or more of the following can be present: binders such as carboxymethylcellulose, ethyl cellulose, microcrystalline cellulose, or gelatin; excipients such as starch, lactose or dextrins; disintegrating agents such as alginic acid, sodium alginate, Primogel, corn starch and the like; lubricants such as magnesium stearate or Sterotex; glidants such as colloidal silicon dioxide; sweetening agents such as sucrose or saccharin, a flavoring agent such as peppermint, methyl salicylate or orange flavoring, and a coloring agent. When the composition is in the form of a capsule, e.g., a gelatin capsule, it can contain, in addition to materials of the above type, a liquid carrier such as polyethylene glycol, cyclodextrin or a fatty oil.

[0169] The composition can be in the form of a liquid, e.g., an elixir, syrup, solution, emulsion or suspension. The liquid can be useful for oral administration or for delivery by injection. When intended for oral administration, a composition can comprise one or more of a sweetening agent, preservatives, dye/colorant and flavor enhancer. In a composition for administration by injection, one or more of a surfactant, preservative, wetting agent, dispersing agent, suspending agent, buffer, stabilizer and isotonic agent can also be included.

[0170] The liquid compositions, whether they are solutions, suspensions or other like form, can also include one or more of the following: sterile diluents such as water for injection, saline solution, preferably physiological saline, Ringer's solution, isotonic sodium chloride, fixed oils such as synthetic mono or digylcerides which can serve as the solvent or suspending medium, polyethylene glycols, glycerin, cyclodextrin, propylene glycol or other solvents; antibacterial agents such as benzyl alcohol or methyl paraben; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. A parenteral composition can be enclosed in ampoule, a disposable syringe or a multiple-dose vial made of glass, plastic or other material. Physiological saline is an exemplary adjuvant. An injectable composition is preferably sterile.

[0171] Preparations for parenteral administration include sterile aqueous or non-aqueous solutions, suspensions, and emulsions. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate. Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media. Parenteral vehicles include sodium chloride solution, Ringer's dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils. Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers (such as those based on Ringer's dextrose), and the like. Preservatives and other additives may also be present such as, for example, antimicrobials, anti-oxidants, chelating agents, and inert gases and the like.

[0172] The effective amount of the engineered Ab-drug conjugate for treatment of a particular cancer or disease will depend on the nature of the cancer or disease and can be determined by standard clinical techniques. The dosage ranges for the administration of the disclosed engineered Ab-drug conjugates are those large enough to produce the desired effect in which the symptoms of the condition or disorder are ameliorated. The dosage should not be so large as to cause adverse side effects, such as unwanted cross-reactions, anaphylactic reactions, and the like. In addition, in vitro or in vivo assays can optionally be employed to help identify optimal dosage ranges.

[0173] The precise dose to be employed in the pharmaceutical compositions will also depend on the age, condition, sex and extent of the disease in the patient, route of administration, and the seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances.

[0174] Typically, the effective amount of the engineered Ab-drug conjugate is at least about 0.01% of a conjugate by weight of the composition. When intended for oral administration, this amount can be varied to range from about 0.1% to about 80% by weight of the pharmaceutical composition. In one embodiment, oral pharmaceutical compositions can comprise from about 4% to about 50% of the conjugate by weight of the composition. In yet another embodiment, present compositions are prepared so that a parenteral dosage unit contains from about 0.011% to about 2% by weight of the conjugate.

[0175] For intravenous administration, the composition can comprise from about 0.01 to about 100 mg of a conjugate per kg of the animal's body weight. In one embodiment, the composition can include from about 1 to about 100 mg of a conjugate per kg of the animal's body weight. In another embodiment, the amount administered will be in the range from about 0.1 to about 25 mg/kg of body weight of the conjugate.

[0176] Generally, the dosage of an Ab-conjugate administered to a patient is typically about 0.01 mg/kg to about 2000 mg/kg of the animal's body weight. In one embodiment, the dosage administered to a patient is between about 0.01 mg/kg to about 10 mg/kg of the animal's body weight. In another embodiment, the dosage administered to a patient is between about 0.1 mg/kg and about 250 mg/kg of the animal's body weight. In yet another embodiment, the dosage administered to a patient is between about 0.1 mg/kg and about 20 mg/kg of the animal's body weight. In yet another embodiment the dosage administered is between about 0.1 mg/kg to about 10 mg/kg of the animal's body weight. In yet another embodiment, the dosage administered is between about 1 mg/kg to about 10 mg/kg of the animal's body weight.

[0177] The Ab-conjugates can be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.). Administration can be systemic or local. Various delivery systems are known, e.g., encapsulation in liposomes, microparticles, microcapsules, capsules, etc., and can be used to administer a conjugate or composition. In certain embodiments, more than one conjugate or composition is administered to a patient.

[0178] The term "carrier" as used herein refers to a diluent, adjuvant or excipient, with which a conjugate is administered. Such pharmaceutical carriers can be liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. The carriers can be saline, gum acacia, gelatin, starch paste, talc, keratin, colloidal silica, urea, and the like. In addition, auxiliary, stabilizing, thickening lubricating and coloring agents can be used. In one embodiment, when administered to a patient, the Ab-conjugate or compositions and pharmaceutically acceptable carriers are sterile. Water is an exemplary carrier when the conjugate are administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable pharmaceutical carriers also include excipients such as starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. The compositions, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.

[0179] The compositions can take the form of solutions, suspensions, emulsion, tablets, pills, pellets, capsules, capsules containing liquids, powders, sustained-release formulations, suppositories, emulsions, aerosols, sprays, suspensions, or any other form suitable for use. Other examples of suitable pharmaceutical carriers are described in "Remington's Pharmaceutical Sciences" by E. W. Martin.

[0180] Typically, the carriers or vehicles for intravenous administration are sterile isotonic aqueous buffer solutions. Pharmaceutical compositions may also include a solubilizing agent or a local anesthetic such as lignocaine to ease pain at the site of the injection.

[0181] Pharmaceutical compositions for oral delivery can be in the form of tablets, lozenges, aqueous or oily suspensions, granules, powders, emulsions, capsules, syrups, or elixirs, for example. Orally administered compositions can contain one or more optionally agents, for example, sweetening agents such as fructose, aspartame or saccharin; flavoring agents; coloring agents; and preserving agents, to provide a pharmaceutically palatable preparation. Moreover, where in tablet or pill form, the pharmaceutical compositions can be coated to delay disintegration and absorption in the gastrointestinal tract thereby providing a sustained action over an extended period of time.

[0182] Pharmaceutical compositions can also be administered topically, in which case the carrier may be in the form of a solution, emulsion, ointment or gel base. For transdermal administration, the pharmaceutical composition can be in the form of a transdermal patch or an iontophoresis device. Topical formulations can comprise a concentration of an engineered Ab-drug conjugate of from about 0.05% to about 50% w/v (weight per unit volume of composition), in another embodiment, from 0.1% to 10% ow/v.

Methods of Preparing Engineered mAb-Drug Conjugates

[0183] In another embodiment, a method of preparing a conjugated N-glycosylated IgG Ab or fragment thereof containing one to ten non-native N-glycosylation sites in the heavy chain constant domain is provided, the method comprising: [0184] (a) transforming a yeast or filamentous fungus host cell genetically engineered to produce N-glycans comprising terminal galactose residues of the structure Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2) or the structure Gal.sub.(1-2)GlcNAc.sub.(1-2)Man.sub.5GlcNAc.sub.2, with a nucleic acid encoding an IgG heavy chain contain domain, wherein the IgG heavy chain constant domain comprises one to ten amino acid mutations, and wherein the amino acid mutations generate at least one non-native N-glycosylation site in the IgG heavy chain constant domain; [0185] (b) culturing the transformed host cell under conditions that allow the expression of IgG heavy chain constant domain comprising terminal galactose residues; [0186] (c) contacting the expressed IgG heavy chain constant domain with a reagent that oxidizes the terminal galactose residues; and [0187] (d) conjugating a drug to the oxidized moiety of the terminal galactose residues.

[0188] The yeast host cell used in step (a) of the method of preparing a conjugated N-glycosylated IgG Ab or fragment thereof containing one to ten non-native N-glycosylation sites in the heavy chain constant domain is selected from the group consisting of Pichia pastoris, Pichia finlandica, Pichia trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia opuntiae, Pichia thermotolerans, Pichia salictaria, Pichia guercuum, Pichia pijperi, Pichia stiptis, Pichia methanolica, Pichia minuta (Ogataea minuta, Pichia lindneri), Pichia sp., Saccharomyces cerevisiae, Saccharomyces sp., Hansenula polymorphs, Kluyveromyces sp., Kluyveromyces lactis, Candida albicans, Aspergillus nidulans, Aspergillus niger, Aspergillus oryzae, Trichoderma reesei, Chrysosporium lucknowense, Fusarium sp., Fusarium gramineum, Fusarium venenatum, Neurospora crassa and Yarrowia lipolitica. In an embodiment, the yeast host cell is Pichia pastoris.

[0189] Methods for producing yeast host cells and filamentous fungal host cells genetically engineered to produce human-like complex N-glycans containing terminal galactose residues (Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2), or human-like hybrid N-gly cans containing galactose residues (Gal.sub.(1-2)GlcNAc.sub.(1-2)Man.sub.5GlcNAc.sub.2) are described in the art, e.g., in U.S. Pat. No. 8,815,544; Bobrowicz P, et al., Glycobiology 14: 757-766; Li et al., (2006) Nat. Biotechnol. 24: 210-215; Zha, 2013. In one embodiment, the yeast host cell is a Pichia pastoris host cell that has been engineered to produce N-glycans comprising predominantly the Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2 glycoforms. In another embodiment, the yeast host cell is a Pichia pastoris host cell that has been engineered to produce N-glycans comprising predominantly the Gal.sub.(1-2)GlcNAc.sub.(1-2)Man.sub.5GlcNAc.sub.2 glycoforms. In another embodiment, the yeast host cell is a Pichia pastoris host cell that has been engineered to produce N-glycans comprising predominantly the Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 glycoforms.

[0190] The nucleic acid encoding a heavy chain constant domain, in useful embodiments may comprise the complete heavy chain of the IgG Ab e.g., anti-Her2 IgG1 (SEQ ID NO: 1), wherein the heavy chain constant domain can be modified to effect the substitution of the relevant amino acid residues by site directed mutagenesis as in Example 1. Alternatively, the nucleic acid encoding the heavy chain domain may be prepared by chemical synthesis, wherein oligonucleotides are designed based on the specific amino acid sequence of the antibody mutant.

[0191] In an embodiment, the aforementioned nucleic acid comprises a nucleotide sequence encoding an anti-Her2 heavy chain mutant polypeptide comprising an amino acid sequence selected from SEQ ID NOs: 4-29, 31, 32, 33, 34, 35, 36, 37, 38, 39 and 40.

[0192] In another embodiment, the aforementioned nucleic acid comprises a nucleotide sequence encoding an anti-mouse PD-1 heavy chain mutant polypeptide comprising an amino acid sequence selected from SEQ ID NOs: 41-45.

[0193] In another embodiment, the aforementioned nucleic acid comprises a nucleotide sequence encoding an anti-CS1 heavy chain mutant polypeptide comprising an amino acid sequence selected from SEQ ID NOs: 46-50.

[0194] In another embodiment, the aforementioned nucleic acid comprises a nucleotide sequence encoding an anti-CD70 heavy chain mutant polypeptide comprising an amino acid sequence selected from SEQ ID NOs: 51-55.

[0195] In another embodiment, the yeast or filamentous host cell is transformed with the complete nucleotide sequences encoding one or both of the heavy and light chain sequences of an IgG Ab, e.g., anti-Her2 IgG1 heavy and light chain sequences (SEQ ID NOs: 1 and 2, respectively) or a fragment thereof. Transformation is effected by inserting the nucleotide sequences encoding the heavy and/or light chains of the antibody into a recombinant vector and operably linked to control sequences required for expression of the heavy and light chain in the transformed host cell. One of skill in the art may make a selection among vectors and expression control sequences well known in the art. In an embodiment, the vector is an expression vector in which the nucleotide sequence encoding the heavy and light chain of the antibodies is operably linked to additional segments required for transcription of the nucleotide sequence. The vector is typically derived from plasmid (see Example 1) or viral DNA. A number of suitable expression vectors for expression in the host cells mentioned herein are commercially available or described in the literature.

[0196] In another embodiment of the foregoing method, the IgG Ab or fragment thereof prepared by the aforementioned method comprises one to ten mutations (or pairs of mutations) in the heavy chain constant polypeptide selected from the group consisting of S134N, G161T, G161S, N203T, N203S, V363T, V363S, Q438N, S176N, A118N, S132N, K133N, A162N, T195N, K210T, Y391T, F423T, F423S, Y436T, Y436S, L193N, K392T, K392S, F423T, S176N/G178T, S176N/G178S, Q419N/N421T, Q419N/N421S, S191N/L193T, S191N/L193S, G194N/Q196T, and G194N/Q196S, according to EU numbering.

[0197] Following transformation of the yeast or filamentous host cells (step a), the transformed host cells are cultured (step b) in a nutrient medium suitable for production of the engineered Ab or fragment thereof using methods known in the art. For example, the host cells may be cultured by shake flask, small-scale or large-scale fermentation (including continuous, batch, fed-batch, or solid state fermentations) in laboratory or industrial fermenters performed in a suitable medium and under conditions allowing the heavy and light chains to be expressed and isolated. Suitable media are available from commercial suppliers or may be prepared according to published composition. The produced Abs or fragments thereof contain an engineered N-glycosylated heavy chain constant domain comprising an N-glycan comprising terminal galactose residues of the structure Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2) or the structure Gal.sub.(1-2)GlcNAc.sub.(1-2)Man.sub.5GlcNAc.sub.2.

[0198] In an embodiment, the engineered Ab prepared by the foregoing method comprises about 50 to about 100 mole % of N-glycan with terminal galactose residues of the structure Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2) or the structure Gal.sub.(1-2)GlcNAc.sub.(1-2)Man.sub.5GlcNAc.sub.2. In another embodiment, the engineered antibody prepared by the foregoing method comprises about 80 to about 100 mole % of N-gly can with terminal galactose residues of the structure Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2) or the structure Gal.sub.(1-2)GlcNAc.sub.(1-2)Man.sub.5GlcNAc.sub.2.

[0199] The aforementioned expressed Ab comprising the N-glycosylated heavy chain constant domain may be recovered from the nutrient medium by methods known in the art, e.g., centrifugation, filtration, extraction, evaporation, or precipitation.

[0200] The engineered Ab may then be purified by a variety of procedures known in the art including, but not limited to, chromatography (e.g. ion exchange, affinity, hydrophobic, chromatofocusing, and size exclusion), electrophoretic procedures (e.g. preparative isoelectric focusing), differential solubility (e.g. ammonium sulfate precipitation), SDS-PAGE, or extraction. In an embodiment, the engineered Ab is purified by protein A chromatography (See Example 3.

[0201] The purified engineered Ab containing the expressed N-glycosylated heavy chain constant domain is then contacted with a reagent that oxidizes the terminal galactose residues of the N-glycan to generate an aldehyde (step c).

[0202] In an embodiment, the reagent is the enzyme galactose oxidase (GAL, D-galactose: oxygen 6-oxidoreductase; EC 1.1.3.9, commercially available from Sigma purified from Dactylium dendroites; also referred herein as GO) which specifically oxidizes terminal galactose residues at the C-6 position to generate an aldehyde group (see e.g., Cooper et al., 1959). The aldehyde group is a chemically reactive group that can be directly conjugated with a reactive amine group such as an alkoxyamine (also known as aminooxy) present in a derivatized-drug to form a stable oxime bond (Ramya et al., 2013) between the derivatized drug and the engineered N-glycan.

[0203] The term "derivatived drug" refers to a drug that contains or is modified to contain a reactive amine.

[0204] The term "reactive amine" refers to any nitrogen-containing functional group that can be covalently attached or bonded through a nitrogen atom to an aldehyde functional group by a simple chemical condensation reaction. Examples of other reactive amines include but are not limited to hydrazine, hydrazide, phenylhydrazine, phenylhydrazide, phenoxyamine, semicarbazide and thiosemicarbazide.

[0205] With respect to carrying out oxidation of the terminal galactose residues of the engineered N-glycosylated Abs, the Ab is present in aqueous solution at a concentration of about 0.1 to 100 mg/ml, 0.5 to 50 mg/ml, 1.0 to 20 mg/ml, or 0.5 to 20 mg/ml (see e.g., Copper et al., and Rayma et al., 2013). The enzyme GO generally is used at a pH about 5.5 to about 8.0. The influence of pH, substrate concentration, buffers and buffer concentrations on enzyme reaction are reported in Cooper et al., supra.

[0206] In another embodiment utilizing GO as the oxidizing reagent, the purified engineered Abs containing the expressed N-glycosylated heavy chain constant domain can be contacted with GO by producing the GO in vivo in the yeast and filamentous fungi host cells that have been genetically engineered to produce N-glycosylated mAbs containing N-glycans comprising terminal galactose residues. For example, a yeast or host cell can also be transformed with a plasmid containing the nucleotide sequence encoding GO (e.g., GO from Fusarium graminearum, SEQ ID NO: 57; see Paukner, 2014; Anasontzis, 2014; Deacon, 2004). In another embodiment, the terminal galactose residue of the engineered N-gly can of the Ab can alsobe oxidized to form aldehyde groups utilizing chemical oxidizing reagents. Examples of chemical oxidizing reagents include, but are not limited to periodic acid, paraperiodic acid, sodium metaperiodate and potassium metaperiodate. Among these, oxygen acids and salts thereof are preferred since secondary or undesirable side reactions are less frequent. For a general discussion, see Jackson, 1944, in Organic Reactions 2, p. 341; Bunton, 1965, Oxidation in Organic Chemistry, Vol. 1 Wiberg, ed., Academic Press, New York, p. 367.

[0207] Oxidation of the engineered Abs with these chemical oxidizing reagents can be carried out by known methods. In the oxidation, the engineered Ab is generally present in the form of an aqueous solution at a concentration generally of less than 100 mg/ml, or 1 to 20 mg/ml. When an oxygen acid or salt thereof is used as the oxidizing agent, it is used generally in the form of an aqueous solution, and the concentration is generally 0.001 to 10 mM and preferably 1.0 to 10 mM. The amount of the oxygen acid or salt thereof depends on the kind of antibody, but generally it is used in excess, for example, ten to 100 times as much as the amount of the oxidizable N-glycan. The optimal amount, however, can be determined by routine experimentation.

[0208] Following oxidation of the engineered N-glycosylated Ab, the Ab can be conjugated to a drug by reacting the Ab with a drug having a reactive amine group selected from the group consisting of hydrazine, hydrazide, phenylhydrazine, phenylhydazide, alkoxyamine, phenoxyamino, semicarbazide and thiosemicarbazide groups.

[0209] In a useful embodiment, the reactive amine group is an alkoxyamine (aminooxy) group. Drugs modified to contain a reactive amino group such as alkoxyamine can be synthesized by methods known in the art (Jayasekara, 2014; Trimaille 2014; Su 2005; Singh 2005) and are also commercially available (e.g., the amino oxy activated C5-linker containing DMI (chemically synthesized by Concortis Biosystems in San Diego, Calif., see Example 10; aminooxy activated Exendin-4-peptide chemically synthesized by Biopeptekin Malvern, Pa., see Example 9; and aminooxy activated CF633 dye chemically synthesized by Biotium in Hayward, Calif., Example 5).

[0210] In an embodiment, a solution of the oxidized engineered Ab at a concentration from about 0.5 to 20 mg/ml is mixed with an amine derivative of a drug (molar ratios of reactive amine group to antibody aldehyde ranging from about 1 to about 10,000) and the solution incubated for from about 1 to 72 hours, preferably in the dark. Suitable temperatures are from 0.degree. to 37.degree. C. and pH may be from about 6 to 8.

[0211] The aforementioned method of preparing Ab-drug conjugate can also be used to prepare Ab-drug conjugate, wherein the engineered Ab contains one to two non-native N-glycosylation sites in the heavy chain framework domain as is described above.

[0212] In another embodiment, a method of preparing a conjugated N-glycosylated Ab or fragment thereof containing one to ten non-native N-glycosylation sites in the heavy chain constant domain is provided, the method comprising: [0213] (a) transforming a yeast or filamentous fungus host cell genetically engineered to produce N-glycans comprising terminal sialic acid residues (NANA.sub.(1-4)Gal.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2) with a nucleic acid encoding a heavy chain contain domain, wherein the heavy chain comprises one to ten amino acid mutations, and wherein the one to ten amino acid mutation generates at least one non-native N-glycosylation site in the heavy chain constant domain; [0214] (b) culturing the transformed yeast host cell under conditions that allow the expression of the heavy chain constant domain comprising terminal sialic acid residues, [0215] (c) contacting the expressed heavy chain constant domain with neuraminidase to remove the terminal sialic acid residues to form N-glycosylated heavy chain constant domain comprising terminal galactose residues; [0216] (d) contacting the expressed glycosylated heavy chain constant domain comprising terminal galactose residues of step (c), with a reagent that oxidizes the terminal galactose residues; [0217] (e) conjugating a drug to the oxidized moiety of the terminal galactose residues.

[0218] Methods for producing yeast host cells and filamentous fungal host cells genetically engineered to produce human-like complex N-glycans containing terminal sialic acid residues are described e.g. in U.S. Pat. Nos. 8,715,963; 7,863,020; Nett et al., (2011), Yeast 28(3):237-52 (2011); Hamilton et al., Curr Opin Biotechnol. 18(5):387-92 (2007); Hamilton et al., (2006) Science 313: 1441-1443.

[0219] Methods of transforming the yeast strains to produce N-glycans with terminal sialic acid residues, preparing mutated nucleic acids containing the non-native N-glycosylation sites, and culturing steps (steps a-b) are as described above (strains containing N-gly cans with terminal galactose residues). With respect to step (c), N-glycans comprising sialic acid residues can be desialyated using the enzyme Acetyl-neuroaminyl hydrolase (neuraminidase, New England Biolabs, Ipswich, Mass.) according to the manufacturer's recommended reaction conditions, to efficiently remove the sialic acid residues leaving predominantly terminal galactose residues. Step (d) of contacting the expressed glycosylated heavy chain constant domain with a reagent, e.g., GO or a chemical reagent, that oxidizes the terminal galactose residues, and step (e) of conjugating a drug to the oxidized moiety of the terminal galactose residues is as described above.

