U.S. patent application number 17/616399 was filed with the patent office on 2022-07-28 for anti-ceacam5 monoclonal antibody, preparation method thereof and use thereof.
The applicant listed for this patent is SHANGHAI GENBASE BIOTECHNOLOGY CO., LTD.. Invention is credited to Shifu Mo, Wei Xu.
Application Number | 20220235142 17/616399 |
Document ID | / |
Family ID | |
Filed Date | 2022-07-28 |
United States Patent
Application |
20220235142 |
Kind Code |
A1 |
Mo; Shifu ; et al. |
July 28, 2022 |
ANTI-CEACAM5 MONOCLONAL ANTIBODY, PREPARATION METHOD THEREOF AND
USE THEREOF
Abstract
Provided are a monoclonal antibody capable of specifically
binding to human carcinoembryonic antigen cell adhesion molecule 5
(CEACAM5) and an antigen binding fragment thereof. Further provided
are a preparation method for and use of said antibody and antigen
binding fragment thereof.
Inventors: |
Mo; Shifu; (Shanghai,
CN) ; Xu; Wei; (Shanghai, CN) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
SHANGHAI GENBASE BIOTECHNOLOGY CO., LTD. |
Shanghai |
|
CN |
|
|
Appl. No.: |
17/616399 |
Filed: |
June 3, 2020 |
PCT Filed: |
June 3, 2020 |
PCT NO: |
PCT/CN2020/094053 |
371 Date: |
December 3, 2021 |
International
Class: |
C07K 16/30 20060101
C07K016/30; C12N 15/85 20060101 C12N015/85; A61P 35/00 20060101
A61P035/00; A61K 47/68 20060101 A61K047/68 |
Foreign Application Data
Date |
Code |
Application Number |
Jun 4, 2019 |
CN |
2019 10481112.6 |
Claims
1.-25. (canceled)
26. An antibody or antigen-binding fragment thereof that
specifically binds to CEACAM5 protein, wherein the antibody or
antigen-binding fragment thereof comprises: 3 CDRs contained in the
heavy chain variable region (VH) as shown in SEQ ID NO: 7; and/or,
3 CDRs contained in the light chain variable region (VL) as shown
in SEQ ID NO: 8; wherein, the 3 CDRs contained in the VH and/or the
3 CDRs contained in the VL are defined by Kabat, IMGT or Chothia
numbering system.
27. The antibody or antigen-binding fragment thereof according to
claim 26, wherein the antibody or antigen-binding fragment thereof
comprises: (a) a heavy chain variable region (VH) comprising the
following 3 complementarity determining regions (CDRs): (i) VH
CDR1, which consists of the following sequence: SEQ ID NO: 1, or a
sequence having a substitution, deletion or addition of one or
several amino acids as compared therewith, (ii) VH CDR2, which
consists of the following sequence: SEQ ID NO: 2, or a sequence
having a substitution, deletion or addition of one or several amino
acids as compared therewith, and (iii) VH CDR3, which consists of
the following sequence: SEQ ID NO: 3, or a sequence having a
substitution, deletion or addition of one or several amino acids as
compared therewith; and/or, (b) a light chain variable region (VL)
comprising the following 3 complementarity determining regions
(CDRs): (iv) VL CDR1, which consists of the following sequence: SEQ
ID NO: 4, or a sequence having a substitution, deletion or addition
of one or several amino acids as compared therewith, (v) VL CDR2,
which consists of the following sequence: SEQ ID NO: 5, or a
sequence having a substitution, deletion or addition of one or
several amino acids as compared therewith, and (vi) VL CDR3, which
consists of the following sequence: SEQ ID NO: 6, or a sequence
having a substitution, deletion or addition of one or several amino
acids as compared therewith.