TABLE-US-00001 Sequences (anti-Her2/trastuzumab IgG1 H chain) SEQ ID NO: 1 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYT RYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGT LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-HER2/trastuzumab Kappa L chain) SEQ ID NO: 2 DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVP SRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (pGLY5883 nucleotide sequence) SEQ ID NO: 3 TCGCGCGTTTCGGTGATGACGGTGAAAACCTCTGACACATGCAGCTCCCGGAGACG GTCACAGCTTGTCTGTAAGCGGATGCCGGGAGCAGACAAGCCCGTCAGGGCGCGTC AGCGGGTGTTGGCGGGTGTCGGGGCTGGCTTAACTATGCGGCATCAGAGCAGATTG TACTGAGAGTGCACCATATGCGGTGTGAAATACCGCACAGATGCGTAAGGAGAAAA TACCGCATCAGGCGCCATTCGCCATTCAGGCTGCGCAACTGTTGGGAAGGGCGATC GGTGCGGGCCTCTTCGCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGC GATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACGTTGTAAAACGACGGCCA GTGAATTGAGATCTAACATCCAAAGACGAAAGGTTGAATGAAACCTTTTTGCCATCC GACATCCACAGGTCCATTCTCACACATAAGTGCCAAACGCAACAGGAGGGGATACA CTAGCAGCAGACCGTTGCAAACGCAGGACCTCCACTCCTCTTCTCCTCAACACCCAC TTTTGCCATCGAAAAACCAGCCCAGTTATTGGGCTTGATTGGAGCTCGCTCATTCCA ATTCCTTCTATTAGGCTACTAACACCATGACTTTATTAGCCTGTCTATCCTGGCCCCC CTGGCGAGGTTCATGTTTGTTTATTTCCGAATGCAACAAGCTCCGCATTACACCCGA ACATCACTCCAGATGAGGGCTTTCTGAGTGTGGGGTCAAATAGTTTCATGTTCCCCA AATGGCCCAAAACTGACAGTTTAAACGCTGTCTTGGAACCTAATATGACAAAAGCG TGATCTCATCCAAGATGAACTAAGTTTGGTTCGTTGAAATGCTAACGGCCAGTTGGT CAAAAAGAAACTTCCAAAAGTCGGCATACCGTTTGTCTTGTTTGGTATTGATTGACG AATGCTCAAAAATAATCTCATTAATGCTTAGCGCAGTCTCTCTATCGCTTCTGAACCC CGGTGCACCTGTGCCGAAACGCAAATGGGGAAACACCCGCTTTTTGGATGATTATGC ATTGTCTCCACATTGTATGCTTCCAAGATTCTGGTGGGAATACTGCTGATAGCCTAA CGTTCATGATCAAAATTTAACTGTTCTAACCCCTACTTGACAGCAATATATAAACAG AAGGAAGCTGCCCTGTCTTAAACCTTTTTTTTTATCATCATTATTAGCTTACTTTCAT AATTGCGACTGGTTCCAATTGACAAGCTTTTGATTTTAACGACTTTTAACGACAACTT GAGAAGATCAAAAAACAACTAATTATTCGAAACGGAATTCGAAACGATGAGATTCC CATCCATCTTCACTGCTGTTTTGTTCGCTGCTTCTTCTGCTTTGGCTGAGGTTCAGTTG GTTGAATCTGGAGGAGGATTGGTTCAACCTGGTGGTTCTTTGAGATTGTCCTGTGCT GCTTCCGGTTTCAACATCAAGGACACTTACATCCACTGGGTTAGACAAGCTCCAGGA AAGGGATTGGAGTGGGTTGCTAGAATCTACCCAACTAACGGTTACACAAGATACGC TGACTCCGTTAAGGGAAGATTCACTATCTCTGCTGACACTTCCAAGAACACTGCTTA CTTGCAGATGAACTCCTTGAGAGCTGAGGATACTGCTGTTTACTACTGTTCCAGATG GGGTGGTGATGGTTTCTACGCTATGGACTACTGGGGTCAAGGAACTTTGGTTACTGT TTCCTCCGCTTCTACTAAGGGACCATCTGTTTTCCCATTGGCTCCATCTTCTAAGTCT ACTTCCGGTGGTACTGCTGCTTTGGGATGTTTGGTTAAAGACTACTTCCCAGAGCCA GTTACTGTTTCTTGGAACTCCGGTGCTTTGACTTCTGGTGTTCACACTTTCCCAGCTG TTTTGCAATCTTCCGGTTTGTACTCTTTGTCCTCCGTTGTTACTGTTCCATCCTCTTCC TTGGGTACTCAGACTTACATCTGTAACGTTAACCACAAGCCATCCAACACTAAGGTT GACAAGAAGGTTGAGCCAAAGTCCTGTGACAAGACACATACTTGTCCACCATGTCC AGCTCCAGAATTGTTGGGTGGTCCATCCGTTTTCTTGTTCCCACCAAAGCCAAAGGA CACTTTGATGATCTCCAGAACTCCAGAGGTTACATGTGTTGTTGTTGACGTTTCTCAC GAGGACCCAGAGGTTAAGTTCAACTGGTACGTTGACGGTGTTGAAGTTCACAACGCT AAGACTAAGCCAAGAGAAGAGCAGTACAACTCCACTTACAGAGTTGTTTCCGTTTTG ACTGTTTTGCACCAGGACTGGTTGAACGGTAAAGAATACAAGTGTAAGGTTTCCAAC AAGGCTTTGCCAGCTCCAATCGAAAAGACTATCTCCAAGGCTAAGGGTCAACCAAG AGAGCCACAGGTTTACACTTTGCCACCATCCAGAGAAGAGATGACTAAGAACCAGG TTTCCTTGACTTGTTTGGTTAAAGGATTCTACCCATCCGACATTGCTGTTGAGTGGGA ATCTAACGGTCAACCAGAGAACAACTACAAGACTACTCCACCAGTTTTGGATTCTGA TGGTTCCTTCTTCTTGTACTCCAAGTTGACTGTTGACAAGTCCAGATGGCAACAGGG TAACGTTTTCTCCTGTTCCGTTATGCATGAGGCTTTGCACAACCACTACACTCAAAAG TCCTTGTCTTTGTCCCCTGGTTAATGAGGCCGGCCATTTAAATACAGGCCCCTTTTCC TTTGTCGATATCATGTAATTAGTTATGTCACGCTTACATTCACGCCCTCCTCCCACAT CCGCTCTAACCGAAAAGGAAGGAGTTAGACAACCTGAAGTCTAGGTCCCTATTTATT TTTTTTAATAGTTATGTTAGTATTAAGAACGTTATTTATATTTCAAATTTTTCTTTTTT TTCTGTACAAACGCGTGTACGCATGTAACATTATACTGAAAACCTTGCTTGAGAAGG TTTTGGGACGCTCGAAGGCTTTAATTTGCAAGCTGGATCTAACATCCAAAGACGAAA GGTTGAATGAAACCTTTTTGCCATCCGACATCCACAGGTCCATTCTCACACATAAGT GCCAAACGCAACAGGAGGGGATACACTAGCAGCAGACCGTTGCAAACGCAGGACC TCCACTCCTCTTCTCCTCAACACCCACTTTTGCCATCGAAAAACCAGCCCAGTTATTG GGCTTGATTGGAGCTCGCTCATTCCAATTCCTTCTATTAGGCTACTAACACCATGACT TTATTAGCCTGTCTATCCTGGCCCCCCTGGCGAGGTTCATGTTTGTTTATTTCCGAAT GCAACAAGCTCCGCATTACACCCGAACATCACTCCAGATGAGGGCTTTCTGAGTGTG GGGTCAAATAGTTTCATGTTCCCCAAATGGCCCAAAACTGACAGTTTAAACGCTGTC TTGGAACCTAATATGACAAAAGCGTGATCTCATCCAAGATGAACTAAGTTTGGTTCG TTGAAATGCTAACGGCCAGTTGGTCAAAAAGAAACTTCCAAAAGTCGGCATACCGT TTGTCTTGTTTGGTATTGATTGACGAATGCTCAAAAATAATCTCATTAATGCTTAGCG CAGTCTCTCTATCGCTTCTGAACCCCGGTGCACCTGTGCCGAAACGCAAATGGGGAA ACACCCGCTTTTTGGATGATTATGCATTGTCTCCACATTGTATGCTTCCAAGATTCTG GTGGGAATACTGCTGATAGCCTAACGTTCATGATCAAAATTTAACTGTTCTAACCCC TACTTGACAGCAATATATAAACAGAAGGAAGCTGCCCTGTCTTAAACCTTTTTTTTT ATCATCATTATTAGCTTACTTTCATAATTGCGACTGGTTCCAATTGACAAGCTTTTGA TTTTAACGACTTTTAACGACAACTTGAGAAGATCAAAAAACAACTAATTATTCGAAA CGGAATTCGAAACGATGAGATTCCCATCCATCTTCACTGCTGTTTTGTTCGCTGCTTC TTCTGCTTTGGCTGACATCCAAATGACTCAATCCCCATCTTCTTTGTCTGCTTCCGTT GGTGACAGAGTTACTATCACTTGTAGAGCTTCCCAGGACGTTAATACTGCTGTTGCT TGGTATCAACAGAAGCCAGGAAAGGCTCCAAAGTTGTTGATCTACTCCGCTTCCTTC TTGTACTCTGGTGTTCCATCCAGATTCTCTGGTTCCAGATCCGGTACTGACTTCACTT TGACTATCTCCTCCTTGCAACCAGAAGATTTCGCTACTTACTACTGTCAGCAGCACTA CACTACTCCACCAACTTTCGGACAGGGTACTAAGGTTGAGATCAAGAGAACTGTTGC TGCTCCATCCGTTTTCATTTTCCCACCATCCGACGAACAGTTGAAGTCTGGTACAGCT TCCGTTGTTTGTTTGTTGAACAACTTCTACCCAAGAGAGGCTAAGGTTCAGTGGAAG GTTGACAACGCTTTGCAATCCGGTAACTCCCAAGAATCCGTTACTGAGCAAGACTCT AAGGACTCCACTTACTCCTTGTCCTCCACTTTGACTTTGTCCAAGGCTGATTACGAGA AGCACAAGGTTTACGCTTGTGAGGTTACACATCAGGGTTTGTCCTCCCCAGTTACTA AGTCCTTCAACAGAGGAGAGTGTTAATAGGGCCGGCCATTTAAATACAGGCCCCTTT TCCTTTGTCGATATCATGTAATTAGTTATGTCACGCTTACATTCACGCCCTCCTCCCA CATCCGCTCTAACCGAAAAGGAAGGAGTTAGACAACCTGAAGTCTAGGTCCCTATTT ATTTTTTTTAATAGTTATGTTAGTATTAAGAACGTTATTTATATTTCAAATTTTTCTTT TTTTTCTGTACAAACGCGTGTACGCATGTAACATTATACTGAAAACCTTGCTTGAGA AGGTTTTGGGACGCTCGAAGGCTTTAATTTGCAAGCTGGATCCGCGGCCGCTTACGC GCCGATCCCCCACACACCATAGCTTCAAAATGTTTCTACTCCTTTTTTACTCTTCCAG ATTTTCTCGGACTCCGCGCATCGCCGTACCACTTCAAAACACCCAAGCACAGCATAC TAAATTTCCCCTCTTTCTTCCTCTAGGGTGTCGTTAATTACCCGTACTAAAGGTTTGG AAAAGAAAAAAGAGACCGCCTCGTTTCTTTTTCTTCGTCGAAAAAGGCAATAAAAA TTTTTATCACGTTTCTTTTTCTTGAAAATTTTTTTTTTTGATTTTTTTCTCTTTCGATGA CCTCCCATTGATATTTAAGTTAATAAACGGTCTTCAATTTCTCAAGTTTCAGTTTCAT TTTTCTTGTTCTATTACAACTTTTTTTACTTCTTGCTCATTAGAAAGAAAGCATAGCA ATCTAATCTAAGTTTTAATTACAAATTAATTAATGGCCAAGTTGACCAGTGCCGTTC CGGTGCTCACCGCGCGCGACGTCGCCGGAGCGGTCGAGTTCTGGACCGACCGGCTC GGGTTCTCCCGGGACTTCGTGGAGGACGACTTCGCCGGTGTGGTCCGGGACGACGTG ACCCTGTTCATCAGCGCGGTCCAGGACCAGGTGGTGCCGGACAACACCCTGGCCTG GGTGTGGGTGCGCGGCCTGGACGAGCTGTACGCCGAGTGGTCGGAGGTCGTGTCCA CGAACTTCCGGGACGCCTCCGGGCCTGCCATGACCGAGATCGGCGAGCAGCCGTGG GGGCGGGAGTTCGCCCTGCGCGACCCGGCCGGCAACTGCGTGCACTTCGTGGCCGA GGAGCAGGACTGATTAATTAACAGGCCCCTTTTCCTTTGTCGATATCATGTAATTAG TTATGTCACGCTTACATTCACGCCCTCCTCCCACATCCGCTCTAACCGAAAAGGAAG GAGTTAGACAACCTGAAGTCTAGGTCCCTATTTATTTTTTTTAATAGTTATGTTAGTA TTAAGAACGTTATTTATATTTCAAATTTTTCTTTTTTTTCTGTACAAACGCGTGTACGC ATGTAACATTATACTGAAAACCTTGCTTGAGAAGGTTTTGGGACGCTCGAAGGCTTT AATTTGCAAGCTGCGGCCTAAGGCGCGCCAGGCCATAATGGCCAAACGGTTTCTCA ATTACTATATACTACTAACCATTTACCTGTAGCGTATTTCTTTTCCCTCTTCGCGAAA GCTCAAGGGCATCTTCTTGACTCATGAAAAATATCTGGATTTCTTCTGACAGATCAT

CACCCTTGAGCCCAACTCTCTAGCCTATGAGTGTAAGTGATAGTCATCTTGCAACAG ATTATTTTGGAACGCAACTAACAAAGCAGATACACCCTTCAGCAGAATCCTTTCTGG ATATTGTGAAGAATGATCGCCAAAGTCACAGTCCTGAGACAGTTCCTAATCTTTACC CCATTTACAAGTTCATCCAATCAGACTTCTTAACGCCTCATCTGGCTTATATCAAGCT TACCAACAGTTCAGAAACTCCCAGTCCAAGTTTCTTGCTTGAAAGTGCGAAGAATGG TGACACCGTTGACAGGTACACCTTTATGGGACATTCCCCCAGAAAAATAATCAAGAC TGGGCCTTTAGAGGGTGCTGAAGTTGACCCCTTGGTGCTTCTGGAAAAAGAACTGAA GGGCACCAGACAAGCGCAACTTCCTGGTATTCCTCGTCTAAGTGGTGGTGCCATAGG ATACATCTCGTACGATTGTATTAAGTACTTTGAACCAAAAACTGAAAGAAAACTGAA AGATGTTTTGCAACTTCCGGAAGCAGCTTTGATGTTGTTCGACACGATCGTGGCTTTT GACAATGTTTATCAAAGATTCCAGGTAATTGGAAACGTTTCTCTATCCGTTGATGAC TCGGACGAAGCTATTCTTGAGAAATATTATAAGACAAGAGAAGAAGTGGAAAAGAT CAGTAAAGTGGTATTTGACAATAAAACTGTTCCCTACTATGAACAGAAAGATATTAT TCAAGGCCAAACGTTCACCTCTAATATTGGTCAGGAAGGGTATGAAAACCATGTTCG CAAGCTGAAAGAACATATTCTGAAAGGAGACATCTTCCAAGCTGTTCCCTCTCAAAG GGTAGCCAGGCCGACCTCATTGCACCCTTTCAACATCTATCGTCATTTGAGAACTGT CAATCCTTCTCCATACATGTTCTATATTGACTATCTAGACTTCCAAGTTGTTGGTGCT TCACCTGAATTACTAGTTAAATCCGACAACAACAACAAAATCATCACACATCCTATT GCTGGAACTCTTCCCAGAGGTAAAACTATCGAAGAGGACGACAATTATGCTAAGCA ATTGAAGTCGTCTTTGAAAGACAGGGCCGAGCACGTCATGCTGGTAGATTTGGCCAG AAATGATATTAACCGTGTGTGTGAGCCCACCAGTACCACGGTTGATCGTTTATTGAC TGTGGAGAGATTTTCTCATGTGATGCATCTTGTGTCAGAAGTCAGTGGAACATTGAG ACCAAACAAGACTCGCTTCGATGCTTTCAGATCCATTTTCCCAGCAGGAACCGTCTC CGGTGCTCCGAAGGTAAGAGCAATGCAACTCATAGGAGAATTGGAAGGAGAAAAG AGAGGTGTTTATGCGGGGGCCGTAGGACACTGGTCGTACGATGGAAAATCGATGGA CACATGTATTGCCTTAAGAACAATGGTCGTCAAGGACGGTGTCGCTTACCTTCAAGC CGGAGGTGGAATTGTCTACGATTCTGACCCCTATGACGAGTACATCGAAACCATGAA CAAAATGAGATCCAACAATAACACCATCTTGGAGGCTGAGAAAATCTGGACCGATA GGTTGGCCAGAGACGAGAATCAAAGTGAATCCGAAGAAAACGATCAATGAACGGA GGACGTAAGTAGGAATTTATGGTTTGGCCATAATGGCCTAGCTTGGCGTAATCATGG TCATAGCTGTTTCCTGTGTGAAATTGTTATCCGCTCACAATTCCACACAACATACGA GCCGGAAGCATAAAGTGTAAAGCCTGGGGTGCCTAATGAGTGAGCTAACTCACATT AATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCA TTAATGAATCGGCCAACGCGCGGGGAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGC TTCCTCGCTCACTGACTCGCTGCGCTCGGTCGTTCGGCTGCGGCGAGCGGTATCAGC TCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACGCAGGAAAGA ACATGTGAGCAAAAGGCCAGCAAAAGGCCAGGAACCGTAAAAAGGCCGCGTTGCT GGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCGACGCTCAAG TCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAA GCTCCCTCGTGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTGTCCGCCTT TCTCCCTTCGGGAAGCGTGGCGCTTTCTCATAGCTCACGCTGTAGGTATCTCAGTTCG GTGTAGGTCGTTCGCTCCAAGCTGGGCTGTGTGCACGAACCCCCCGTTCAGCCCGAC CGCTGCGCCTTATCCGGTAACTATCGTCTTGAGTCCAACCCGGTAAGACACGACTTA TCGCCACTGGCAGCAGCCACTGGTAACAGGATTAGCAGAGCGAGGTATGTAGGCGG TGCTACAGAGTTCTTGAAGTGGTGGCCTAACTACGGCTACACTAGAAGGACAGTATT TGGTATCTGCGCTCTGCTGAAGCCAGTTACCTTCGGAAAAAGAGTTGGTAGCTCTTG ATCCGGCAAACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTTTGCAAGCAGCAGAT TACGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTACGGGGTCTGA CGCTCAGTGGAACGAAAACTCACGTTAAGGGATTTTGGTCATGAGATTATCAAAAA GGATCTTCACCTAGATCCTTTTAAATTAAAAATGAAGTTTTAAATCAATCTAAAGTA TATATGAGTAAACTTGGTCTGACAGTTACCAATGCTTAATCAGTGAGGCACCTATCT CAGCGATCTGTCTATTTCGTTCATCCATAGTTGCCTGACTCCCCGTCGTGTAGATAAC TACGATACGGGAGGGCTTACCATCTGGCCCCAGTGCTGCAATGATACCGCGAGACC CACGCTCACCGGCTCCAGATTTATCAGCAATAAACCAGCCAGCCGGAAGGGCCGAG CGCAGAAGTGGTCCTGCAACTTTATCCGCCTCCATCCAGTCTATTAATTGTTGCCGG GAAGCTAGAGTAAGTAGTTCGCCAGTTAATAGTTTGCGCAACGTTGTTGCCATTGCT ACAGGCATCGTGGTGTCACGCTCGTCGTTTGGTATGGCTTCATTCAGCTCCGGTTCCC AACGATCAAGGCGAGTTACATGATCCCCCATGTTGTGCAAAAAAGCGGTTAGCTCCT TCGGTCCTCCGATCGTTGTCAGAAGTAAGTTGGCCGCAGTGTTATCACTCATGGTTA TGGCAGCACTGCATAATTCTCTTACTGTCATGCCATCCGTAAGATGCTTTTCTGTGAC TGGTGAGTACTCAACCAAGTCATTCTGAGAATAGTGTATGCGGCGACCGAGTTGCTC TTGCCCGGCGTCAATACGGGATAATACCGCGCCACATAGCAGAACTTTAAAAGTGCT CATCATTGGAAAACGTTCTTCGGGGCGAAAACTCTCAAGGATCTTACCGCTGTTGAG ATCCAGTTCGATGTAACCCACTCGTGCACCCAACTGATCTTCAGCATCTTTTACTTTC ACCAGCGTTTCTGGGTGAGCAAAAACAGGAAGGCAAAATGCCGCAAAAAAGGGAA TAAGGGCGACACGGAAATGTTGAATACTCATACTCTTCCTTTTTCAATATTATTGAA GCATTTATCAGGGTTATTGTCTCATGAGCGGATACATATTTGAATGTATTTAGAAAA ATAAACAAATAGGGGTTCCGCGCACATTTCCCCGAAAAGTGCCACCTGACGTCTAA GAAACCATTATTATCATGACATTAACCTATAAAAATAGGCGTATCACGAGGCCCTTT CGTC (anti-Her2/trastuzumab IgG1 H chain, Q105N (Kabat), pGLY10044) SEQ ID NO: 4 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARTYPTNGYT RYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGNGT LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, S134N (EU), pGLY10045) SEQ ID NO: 5 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARTYPTNGYT RYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGT LVTVSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, G161T (EU), pGLY10046) SEQ ID NO: 6 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYT RYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGT LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSTALTSGVHTFP AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, Q175N (EU), pGLY10047) SEQ ID NO: 7 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYT RYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGT LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP AVLNSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, N203T (EU), pGLY10048) SEQ ID NO: 8 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYT RYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGT LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVTHKPSNTKVDKKVEPKSCDKTHTCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, V363T (EU), pGLY10049) SEQ ID NO: 9 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYT RYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGT LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPA PELLGGPSVFLEPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQTSLTCLVKGEYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, Q386T (EU), pGLY10050)

SEQ ID NO: 10 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYT RYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGT LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPA PELLGGPSVFLEPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGTPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, Q438N (EU), pGLY10051) SEQ ID NO: 11 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYT RYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGT LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPA PELLGGPSVFLEPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTNKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, S113N (Kabat), pGLY14120) SEQ ID NO: 12 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFYAMDYWGQGTLVTVSNASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, A118N (EU), pGLY14121) SEQ ID NO: 13 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVARTYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFYAMDYWGQGTLVTVSSNSTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, S132N (EU), pGLY14122) SEQ ID NO: 14 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVARTYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSNKSTSGGTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, K133N (EU), pGLY14123) SEQ ID NO: 15 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSNSTSGGTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, A162N (EU), pGLY14124) SEQ ID NO: 16 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVARTYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV TVSWNSGNLTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, T195N (EU), pGLY14125) SEQ ID NO: 17 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGNQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, K210T (EU), pGLY14126) SEQ ID NO: 18 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTTVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, Y391T (EU), pGLY14127) SEQ ID NO: 19 MREPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NTKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, F423T (EU), pGLY14128) SEQ ID NO: 20 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVTSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, Y436T (EU), pGLY14129) SEQ ID NO: 21 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHTTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, L193N (EU), pGLY14130) SEQ ID NO: 22 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSNGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, Q419N, N421T (EU), pGLY14131) SEQ ID NO: 23 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQNGTVFSCSVMHEALHNHYTQKSLSLSPG

(anti-Her2/trastuzumab IgG1 H chain, S176N, G178T (EU), pGLY14132) SEQ ID NO: 24 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQNSTLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, S191N, L193T (EU), pGLY14133) SEQ ID NO: 25 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSNSTGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, G194N, Q196T (EU), pGLY14134) SEQ ID NO: 26 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLNTTTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, G161T, S134N (EU), pGLY14135) SEQ ID NO: 27 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPV TVSWNSTALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-Her2/trastuzumab IgG1 H chain, G161S, S134N (EU), pGLY14136) SEQ ID NO: 28 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPV TVSWNSSALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (null-Her2 IgG1 H chain, F243A, F264A (EU), pGLY11576) SEQ ID NO: 29 EVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVAEIYPTNGYTR YADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFGAMDYWGQGTL VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAP ELLGGPSVFLAPPKPKDTLMISRTPEVTCVVADVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (null-Her2 L chain, pGLY11576) SEQ ID NO: 30 DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASFLYSGVP SRFSGSGSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (null-Her2 IgG1 H chain, S134N (EU), pGLY14137) SEQ ID NO: 31 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVAEIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFGAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLAPPKPKDTLMISRTPEVTCVVADVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (null-Her2 IgG1 H chain, G161T (EU), pGLY14138) SEQ ID NO: 32 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVAEIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFGAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPV TVSWNSTALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLAPPKPKDTLMISRTPEVTCVVADVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (null-Her2 IgG1 H chain, S134N, G161T (EU), pGLY14139) SEQ ID NO: 33 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVAEIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFGAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPV TVSWNSTALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLAPPKPKDTLMISRTPEVTCVVADVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (null-Her2 IgG1 H chain, S134N, G161T, N203T (EU), pGLY14172) SEQ ID NO: 34 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVAEIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFGAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPV TVSWNSTALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVTHKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLAPPKPKDTLMISRTPEVTCVVADVSHEDPEVK FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (null-Her2 IgG1 H chain, K30T, Y56T (Kabat), S134N (EU), G161T (EU), pGLY14173) SEQ ID NO: 35 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNITDTYIHWVRQAP GKGLEWVAEIYPTNGTTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFGAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPV TVSWNSTALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLAPPKPKDTLMISRTPEVTCVVADVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (null-Her2 IgG1 H chain, K30T (Kabat), K64N/R66T (Kabat), S134N (EU), G161T (EU), pGLY14174) SEQ ID NO: 36 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNITDTYIHWVRQAP GKGLEWVAEIYPTNGYTRYADSVNGTFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFGAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPV TVSWNSTALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLAPPKPKDTLMISRTPEVTCVVADVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (null-Her2 IgG1 H chain, Y56T, K64N/R66T (Kabat), S134N(EU), G161T (EU), N203T (EU), pGLY14175) SEQ ID NO: 37 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVAEIYPTNGTTRYADSVNGTFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFGAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPV TVSWNSTALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVTHKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLAPPKPKDTLMISRTPEVTCVVADVSHEDPEVK FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN

YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (null-Her2 IgG1 H chain, Y56T (Kabat), S134N (EU), G161T (EU), S176N/G178T (EU), N203T (EU), pGLY14176) SEQ ID NO: 38 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAP GKGLEWVAEIYPTNGTTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFGAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPV TVSWNSTALTSGVHTFPAVLQNSTLYSLSSVVTVPSSSLGTQTYICNVTHKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLAPPKPKDTLMISRTPEVTCVVADVSHEDPEVK FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (null-Her2 IgG1 H chain, K30T (Kabat), Y56T (Kabat), K64N/R66T (Kabat), S134N (EU), G161T (EU), N203T (EU), pGLY14177) SEQ ID NO: 39 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNITDTYIHWVRQAP GKGLEWVAEIYPTNGTTRYADSVNGTFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFGAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPV TVSWNSTALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVTHKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLAPPKPKDTLMISRTPEVTCVVADVSHEDPEVK FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (null-Her2 IgG1 H chain, K30T, Y56T, K64N/R66T (Kabat), S134N, G161T, S176N/G178T, N203T, V363T, K392T, F423T (EU), pGLY14178) SEQ ID NO: 40 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNITDTYIHWVRQAP GKGLEWVAEIYPTNGTTRYADSVNGTFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFGAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPV TVSWNSTALTSGVHTFPAVLQNSTLYSLSSVVTVPSSSLGTQTYICNVTHKPSNTKVDKK VEPKSCDKTHTCPPCPAPELLGGPSVFLAPPKPKDTLMISRTPEVTCVVADVSHEDPEVK FNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPA PIEKTISKAKGQPREPQVYTLPPSREEMTKNQTSLTCLVKGFYPSDIAVEWESNGQPENN YTTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVTSCSVMHEALHNHYTQKSLSLSPG (null-Her2 IgG1 H chain, K30T (Kabat), Y56T (Kabat), K64N/R66T (Kabat), S134N (EU), G161T (EU), L193N (EU), N203T (EU), V363T (EU), K392T (EU), F423T (EU), pGLY14179) SEQ ID NO: 41 MRFPSIFTAVLFAASSALAEVQLVESGGGLVQPGGSLRLSCAASGFNITDTYIHWVRQAP GKGLEWVAEIYPTNGTTRYADSVNGTFTISADTSKNTAYLQMNSLRAEDTAVYYCSRW GGDGFGAMDYWGQGTLVTVSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPV TVSWNSTALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSNGTQTYICNVTHKPSNTKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLAPPKPKDTLMISRTPEVTCVVADVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP APIEKTISKAKGQPREPQVYTLPPSREEMTKNQTSLTCLVKGFYPSDIAVEWESNGQPEN NYTTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVTSCSVMHEALHNHYTQKSLSLSPG (anti-mouse PD1 chimeric IgG1 H chain, pGLY13649) SEQ ID NO: 42 EVQLVESGGGLVQPGGSLKLSCAASGFTFSNSGLAWVRQAPEKGLEWVATITYNGTST YYRDSVKGRFTISRDNAKNTLYLQMSSLRSEDTATYYCARWVPGSGNFDYWGQGTLV TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPE LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-mouse PD1 mouse L chain, pGLY13649) SEQ ID NO: 43 DIVLTQSPASLAVSLGQRATISCRASQSVTISRYTLMHWYQQKPGQPPKLLIYRASNLAS GIPARFSGSGSGTDFTLNIHPVEEDDAATYYCQQSRESPWTFGGGTKLEIKRADAAPTVS IFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC (anti-mouse PD1 chimeric IgG1 H chain, S134N (EU), pGLY14163) SEQ ID NO: 44 EVQLVESGGGLVQPGGSLKLSCAASGFTFSNSGLAWVRQAPEKGLEWVATITYNGTST YYRDSVKGRFTISRDNAKNTLYLQMSSLRSEDTATYYCARWVPGSGNFDYWGQGTLV TVSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-mouse PD1 chimeric IgG1 H chain, G161T (EU), pGLY14164) SEQ ID NO: 45 EVQLVESGGGLVQPGGSLKLSCAASGFTFSNSGLAWVRQAPEKGLEWVATITYNGTST YYRDSVKGRFTISRDNAKNTLYLQMSSLRSEDTATYYCARWVPGSGNFDYWGQGTLV TVSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPVTVSWNSTALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPE LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-mouse PD1 chimeric IgG1 H chain, S134N, G161T (EU), pGLY14165) SEQ ID NO: 46 EVQLVESGGGLVQPGGSLKLSCAASGFTFSNSGLAWVRQAPEKGLEWVATITYNGTST YYRDSVKGRFTISRDNAKNTLYLQMSSLRSEDTATYYCARWVPGSGNFDYWGQGTLV TVSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-CS1 IgG1 H chain, pGLY8040) SEQ ID NO: 47 EVQLVESGGGLVQPGGSLRLSCAASGFDFSRYWMSWVRQAPGKGLEWIGEINPDSSTIN YAPSLKDKFIISRDNAKNSLYLQMNSLRAEDTAVYYCARPDGNYWYFDVWGQGTLVT VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-CS1 L chain, pGLY8040) SEQ ID NO: 48 DIQMTQSPSSLSASVGDRVTITCKASQDVGIAVAWYQQKPGKVPKLLIYWASTRHTGVP DRFSGSGSGTDFTLTISSLQPEDVATYYCQQYSSYPYTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (anti-CS1 IgG1 H chain, S134N (EU), pGLY14157) SEQ ID NO: 49 EVQLVESGGGLVQPGGSLRLSCAASGFDFSRYWMSWVRQAPGKGLEWIGEINPDSSTIN YAPSLKDKFIISRDNAKNSLYLQMNSLRAEDTAVYYCARPDGNYWYFDVWGQGTLVT VSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPE LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-CS1 IgG1 H chain, G161T (EU), pGLY14158) SEQ ID NO: 50 EVQLVESGGGLVQPGGSLRLSCAASGFDFSRYWMSWVRQAPGKGLEWIGEINPDSSTIN YAPSLKDKFIISRDNAKNSLYLQMNSLRAEDTAVYYCARPDGNYWYFDVWGQGTLVT VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSTALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-CS1 IgG1 H chain, S134N, G161T (EU), pGLY14159) SEQ ID NO: 51 EVQLVESGGGLVQPGGSLRLSCAASGFDFSRYWMSWVRQAPGKGLEWIGEINPDSSTIN YAPSLKDKFIISRDNAKNSLYLQMNSLRAEDTAVYYCARPDGNYWYFDVWGQGTLVT VSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPVTVSWNSTALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-CD70 IgG1 H chain, pGLY14148) SEQ ID NO: 52 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYIMHWVRQAPGKGLEWVAVISYDGRNK YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDTDGYDFDYWGQGTLVT

VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG anti-CD70 L chain, pGLY14148) SEQ ID NO: 53 EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA RFSGSGSGTDFTLTISSLEPEDFAVYYCQQRTNWPLTFGGGTKVEIKRTVAAPSVFIFPPS DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC (anti-CD70 IgG1 H chain, S134N (EU), pGLY14149) SEQ ID NO: 54 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYIMHWVRQAPGKGLEWVAVISYDGRNK YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDTDGYDFDYWGQGTLVT VSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPE LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-CD70 IgG1 H chain, G161T (EU), pGLY14150) SEQ ID NO: 55 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYIMHWVRQAPGKGLEWVAVISYDGRNK YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDTDGYDFDYWGQGTLVT VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSTALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (anti-CD70 IgG1 H chain, S134N, G161T (EU), pGLY14151) SEQ ID NO: 56 QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYIMHWVRQAPGKGLEWVAVISYDGRNK YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDTDGYDFDYWGQGTLVT VSSASTKGPSVFPLAPSSKNTSGGTAALGCLVKDYFPEPVTVSWNSTALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTV DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (Protein sequence of Galactose Oxidase from Fusarium graminearum Genbank: P0CS93) SEQ ID NO: 57 MKHLLTLALCFSSINAVAVTVPHKAVGTGIPEGSLQFLSLRASAPIGSAISRNNWAVTCD SAQSGNECNKAIDGNKDTFWHTFYGANGDPKPPHTYTIDMKTTQNVNGLSMLPRQDG NQNGWIGRHEVYLSSDGTNWGSPVASGSWFADSTTKYSNFETRPARYVRLVAITEANG QPWTSIAEINVFQASSYTAPQPGLGRWGPTIDLPIVPAAAAIEPTSGRVLMWSSYRNDAF GGSPGGITLTSSWDPSTGIVSDRTVTVTKHDMFCPGISMDGNGQIVVTGGNDAKKTSLY DSSSDSWIPGPDMQVARGYQSSATMSDGRVFTIGGSWSGGVFEKNGEVYSPSSKTWTSL PNAKVNPMLTADKQGLYRSDNHAWLFGWKKGSVFQAGPSTAMNWYYTSGSGDVKSA GKRQSNRGVAPDAMCGNAVMYDAVKGKILTFGGSPDYQDSDATTNAHIITLGEPGTSP NTVFASNGLYFARTFHTSVVLPDGSTFITGGQRRGIPFEDSTPVFTPEIYVPEQDTFYKQN PNSIVRVYHSISLLLPDGRVFNGGGGLCGDCTTNHFDAQIFTPNYLYNSNGNLATRPKIT RTSTQSVKVGGRITISTDSSISKASLIRYGTATHTVNTDQRRIPLTLTNNGGNSYSFQVPSD SGVALPGYWMLFVMNSAGVPSVASTIRVTQ (Gene sequence of Galactose Oxidase from Fusarium graminearum) SEQ ID NO: 58 ATGGCCGATCAGCAAACGGTCCTTAGTGTATCCGTACCTGGATATATAAGACTGGAA GATATCAGTTGTTCTTCATCTGCCAGTATCACCTTCATTATCTATTCAAGTCACTCTC TCAACTTATTCTTGCCTCTCTCTATGTCAATATGAAACACTTTTTATCACTCGCTCTTT GCTTCAGCAGCATCAATGCTGTTGCTGTCACCGTCCCTCACAAGTCCGGAGGAACTG GAAGTCCTGAAGGGAGTCTTCAGTTCCTGAGTCTTCGGGCCTCAGCACCTATCGGAA GCGCTATTTCTCGCAACAACTGGGCCGTCACTTGCGACAGTGCACAGTCGGGAAATG AATGCAACAAGGCCATCGATGGCAACAAGGATACCTTTTGGCACACATTCTATGGG GCCAATGGAGATCCAAAGCCCCCTCACACATACACGATTGACATGAAGACAACTCA GAATGTCAACGGCTTGTCTATGTTGCCTCGACAGGATGGTAACCAAAACGGCTGGAT CGGTCGCCATGAGGTTTATCTAAGCTCAGATGGCACAAACTGGGGCAGCCCTGTTGC GTCAGGTAGTTGGTTTGCCGACTCTACTACAAAATACTCCAACTTTGAAACTCGCCC TGCTCGCTATGTTCGTCTTGTCGCTGTCACTGAAGCGAATGGCCAGCCTTGGACTAG CATTGCAGAGATCAACGTCTTCCAAGCTAGTTCTTACACAGCCCCTCAGCCTGGCCT TGGCCGCTGGGGTCCGACTATTGACTTGCCGATTGTTCCTGCGGCTGCAGCAATTGA GCCGACATCGGGACGAGTCCTTATGTGGTCTTCGTATCGCAATGATGCATTTGGAGG ATCCCCTGGTGGTATCACTTTGACGTCTTCGTGGGATCCATCCACTGGCATTGTTTCC GACCGCACTGTGACAGTCACCAAGCATGATATGTTCTGCCCTGGTATCTCCATGGAT GGTAACGGTCAGATCGTAGTCACAGGTGGCAACGACGCCAAGAAGACCAGTTTGTA TGATTCATCTAGCGATAGCTGGATCCCGGGACCTGACATGCAAGTGGCTCGTGGGTA TCAGTCATCAGCTACCATGTCAGACGGTCGTGTTTTTACCATTGGAGGCTCCTGGAG CGGTGGCGTATTTGAGAAGAATGGCGAAGTCTATAGCCCATCTTCAAAGACATGGA CGTCCCTACCCAATGCCAAGGTCAACCCAATGTTGACGGCTGACAAGCAAGGATTG TACCGTTCAGACAACCACGCGTGGCTCTTTGGATGGAAGAAGGGTTCGGTGTTCCAA GCGGGACCTAGTACAGCCATGAACTGGTACTATACCAGTGGAAGTGGCGATGTGAA GTCAGCCGGAAAACGCCAGTCTAACCGTGGTGTAGCCCCTGATGCCATGTGCGGAA ACGCTGTCATGTACGACGCCGTTAAAGGAAAGATCCTGACCTTTGGCGGCTCCCCAG ACTATCAAGACTCTGACGCCACAACCAACGCCCACATCATCACCCTCGGTGAACCCG GAACATCTCCCAACACTGTCTTTGCTAGCAATGGCTTGTACTTTGCTCGAACGTTCCA CACCTCTGTTGTTCTTCCAGACGGAAGCACGTTCATTACAGGAGGCCAACGACGTGG AATTCCGTTCGAGGATTCAACCCCGGTATTTACACCTGAGATCTACGTCCCTGAACA AGACACTTTCTACAAGCAGAACCCCAACTCCATTGTTCGCGTCTACCACAGCATTTC CCTTTTGTTACCTGATGGCAGGGTATTTAACGGTGGTGGTGGTCTTTGTGGCGATTGT ACCACGAATCATTTCGACGCGCAAATCTTTACGCCAAACTATCTTTACAATAGCAAC GGCAATCTCGCGACACGTCCCAAGATTACCAGAACCTCTACACAGAGCGTCAAGGT CGGTGGCAGGATCACAATCTCGACGGACTCTTCGATTACAAAGGCGTCGTTGATTCG CTATGGTACAGCGACACACACGGTTAATACTGACCAGCGTCGCATTCCCCTGACTCT GACAAACAATGGAGGAAATAGCTATTCTTTCCAAGTTCCTAGCGACTCTGGTGTTGC TTTGCCTGGCTACTGGATGTTGTTCGTGATGAACTCGGCCGGTGTTCCTAGTGTGGCT TCGACGATTCGCGTTACTCAGTGA