28. The antibody or antigen-binding fragment thereof according to
claim 27, wherein the antibody or antigen-binding fragment thereof
is characterized by one or more of the following: (1) the
substitution described in any one of (i) to (vi) is a conservative
substitution; and, (2) the antibody or antigen-binding fragment
thereof comprises the following three heavy chain CDRs: VH CDR1
having a sequence as shown in SEQ ID NO: 1, VH CDR2 having a
sequence as shown in SEQ ID NO: 2, and VH CDR3 having a sequence as
shown in SEQ ID NO: 3; and/or, the following three light chain
CDRs: VL CDR1 having a sequence as shown in SEQ ID NO: 4, VL CDR2
having a sequence as shown in SEQ ID NO: 5, and VL CDR3 having a
sequence as shown in SEQ ID NO: 6.
29. The antibody or antigen-binding fragment thereof according to
claim 26, wherein the antibody or antigen-binding fragment thereof
comprises: (a) a heavy chain variable region (VH), which comprises
an amino acid sequence selected from the following: (i) the
sequence as shown in SEQ ID NO: 7; (ii) a sequence having a
substitution, deletion or addition of one or several amino acids as
compared with the sequence shown in SEQ ID NO: 7; or (iii) a
sequence having a sequence identity of at least 80%, at least 85%,
at least 90%, at least 91%, at least 92%, at least 93%, at least
94%, at least 95%, at least 96%, at least 97%, at least 98%, at
least 99%, or 100% as compared with the sequence shown in SEQ ID
NO: 7; and/or (b) a light chain variable region (VL), which
comprises an amino acid sequence selected from the following: (iv)
the sequence as shown in SEQ ID NO: 8; (v) a sequence having a
substitution, deletion or addition of one or several amino acids as
compared with the sequence shown in SEQ ID NO: 8; or (vi) a
sequence having a sequence identity of at least 80%, at least 85%,
at least 90%, at least 91%, at least 92%, at least 93%, at least
94%, at least 95%, at least 96%, at least 97%, at least 98%, at
least 99%, or 100% as compared with the sequence shown in SEQ ID
NO: 8; optionally, the antibody or antigen-binding fragment thereof
is characterized by one or more of the following: (1) the
substitution described in (ii) or (v) is a conservative
substitution; and, (2) the antibody or antigen-binding fragment
thereof comprises: VH having the sequence shown in SEQ ID NO: 7 and
VL having the sequence shown in SEQ ID NO: 8.
30. The antibody or antigen-binding fragment thereof according to
claim 26, wherein the antibody or antigen-binding fragment thereof
comprises a heave chain constant region (CH) of a human
immunoglobulin and/or a light chain constant region (CL) of a human
immunoglobulin; optionally, the antibody or antigen-binding
fragment thereof is characterized by one or more of the following:
(1) the heavy chain constant region is an IgG heavy chain constant
region; (2) the heavy chain constant region has the sequence as
shown in SEQ ID NO: 9; (3) the light chain constant region is a
.kappa. light chain constant region; (4) the light chain constant
region has the sequence as shown in SEQ ID NO: 11; (5) the
antigen-binding fragment is selected from the group consisting of
Fab, Fab', (Fab').sub.2, Fv, disulfide-linked Fv, BsFv, DsFv,
(dsFv).sub.2, dsFv-dsFv', scFv, scFv dimer, camelized single chain
domain antibody, diabody, ds diabody, nanobody, single domain
antibody (sdAb), bivalent domain antibody; and/or, the antibody is
a murine antibody, chimeric antibody, humanized antibody,
bispecific antibody or multispecific antibody; and (6) the antibody
or antigen-binding fragment thereof comprises a label.
31. An isolated nucleic acid molecule, which encodes the antibody
or antigen-binding fragment thereof according to claim 26, or its
heavy chain variable region and/or light chain variable region.
32. A vector, which comprises the isolated nucleic acid molecule
according to claim 31.
33. A host cell, which comprises the isolated nucleic acid molecule
according to claim 31 or a vector comprising the isolated nucleic
acid molecule.
34. A method for preparing the antibody or antigen-binding fragment
thereof according to claim 26, which comprises: (i) culturing a
host cell under a condition allowing expression of the antibody or
antigen-binding fragment thereof, wherein the host cell comprises a
nucleic acid molecule encoding the antibody or antigen-binding
fragment thereof; and (ii) recovering the antibody or
antigen-binding fragment thereof from a culture of the host
cell.