REFERENCES

[0220] Alley S C, Okeley N M, Senter P D. Antibody-drug conjugates: targeted drug delivery for cancer. Curr Opin Chem Biol. 2010 August; 14(4):529-37. doi: 10.1016/j.cbpa.2010.06.170. Epub 2010 Jul. 17. Review. PubMed PMID: 20643572. [0221] Axup J Y, Bajjuri K M, Ritland M, Hutchins B M, Kim C H, Kazane S A, HalderR, Forsyth J S, Santidrian A F, Stafin K, Lu Y, Tran H, Seller A J, Biroc S L, Szydlik A, Pinkstaff J K, Tian F, Sinha S C, Felding-Habermann B, Smider V V, Schultz P G. Synthesis of site-specific antibody-drug conjugates using unnatural amino acids. Proc Natl Acad Sci USA. 2012 Oct. 2; 109(40):16101-6. doi: 10.1073/pnas.1211023109. Epub 2012 Sep. 17. PubMedPMID: 22988081; PubMed Central PMCID: PMC3479532. [0222] Barnard G C, Kull A R, Sharkey N S, Shaikh S S, Rittenhour A M, Burnina I, Jiang Y, Li F, Lynaugh H, Mitchell T, Nett J H, Nylen A, Potgieter T I, Prinz B, Rios S E, Zha D, Sethuraman N, Stadheim T A, Bobrowicz P. High-throughput screening and selection of yeast cell lines expressing monoclonal antibodies. J Ind Microbiol Biotechnol. 2010 September; 37(9):961-71. [0223] Burnina I, Hoyt E, Lynaugh H, Li H, Gong B. A cost-effective plate-based sample preparation for antibody N-glycan analysis. J Chromatogr A. 2013 Sep. 13; 1307:201-6. doi: 10.1016/j.chroma.2013.07.104. Epub 2013 Aug. 2. PubMed PMID: 23932029. [0224] Burris H A. Developments in the use of antibody-drug conjugates. Am Soc Clin Oncol Educ Book. 2013. doi: 10.1200/EdBook_AM.2013.33.e99. PubMed PMID: 23714468. [0225] Butler M, Meneses-Acosta A. Recent advances in technology supporting biopharmaceutical production from mammalian cells. Appl Microbiol Biotechnol. 2012 November; 96(4):885-94. doi: 10.1007/s00253-012-4451-z. Epub 2012 Oct. 5. Review. PubMed PMID: 23053101. [0226] Choi B K, Bobrowicz P, Davidson R C, Hamilton S R, Kung D H, Li H, Miele R G, Nett J H, Wildt S, Gerngross T U. Use of combinatorial genetic libraries to humanize N-linked glycosylation in the yeast Pichia pastoris. Proc Natl Acad Sci USA. 2003 Apr. 29; 100(9):5022-7. Epub 2003 Apr. 17. PubMed PMID: 12702754; PubMed Central PMCID: PMC154291. [0227] Choi B K, Actor J K, Rios S, d'Anjou M, Stadheim T A, Warburton S, Giaccone E, Cukan M, Li H, Kull A, Sharkey N, Gollnick P, Kocieba M, Artym J, Zimecki M, Kruzel M L, Wildt S. Recombinant human lactoferrin expressed in glycoengineered Pichia pastoris: effect of terminal N-acetylneuraminic acid on in vitro secondary humoral immune response. Glycoconj J. 2008 August; 25(6):581-93. doi: 10.1007/s10719-008-9123-y. Epub 2008 Mar. 26. PubMed PMID: 18365311; PubMed Central PMCID. [0228] Cooper J A D, Smith W, Bacila M and heitor M. Galactose Oxidase fromPolyporus circinatus, Fr. J. Biol. Chem. 1959 Mar. 1; 234:445-448. [0229] Cregg J M, Cereghino J L, Shi J, Higgins D R. Recombinant protein expression in Pichia pastoris. Mol Biotechnol. 2000 September; 16(1):23-52. PubMedPPMID: 11098467. [0230] Crisalli P, Kool E T. Water-soluble organocatalysts for hydrazone and oxime formation. J Org Chem. 2013 Feb. 1; 78(3):1184-9. doi: 10.1021/jo302746p. Epub 2013 Jan. 15. PubMed PMID: 23289546; PubMed Central PMCID: PMC3562402. [0231] Lynaugh H, Li H, Gong B. Rapid Fc glycosylation analysis of Fc fusions with IdeS and liquid chromatography mass spectrometry. MAbs. 2013 September-October; 5(5):641-5. doi: 10.4161/mabs.25302. Epub 2013 Jun. 20. PubMedPMID: 23839239. [0232] Flygare J A, Pillow T H, Aristoff P. Antibody-drug conjugates for the treatment of cancer. Chem Biol Drug Des. 2013 January; 81(1):113-21. doi: 10.1111/cbdd.12085. Review. PubMed PMID: 23253133. [0233] Gomathinayagam S, Hoyt E, Thompson A M, Brown E, KaravegK, Hamilton S R, Li H. High-throughput multimodal strong anion exchange purification and N-glycan characterization of endogenous glycoprotein expressed in glycoengineered Pichia pastoris. Methods Mol Biol. 2012; 899:315-23. doi: 10.1007/978-1-61779-921-1_20. PubMedPMID: 22735962. [0234] Hamilton S R, Davidson R C, Sethuraman N, Nett J H, Jiang Y, Rios S, Bobrowicz P, Stadheim T A, Li H, Choi B K, Hopkins D, Wischnewski H, Roser J, Mitchell T, Strawbridge R R, Hoopes J, Wildt S, Gerngross T U. Humanization of yeast to produce complex terminally sialylated glycoproteins. Science. 2006 Sep. 8; 313(5792):1441-3. PubMedPPMID: 16960007. [0235] Hopkins D, Gomathinayagam S, Rittenhour A M, Du M, Hoyt E, Karaveg K, Mitchell T, Nett J H, Sharkey N J, Stadheim T A, Li H, Hamilton S R. Elimination of .beta.-mannose glycan structures in Pichia pastoris. Glycobiology. 2011 December; 21(12):1616-26. doi: 10.1093/glycob/cwrl08. Epub 2011 Aug. 12. [0236] Hossler P, Khattak S F, Li Z J. Optimal and consistent protein glycosylation in mammalian cell culture. Glycobiology. 2009 September; 19(9):936-49. doi: 10.1093/glycob/cwp079. Epub 2009 Jun. 3. Review. PubMed PMID: 19494347. [0237] Jackson D, Atkinson J, Guevara C I, Zhang C, Kery V, Moon S J, Virata C, Yang P, Lowe C, Pinkstaff J, Cho H, Knudsen N, Manibusan A, Tian F, Sun Y, Lu Y, Sellers A, Jia X C, Joseph I, Anand B, Morrison K, Pereira D S, Stover D. In vitro and in vivo evaluation of cysteine and site specific conjugated herceptin antibody-drug conjugates. PLoS One. 2014 Jan. 14; 9(1):e83865. doi: 10.1371/journal.pone.0083865. eCollection 2014. PubMedPMID: 24454709; PubMed Central PMCID: PMC3891645. [0238] Jayasekara P S, Jacobson K A, Rapid synthesis of alkoxyamine hydrochloride derivatives from alkyl bromide and N,N'-di-tert-butoxycarbonylhydroxylamine. Synth. Commun. 2014, Aug. 1, 2014, 44(16): 2344-2347. [0239] Jiang Y, Li F, Zha D, Potgieter T I, Mitchell T, Moore R, Cukan M, Houston-Cummings N R, Nylen A, Drummond J E, McKelvey T W, d'Anjou M, Stadheim T A, Sethuraman N, Li H. Purification process development of a recombinant monoclonal antibody expressed in glycoengineered Pichia pastoris. Protein Expr Purif. 2011 March; 76(1):7-14. doi: 10.1016/j.pep.2010.11.004. Epub 2010 Nov. 11. PubMed PMID: 21074617. [0240] Junutula J R, Raab H, Clark S, Bhakta S, Leipold D D, Weir S, Chen Y, Simpson M, Tsai S P, Dennis M S, Lu Y, Meng Y G, Ng C, Yang J, Lee C C, Duenas E, Gorrell J, Katta V, Kim A, McDorman K, Flagella K, Venook R, Ross S, Spencer S D, Lee Wong W, Lowman H B, Vandlen R, Sliwkowski M X, Scheller R H, Polakis P, Mallet W. Site-specific conjugation of a cytotoxic drug to an antibody improves the therapeutic index. Nat Biotechnol. 2008 August; 26(8):925-32. doi: 10.1038/nbt.1480. Epub 2008 Jul. 20. PubMed PMID: 18641636. [0241] Junutula J R, Flagella K M, Graham R A, Parsons K L, Ha E, Raab H, Bhakta S, Nguyen T, Dugger D L, Li G, Mai E, Lewis Phillips G D, Hiraragi H, Fuji R N, Tibbitts J, Vandlen R, Spencer S D, Scheller R H, Polakis P, Sliwkowski M X. Engineered thio-trastuzumab-DM1 conjugate with an improved therapeutic index to target human epidermal growth factor receptor 2-positive breast cancer. Clin Cancer Res. 2010 Oct. 1; 16(19):4769-78. doi: 10.1158/1078-0432.CCR-10-0987. Epub 2010 Aug. 30. PubMedPMID: 20805300. [0242] Kaneko Y, Nimmerjahn F, Ravetch J V. Anti-inflammatory activity of immunoglobulin G resulting from Fc sialylation. Science. 2006 Aug. 4; 313(5787):670-3. PubMed PMID: 16888140. [0243] Li H, Sethuraman N, Stadheim T A, Zha D, Prinz B, Ballew N, Bobrowicz P, Choi B K, Cook W J, Cukan M, Houston-Cummings N R, Davidson R, Gong B, Hamilton S R, Hoopes J P, Jiang Y, Kim N, Mansfield R, Nett J H, Rios S, Strawbridge R, Wildt S, Gerngross T U. Optimization of humanized IgGs in glycoengineered Pichia pastoris. Nat Biotechnol. 2006 February; 24(2):210-5. Epub 2006 Jan. 22. PubMed PMID: 16429149. [0244] Liu H F, Ma J, Winter C, Bayer R. Recovery and purification process development for monoclonal antibody production. MAbs. 2010 September-October; 2(5):480-99. Epub 2010 Sep. 1. Review. PubMed PMID: 20647768; PubMed Central PMCID: PMC2958570. [0245] Mullard A. Maturing antibody-drug conjugate pipeline hits 30. Nat Rev Drug Discov. 2013 May; 12(5):329-32. doi: 10.1038/nrd4009. Erratum in: Nat Rev Drug Discov. 2013 June; 12(6):483. [0246] Nett J H, Gomathinayagam S, Hamilton S R, Gong B, Davidson R C, Du M, Hopkins D, Mitchell T, Mallem M R, Nylen A, Shaikh S S, Sharkey N, Barnard G C, Copeland V, Liu L, Evers R, Li Y, Gray P M, Lingham R B, Visco D, Forrest G, DeMartino J, Linden T, Potgieter T I, Wildt S, Stadheim T A, d'Anjou M, Li H, Sethuraman N. Optimization of erythropoietin production with controlled glycosylation-PEGylated erythropoietin produced in glycoengineered Pichia pastoris. J Biotechnol. 2012 January; 157(1):198-206. doi: 10.1016/j.jbiotec.2011.11.002. Epub 2011 Nov. 9. PubMed PMID: 22100268. [0247] Nitschke L. CD22 and Siglec-G: B-cell inhibitory receptors with distinct functions. Immunol Rev. 2009 July; 230(1):128-43. doi: 10.1111/j.1600-065X.2009.00801.x. Review. PubMedd PMID: 19594633. [0248] Omasa T, Onitsuka M, Kim W D. Cell engineering and cultivation of chinese hamster ovary (CHO) cells. Curr Pharm Biotechnol. 2010 April; 11(3):233-40. Review. PubMed PMID: 20210750. [0249] Panowski S, Bhakta S, Raab H, Polakis P, Junutula J R. Site-specific antibody drug conjugates for cancer therapy. MAbs. 2014 January-February; 6(1):34-45. doi: 10.4161/mabs.27022. PubMed PMID: 24423619; PubMed Central PMCID: PMC3929453. [0250] Potgieter T I, Cukan M, Drummond J E, Houston-Cummings N R, Jiang Y, Li F, Lynaugh H, Mallem M, McKelvey T W, Mitchell T, Nylen A, Rittenhour A, Stadheim T A, Zha D, d'Anjou M. Production of monoclonal antibodies by glycoengineered Pichia pastoris. J Biotechnol. 2009 Feb. 23; 139(4):318-25. doi: 10.1016/j.jbiotec.2008.12.015. Epub 2008 Dec. 27. PubMed PMID: 19162096. [0251] Prime S, Dearnley J, Ventom A M, Parekh R B, Edge C J. Oligosaccharide sequencing based on exo- and endoglycosidase digestion and liquid chromatographic analysis of the products. J Chromatogr A. 1996 Jan. 12; 720(1-2):263-74. Review. PubMed PMID: 8601195. [0252] Ramya T N, Weerapana E, Cravatt B F, Paulson J C. Glycoproteomics enabled by tagging sialic acid- or galactose-terminated glycans. Glycobiology. 2013 February; 23(2):211-21. Epub 2012 Oct. 15. PubMed PMID: 23070960. [0253] Restelli V, Wang M D, Huzel N, Ethier M, Perreault H, Butler M. The effect of dissolved oxygen on the production and the glycosylation profile of recombinant human erythropoietin produced from CHO cells. Biotechnol Bioeng. 2006 Jun. 20; 94(3):481-94. [0254] Ricart A D, Tolcher A W. Technology insight: cytotoxic drug immunoconjugates for cancer therapy. Nat Clin Pract Oncol. 2007 April; 4(4):245-55. Review. PubMed PMID: 17392715. [0255] Rita Costa A, Elisa Rodrigues M, Henriques M, Azeredo J, Oliveira R. Guidelines to cell engineering for monoclonal antibody production. Eur J Pharm Biopharm. 2010 February; 74(2):127-38. doi: 10.1016/j.ejpb.2009.10.002. Epub 2009 Oct. 22. Review. PubMed PMID: 19853660. [0256] Schirrmann T, Al-Halabi L, Dubel S, Hust M. Production systems for recombinant antibodies. FrontBiosci. 2008 May 1; 13:4576-94. Review. PubMed PMID: 18508530. [0257] Schrama D, Reisfeld R A, Becker J C. Antibody targeted drugs as cancer therapeutics. Nat Rev Drug Discov. 2006 February; 5(2):147-59. Review. PubMedd PMID: 16424916. [0258] Sethuraman N, Stadheim T A. Challenges in therapeutic glycoprotein production. Curr Opin Biotechnol. 2006 August; 17(4):341-6. Epub 2006 Jul. 7. Review. PubMed PMID: 16828275. [0259] Singh Y, Renauder O, Defranco E, Dumy P. Preparation of a multitopic glycopeptide-oligonucleotice conjugate. Org. Lett. 2005 Mar. 31; 7(7): 1359-62. [0260] Su S, Acquilano De, Arumagasamy J, Beeler A B, Eastwood El, Giguere J R, Lan P, Lei X, Min G K, Yeager A R, Zhou Y, Panek J S, Snyder J K, Schaus S E, Porco J A Jr. Convergent synthesis of a complex oxime library using chemical domain shuffling. Org. Lett. 2005 Jun. 23; 7(13):2751-4. [0261] Tian F, Lu Y, Manibusan A, Sellers A, Tran H, Sun Y, Phuong T, Barnett R, Hehli B, Song F, DeGuzman M J, Ensari S, Pinkstaff J K, Sullivan L M, Biroc S L, Cho H, Schultz P G, DiJoseph J, Dougher M, Ma D, Dushin R, Leal M, Tchistiakova L, FeyfantE, Gerber H P, Sapra P. A general approach to site-specific antibody drug conjugates. Proc Natl Acad Sci USA. 2014 Feb. 4; 111(5):1766-71. doi: 10.1073/pnas.1321237111. Epub 2014 Jan. 17. PubMedd PMID: 24443552; PubMed Central PMCID: PMC3918752. [0262] Trimalille T, Autissier L, Rakotonirina M D, Guillaneuf Y, Villard C, Bertin D, Gigmes D, Mabrouk K. Peptide ligation from alkoxyamine based radical addition. Chem. Commun (Camb). 2014 Mar. 14; 50(21): 2744-7 [0263] Tsubata T. Role of inhibitory BCR co-receptors in immunity. Infect Disord Drug Targets. 2012 June; 12(3):181-90. Review. PubMed PMID: 22394175. [0264] Verma S, Miles D, Gianni L, Krop I E, Welslau M, Baselga J, Pegram M, Oh D Y, Dieras V, Guardino E, Fang L, Lu M W, Olsen S, Blackwell K; EMILIA Study Group. Trastuzumab emtansine for HER2-positive advanced breast cancer. N Engl J Med. 2012 Nov. 8; 367(19):1783-91. doi: 10.1056/NEJMoa1209124. Epub 2012 Oct. 1. Erratum in: N Engl J Med. 2013 Jun. 20; 368(25):2442. PubMedPMID: 23020162. [0265] Walsh G. Biopharmaceutical benchmarks 2014. NatBiotechnol. 2014 October; 32(10):992-1000. doi: 10.1038/nbt.3040. PubMedPPMID: 25299917. [0266] Wang, R E, Liu, T, Wang, Y, Cao, Y, Du, J, Luo, X, Deshmukh, V, Kim, C H, Lawson, B R, Tremblay, M S, Young, T S, Kazane, SA, Wang, F and Schultz, P G. JACS. January 2015 (web, communication), "An Immunosuppressive Antibody-Drug Conjugate". [0267] Zhang N, Liu L, Dumitru C D, Cummings N R, Cukan M, Jiang Y, Li Y, Li F, Mitchell T, Mallem M R, Ou Y, Patel R N, Vo K, Wang H, Burnina I, Choi B K, Huber H E, Stadheim T A, Zha D. Glycoengineered Pichia produced anti-HER2 is comparable to trastuzumab in preclinical study. MAbs. 2011 May-June; 3(3):289-98. Epub 2011 May 1. PubMed PMID: 21487242; PubMed Central PMCID: PMC3149709. [0268] Zha D. Glycoengineered Pichia-based expression of monoclonal antibodies. MethodsMol Biol. 2013; 988:31-43. doi: 10.1007/978-1-62703-327-5_3. PubMedPMID: 23475712. [0269] Zhou H, Liu Z G, Sun Z W, Huang Y, Yu W Y. Generation of stable cell lines by site-specific integration of transgenes into engineered Chinese hamster ovary strains using an FLP-FRT system. J Biotechnol. 2010 May 17; 147(2):122-9. doi: 10.1016/j.jbiotec.2010.03.020. Epub 2010 Apr. 3. PubMed PMID: 20371256. [0270] Zimmerman E S, Heibeck T H, Gill A, Li X, Murray C J, Madlansacay M R, Tran C, UterNT, Yin G, Rivers P J, Yam A Y, Wang W D, Steiner A R, Bajad S U, Penta K, Yang W, Hallam T J, Thanos C D, Sato A K. Production of site-specific antibody-drug conjugates using optimized non-natural amino acids in a cell-free expression system. Bioconjug Chem. 2014 Feb. 19; 25(2):351-61. doi: 10.1021/bc400490z.Epub 2014 Jan. 29. PubMedPMID: 24437342.

EXAMPLES

Example 1: Expression of Anti-Her2 with Non-Native N-Glycan-Incorporating Site-Directed Alterations

[0271] The anti-HER2 (trastuzumab) IgG1 H chain and L chain sequences (Seq ID NO: 1 and 2, respectively) were incorporated into a single Zeo.sup.R-marked, TRP2-integrating Pichia pastoris roll-in expression plasmid, each as part of separate AOX1-driven expression cassettes containing the Saccharomyces cerevisiae alpha factor pre signal sequence (Seq ID NO: 3) to generate plasmid pGLY5883 (FIG. 3; SEQ ID NO: 4). Site-directed mutations were then designed based on desirable locations within the H chain. These locations were chosen as sites that would: 1) be within or near loop or where a side chain was solvent exposed to not disrupt an Ig-fold, 2) not be near critical sites related to mAb function (e.g. Ag-binding, FcRN binding, Fc.gamma.R-binding), and 3) be converted to an N-glycan sequon with a minimum of primary sequence modification. Initially 8 sites were chosen to test whether non-native N-glycosylation sites can be efficiently incorporated into an immunoglobulin with a high degree of N-glycan occupancy without disrupting the normal folding or function of the parent antibody. These 8 sites are indicated in Table 1.

[0272] Plasmids pGLY10044-10051, constructed by Genewiz (South Plainfield, N.J.), are derived from plasmid pGLY5883 and differ only by the indicated non-native N-glycosylation site introducing mutations in the anti-HER2 H chain cassette (Table 1) resulting in SEQ ID NO: 4-11.

TABLE-US-00002 TABLE 1 Heavy chain Sequence Sequence Sequence Secreted N-glycan Conjugated protein change change change and folded site is with Plasmid Seq ID (EU) (anti-HER2) (Kabat) mAb? occupied? Fluorophore? pGLY10044 Seq. ID NO: 4 N/A Q112N Q105N Yes Yes No pGLY10045 Seq. ID NO: 5 S134N S137N S130N Yes Yes Yes pGLY10046 Seq. ID NO: 6 G161T G164T G158T Yes Yes Yes pGLY10047 Seq. ID NO: 7 Q175N Q178N Q179N No N/A N/A pGLY10048 Seq. ID NO: 8 N203T N206T N211T Yes Yes Yes pGLY10049 Seq. ID NO: 9 V363T V366T V386T Yes Yes Yes pGLY10050 Seq. ID NO: 10 Q386T Q389T Q414T Yes No N/A pGLY10051 Seq. ID NO: 11 Q438N Q441N Q469N Yes Yes Yes

[0273] Each of these plasmids was transformed into strain YGLY30329, a glycoengineered strain of P. pastoris that has been genetically engineered to produce N-glycans of the human complex type with terminal galactose acid residues (FIG. 1, GS5.0; see also, e.g., Bobrowicz, 2004). Transformations were performed as previously described (Cregg et al, 2000) and clones were selected on YSD (100 yeast extract, 2% soytone, 2% dextrose) agar plates containing 100 .mu.g/ml Zeocin (Life Technologies, Carlsbad, Calif.). Clones were then cultivated in 96 deep well plates (DWP), in BMGY liquid medium, and induced in BMMY containing methanol as a sole carbon source, as previously described (Barnard et al, 2010). Cultures were centrifuged at 2500.times.g for 10 minutes in a Beckman swinging bucket centrifuge and supernatants were subjected to protein A purification (Jiang et al, 2011). The protein A-purified samples were subjected to capillary electrophoresis (CE) using a Caliper GXII (Perkin Elmer, Waltham, Mass.) using the standard HT Protein Express 200 method as detailed previously (Gomathinayagam, 2012). Upon CE analysis, seven of the eight constructs yielded bands consistent with heavy and light chain under reducing conditions and a band consistent with a uniform, well assembled antibody under non-reducing conditions when visualized using the Caliper LabChip GX software version 4.1 (FIG. 4). The clones transformed with plasmid pGLY10047 (Q175N) did not produce any antibody presumably because the additional N-glycosylation site disrupted antibody folding and prevented proper assembly. Thus, even though the engineered sites were carefully chosen to be exposed and not affect antibody folding, there is an empirical aspect to the N-glycan site engineering that was not predicted.

Example 2: Microreactor Cultivation of N-Glycan Site Engineered Anti-Her2 Antibody-Producing Clones

[0274] Representative clones from the seven constructs that yielded fully folded antibody were cultivated in an Applikon (Foster City, Calif.) micro24 5 ml mini-fermenter apparatus. Seed cultures were prepared by inoculating strains from YSD plates to a Whatman 24-well Uniplate (10 ml, natural polypropylene) containing 3.5 ml of 4% BMGY medium (Invitrogen, Carlsbad, Calif.) buffered to pH 6.0 with potassium phosphate buffer. The seed cultures were grown 65-72 hours in a temperature controlled shaker at 24.degree. C. and 650 rpm agitation. 1.0 ml of the 24 well plate grown seed culture and 4.0 ml of 4% BMGY medium was then used to inoculate each well of a Micro24 plate (Type: REG2). 30 ml of Antifoam 204 (1:25 dilution, Sigma Aldrich) was added to each well. The Micro24 was operated in Microaerobic1 mode and the fermentations were controlled at 200% dissolved oxygen, pH at 6.5, temperature at 24.degree. C. and agitation at 800 rpm. The induction phase was initiated upon observance of a dissolved oxygen (DO) spike after the growth phase by adding bolus shots of methanol feed solution (100% [w/w] methanol, 5 mg/l biotin and 12.5 ml/l PTM2 salts), 50p in the morning and 125 .mu.l in the afternoon. After approximately 72 hours of methanol induction, the cell-free culture supernatant was harvested by centrifugation at 2500.times. g in a Beckman swinging bucket centrifuge and subjected to protein A purification by standard methods (Jiang, 2011).

[0275] Antibody was quantified by reverse phase HPLC (Barnard et al, 2010) and also analyzed by capillary electrophoresis as described above, in this case both under non-reduced and reduced conditions. In all cases upon analysis using the Caliper LabChip GX software version 4.1, the selected clones produced protein consistent with well-assembled antibody, and consisting of a single heavy and light chain band in the reducing condition (FIG. 5).

[0276] The protein was further subjected to Quadrapole Time-of-Flight Liquid chromatography/Mass spectrometry (Q-ToF mass spectrometry or Q-ToF LCMS or Q-ToF MS) analysis under reduced conditions as described previously (Lynaugh et al, 2013). Briefly, 5 .mu.l (1 mg/ml) was injected in an Agilent Q-TOF 6520 mass spectrometer. The dual ESI ion source was set as follows: gas temp at 350.degree. C.; drying gas at 13 L/min; nebulizer at 45 psig; fragmentor at 150 V; skimmer at 65 V; Oct1 RF VPP at 750 V; Vcap at 3500 V. Data were analyzed using MassHunter software. Of the seven constructs that were tested, six resulted in proteins where the second engineered N-glycan site was occupied with a glycan in addition to the canonical N-297 site (FIG. 6). The only exception is in panel 5F where only a single N-glycan is added, the Fc N-297 glycan. Therefore it was concluded that the engineered N-glycan site in pGLY10050 (resulting from the Q386T mutation) is not efficiently occupied. The remaining samples resulted in profiles consistent with a majority of the protein being occupied with two N-glycans per H chain (4 N-glycans per mAb), one at N-297 and another at each of the respective engineered sites.

[0277] Therefore, based on this evidence, it is not possible to simply select a site and introduce an Asn-turn sequence through mutagenesis that will lead to a well-folded protein and be efficiently N-glycan occupied.

Example 3: Bioreactor Expression and Purification of Non-Native N-Glycosylation Site Engineered Anti-HER2 Antibody

[0278] Representative clones from the six constructs that yielded fully folded antibody with a well-occupied non-native N-glycosylation site (See Table 1) were cultured in 1 L Fedbatch Pro fermenters (DASGIP Biotools, Shrewsbury, Mass.) using a glycerol fedbatch and methanol induction similarly to what has been described previously (Hopkins, 2011), with the notable difference of using a dissolved oxygen (DO) limited fed-batch induction paradigm. Briefly, inocula derived from yeast patches (isolated from a single colony) on agar plates were cultivated in 0.5 L baffled seed flasks in 0.1 L of 4% BSGY (without maltitol, table 2). Seed flasks were grown at 180 rpm and 24.degree. C. (Innova 44, New Brunswick Scientific) for 48 hours. Bioreactor vessels were charged with 0.6 L of 0.2 .mu.m filtered 4% BSGY media (plus 4 drops/L Sigma 204 antifoam, Table 2) and autoclaved at 121.degree. C. for 45 minutes.

TABLE-US-00003 TABLE 2 Media/Reagent Composition 4% BSGY 40 g/L glycerol, 20 g/L soytone, 10 g/L yeast extract, medium: 11.9 g/L KH2PO4, 2.3 g/L K2HPO4, 50 g/L maltitol, 13.4 g/L YNB with ammonium sulfate without amino acids, 8 mg/L Biotin. PTM2 salts: 0.6 g/L CuSO4--5H2O, 80 mg/L NaI, 1.8 g/L MnSO--4H2O, 20 mg/L H3BO4, 6.5 g/L FeSO4--7H2O, 2.0 g/L ZnCl2, 0.5 g/L CoCl2--6H2O, 0.2 g/L Na2MoO4--2H2O, 0.2 g/L biotin, 5 mL/L H2SO4 (85%)

[0279] After sterilization and cooling, the aeration, agitation, and temperatures were set to 0.7 vvm, 600 rpm, and 24.degree. C. respectively. The pH was adjusted to and controlled at 6.5 using 15% ammonium hydroxide. Inoculation of a prepared bioreactor occurred aseptically with 60 mL from a seed flask. Agitation was ramped to maintain 20% DO saturation. After the initial glycerol charge was consumed, denoted by a sharp increase in the DO, a 50% w/w glycerol solution containing 5 mg/L biotin and 32.3 mg/L PMTi4 was triggered to feed at 7.7 g/L-h for 8 hours. During the glycerol fed-batch phase 0.42 mL of PTM2 salts (Table 2) was injected manually. After completion of the glycerol fed-batch phase, the agitation rate was locked at 600 rpm and a bolus addition of 6.0 g of methanol containing 5 mg/L biotin and 12.5 mL/L PTM2 salts was added. During methanol induction phase the DO remains near 0% until the methanol bolus is entirely consumed. Each time the DO increases to >30% another 6.0 g bolus of the methanol feed solution is added to prolong the induction time. After methanol adaptation, it takes on average 9-10 hours to consume the 1% methanol boluses. Injections of 0.25 mL of 2.1 mg/mL PMTi4 (in methanol) were added each 24 hours of induction time. After 80-90 hours of methanol induction, the cell-free culture supernatant was harvested by centrifugation (Sorvall Evolution RC, Thermo Scientific) at 8500 rpm for 40 minutes and then subjected to small scale protein A purification by standard methods (Jiang, 2011).

[0280] Antibody was quantified by reverse phase TIPLC and calculated on a per liter basis (Barnard et al, 2010). Fermentation titers indicated that the N-glycan sites that were occupied and tolerated by the mAb structure based on small scale expression resulted in no significant alteration in mAb titer at 1 L fermentation scale (Table 3).

TABLE-US-00004 TABLE 3 Sequence mAb liter mAb titer Ferm. 1 L Ferm. change (mg/L) (mg/L) # Sample ID Strain name (EU) HPLC Bradford 1 D133201 YGLY35490 N203T 332 ND 2 D133202* YGLY35491 N203T 499 440 3 D133203* YGLY35492 V363T 569 446 4 D133204 YGLY35493 V363T 279 ND 5 D133205 YGLY35494 V363T 275 ND 6 D133206 YGLY35495 Q438N 488 ND 7 D133207 YGLY35496 Q438N 269 ND 8 D133208* YGLY35497 Q438N 705 569 9 D133401 YGLY35516 Q109N.sup.# 443 ND 10 D133402 YGLY35517 Q109N.sup.# 512 ND 11 D133403 YGLY35518 S134N 276 ND 12 D133404* YGLY35519 S134N 299 253 13 D133405 YGLY35520 G161T 646 ND 14 D133406* YGLY35521 G161T 384 305 15 D133407 YGLY35522 N203T 445 ND 16 D133408 YGLY35523 N203T 393 ND C Anti-HER2 multiple None 509 +/- 54 ND

[0281] The purified antibody was further subjected to capillary electrophoresis and Q-ToF mass spectrometry analysis as outlined above. As with smaller scale cultivation, the selected clones produced protein consistent with well-assembled antibody, and consisting of a single heavy and light chain band in the reducing condition (FIG. 7). Based on reduced Q-T of, the clones selected also yielded a majority of antibody with N-glycans fully occupied at two sites, the N-297 canonical site and the respective engineered non-native N-glycosylation site (FIG. 8A-8C). Some of the additional sites resulted in better N-glycan uniformity than others. For instance, the Q109N site resulted in poor conversion to complex forms with the resulting N-glycans primarily of the hybrid type whereas S134N resulted in predominantly complex terminally galactosylated N-glycans, with the assumption of a mixture of GS4.0, GS4.5 and GS5.0 at the Fc N-297 site based on previous mAb N-glycan analysis (FIG. 8B).

[0282] Larger aliquots (500 ml) of fermentation supernatant were purified by protein A chromatography for one each of the five best mutations (Samples D133202, D133203, D133208, D133404, and D133406, Table 3). The quantification of purified protein as measured by Bradford assay agreed well with the HPLC measurements from supernatant (Table 3). Purified protein was analyzed by Q-ToF and revealed masses that correspond to the expected L chain mass and several clustered masses that corresponded to the expected H chain mass (FIG. 9A). Upon zooming to the H chain mass region on the trace, the predominant H chain mass in each case corresponded to the predicted anti-Her2 H chain with 2 N-glycans one comprised of a GS4.0 glycoform and the other of a GS5.0 glycform (FIG. 9B). Previous analysis of antibodies in the same host strain yielded N-297 canonical Fc N-glycans consisting of primarily GS4.0 with a minority of GS4.5 and GS5.0 glycoforms (Zhang et al, 2011). It was therefore concluded that the additional N-linked site was occupied with predominantly GS5.0 N-glycans. In support of this, sample D133404 was digested with Endoglycosidase S (EndoS, Genovis, Cambridge, Mass.) and subsequently digested with Peptide-N-glycosidase F (PNGase, New England Biolabs, Ipswich, Mass.). The EndoS enzyme will remove the N-297 canonical glycan, cleaving between the core GlcNAc residues, and leave any other mAb glycans intact. N-glycan analysis by MALDI-TOF MS of the EndoS released N-glycans revealed the expected predominant GS4.0 mass (less one GlcNAc which is the core GlcNAc not removed); while Q-ToF analysis of the reduced H chain showed a mass consistent with the H chain containing G2 and GlcNAc (FIG. 10). Moreover, PNGase digestion of the EndoS digested sample and MALDI-TOF MS of the released N-glycans revealed G2 and G2-GlcNAc (the EndoS enzyme, still active in the mixture, can remove a GlcNAc from the released G2 glycan; FIG. 10). Finally, Q-ToF analysis of the EndoS and PNGase digested mAb yielded an expected mass consistent with the deglycosylated H chain (FIG. 10). Taken together these data demonstrate that the additional N-glycosylation site (atN134 in sample D133404) is occupied with a predominant GS5.0 N-glycan while the canonical N-297 glycan is occupied with the expected mixture of predominantly GS4.0 plus a minority of GS4.5 and GS5.0.

Example 4: Antigen Binding of Anti-Her2 Modified Abs with Non-Native N-Glycosylation Sites

[0283] To determine whether incorporation of non-canonical N-glycans into the anti-Her2 mAb sequence impacts binding of the antibody to the Her2 protein, the affinity of purifiedN-glycan modified mAbs was measured by surface plasmon resonance using a Biacore T-100 instrument (GE Healthcare, Little Chalfont, UK). First, a Series S CM5 Chip (GE Healthcare) was immobilized via amine coupling kit (GE Healthcare) to >10000 RU with an anti-human Fc capture antibody kit (GE Healthcare). Purified anti-Her2 antibody protein samples from batches D133202, D133203, D133404, and D133406 along with the commercial (CHO-produced trastuzumab) anti-Her2 were were captured to 30 RU on the active flowcells and no antibody was captured on the reference flowcell. Serially diluted human Her2 ectodomain (Biotang, Lexington, Mass.), ranging in concentration from 50 nMto 0.39 nM, was injected for 5 minutes over all flowcells and dissociation was monitored for 10 minutes. Binding data was double referenced by subtracting the reference flowcell signal and a 0 nM Her2 injection. All of the reagents were prepared in 1.times. HBS-EP+(GE Healthcare, pH7.4) running buffer and the binding measurements were performed on a Biacore T100 at 25.degree. C. All data was fit with 1:1 Binding Model in Biacore T100 Evaluation Software (v2.0.4). Analysis of the binding curves, maximum binding capacity, and affinity, based on a 1:1 binding fit revealed no significant differences between commercial anti-Her2, trastuzumab (FIG. 11, Panel E), and any of the N-glycan modified, glycoengineered Pichia-produced Abs (FIG. 11, Panels A-D)

Example 5: Conjugation of an Activated Fluorophore to Enzymatically Oxidized Terminal Galactose of N-Glycans

[0284] Next, we asked whether N-glycans at non-native N-glycosylation sites on mAbs would be appropriate substrates and locales for chemical conjugation. Galactose oxidase (d-galactose:oxygen 6-oxidoreductase GO; EC 1.1.3.9) fromFusariumgraminarium, aka Dactylium dendroides (Fg GO) is a glycan-modifying enzyme previously shown to oxidize terminal .beta.-1,4-galactose residues in the context of a protein (Cooper et al, 1959). The result of this enzymatic galactose oxidation is a chemically reactive aldehyde group that is receptive to direct conjugation with an alkoxyamine substrate to form a stable oxime bond (Ramya et al, 2013). However, attempts to oxidize and efficiently conjugate to the asialylated complex Fc N-297 glycan of a standard IgG, which typically contains a small but significant amount of terminal .beta.-1,4-linked galactose (20-40% on one arm, 1-10% on both arms), have beenunsuccessful to date; a finding that was recapitulated here with commercial trastuzumab (FIG. 12). Given that the location of this canonical IgG glycan is known to be buried between and closely tethered to the Ig folds of the Fc C.sub.H2 domain, it is likely that steric hindrance prevents either enzyme modification or addition of a conjugate to this N-glycan site. As shown, when mAbs with non-native N-glycosylation sites are produced in a GFI5.0 glycoengineered yeast strain (FIG. 2) the additional non-native N-glycosylation sites are composed predominantly of biantennary terminal .beta.-1,4-linked galactose (FIG. 9). Therefore, we interrogated whether it is possible to enzymatically oxidase and chemically conjugate an activated fluorophore to an antibody via these engineered terminal galactose sugars. In a one-pot reaction method, 200 .mu.g of the purified anti-HER2 antibodies containing extra N-glycans (Table 1) was incubated with 0.45 units of Fg GO (Sigma, St. Louis, Mo.), 800 units of catalase and an aminooxy activated CF633 dye (Biotium, Hayward, Calif.) to a final concentration of 100 .mu.M in 50 mM sodium phosphate buffer at pH 7 and 25.degree. C. in dark conditions for 24 and 48 hours. For the mAb variants that were most efficiently conjugated, the S134N and G161 T mutant anti-HER2 proteins, significant transfer of up to two fluorophore moieties were observed per reduced H chain as determined by Q-ToF, with two per H chain being the expected maximum number of available sites given a theoretical 100% biantennary galactose structure and 100% N-glycan occupancy and no conjugation at the Fe N-297 glycan (FIG. 13).

Example 6: Desialylation and Conjugation of mAbs Containing Sialylated N-Glycans

[0285] For non-native N-glycosylation site containing mAbs produced in GFI6.0 glycoengineered strains (FIG. 2) the N-glycans will be predominantly sialylated and thus resistant to galactose oxidase (which requires a terminal galactose sugar). Therefore, to generate a substrate for enzymatic/chemical conjugation in such a strain, plasmids expressing modified anti-Her2 mAbs containing non-native N-glycosylation sites (pGLY14137 and pGLY14138) were transformed into GFI6.0 strain YGLY36472 and clones were selected on 100 mg/ml zeocin plates. The resulting clones were cultivated in micro24 5 mL bioreactors as described earlier (see Example 2). Selected clones were then cultivated in 1 L Dasgip bioreactors as described (Example 3). The harvested supernatants were purified by protein A chromatography also as referenced (Jiang, 2011). The resulting protein was analyzed by Q-ToF under reducing conditions, which resulted in masses consistent with the intactH chain of the modified anti-Her2 mAb with the expected sialylated N-glycan profile (FIG. 14). The purified protein was subsequently desialylated using Acetyl-neuraminyl hydrolase (neuraminidase, New England Biolab s, Ipswich, Mass.) according to the manufacturer's recommended reaction conditions. The resulting protein was analyzed by Q-ToF under reducing conditions and N-glycans were removed enzymatically by PNGase digestion (New England Biolabs, Ipswich, Mass.) and analyzed quantitatively by HPLC (Burnina, 2012). The results indicated that as expected the sialic acid residues were efficiently removed by the Neuraminidase enzyme leaving predominantly terminal galactose residues (Prime, 1996), which have been shown here and previously to be efficient substrates for the GO enzyme to support oxime ligation.

Example 7: Optimization of Combined Enzymatic/Chemical Conjugation Step

[0286] Conjugation reactions were next carried out with chemical catalysts for the two most receptive acceptor position anti-Her2 muteins (S134N and G161T). Initially, three different catalysts were used: 2-Amino-5-methoxybenzoic acid (AMB), 3,5-diaminobenzoic acid (DAB), and aniline (Crisalli 2013). Both aniline and AMB improved the conjugation efficiency, whereas addition of DAB did not result in increased conjugation. The conjugation reaction was improved most by the presence of 50 mM Aniline which, after 72 h resulted in >90% of the available terminal galactose residues having a fluorophore (FIG. 15). Also, temperature and pH optimization can be applied to the initial reaction to reduce the amount of aniline or time required for complete conjugation (not shown).

[0287] Using these optimized conditions, conjugation reactions were carried out for each of the five purified modified mAbs containing non-native N-glycosylation sites (N206T, V363T, Q438N, S134N, and G161T). The glycan modified antibodies were conjugated with alkoxyamine-modified Alexafluor488 fluorophore (Alexa488, Invitrogen, Claremont, Calif.). Conjugation proceeded highly efficiently for 4 of the 5 with a significant proportion of singly conjugated H chain remaining for the N203T variant. However, even for this protein the plurality of resulting mAb contained two conjugated fluorophores (FIG. 16). For the other four glycan-modified mAbs, the predominant species (>80%) following optimized conjugation was H chain containing two fluorophores, where in each case the maximum number of available sites is two, considering one extra N-glycan per H chain, each containing a predominantly biantennary N-glycan with terminal galactose (FIG. 16). The heterogeneity of peaks observed in the Q-ToF arise from the expected N-glycan profile atthe Fc N-297 site, which typically contains a mixture of GS4.0, GS4.5 and GS5.0 structures with a small amount of hybrid and mannose forms (Zha, 2013).

[0288] The minor conjugation of a 3.sup.rd site observed for three of the glycan modified mAbs (N206T, V363T, and Q438N), can be interpreted based on mass to be conjugation of the N-297 glycan on hybrid galactosylated (GS3.5, FIG. 1) structures. These three protein samples contained a larger degree of such hybrid structures than the S134N and G161T sample preparations. While previous data showed that conjugation was not possible to complex N-glycans at the N-297 site, this result indicates that conjugation can be directed to the N-297 site if the N-glycan is a hybrid structure. This important finding demonstrates that for a mAb produced with exclusively hybrid N-glycoforms at the N-297 site (an outcome that is possible using glycoengineered yeast strain GFI3.5, FIG. 2), conjugation could be performed at this site with a single available site per N-glycan. However, confirming previous results, no conjugation to complex N-glycan structures is observed at the N-297 site, which allows for discrete control over conjugation position if glycosylation microheterogeneity is controlled.

[0289] Taken together, these data demonstrate that nearly quantitative oxime conjugation can be achieved at certain non-native N-glycosylation sites of glycan modified mAbs following enzymatic oxidation of galactose residues to a reactive aldehyde form. Moreover, even under conditions that promote highly efficient conjugation to the desired site, no non-specific oxidation or conjugation is observed. Finally under these conditions, complex N-glycans at the N-297 of the Fc (a modest fraction of which are galactosylated GS4.5 and GS5.0) are not oxidized by the GalOx enzyme, thereby maintaining site-specificity of the conjugation reaction irrespective of the presence of a complex glycan at the canonical N-297 site. Thus, importantly, this glycan-based conjugation is completely compatible with full effector function-enabled antibodies.

Example 8: Scale-Up and Bioanalytical Characterization of Glyco-Conjugated Abs

[0290] The conjugation reaction described in Example 5 (modified by addition of aniline as described in Example 7) was scaled to larger volume using the S134N and G161T modified anti-Her2 mAb sequences. Alkoxyamine-modified Alexa488 and alkoxyamine modified biotin were used as conjugation substrates (100 mM for each) and conjugation reactions were carried out at 25.degree. C. for 72 h. The reaction products were subjected to Q-ToF MS with the results shown in FIG. 17. In each case the DAR was calculated based on the relative abundance of the peaks assigned to the bi-conjugated, mono-conjugated, and unconjugated antibody (FIG. 17).

[0291] The Alexa488 conjugated G161T glycan modified anti-Her2 antibody was also subjected to IdeS (Fabricator, NEB, Ipswich, Mass.) digestion and Q-ToF MS to confirm the location of the conjugated dye. The IdeS digestion was carried out according to the manufacturer's instructions. Upon digestion and MS analysis, it was observed that the two non-native N-glycosylation sites residing on the F(ab').sub.2 were modified with 3-4 Alexa 488 moieties while the Fc-fragment was nearly completely unmodified.

[0292] The same Alexa488 conjugated G161T glycan modified anti-Her2 antibody (FIG. 19) was subjected to size exclusion chromatography (SEC) along with the parental unconjugated G161 T anti-Her2 mAb (FIG. 9B, D133406) and commercial anti-Her2 (Trastuzumab). SEC was performed as previously described (Potgieter et al, 2009). Retention times and peak analysis indicates that the glycan modified anti-Her2 produced in glycoengineered Pichia and the Alexa488 conjugated version retain a minimal propensity for aggregation and in general have a comparable initial stability compared to the commercial control. Thus, the addition of a non-native N-glycosylation sites or conjugation to the glycan does not increase propensity for aggregation or mis-folding of the antibody.

[0293] In order to further probe stability, the glycan-modified antibodies were incubated at 45.degree. C. for 2 weeks in 100 mM sodium phosphate pH 7.0 at a concentration of 5 mg/ml and then subjected to SEC. All samples retained intactness and resisted aggregation except for the G161T modified antibody, which degraded slightly more rapidly at 45.degree. C. than the commercial control or other glycan-modified mAbs (FIG. 20).

Example 9: Covalent Attachment of an Aminooxy Activated GLP-1 Receptor Agonistic Peptide to an Ab Via Glyco-Conjugation

[0294] An aminooxy chemically activated Exendin-4 peptide modified at the gamma amine of the C-terminal Lysine (FIG. 21) was constructed by Biopeptek (Malvern, Pa.). This peptide was conjugated to the purified S134N and G161T modified anti-Her2 Abs using the one-pot combined enzymatic/chemical conjugation procedure illustrated in Examples 5 (with a 100 .mu.M final concentration of peptide and 50 mM aniline). The conjugated peptide was analyzed by Q-ToF MS and shown to be intact and conjugated to a DAR of 3.3 out of a theoretical maximum of 4 potential sites (FIG. 21). The glyco-ADC exendin-4 conjugate was evaluated for its ability to bind and activate the GLP-1 receptor (GLP-1R) using a recombinant Chinese Hamster Ovary (CHO) cell-based assay. A recombinant CHO stable cell line was generated by expression of the serpentine G protein coupled receptor GLP-1R, which induces intracellular cAMP production by native CHO Adenylyl Cyclase via G protein activation. To evaluate glyco-ADC exendin-4 activity, CHO GLP-1R cells were exposed to either glyco-ADC exendin-4 conjugate or native GLP-1 as a control at a range of concentrations. Resulting changes in cAMP levels were determined using the HitHunter cAMP XS+ system (DiscoveRx Corporation, Fremont, Calif.) on a Tecan infinite 200Pro reader. Results were compiled and plotted and EC50 valueswere calculated using Graphpad Prism 5 software. The glyco-ADC exendin-4 conjugate was active with EC50 values ranging from 2-5 fold lower than native GLP-1 peptide (FIG. 21). These data indicate that an active peptide can be conjugated to antibodies at non-native N-glycosylation sites via galactose oxidase and oxime ligation.

Example 10: Conjugation of a Cytotoxic Agent to an Antibody at Non-Native N-Glycosylation Sites

[0295] An aminooxy activated C5-linker containing DM1 (alkoxy-C5-DM1, FIG. 22A) chemically synthesized by Concortis Biosystems (San Diego, Calif.), was conjugated to the S134N and G61T anti-Her2 mAbs using the protocol described in example 5 (with 100 pMDM1 and 50 mM aniline) to generate oxime ligated C5-DM1 conjugated mAbs. The C5-DM1 conjugated mAbs were subjected to Q-ToF MS under reducing conditions and the G161T MS trace is shown as an example (FIG. 22B). For both S134N and G161T C5-DM1 conjugated Abs, masses were observed that are consistent with addition of a single and two C5-DM1 molecules as well as a very small fraction of unconjugated H chain. This is in contrast to the heterogeneity observed in commercial ado-trastuzumab emtansine, which contains from 0-8 DM1 molecules dispersed throughout the H and L chains as evidenced by Q-ToF MS (FIG. 23). This diversity has been demonstrated in other studies to contribute to lower serum stability (PK) and activity (PD) compared to similar but more homogeneous ADCs based on the same mAb scaffold, resulting in better efficacy for the more homogeneous molecule, even with a lower DAR (Jackson, 2014; Tian, 2014; Axup, 2012).

Example 11: Generation of Additional Non-Native N-Glycosylation Site-Modified Antibodies for Site-Specific Glyco-Conjugation

[0296] With the knowledge that combined enzymatic/chemical conjugation can occur efficiently at selected engineered N-glycan sequons a further set of native N-glycosylation sites were constructed by introducing site-directed mutants into an IgG to determine whether these new structurally selected sites would be suitable substrates for 1) efficient addition of N-glycans and 2) conjugation of cargo. A list of mutations that were constructed and the associated sequence references is found in Table 4.

TABLE-US-00005 TABLE 4 Plasmid Mutation Mutation Mutation H chain name (EU numbering) (Herceptin numbering) (Kabat numbering) Sequence pGLY14120 N/A S120N S113N SEQ ID NO: 12 pGLY14121 A118N A121N A114N SEQ ID NO: 13 pGLY14122 S132N S135N S128M SEQ ID NO: 14 pGLY14123 K133N K136N K129N SEQ ID NO: 15 pGLY14124 A162N A165N A165N SEQ ID NO: 16 pGLY14125 T195N T198N T200N SEQ ID NO: 17 pGLY14126 K210T K213T K218T SEQ ID NO: 18 pGLY14127 Y391T Y394T Y419T SEQ ID NO: 19 pGLY14128 F423T F426T F454T SEQ ID NO: 20 pGLY14129 Y436T Y439T Y467T SEQ ID NO: 21 pGLY14130 L193N L196N L198N SEQ ID NO: 22 pGLY14131 Q419N/N421T Q422N/N424T Q450N/N452T SEQ ID NO: 23 pGLY14132 S176N/G178T S179N/G181T S180N/G183T SEQ ID NO: 24 pGLY14133 S191N/L193T S194N/L196T S196N/L198T SEQ ID NO: 25 pGLY14134 G194N/Q196T G197N/Q199T G199N/Q203T SEQ ID NO: 26

[0297] Notably, at some sites more than a single mutation was required to generate an efficient predicted NXS/T (where X is not Pro) sequon. Mutations were introduced into the anti-Her2 IgG1 mAb sequence in plasmid pGLY5883 (FIG. 3), generating plasmids pGLY14120-pGLY14134, containing the AOX1 promoter and Zeocin resistance cassette. The new anti-HER2 N-glycan mutein expressing plasmids were transformed into glycoengineered Pichia strain YGLY30329 by electroporation and clones were selected on medium containing 100 .mu.g/mL and 300 .mu.g/mL Zeocin. Isolated clones were screened for expression by 96 well plate cultivation as described (Example 1 and Barnard, 2010). Clones demonstrated to express mAb were then cultivated in microreactors as described (Example 2). The supernatant was harvested and the produced antibody from these clones was purified by protein A (Jiang et al, 2011). The purified protein was analyzed by Q-ToF MS and the results are shown in FIGS. 24A and 24B. In each case the L chain is the same and was observed as expected (data not shown). The MS traces are zoomed to show the region where the expected H chain masses would reside. The expected mass range for a naked H chain, a H chain with a single N-glycan, and a H chain with two N-glycans is indicated (masses vary slightly due to the mutations introduced). For all Abs shown the predominant peaks observed correspond to H chains with 2 N-linked glycans (the N-297 glycan plus one other glycan at a different location in each case) with the masses varying slightly due to amino acid changes for the introduced mutations and glycan microheterogeneity (FIGS. 24A and 24B). Thus, based on knowledge gained in the first round on mutagenesis, mutations can be selected to add glycans at locations where the glycan will be transferred efficiently and the protein folded and secreted.

Example 12: Generation of Abs with Multiple Non-Native N-Glycosylation Sites

[0298] The S134N and G161T mutations provide two efficient N-glycan sites for conjugation (N134 and N159). We next sought to determine if these sites could be combined on the same antibody scaffold to generate an ADC with a DAR:8 at specific sites of conjugation. The S134N mutated anti-Her2 antibody was mutated to incorporate G161T or G161S mutations. The resulting plasmids (pGLY14135 and pGLY14136) were transformed into strain YGLY30329 as described in Example 2. Two resulting clones of each were cultivated in Dasgip 1 L fermenters as described in Example 3. The fermentation supernatant was purified by protein A chromatography and the resulting protein subjected to Q-ToF analysis. Both the S134N/G161T and S134N/G161S double mutein containing mAbs were efficiently glycosylated at 3 sites on each reduced H chain (N134, N159, and N297) with minimal residual singly or doubly glycosylated protein (FIG. 25).

[0299] Given that Abs can be produced accommodating two N-glycan sites and the glycoengineered yeast system can modify these sites efficiently to terminal galactose (Illustrated in FIGS. 26A and 26B), we sought to determine how many N-glycans could be added to a structure, for example, to maximize DAR. To accomplish this, a series of sites were chosen to combine that would each be in disparate loops of the same antibody sequence. Between four and ten extra N-glycan sites were introduced by site directed mutagenesis (Illustrated in FIG. 26C) into an engineered version of the anti-Her2 (trastuzumab) sequence, deemed null-HER2, that has been mutated to eliminate Her2 antigen binding by mutation of two residues in the variable region (one each in the VH and VL, See SEQ ID 29 and 30, respectively).

[0300] Plasmids pGLYl4172-14179, constructed by Genewiz (South Plainfield, N.J.), contain the null-Her2 H and L chain sequences as derived from pGLY11576 (FIG. 27), and are each modified only by introduction of the mutations as illustrated in Table 5.

TABLE-US-00006 TABLE 5 Plasmid Mutation Mutation Mutation H chain name (EU numbering) (Herceptin numbering) (Kabat numbering) Sequence pGLY14172 S134N, G161T, N203T S137, G164T, N206T S130N, G158T, N211T SEQ ID NO: 34 pGLY14173 N/A, N/A, S134N, K30T, Y57T, S137N, K30T, Y56T, S137N, SEQ ID NO: 35 G161T G164T G164T pGLY14174 N/A, N/A, S134N, K30T, K65N/R67T, K30T, K64N/R66T, SEQ ID NO: 36 G161T S137N, G164T S130N, G158T pGLY14175 N/A, N/A, S134N, Y57T, K65N/R67T, Y56T, K64N/R66T, SEQ ID NO: 37 G161T, N203T S137N, G164T, N206T S130N, G158T, N211T pGLY14176 N/A, S134N, G161T, Y57T, S137N, G164T, Y56T, S130N, G158T, SEQ ID NO: 38 S176N/G178T, N203T S179N/G181T, N206T S180N/G183T, N211T pGLY14177 N/A, N/A, N/A, S134N, K30T, Y57T, K65N/R67T, K30T, Y56T, K64N/R66T, SEQ ID NO: 39 G161T, N203T S137N, G164T, N206T S130N, G158T, N211T PGLY14178 N/A, N/A, N/A S134N, K30T, Y57T, K65N/R67T, K30T, Y56T, K64N/R66T, SEQ ID NO: 40 G161T, S176N/G178T, S137N, G164T, S130N, G158T, N203T, V363T, K392T, S179N/G181T, N206T, S180N/G183T, N211T, F423T V366T, K395T, F246T V386T, K420T, F454T pGLY14179 N/A, N/A, N/A, S134N, K30T, Y57T, K65N/R67T, K30T, Y56T, K64N/R66T, SEQ ID NO: 41 G161T, L193N, N203T, S137N, G164T, L196T, S130N, G158T, L198N, V363T, K392T, F423T N206T, V366T, K395T, N211T, V386T, K420T, F426T F454T

[0301] Each of these plasmids was transformed into strain YGLY30329 and clones were selected and screened for secretion of antibody in 96 DWP format as described in Example 1. Following this, several positive clones were cultivated in 5 ml micro24 reactors and the supernatants were harvested by centrifugation and purified by protein A chromatography as described in example 2 above. The purified samples were subjected to capillary electrophoresis (CE) on a Labchip GXII instrument (Caliper Life Sciences, Hopkinton, Mass.) using the standard HT Protein Express 200 method as described (Gomathinayagam, 2012). From this analysis it was possible to conclude that most of the additional N-glycosylation sites were indeed occupied due to the shifts in migration. To illustrate this, a single representative purified non-reduced CE sample from each of the plasmids was displayed using the Labchip GXII visualization software version 4.1 (FIG. 26D). Moreover, these samples were subjected to enzymatic N-glycan removal by PNGase digestion and MALDI-TOF MS of the free N-glycans as previously described (Choi, 2003). Most of the clones revealed a predominant mass at 1660 or 1676 (Na or K adducts), identified to be the biantennary terminally galactosylated human complex N-glycan Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 (FIG. 2, GS5.0). A representative sample from a clone resulting from introduction of pGLY14179 into YGLY30329 is shown in FIG. 26E. The mAb expressed in this strain contains a total of 22 N-glycosylation sites (11 per H chain). It can also been observed in these non-reducing samples that mAb assembly is of high integrity with mostly a single species observed in each case. Poorly assembled mAb would often result in poor resolution in CE under non-reducing conditions.

[0302] Several clones from strain YGLY30329 expressing plasmids pGLY14172-14179 were cultivated in Dasgip IL fermenters as described in Example 3 above. Following around 80-90 h of methanol induction, supernatants were harvested by centrifugation and purified by standard protein A chromatography (Example 3 above and Jiang, 2011). The purified Abs from these strains were then subjected to Q-ToF MS under reducing conditions (see example 2 above). The results, illustrated in FIGS. 28A and 28B, reveal again that the non-native N-glycosylation sites are occupied in each of the newly constructed antibody sequences. Here, with precise mass identification, it can be determined that in each case at least the majority of the antibody contains the number of N-glycans as engineered. Inmost cases there is very little evidence of reduced occupancy at any of the sites. Moreover, it can also be observed that in most cases a single peak is predominantly visible, corresponding to a mass of the H chain plus the corresponding number of N-glycans with the GS5.0 structure (FIG. 2). Importantly, this indicates that the Abs in each case are able to be occupied with a specified number of N-glycans at preselected sites, properly assembled in the ER, and fully glycan matured in the Golgi with high integrity, all of which is required for the desired substrate for efficient conjugation.

Example 13: Highly Sialylated mAbs

[0303] In addition to generating highly glycan-modified Abs with terminal galactose for conjugation purposes, it could be desirable to produce antibodies with a high degree of sialylation in the same manner. Such Abs could be used for conjugation by chemical modification of the sialic acid residues (Ramya, 2013).

[0304] To generate mAbs with a high degree of sialylation, the plasmids illustrated in Example 12 (see table 5) were transformed into Glycoengineered Pichia strain YGLY36472 capable of modifying secreted proteins with the biantennary sialylated human N-glycan (see, e.g., Hamilton, 2006; FIG. 2, GS6.0). Clones were selected and screened for secretion of antibody in 96 DWP format as described in Example 1. Supernatants from these 96 DWP cultures were harvested by centrifugation at 2500.times.g in a Beckman swinging bucket centrifuge and purified by protein A chromatography as described previously (Barnard, 2010). The purified samples were subjected to non-reducing CE analysis on a Labchip GXII instrument (Caliper Life Sciences, Hopkinton, Mass.) using the standard HT Protein Express 200 method as described (Gomathinayagam, 2012). As illustrated in FIGS. 29A and 29B using the Labchip GX gel image software version 4.1, it can be concluded that most of the additional N-glycosylation sites were indeed occupied due to the shifts in migration. Moreover, it can also be observed in these non-reduced samples that the assembly, while somewhat clone- and plasmid-dependent is very robust overall with generally a single predominant band in each lane as illustrated by (FIGS. 29A and B). Moreover, when the N-glycans from these Abs were released and analyzed by MALDI-TOF as described (Choi, 2003). The predominant N-glycan observed in most clones was consistent with NANA.sub.2Gal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 (FIG. 2, GS6.0) based on mass with the 2.sup.nd most predominant species being NANAGal.sub.2GlcNAc.sub.2Man.sub.3GlcNAc.sub.2. A representative MALDI-TOF MS trace from a clone resulting from introducing plasmid pGLYl4179 into strain YGLY36472 is depicted in FIG. 30. Moreover, the purified intact Abs from these strains were subjected to Q-ToF MS under reducing conditions (see example 2 above). The results, illustrated in FIGS. 31A, 31B, 31C, and 31D, reveal that the non-native N-glycosylation sites are occupied in each of the constructed antibody sequences in GS6.0 strains similar to in GS5.0 strains. Here, with precise mass identification, it can be determined that in each case at vast the majority of the antibody contains the number of N-glycans as engineered. In most cases there is very little evidence of reduced occupancy at any of the sites. Moreover, it can also be observed that in most cases a single peak is predominantly visible, corresponding to a mass of the H chain plus the corresponding number of N-glycans with the GS6.0 structure (FIG. 2), indicating that antibodies modified with non-native N-glycosylation sites can be expressed efficiently in GS6.0 strains and are suitable for conjugation by the methods described herein.

Example 14: Generation of Additional Abs with Non-Native N-Glycosylation Sites

[0305] To assure that the efficient modification of the anti-HER2 antibody with non-canonical N-glycans is not restricted to the anti-HER2 sequence we modified additional mAb sequences with different antigen-binding Fab regions. A pair (H and L) of variable domain sequences directed against the murine Programmed Cell Death 1 (PD-1) ligand was constructed as a human IgG1 chimera (Seq ID 42 and 43). This chimeric mAb sequence was further modified to incorporate the S134N (EU, Seq ID 44) or G161T (EU, Seq ID 45) mutations, which each add one additional N-glycan to the CHi domain or the combined S137N/G161T mutations (EU, Seq ID 46), which adds two additional N-glycans per H chain. The original anti-mPD-1 H chain sequence (pGLY13649, FIG. 32) was modified using site-directed mutagenesis by Genewiz (South Plainfield, N.J.) to generate plasmids pGLY14163 (S134N), pGLY14164 (G161 T), and pGLY14165 (S134N/G161T). These plasmids were transformed into strain YGLY30329 and clones were selected and screened for mAb secretion as described in Examples 1 and 2 above. Clones deemed to be expressing antibody were then cultivated in 1 L Dasgip fermenters as described in Example 3 above. The fermentation supernatant was purified by protein A chromatography and the resulting protein subjected to Q-ToF analysis. Each of the S134N, and G161T single mutein mAbs was efficiently glycosylated at 3 sites on each reduced H chain, the canonical N-297 site, a variable chain site that was part of the anti-PD-1 CDR sequence, and the non-native N-glycosylation (either N134 orN159) site with a majority of GS5.0 biantennary terminally galactosylated N-glycans atboth the CDR N-glycan and at the non-native site and a mixture of GS4.0, GS4.5 and GS5.0 N-glycans at the N-297 site (FIG. 33). Similarly, the S134N/G161T double mutein containing mAbs were efficiently glycosylated at 4 sites on each reduced H chain (FIG. 33).

[0306] In addition to the anti-mPD-1 Ab sequence, an anti-CS1 Ab sequence H chain and L chain (Zha 2013, Seq ID 47 and Seq ID 48, respectively) was modified to incorporate the same sets of mutations, S134N (EU, Seq ID 49), G161T (EU, Seq ID 50), and the double mutant S134N/G161T (EU, Seq ID 51). The original anti-CS-1 H chain sequence (pGLY8040, FIG. 34) was modified using site-directed mutagenesis by Genewiz (South Plainfield, N.J.) to generate plasmids pGLY14157 (S134N), pGLY14158 (G161T), andpGLYl4159 (S134N/G161T). These plasmids were transformed into strain YGLY30329 and clones were selected and screened for mAb secretion as described in Examples 1 and 2 above. Clones deemed to be expressing antibody were then cultivated in 1 L Dasgip fermenters as described in Example 3 above. The fermentation supernatant was purified by protein A chromatography and the resulting protein subjected to Q-ToF analysis. Each of the S134N, and G161T single mutein mAbs was efficiently glycosylated at 2 sites on each reduced H chain, the canonical N-297 site, and the non-canonical (either N134 orN159) site with a majority of GS5.0 biantennary terminally galactosylated N-glycans at the non-canonical site and a mixture of GS4.0, GS4.5 and GS5.0N-glycans at the N-297 site (FIG. 35). Similarly, the S134N/G161T double mutein containing mAbs were efficiently glycosylated at 3 sites on each reduced H chain (FIG. 35).

[0307] Finally, a previously published anti-CD70 antibody sequence (Coccia, USapp 2010/0150950 A1) was modified to incorporate the same sets of mutations, S134N (EU), G161T (EU), and the double mutant (S134N/G161T). The anti-CD70 VH and VL sequences (Seq ID 52 and 53, respectively) were synthesized and constructed by Genewiz (South Plainfield, N.J.) in a human IgG1 frameworkby cloning into plasmid pGLY5730 (FIG. 36) to generate a P. pastoris IgG1 anti-CD70 expression plasmid named pGLY14148. This plasmid was then further modified to incorporate three sets of N-glycan site-generating muteins to generate plasmids pGLYl4149 (S134N, Seq ID 54), pGLYl4150 (G161T, Seq ID 55), and pGLYl4151 (S134N/G161T, Seq ID 56). These plasmids were transformed into strain YGLY30329 and clones were selected and screened for mAb secretion as described in Examples 1 and 2 above. Clones deemed to be expressing antibody were then cultivated in 1 L Dasgip fermenters as described in Example 3 above. The fermentation supernatant was purified by protein A chromatography and the resulting protein subjected to Q-ToF analysis. Each of the S134N, and G161T single mutein mAbs was efficiently glycosylated at 2 sites on each reduced H chain, the canonical N-297 site, and the non-canonical (either N134 or N159) site with a majority of GS5.0 biantennary terminally galactosylated N-glycans at the non-canonical site and a mixture of GS4.0, GS4.5 and GS5.0 N-glycans at the N-297 site (FIG. 37). Similarly, the S134N/G161T double mutein containing mAbs were efficiently glycosylated at 3 sites on each reduced H chain (FIG. 37).

Sequence CWU 1

1

581449PRTArtificial Sequenceimmunoglobulin chain 1Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn Thr Ala Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr Trp Gly Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val 115 120 125Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala 130 135 140Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser145 150 155 160Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val 165 170 175Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro 180 185 190Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys 195 200 205Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp 210 215 220Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly225 230 235 240Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile 245 250 255Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu 260 265 270Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His 275 280 285Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg 290 295 300Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys305 310 315 320Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu 325 330 335Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr 340 345 350Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu 355 360 365Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp 370 375 380Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val385 390 395 400Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp 405 410 415Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His 420 425 430Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro 435 440 445Gly2214PRTArtificial Sequenceimmunoglobulin chain 2Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Asp Val Asn Thr Ala 20 25 30Val Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Ser Ala Ser Phe Leu Tyr Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Arg Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln His Tyr Thr Thr Pro Pro 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala 100 105 110Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120 125Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150 155 160Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165 170 175Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr 180 185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser 195 200 205Phe Asn Arg Gly Glu Cys 210310216DNAArtificial Sequenceimmunoglobulin chain 3tcgcgcgttt cggtgatgac ggtgaaaacc tctgacacat gcagctcccg gagacggtca 60cagcttgtct gtaagcggat gccgggagca gacaagcccg tcagggcgcg tcagcgggtg 120ttggcgggtg tcggggctgg cttaactatg cggcatcaga gcagattgta ctgagagtgc 180accatatgcg gtgtgaaata ccgcacagat gcgtaaggag aaaataccgc atcaggcgcc 240attcgccatt caggctgcgc aactgttggg aagggcgatc ggtgcgggcc tcttcgctat 300tacgccagct ggcgaaaggg ggatgtgctg caaggcgatt aagttgggta acgccagggt 360tttcccagtc acgacgttgt aaaacgacgg ccagtgaatt gagatctaac atccaaagac 420gaaaggttga atgaaacctt tttgccatcc gacatccaca ggtccattct cacacataag 480tgccaaacgc aacaggaggg gatacactag cagcagaccg ttgcaaacgc aggacctcca 540ctcctcttct cctcaacacc cacttttgcc atcgaaaaac cagcccagtt attgggcttg 600attggagctc gctcattcca attccttcta ttaggctact aacaccatga ctttattagc 660ctgtctatcc tggcccccct ggcgaggttc atgtttgttt atttccgaat gcaacaagct 720ccgcattaca cccgaacatc actccagatg agggctttct gagtgtgggg tcaaatagtt 780tcatgttccc caaatggccc aaaactgaca gtttaaacgc tgtcttggaa cctaatatga 840caaaagcgtg atctcatcca agatgaacta agtttggttc gttgaaatgc taacggccag 900ttggtcaaaa agaaacttcc aaaagtcggc ataccgtttg tcttgtttgg tattgattga 960cgaatgctca aaaataatct cattaatgct tagcgcagtc tctctatcgc ttctgaaccc 1020cggtgcacct gtgccgaaac gcaaatgggg aaacacccgc tttttggatg attatgcatt 1080gtctccacat tgtatgcttc caagattctg gtgggaatac tgctgatagc ctaacgttca 1140tgatcaaaat ttaactgttc taacccctac ttgacagcaa tatataaaca gaaggaagct 1200gccctgtctt aaaccttttt ttttatcatc attattagct tactttcata attgcgactg 1260gttccaattg acaagctttt gattttaacg acttttaacg acaacttgag aagatcaaaa 1320aacaactaat tattcgaaac ggaattcgaa acgatgagat tcccatccat cttcactgct 1380gttttgttcg ctgcttcttc tgctttggct gaggttcagt tggttgaatc tggaggagga 1440ttggttcaac ctggtggttc tttgagattg tcctgtgctg cttccggttt caacatcaag 1500gacacttaca tccactgggt tagacaagct ccaggaaagg gattggagtg ggttgctaga 1560atctacccaa ctaacggtta cacaagatac gctgactccg ttaagggaag attcactatc 1620tctgctgaca cttccaagaa cactgcttac ttgcagatga actccttgag agctgaggat 1680actgctgttt actactgttc cagatggggt ggtgatggtt tctacgctat ggactactgg 1740ggtcaaggaa ctttggttac tgtttcctcc gcttctacta agggaccatc tgttttccca 1800ttggctccat cttctaagtc tacttccggt ggtactgctg ctttgggatg tttggttaaa 1860gactacttcc cagagccagt tactgtttct tggaactccg gtgctttgac ttctggtgtt 1920cacactttcc cagctgtttt gcaatcttcc ggtttgtact ctttgtcctc cgttgttact 1980gttccatcct cttccttggg tactcagact tacatctgta acgttaacca caagccatcc 2040aacactaagg ttgacaagaa ggttgagcca aagtcctgtg acaagacaca tacttgtcca 2100ccatgtccag ctccagaatt gttgggtggt ccatccgttt tcttgttccc accaaagcca 2160aaggacactt tgatgatctc cagaactcca gaggttacat gtgttgttgt tgacgtttct 2220cacgaggacc cagaggttaa gttcaactgg tacgttgacg gtgttgaagt tcacaacgct 2280aagactaagc caagagaaga gcagtacaac tccacttaca gagttgtttc cgttttgact 2340gttttgcacc aggactggtt gaacggtaaa gaatacaagt gtaaggtttc caacaaggct 2400ttgccagctc caatcgaaaa gactatctcc aaggctaagg gtcaaccaag agagccacag 2460gtttacactt tgccaccatc cagagaagag atgactaaga accaggtttc cttgacttgt 2520ttggttaaag gattctaccc atccgacatt gctgttgagt gggaatctaa cggtcaacca 2580gagaacaact acaagactac tccaccagtt ttggattctg atggttcctt cttcttgtac 2640tccaagttga ctgttgacaa gtccagatgg caacagggta acgttttctc ctgttccgtt 2700atgcatgagg ctttgcacaa ccactacact caaaagtcct tgtctttgtc ccctggttaa 2760tgaggccggc catttaaata caggcccctt ttcctttgtc gatatcatgt aattagttat 2820gtcacgctta cattcacgcc ctcctcccac atccgctcta accgaaaagg aaggagttag 2880acaacctgaa gtctaggtcc ctatttattt tttttaatag ttatgttagt attaagaacg 2940ttatttatat ttcaaatttt tctttttttt ctgtacaaac gcgtgtacgc atgtaacatt 3000atactgaaaa ccttgcttga gaaggttttg ggacgctcga aggctttaat ttgcaagctg 3060gatctaacat ccaaagacga aaggttgaat gaaacctttt tgccatccga catccacagg 3120tccattctca cacataagtg ccaaacgcaa caggagggga tacactagca gcagaccgtt 3180gcaaacgcag gacctccact cctcttctcc tcaacaccca cttttgccat cgaaaaacca 3240gcccagttat tgggcttgat tggagctcgc tcattccaat tccttctatt aggctactaa 3300caccatgact ttattagcct gtctatcctg gcccccctgg cgaggttcat gtttgtttat 3360ttccgaatgc aacaagctcc gcattacacc cgaacatcac tccagatgag ggctttctga 3420gtgtggggtc aaatagtttc atgttcccca aatggcccaa aactgacagt ttaaacgctg 3480tcttggaacc taatatgaca aaagcgtgat ctcatccaag atgaactaag tttggttcgt 3540tgaaatgcta acggccagtt ggtcaaaaag aaacttccaa aagtcggcat accgtttgtc 3600ttgtttggta ttgattgacg aatgctcaaa aataatctca ttaatgctta gcgcagtctc 3660tctatcgctt ctgaaccccg gtgcacctgt gccgaaacgc aaatggggaa acacccgctt 3720tttggatgat tatgcattgt ctccacattg tatgcttcca agattctggt gggaatactg 3780ctgatagcct aacgttcatg atcaaaattt aactgttcta acccctactt gacagcaata 3840tataaacaga aggaagctgc cctgtcttaa accttttttt ttatcatcat tattagctta 3900ctttcataat tgcgactggt tccaattgac aagcttttga ttttaacgac ttttaacgac 3960aacttgagaa gatcaaaaaa caactaatta ttcgaaacgg aattcgaaac gatgagattc 4020ccatccatct tcactgctgt tttgttcgct gcttcttctg ctttggctga catccaaatg 4080actcaatccc catcttcttt gtctgcttcc gttggtgaca gagttactat cacttgtaga 4140gcttcccagg acgttaatac tgctgttgct tggtatcaac agaagccagg aaaggctcca 4200aagttgttga tctactccgc ttccttcttg tactctggtg ttccatccag attctctggt 4260tccagatccg gtactgactt cactttgact atctcctcct tgcaaccaga agatttcgct 4320acttactact gtcagcagca ctacactact ccaccaactt tcggacaggg tactaaggtt 4380gagatcaaga gaactgttgc tgctccatcc gttttcattt tcccaccatc cgacgaacag 4440ttgaagtctg gtacagcttc cgttgtttgt ttgttgaaca acttctaccc aagagaggct 4500aaggttcagt ggaaggttga caacgctttg caatccggta actcccaaga atccgttact 4560gagcaagact ctaaggactc cacttactcc ttgtcctcca ctttgacttt gtccaaggct 4620gattacgaga agcacaaggt ttacgcttgt gaggttacac atcagggttt gtcctcccca 4680gttactaagt ccttcaacag aggagagtgt taatagggcc ggccatttaa atacaggccc 4740cttttccttt gtcgatatca tgtaattagt tatgtcacgc ttacattcac gccctcctcc 4800cacatccgct ctaaccgaaa aggaaggagt tagacaacct gaagtctagg tccctattta 4860ttttttttaa tagttatgtt agtattaaga acgttattta tatttcaaat ttttcttttt 4920tttctgtaca aacgcgtgta cgcatgtaac attatactga aaaccttgct tgagaaggtt 4980ttgggacgct cgaaggcttt aatttgcaag ctggatccgc ggccgcttac gcgccgatcc 5040cccacacacc atagcttcaa aatgtttcta ctcctttttt actcttccag attttctcgg 5100actccgcgca tcgccgtacc acttcaaaac acccaagcac agcatactaa atttcccctc 5160tttcttcctc tagggtgtcg ttaattaccc gtactaaagg tttggaaaag aaaaaagaga 5220ccgcctcgtt tctttttctt cgtcgaaaaa ggcaataaaa atttttatca cgtttctttt 5280tcttgaaaat tttttttttt gatttttttc tctttcgatg acctcccatt gatatttaag 5340ttaataaacg gtcttcaatt tctcaagttt cagtttcatt tttcttgttc tattacaact 5400ttttttactt cttgctcatt agaaagaaag catagcaatc taatctaagt tttaattaca 5460aattaattaa tggccaagtt gaccagtgcc gttccggtgc tcaccgcgcg cgacgtcgcc 5520ggagcggtcg agttctggac cgaccggctc gggttctccc gggacttcgt ggaggacgac 5580ttcgccggtg tggtccggga cgacgtgacc ctgttcatca gcgcggtcca ggaccaggtg 5640gtgccggaca acaccctggc ctgggtgtgg gtgcgcggcc tggacgagct gtacgccgag 5700tggtcggagg tcgtgtccac gaacttccgg gacgcctccg ggcctgccat gaccgagatc 5760ggcgagcagc cgtgggggcg ggagttcgcc ctgcgcgacc cggccggcaa ctgcgtgcac 5820ttcgtggccg aggagcagga ctgattaatt aacaggcccc ttttcctttg tcgatatcat 5880gtaattagtt atgtcacgct tacattcacg ccctcctccc acatccgctc taaccgaaaa 5940ggaaggagtt agacaacctg aagtctaggt ccctatttat tttttttaat agttatgtta 6000gtattaagaa cgttatttat atttcaaatt tttctttttt ttctgtacaa acgcgtgtac 6060gcatgtaaca ttatactgaa aaccttgctt gagaaggttt tgggacgctc gaaggcttta 6120atttgcaagc tgcggcctaa ggcgcgccag gccataatgg ccaaacggtt tctcaattac 6180tatatactac taaccattta cctgtagcgt atttcttttc cctcttcgcg aaagctcaag 6240ggcatcttct tgactcatga aaaatatctg gatttcttct gacagatcat cacccttgag 6300cccaactctc tagcctatga gtgtaagtga tagtcatctt gcaacagatt attttggaac 6360gcaactaaca aagcagatac acccttcagc agaatccttt ctggatattg tgaagaatga 6420tcgccaaagt cacagtcctg agacagttcc taatctttac cccatttaca agttcatcca 6480atcagacttc ttaacgcctc atctggctta tatcaagctt accaacagtt cagaaactcc 6540cagtccaagt ttcttgcttg aaagtgcgaa gaatggtgac accgttgaca ggtacacctt 6600tatgggacat tcccccagaa aaataatcaa gactgggcct ttagagggtg ctgaagttga 6660ccccttggtg cttctggaaa aagaactgaa gggcaccaga caagcgcaac ttcctggtat 6720tcctcgtcta agtggtggtg ccataggata catctcgtac gattgtatta agtactttga 6780accaaaaact gaaagaaaac tgaaagatgt tttgcaactt ccggaagcag ctttgatgtt 6840gttcgacacg atcgtggctt ttgacaatgt ttatcaaaga ttccaggtaa ttggaaacgt 6900ttctctatcc gttgatgact cggacgaagc tattcttgag aaatattata agacaagaga 6960agaagtggaa aagatcagta aagtggtatt tgacaataaa actgttccct actatgaaca 7020gaaagatatt attcaaggcc aaacgttcac ctctaatatt ggtcaggaag ggtatgaaaa 7080ccatgttcgc aagctgaaag aacatattct gaaaggagac atcttccaag ctgttccctc 7140tcaaagggta gccaggccga cctcattgca ccctttcaac atctatcgtc atttgagaac 7200tgtcaatcct tctccataca tgttctatat tgactatcta gacttccaag ttgttggtgc 7260ttcacctgaa ttactagtta aatccgacaa caacaacaaa atcatcacac atcctattgc 7320tggaactctt cccagaggta aaactatcga agaggacgac aattatgcta agcaattgaa 7380gtcgtctttg aaagacaggg ccgagcacgt catgctggta gatttggcca gaaatgatat 7440taaccgtgtg tgtgagccca ccagtaccac ggttgatcgt ttattgactg tggagagatt 7500ttctcatgtg atgcatcttg tgtcagaagt cagtggaaca ttgagaccaa acaagactcg 7560cttcgatgct ttcagatcca ttttcccagc aggaaccgtc tccggtgctc cgaaggtaag 7620agcaatgcaa ctcataggag aattggaagg agaaaagaga ggtgtttatg cgggggccgt 7680aggacactgg tcgtacgatg gaaaatcgat ggacacatgt attgccttaa gaacaatggt 7740cgtcaaggac ggtgtcgctt accttcaagc cggaggtgga attgtctacg attctgaccc 7800ctatgacgag tacatcgaaa ccatgaacaa aatgagatcc aacaataaca ccatcttgga 7860ggctgagaaa atctggaccg ataggttggc cagagacgag aatcaaagtg aatccgaaga 7920aaacgatcaa tgaacggagg acgtaagtag gaatttatgg tttggccata atggcctagc 7980ttggcgtaat catggtcata gctgtttcct gtgtgaaatt gttatccgct cacaattcca 8040cacaacatac gagccggaag cataaagtgt aaagcctggg gtgcctaatg agtgagctaa 8100ctcacattaa ttgcgttgcg ctcactgccc gctttccagt cgggaaacct gtcgtgccag 8160ctgcattaat gaatcggcca acgcgcgggg agaggcggtt tgcgtattgg gcgctcttcc 8220gcttcctcgc tcactgactc gctgcgctcg gtcgttcggc tgcggcgagc ggtatcagct 8280cactcaaagg cggtaatacg gttatccaca gaatcagggg ataacgcagg aaagaacatg 8340tgagcaaaag gccagcaaaa ggccaggaac cgtaaaaagg ccgcgttgct ggcgtttttc 8400cataggctcc gcccccctga cgagcatcac aaaaatcgac gctcaagtca gaggtggcga 8460aacccgacag gactataaag ataccaggcg tttccccctg gaagctccct cgtgcgctct 8520cctgttccga ccctgccgct taccggatac ctgtccgcct ttctcccttc gggaagcgtg 8580gcgctttctc atagctcacg ctgtaggtat ctcagttcgg tgtaggtcgt tcgctccaag 8640ctgggctgtg tgcacgaacc ccccgttcag cccgaccgct gcgccttatc cggtaactat 8700cgtcttgagt ccaacccggt aagacacgac ttatcgccac tggcagcagc cactggtaac 8760aggattagca gagcgaggta tgtaggcggt gctacagagt tcttgaagtg gtggcctaac 8820tacggctaca ctagaaggac agtatttggt atctgcgctc tgctgaagcc agttaccttc 8880ggaaaaagag ttggtagctc ttgatccggc aaacaaacca ccgctggtag cggtggtttt 8940tttgtttgca agcagcagat tacgcgcaga aaaaaaggat ctcaagaaga tcctttgatc 9000ttttctacgg ggtctgacgc tcagtggaac gaaaactcac gttaagggat tttggtcatg 9060agattatcaa aaaggatctt cacctagatc cttttaaatt aaaaatgaag ttttaaatca 9120atctaaagta tatatgagta aacttggtct gacagttacc aatgcttaat cagtgaggca 9180cctatctcag cgatctgtct atttcgttca tccatagttg cctgactccc cgtcgtgtag 9240ataactacga tacgggaggg cttaccatct ggccccagtg ctgcaatgat accgcgagac 9300ccacgctcac cggctccaga tttatcagca ataaaccagc cagccggaag ggccgagcgc 9360agaagtggtc ctgcaacttt atccgcctcc atccagtcta ttaattgttg ccgggaagct 9420agagtaagta gttcgccagt taatagtttg cgcaacgttg ttgccattgc tacaggcatc 9480gtggtgtcac gctcgtcgtt tggtatggct tcattcagct ccggttccca acgatcaagg 9540cgagttacat gatcccccat gttgtgcaaa aaagcggtta gctccttcgg tcctccgatc 9600gttgtcagaa gtaagttggc cgcagtgtta tcactcatgg ttatggcagc actgcataat 9660tctcttactg tcatgccatc cgtaagatgc ttttctgtga ctggtgagta ctcaaccaag 9720tcattctgag aatagtgtat gcggcgaccg agttgctctt gcccggcgtc aatacgggat 9780aataccgcgc cacatagcag aactttaaaa gtgctcatca ttggaaaacg ttcttcgggg 9840cgaaaactct caaggatctt accgctgttg agatccagtt cgatgtaacc cactcgtgca 9900cccaactgat cttcagcatc ttttactttc accagcgttt ctgggtgagc aaaaacagga 9960aggcaaaatg ccgcaaaaaa gggaataagg gcgacacgga aatgttgaat actcatactc 10020ttcctttttc aatattattg aagcatttat cagggttatt gtctcatgag cggatacata 10080tttgaatgta tttagaaaaa taaacaaata ggggttccgc gcacatttcc ccgaaaagtg 10140ccacctgacg tctaagaaac cattattatc atgacattaa cctataaaaa taggcgtatc 10200acgaggccct ttcgtc 102164449PRTArtificial Sequenceimmunoglobulin chain 4Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn Thr Ala Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met

Asp Tyr Trp Gly Asn 100 105 110Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val 115 120 125Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala 130 135 140Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser145 150 155 160Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val 165 170 175Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro 180 185 190Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys 195 200 205Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp 210 215 220Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly225 230 235 240Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile 245 250 255Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu 260 265 270Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His 275 280 285Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg 290 295 300Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys305 310 315 320Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu 325 330 335Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr 340 345 350Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu 355 360 365Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp 370 375 380Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val385 390 395 400Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp 405 410 415Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His 420 425 430Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro 435 440 445Gly5449PRTArtificial Sequenceimmunoglobulin chain 5Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn Thr Ala Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr Trp Gly Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val 115 120 125Phe Pro Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly Thr Ala Ala 130 135 140Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser145 150 155 160Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val 165 170 175Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro 180 185 190Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys 195 200 205Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp 210 215 220Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly225 230 235 240Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile 245 250 255Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu 260 265 270Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His 275 280 285Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg 290 295 300Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys305 310 315 320Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu 325 330 335Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr 340 345 350Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu 355 360 365Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp 370 375 380Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val385 390 395 400Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp 405 410 415Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His 420 425 430Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro 435 440 445Gly6449PRTArtificial Sequenceimmunoglobulin chain 6Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn Thr Ala Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr Trp Gly Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val 115 120 125Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala 130 135 140Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser145 150 155 160Trp Asn Ser Thr Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val 165 170 175Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro 180 185 190Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys 195 200 205Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp 210 215 220Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly225 230 235 240Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile 245 250 255Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu 260 265 270Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His 275 280 285Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg 290 295 300Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys305 310 315 320Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu 325 330 335Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr 340 345 350Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu 355 360 365Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp 370 375 380Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val385 390 395 400Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp 405 410 415Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His 420 425 430Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro 435 440 445Gly7449PRTArtificial Sequenceimmunoglobulin chain 7Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn Thr Ala Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr Trp Gly Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val 115 120 125Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala 130 135 140Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser145 150 155 160Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val 165 170 175Leu Asn Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro 180 185 190Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys 195 200 205Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp 210 215 220Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly225 230 235 240Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile 245 250 255Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu 260 265 270Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His 275 280 285Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg 290 295 300Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys305 310 315 320Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu 325 330 335Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr 340 345 350Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu 355 360 365Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp 370 375 380Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val385 390 395 400Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp 405 410 415Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His 420 425 430Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro 435 440 445Gly8449PRTArtificial Sequenceimmunoglobulin chain 8Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn Thr Ala Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr Trp Gly Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val 115 120 125Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala 130 135 140Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser145 150 155 160Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val 165 170 175Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro 180 185 190Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Thr His Lys 195 200 205Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp 210 215 220Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly225 230 235 240Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile 245 250 255Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu 260 265 270Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His 275 280 285Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg 290 295 300Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys305 310 315 320Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu 325 330 335Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr 340 345 350Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu 355 360 365Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp 370 375 380Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val385 390 395 400Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp 405 410 415Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His 420 425 430Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro 435 440 445Gly9449PRTArtificial Sequenceimmunoglobulin chain 9Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn Thr Ala Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr Trp Gly Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val 115 120 125Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala 130 135 140Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser145 150 155 160Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val 165 170 175Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro 180 185 190Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys 195 200 205Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp 210 215 220Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly225 230 235 240Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile 245 250 255Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu 260 265 270Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His 275 280 285Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg 290 295 300Val Val Ser Val Leu Thr Val Leu His Gln Asp

Trp Leu Asn Gly Lys305 310 315 320Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu 325 330 335Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr 340 345 350Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Thr Ser Leu 355 360 365Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp 370 375 380Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val385 390 395 400Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp 405 410 415Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His 420 425 430Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro 435 440 445Gly10449PRTArtificial Sequenceimmunoglobulin chain 10Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn Thr Ala Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr Trp Gly Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val 115 120 125Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala 130 135 140Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser145 150 155 160Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val 165 170 175Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro 180 185 190Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys 195 200 205Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp 210 215 220Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly225 230 235 240Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile 245 250 255Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu 260 265 270Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His 275 280 285Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg 290 295 300Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys305 310 315 320Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu 325 330 335Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr 340 345 350Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu 355 360 365Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp 370 375 380Glu Ser Asn Gly Thr Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val385 390 395 400Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp 405 410 415Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His 420 425 430Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro 435 440 445Gly11449PRTArtificial Sequenceimmunoglobulin chain 11Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn Thr Ala Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr Trp Gly Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val 115 120 125Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala 130 135 140Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser145 150 155 160Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val 165 170 175Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro 180 185 190Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys 195 200 205Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp 210 215 220Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly225 230 235 240Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile 245 250 255Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu 260 265 270Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His 275 280 285Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg 290 295 300Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys305 310 315 320Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu 325 330 335Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr 340 345 350Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu 355 360 365Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp 370 375 380Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val385 390 395 400Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp 405 410 415Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His 420 425 430Glu Ala Leu His Asn His Tyr Thr Asn Lys Ser Leu Ser Leu Ser Pro 435 440 445Gly12468PRTArtificial Sequenceimmunoglobulin chain 12Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Asn Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46513468PRTArtificial Sequenceimmunoglobulin chain 13Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Asn Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46514468PRTArtificial Sequenceimmunoglobulin chain 14Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Asn Lys Ser Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46515468PRTArtificial Sequenceimmunoglobulin chain 15Met Arg Phe Pro

Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Asn Ser Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46516468PRTArtificial Sequenceimmunoglobulin chain 16Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Gly Asn Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46517468PRTArtificial Sequenceimmunoglobulin chain 17Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Asn Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46518468PRTArtificial Sequenceimmunoglobulin chain 18Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Thr Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46519468PRTArtificial Sequenceimmunoglobulin chain 19Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Thr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46520468PRTArtificial Sequenceimmunoglobulin chain 20Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105

110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Thr Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46521468PRTArtificial Sequenceimmunoglobulin chain 21Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Thr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46522468PRTArtificial Sequenceimmunoglobulin chain 22Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Asn Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46523468PRTArtificial Sequenceimmunoglobulin chain 23Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Asn Gly Thr Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46524468PRTArtificial Sequenceimmunoglobulin chain 24Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Asn Ser Thr Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46525468PRTArtificial Sequenceimmunoglobulin chain 25Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Asn Ser Thr Gly Thr Gln Thr Tyr Ile Cys Asn Val 210

215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46526468PRTArtificial Sequenceimmunoglobulin chain 26Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Asn Thr Thr Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46527468PRTArtificial Sequenceimmunoglobulin chain 27Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Thr Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46528468PRTArtificial Sequenceimmunoglobulin chain 28Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Arg Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Tyr Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Ser Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46529449PRTArtificial Sequenceimmunoglobulin chain 29Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile Lys Asp Thr 20 25 30Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Glu Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn Thr Ala Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ser Arg Trp Gly Gly Asp Gly Phe Gly Ala Met Asp Tyr Trp Gly Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val 115 120 125Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala 130 135 140Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser145 150 155 160Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val 165 170 175Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro 180 185 190Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys 195 200 205Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp 210 215 220Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly225 230 235 240Pro Ser Val Phe Leu Ala Pro Pro Lys Pro Lys Asp Thr Leu Met Ile 245 250 255Ser Arg Thr Pro Glu Val Thr Cys Val Val Ala Asp Val Ser His Glu 260 265 270Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His 275 280 285Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg 290 295 300Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys305 310 315 320Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu 325 330 335Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr 340 345 350Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu 355 360 365Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp 370 375 380Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val385 390 395 400Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp 405 410 415Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His 420 425 430Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro 435 440 445Gly30214PRTArtificial Sequenceimmunoglobulin chain 30Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Asp Val Asn Thr Ala 20 25 30Val Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Ser Ala Ser Phe Leu Tyr Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln His Tyr Thr Thr Pro Pro 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala 100 105 110Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120 125Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150 155 160Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165 170 175Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr 180 185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser 195 200 205Phe Asn Arg Gly Glu Cys 21031468PRTArtificial Sequenceimmunoglobulin chain 31Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Glu Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Gly Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly

Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Ala Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Ala Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46532468PRTArtificial Sequenceimmunoglobulin chain 32Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Glu Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Gly Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Thr Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Ala Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Ala Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46533468PRTArtificial Sequenceimmunoglobulin chain 33Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Glu Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Gly Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Thr Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Ala Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Ala Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46534468PRTArtificial Sequenceimmunoglobulin chain 34Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Glu Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Gly Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Thr Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Thr His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Ala Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Ala Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46535468PRTArtificial Sequenceimmunoglobulin chain 35Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Thr Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Glu Ile Tyr Pro Thr Asn Gly Thr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Gly Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Thr Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Ala Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Ala Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46536468PRTArtificial Sequenceimmunoglobulin chain 36Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Thr Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Glu Ile Tyr Pro Thr Asn Gly Tyr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Asn Gly Thr Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Gly Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Thr Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235

240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Ala Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Ala Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46537468PRTArtificial Sequenceimmunoglobulin chain 37Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Glu Ile Tyr Pro Thr Asn Gly Thr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Asn Gly Thr Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Gly Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Thr Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Thr His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Ala Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Ala Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46538468PRTArtificial Sequenceimmunoglobulin chain 38Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Lys Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Glu Ile Tyr Pro Thr Asn Gly Thr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Gly Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Thr Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Asn Ser Thr Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Thr His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Ala Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Ala Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46539468PRTArtificial Sequenceimmunoglobulin chain 39Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Thr Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Glu Ile Tyr Pro Thr Asn Gly Thr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Asn Gly Thr Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Gly Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Thr Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Thr His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Ala Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Ala Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46540468PRTArtificial Sequenceimmunoglobulin chain 40Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Thr Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Glu Ile Tyr Pro Thr Asn Gly Thr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Asn Gly Thr Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Gly Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Thr Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Asn Ser Thr Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Thr His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Ala Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Ala Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340 345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Thr Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Thr Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Thr Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46541468PRTArtificial Sequenceimmunoglobulin chain 41Met Arg Phe Pro Ser Ile Phe Thr Ala Val Leu Phe Ala Ala Ser Ser1 5 10 15Ala Leu Ala Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln 20 25 30Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asn Ile 35 40 45Thr Asp Thr Tyr Ile His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60Glu Trp Val Ala Glu Ile Tyr Pro Thr Asn Gly Thr Thr Arg Tyr Ala65 70 75 80Asp Ser Val Asn Gly Thr Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn 85 90 95Thr Ala Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110Tyr Tyr Cys Ser Arg Trp Gly Gly Asp Gly Phe Gly Ala Met Asp Tyr 115 120 125Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly145 150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val 165 170 175Thr Val Ser Trp Asn Ser Thr Ala Leu Thr Ser Gly Val His Thr Phe 180 185 190Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val 195 200 205Thr Val Pro Ser Ser Ser Asn Gly Thr Gln Thr Tyr Ile Cys Asn Val 210 215 220Thr His Lys Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys225 230 235 240Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu 245 250 255Leu Gly Gly Pro Ser Val Phe Leu Ala Pro Pro Lys Pro Lys Asp Thr 260 265 270Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Ala Asp Val 275 280 285Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val 290 295 300Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser305 310 315 320Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu 325 330 335Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala 340

345 350Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro 355 360 365Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln 370 375 380Thr Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala385 390 395 400Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Thr Thr Thr 405 410 415Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Thr Ser Cys Ser 435 440 445Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser 450 455 460Leu Ser Pro Gly46542448PRTArtificial Sequenceimmunoglobulin chain 42Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Lys Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ser 20 25 30Gly Leu Ala Trp Val Arg Gln Ala Pro Glu Lys Gly Leu Glu Trp Val 35 40 45Ala Thr Ile Thr Tyr Asn Gly Thr Ser Thr Tyr Tyr Arg Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Ser Ser Leu Arg Ser Glu Asp Thr Ala Thr Tyr Tyr Cys 85 90 95Ala Arg Trp Val Pro Gly Ser Gly Asn Phe Asp Tyr Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe 115 120 125Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu 130 135 140Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp145 150 155 160Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu 165 170 175Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser 180 185 190Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro 195 200 205Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys 210 215 220Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro225 230 235 240Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 245 250 255Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 260 265 270Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 275 280 285Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val 290 295 300Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu305 310 315 320Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 325 330 335Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr 340 345 350Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 355 360 365Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 370 375 380Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu385 390 395 400Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 405 410 415Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 420 425 430Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 435 440 44543218PRTArtificial Sequenceimmunoglobulin chain 43Asp Ile Val Leu Thr Gln Ser Pro Ala Ser Leu Ala Val Ser Leu Gly1 5 10 15Gln Arg Ala Thr Ile Ser Cys Arg Ala Ser Gln Ser Val Thr Ile Ser 20 25 30Arg Tyr Thr Leu Met His Trp Tyr Gln Gln Lys Pro Gly Gln Pro Pro 35 40 45Lys Leu Leu Ile Tyr Arg Ala Ser Asn Leu Ala Ser Gly Ile Pro Ala 50 55 60Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Asn Ile His65 70 75 80Pro Val Glu Glu Asp Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Ser Arg 85 90 95Glu Ser Pro Trp Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg 100 105 110Ala Asp Ala Ala Pro Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln 115 120 125Leu Thr Ser Gly Gly Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr 130 135 140Pro Lys Asp Ile Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln145 150 155 160Asn Gly Val Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr 165 170 175Tyr Ser Met Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg 180 185 190His Asn Ser Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro 195 200 205Ile Val Lys Ser Phe Asn Arg Asn Glu Cys 210 21544448PRTArtificial Sequenceimmunoglobulin chain 44Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Lys Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ser 20 25 30Gly Leu Ala Trp Val Arg Gln Ala Pro Glu Lys Gly Leu Glu Trp Val 35 40 45Ala Thr Ile Thr Tyr Asn Gly Thr Ser Thr Tyr Tyr Arg Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Ser Ser Leu Arg Ser Glu Asp Thr Ala Thr Tyr Tyr Cys 85 90 95Ala Arg Trp Val Pro Gly Ser Gly Asn Phe Asp Tyr Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe 115 120 125Pro Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly Thr Ala Ala Leu 130 135 140Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp145 150 155 160Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu 165 170 175Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser 180 185 190Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro 195 200 205Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys 210 215 220Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro225 230 235 240Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 245 250 255Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 260 265 270Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 275 280 285Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val 290 295 300Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu305 310 315 320Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 325 330 335Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr 340 345 350Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 355 360 365Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 370 375 380Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu385 390 395 400Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 405 410 415Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 420 425 430Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 435 440 44545448PRTArtificial Sequenceimmunoglobulin chain 45Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Lys Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ser 20 25 30Gly Leu Ala Trp Val Arg Gln Ala Pro Glu Lys Gly Leu Glu Trp Val 35 40 45Ala Thr Ile Thr Tyr Asn Gly Thr Ser Thr Tyr Tyr Arg Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Ser Ser Leu Arg Ser Glu Asp Thr Ala Thr Tyr Tyr Cys 85 90 95Ala Arg Trp Val Pro Gly Ser Gly Asn Phe Asp Tyr Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe 115 120 125Pro Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly Thr Ala Ala Leu 130 135 140Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp145 150 155 160Asn Ser Thr Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu 165 170 175Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser 180 185 190Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro 195 200 205Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys 210 215 220Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro225 230 235 240Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 245 250 255Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 260 265 270Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 275 280 285Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val 290 295 300Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu305 310 315 320Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 325 330 335Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr 340 345 350Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 355 360 365Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 370 375 380Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu385 390 395 400Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 405 410 415Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 420 425 430Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 435 440 44546448PRTArtificial Sequenceimmunoglobulin chain 46Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Lys Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Ser 20 25 30Gly Leu Ala Trp Val Arg Gln Ala Pro Glu Lys Gly Leu Glu Trp Val 35 40 45Ala Thr Ile Thr Tyr Asn Gly Thr Ser Thr Tyr Tyr Arg Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Ser Ser Leu Arg Ser Glu Asp Thr Ala Thr Tyr Tyr Cys 85 90 95Ala Arg Trp Val Pro Gly Ser Gly Asn Phe Asp Tyr Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe 115 120 125Pro Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly Thr Ala Ala Leu 130 135 140Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp145 150 155 160Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu 165 170 175Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser 180 185 190Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro 195 200 205Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys 210 215 220Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro225 230 235 240Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 245 250 255Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 260 265 270Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 275 280 285Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val 290 295 300Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu305 310 315 320Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 325 330 335Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr 340 345 350Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 355 360 365Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 370 375 380Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu385 390 395 400Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 405 410 415Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 420 425 430Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 435 440 44547448PRTArtificial Sequenceimmunoglobulin chain 47Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asp Phe Ser Arg Tyr 20 25 30Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Glu Ile Asn Pro Asp Ser Ser Thr Ile Asn Tyr Ala Pro Ser Leu 50 55 60Lys Asp Lys Phe Ile Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Pro Asp Gly Asn Tyr Trp Tyr Phe Asp Val Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe 115 120 125Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu 130 135 140Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp145 150 155 160Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu 165 170 175Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser 180 185 190Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro 195 200 205Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys 210 215 220Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro225 230 235 240Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 245 250 255Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 260 265 270Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 275 280 285Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val 290 295 300Val Ser Val Leu Thr Val Leu His Gln Asp Trp

Leu Asn Gly Lys Glu305 310 315 320Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 325 330 335Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr 340 345 350Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 355 360 365Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 370 375 380Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu385 390 395 400Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 405 410 415Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 420 425 430Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 435 440 44548214PRTArtificial Sequenceimmunoglobulin chain 48Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Val Gly Ile Ala 20 25 30Val Ala Trp Tyr Gln Gln Lys Pro Gly Lys Val Pro Lys Leu Leu Ile 35 40 45Tyr Trp Ala Ser Thr Arg His Thr Gly Val Pro Asp Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Val Ala Thr Tyr Tyr Cys Gln Gln Tyr Ser Ser Tyr Pro Tyr 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala 100 105 110Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120 125Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150 155 160Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165 170 175Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr 180 185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser 195 200 205Phe Asn Arg Gly Glu Cys 21049448PRTArtificial Sequenceimmunoglobulin chain 49Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asp Phe Ser Arg Tyr 20 25 30Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Glu Ile Asn Pro Asp Ser Ser Thr Ile Asn Tyr Ala Pro Ser Leu 50 55 60Lys Asp Lys Phe Ile Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Pro Asp Gly Asn Tyr Trp Tyr Phe Asp Val Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe 115 120 125Pro Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly Thr Ala Ala Leu 130 135 140Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp145 150 155 160Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu 165 170 175Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser 180 185 190Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro 195 200 205Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys 210 215 220Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro225 230 235 240Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 245 250 255Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 260 265 270Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 275 280 285Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val 290 295 300Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu305 310 315 320Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 325 330 335Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr 340 345 350Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 355 360 365Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 370 375 380Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu385 390 395 400Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 405 410 415Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 420 425 430Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 435 440 44550448PRTArtificial Sequenceimmunoglobulin chain 50Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asp Phe Ser Arg Tyr 20 25 30Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Glu Ile Asn Pro Asp Ser Ser Thr Ile Asn Tyr Ala Pro Ser Leu 50 55 60Lys Asp Lys Phe Ile Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Pro Asp Gly Asn Tyr Trp Tyr Phe Asp Val Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe 115 120 125Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu 130 135 140Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp145 150 155 160Asn Ser Thr Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu 165 170 175Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser 180 185 190Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro 195 200 205Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys 210 215 220Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro225 230 235 240Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 245 250 255Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 260 265 270Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 275 280 285Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val 290 295 300Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu305 310 315 320Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 325 330 335Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr 340 345 350Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 355 360 365Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 370 375 380Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu385 390 395 400Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 405 410 415Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 420 425 430Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 435 440 44551448PRTArtificial Sequenceimmunoglobulin chain 51Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Asp Phe Ser Arg Tyr 20 25 30Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45Gly Glu Ile Asn Pro Asp Ser Ser Thr Ile Asn Tyr Ala Pro Ser Leu 50 55 60Lys Asp Lys Phe Ile Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Pro Asp Gly Asn Tyr Trp Tyr Phe Asp Val Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe 115 120 125Pro Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly Thr Ala Ala Leu 130 135 140Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp145 150 155 160Asn Ser Thr Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu 165 170 175Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser 180 185 190Ser Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro 195 200 205Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys 210 215 220Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro225 230 235 240Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 245 250 255Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp 260 265 270Pro Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 275 280 285Ala Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val 290 295 300Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu305 310 315 320Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys 325 330 335Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr 340 345 350Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr 355 360 365Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 370 375 380Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu385 390 395 400Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys 405 410 415Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu 420 425 430Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 435 440 44552447PRTArtificial Sequenceimmunoglobulin chain 52Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ile Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Val Ile Ser Tyr Asp Gly Arg Asn Lys Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Asp Gly Tyr Asp Phe Asp Tyr Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro 115 120 125Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly 130 135 140Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn145 150 155 160Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln 165 170 175Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser 180 185 190Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser 195 200 205Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr 210 215 220His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser225 230 235 240Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 245 250 255Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro 260 265 270Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 275 280 285Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 290 295 300Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr305 310 315 320Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 325 330 335Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 340 345 350Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys 355 360 365Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 370 375 380Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp385 390 395 400Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 405 410 415Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala 420 425 430Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 435 440 44553214PRTArtificial Sequenceimmunoglobulin chain 53Glu Ile Val Leu Thr Gln Ser Pro Ala Thr Leu Ser Leu Ser Pro Gly1 5 10 15Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Ser Tyr 20 25 30Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu Ile 35 40 45Tyr Asp Ala Ser Asn Arg Ala Thr Gly Ile Pro Ala Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Glu Pro65 70 75 80Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Arg Thr Asn Trp Pro Leu 85 90 95Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala 100 105 110Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120 125Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150 155 160Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165 170 175Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr 180 185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser 195 200 205Phe Asn Arg Gly Glu Cys 21054447PRTArtificial Sequenceimmunoglobulin chain 54Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ile Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Val Ile Ser Tyr Asp Gly Arg Asn Lys Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu

Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Asp Gly Tyr Asp Phe Asp Tyr Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro 115 120 125Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly Thr Ala Ala Leu Gly 130 135 140Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn145 150 155 160Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln 165 170 175Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser 180 185 190Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser 195 200 205Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr 210 215 220His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser225 230 235 240Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 245 250 255Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro 260 265 270Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 275 280 285Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 290 295 300Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr305 310 315 320Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 325 330 335Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 340 345 350Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys 355 360 365Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 370 375 380Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp385 390 395 400Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 405 410 415Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala 420 425 430Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 435 440 44555447PRTArtificial Sequenceimmunoglobulin chain 55Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ile Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Val Ile Ser Tyr Asp Gly Arg Asn Lys Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Asp Gly Tyr Asp Phe Asp Tyr Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro 115 120 125Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly 130 135 140Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn145 150 155 160Ser Thr Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln 165 170 175Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser 180 185 190Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser 195 200 205Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr 210 215 220His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser225 230 235 240Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 245 250 255Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro 260 265 270Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 275 280 285Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 290 295 300Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr305 310 315 320Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 325 330 335Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 340 345 350Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys 355 360 365Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 370 375 380Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp385 390 395 400Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 405 410 415Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala 420 425 430Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 435 440 44556447PRTArtificial Sequenceimmunoglobulin chain 56Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ile Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Val Ile Ser Tyr Asp Gly Arg Asn Lys Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Asp Gly Tyr Asp Phe Asp Tyr Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro 115 120 125Leu Ala Pro Ser Ser Lys Asn Thr Ser Gly Gly Thr Ala Ala Leu Gly 130 135 140Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn145 150 155 160Ser Thr Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln 165 170 175Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser 180 185 190Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser 195 200 205Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys Asp Lys Thr 210 215 220His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser225 230 235 240Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 245 250 255Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro 260 265 270Glu Val Lys Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn Ala 275 280 285Lys Thr Lys Pro Arg Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 290 295 300Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr305 310 315 320Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 325 330 335Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 340 345 350Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val Ser Leu Thr Cys 355 360 365Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 370 375 380Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp385 390 395 400Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser 405 410 415Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His Glu Ala 420 425 430Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 435 440 44557680PRTFusarium graminearum 57Met Lys His Leu Leu Thr Leu Ala Leu Cys Phe Ser Ser Ile Asn Ala1 5 10 15Val Ala Val Thr Val Pro His Lys Ala Val Gly Thr Gly Ile Pro Glu 20 25 30Gly Ser Leu Gln Phe Leu Ser Leu Arg Ala Ser Ala Pro Ile Gly Ser 35 40 45Ala Ile Ser Arg Asn Asn Trp Ala Val Thr Cys Asp Ser Ala Gln Ser 50 55 60Gly Asn Glu Cys Asn Lys Ala Ile Asp Gly Asn Lys Asp Thr Phe Trp65 70 75 80His Thr Phe Tyr Gly Ala Asn Gly Asp Pro Lys Pro Pro His Thr Tyr 85 90 95Thr Ile Asp Met Lys Thr Thr Gln Asn Val Asn Gly Leu Ser Met Leu 100 105 110Pro Arg Gln Asp Gly Asn Gln Asn Gly Trp Ile Gly Arg His Glu Val 115 120 125Tyr Leu Ser Ser Asp Gly Thr Asn Trp Gly Ser Pro Val Ala Ser Gly 130 135 140Ser Trp Phe Ala Asp Ser Thr Thr Lys Tyr Ser Asn Phe Glu Thr Arg145 150 155 160Pro Ala Arg Tyr Val Arg Leu Val Ala Ile Thr Glu Ala Asn Gly Gln 165 170 175Pro Trp Thr Ser Ile Ala Glu Ile Asn Val Phe Gln Ala Ser Ser Tyr 180 185 190Thr Ala Pro Gln Pro Gly Leu Gly Arg Trp Gly Pro Thr Ile Asp Leu 195 200 205Pro Ile Val Pro Ala Ala Ala Ala Ile Glu Pro Thr Ser Gly Arg Val 210 215 220Leu Met Trp Ser Ser Tyr Arg Asn Asp Ala Phe Gly Gly Ser Pro Gly225 230 235 240Gly Ile Thr Leu Thr Ser Ser Trp Asp Pro Ser Thr Gly Ile Val Ser 245 250 255Asp Arg Thr Val Thr Val Thr Lys His Asp Met Phe Cys Pro Gly Ile 260 265 270Ser Met Asp Gly Asn Gly Gln Ile Val Val Thr Gly Gly Asn Asp Ala 275 280 285Lys Lys Thr Ser Leu Tyr Asp Ser Ser Ser Asp Ser Trp Ile Pro Gly 290 295 300Pro Asp Met Gln Val Ala Arg Gly Tyr Gln Ser Ser Ala Thr Met Ser305 310 315 320Asp Gly Arg Val Phe Thr Ile Gly Gly Ser Trp Ser Gly Gly Val Phe 325 330 335Glu Lys Asn Gly Glu Val Tyr Ser Pro Ser Ser Lys Thr Trp Thr Ser 340 345 350Leu Pro Asn Ala Lys Val Asn Pro Met Leu Thr Ala Asp Lys Gln Gly 355 360 365Leu Tyr Arg Ser Asp Asn His Ala Trp Leu Phe Gly Trp Lys Lys Gly 370 375 380Ser Val Phe Gln Ala Gly Pro Ser Thr Ala Met Asn Trp Tyr Tyr Thr385 390 395 400Ser Gly Ser Gly Asp Val Lys Ser Ala Gly Lys Arg Gln Ser Asn Arg 405 410 415Gly Val Ala Pro Asp Ala Met Cys Gly Asn Ala Val Met Tyr Asp Ala 420 425 430Val Lys Gly Lys Ile Leu Thr Phe Gly Gly Ser Pro Asp Tyr Gln Asp 435 440 445Ser Asp Ala Thr Thr Asn Ala His Ile Ile Thr Leu Gly Glu Pro Gly 450 455 460Thr Ser Pro Asn Thr Val Phe Ala Ser Asn Gly Leu Tyr Phe Ala Arg465 470 475 480Thr Phe His Thr Ser Val Val Leu Pro Asp Gly Ser Thr Phe Ile Thr 485 490 495Gly Gly Gln Arg Arg Gly Ile Pro Phe Glu Asp Ser Thr Pro Val Phe 500 505 510Thr Pro Glu Ile Tyr Val Pro Glu Gln Asp Thr Phe Tyr Lys Gln Asn 515 520 525Pro Asn Ser Ile Val Arg Val Tyr His Ser Ile Ser Leu Leu Leu Pro 530 535 540Asp Gly Arg Val Phe Asn Gly Gly Gly Gly Leu Cys Gly Asp Cys Thr545 550 555 560Thr Asn His Phe Asp Ala Gln Ile Phe Thr Pro Asn Tyr Leu Tyr Asn 565 570 575Ser Asn Gly Asn Leu Ala Thr Arg Pro Lys Ile Thr Arg Thr Ser Thr 580 585 590Gln Ser Val Lys Val Gly Gly Arg Ile Thr Ile Ser Thr Asp Ser Ser 595 600 605Ile Ser Lys Ala Ser Leu Ile Arg Tyr Gly Thr Ala Thr His Thr Val 610 615 620Asn Thr Asp Gln Arg Arg Ile Pro Leu Thr Leu Thr Asn Asn Gly Gly625 630 635 640Asn Ser Tyr Ser Phe Gln Val Pro Ser Asp Ser Gly Val Ala Leu Pro 645 650 655Gly Tyr Trp Met Leu Phe Val Met Asn Ser Ala Gly Val Pro Ser Val 660 665 670Ala Ser Thr Ile Arg Val Thr Gln 675 680582189DNAFusarium graminearum 58atggccgatc agcaaacggt ccttagtgta tccgtacctg gatatataag actggaagat 60atcagttgtt cttcatctgc cagtatcacc ttcattatct attcaagtca ctctctcaac 120ttattcttgc ctctctctat gtcaatatga aacacttttt atcactcgct ctttgcttca 180gcagcatcaa tgctgttgct gtcaccgtcc ctcacaagtc cggaggaact ggaagtcctg 240aagggagtct tcagttcctg agtcttcggg cctcagcacc tatcggaagc gctatttctc 300gcaacaactg ggccgtcact tgcgacagtg cacagtcggg aaatgaatgc aacaaggcca 360tcgatggcaa caaggatacc ttttggcaca cattctatgg ggccaatgga gatccaaagc 420cccctcacac atacacgatt gacatgaaga caactcagaa tgtcaacggc ttgtctatgt 480tgcctcgaca ggatggtaac caaaacggct ggatcggtcg ccatgaggtt tatctaagct 540cagatggcac aaactggggc agccctgttg cgtcaggtag ttggtttgcc gactctacta 600caaaatactc caactttgaa actcgccctg ctcgctatgt tcgtcttgtc gctgtcactg 660aagcgaatgg ccagccttgg actagcattg cagagatcaa cgtcttccaa gctagttctt 720acacagcccc tcagcctggc cttggccgct ggggtccgac tattgacttg ccgattgttc 780ctgcggctgc agcaattgag ccgacatcgg gacgagtcct tatgtggtct tcgtatcgca 840atgatgcatt tggaggatcc cctggtggta tcactttgac gtcttcgtgg gatccatcca 900ctggcattgt ttccgaccgc actgtgacag tcaccaagca tgatatgttc tgccctggta 960tctccatgga tggtaacggt cagatcgtag tcacaggtgg caacgacgcc aagaagacca 1020gtttgtatga ttcatctagc gatagctgga tcccgggacc tgacatgcaa gtggctcgtg 1080ggtatcagtc atcagctacc atgtcagacg gtcgtgtttt taccattgga ggctcctgga 1140gcggtggcgt atttgagaag aatggcgaag tctatagccc atcttcaaag acatggacgt 1200ccctacccaa tgccaaggtc aacccaatgt tgacggctga caagcaagga ttgtaccgtt 1260cagacaacca cgcgtggctc tttggatgga agaagggttc ggtgttccaa gcgggaccta 1320gtacagccat gaactggtac tataccagtg gaagtggcga tgtgaagtca gccggaaaac 1380gccagtctaa ccgtggtgta gcccctgatg ccatgtgcgg aaacgctgtc atgtacgacg 1440ccgttaaagg aaagatcctg acctttggcg gctccccaga ctatcaagac tctgacgcca 1500caaccaacgc ccacatcatc accctcggtg aacccggaac atctcccaac actgtctttg 1560ctagcaatgg cttgtacttt gctcgaacgt tccacacctc tgttgttctt ccagacggaa 1620gcacgttcat tacaggaggc caacgacgtg gaattccgtt cgaggattca accccggtat 1680ttacacctga gatctacgtc cctgaacaag acactttcta caagcagaac cccaactcca 1740ttgttcgcgt ctaccacagc atttcccttt tgttacctga tggcagggta tttaacggtg 1800gtggtggtct ttgtggcgat tgtaccacga atcatttcga cgcgcaaatc tttacgccaa 1860actatcttta caatagcaac ggcaatctcg cgacacgtcc caagattacc agaacctcta 1920cacagagcgt caaggtcggt ggcaggatca caatctcgac ggactcttcg attacaaagg 1980cgtcgttgat tcgctatggt acagcgacac acacggttaa tactgaccag cgtcgcattc 2040ccctgactct gacaaacaat ggaggaaata gctattcttt ccaagttcct agcgactctg 2100gtgttgcttt gcctggctac tggatgttgt tcgtgatgaa ctcggccggt gttcctagtg 2160tggcttcgac gattcgcgtt actcagtga 2189

* * * * *


uspto.report is an independent third-party trademark research tool that is not affiliated, endorsed, or sponsored by the United States Patent and Trademark Office (USPTO) or any other governmental organization. The information provided by uspto.report is based on publicly available data at the time of writing and is intended for informational purposes only.

While we strive to provide accurate and up-to-date information, we do not guarantee the accuracy, completeness, reliability, or suitability of the information displayed on this site. The use of this site is at your own risk. Any reliance you place on such information is therefore strictly at your own risk.

All official trademark data, including owner information, should be verified by visiting the official USPTO website at www.uspto.gov. This site is not intended to replace professional legal advice and should not be used as a substitute for consulting with a legal professional who is knowledgeable about trademark law.

© 2024 USPTO.report | Privacy Policy | Resources | RSS Feed of Trademarks | Trademark Filings Twitter Feed