35. A bispecific or multispecific molecule, which comprises the
antibody or antigen-binding fragment thereof according to claim 26;
optionally, the bispecific or multispecific molecule is
characterized by one or more of the following: (1) the bispecific
or multispecific molecule specifically binds to CEACAM5, and
additionally specifically binds to one or several other targets;
(2) the bispecific or multispecific molecule further comprises at
least one molecule having a second binding specificity for a second
target; and (3) the bispecific or multispecific molecule further
comprises a second antibody.
36. An immunoconjugate, which comprises the antibody or
antigen-binding fragment thereof according to claim 26 and a
therapeutic agent linked to the antibody or antigen-binding
fragment thereof; optionally, the immunoconjugate is characterized
by one or more of the following: (1) the therapeutic agent is a
cytotoxic agent; (2) the therapeutic agent is selected from the
group consisting of alkylating agent, mitotic inhibitor, anti-tumor
antibiotic, antimetabolite, topoisomerase inhibitor, tyrosine
kinase inhibitor, radionuclide agent, and any combination thereof,
and (3) the immunoconjugate is an antibody-drug conjugate
(ADC).
37. A pharmaceutical composition, which comprises the antibody or
antigen-binding fragment thereof according to claim 26, or a
bispecific or multispecific molecule comprising the antibody or
antigen-binding fragment thereof, or an immunoconjugate comprising
the antibody or antigen-binding fragment thereof, with a
pharmaceutically acceptable carrier and/or excipient; and
optionally, comprises an additional pharmaceutically active agent;
optionally, the pharmaceutical composition is characterized by one
or more of the following: (1) the additional pharmaceutically
active agent is a drug with an anti-tumor activity; (2) the
additional pharmaceutically active agent is an alkylating agent,
mitotic inhibitor, anti-tumor antibiotic, antimetabolite,
topoisomerase inhibitor, tyrosine kinase inhibitor, radionuclide,
radiosensitizer, anti-angiogenesis agent, cytokine, molecular
targeted drug, immune checkpoint inhibitor or oncolytic virus; and
(3) the antibody or antigen-binding fragment thereof, bispecific or
multispecific molecule or immunoconjugate and the additional
pharmaceutically active agent are provided as separate components
or as components of the same composition.
38. A kit, which comprises the antibody or antigen-binding fragment
thereof according to claim 26; and optionally, a second antibody;
wherein the antibody or antigen-binding fragment thereof and/or the
second antibody optionally comprises a detectable label.
39. A chimeric antigen receptor, which comprises an antigen-binding
domain of the antibody or antigen-binding fragment thereof
according to claim 26; optionally, the chimeric antigen receptor is
characterized by one or more of the following: (1) the
antigen-binding domain comprises a heavy chain variable region and
a light chain variable region of the antibody or antigen-binding
fragment thereof according to claim 26; and (2) the antigen-binding
domain is a scFv.
40. An isolated nucleic acid molecule, which encodes the chimeric
antigen receptor according to claim 39.
41. A vector, which comprises the isolated nucleic acid molecule
according to claim 40.
42. A host cell, which comprises the isolated nucleic acid molecule
according to claim 40 or a vector comprising the isolated nucleic
acid molecule; optionally, the host cell is characterized by one or
more of the following: (1) the host cell is an immune effector
cell; (2) the host cell is T cell or NK cell; and (3) the host cell
is a chimeric antigen receptor T cell (CAR-T).
43. A method for reducing expression level of CEACAM5 on the
surface of a cell, which comprises contacting a cell expressing
CEACAM5 on the surface thereof with the following: (1) the antibody
or antigen-binding fragment thereof according to claim 26, or (2) a
bispecific or multispecific molecule comprising the antibody or
antigen-binding fragment thereof, or (3) an immunoconjugate
comprising the antibody or antigen-binding fragment thereof, or (4)
a pharmaceutical composition comprising the antibody or
antigen-binding fragment thereof, or (5) a chimeric antigen
receptor comprising the antibody or antigen-binding fragment
thereof, or (6) a host cell comprising the isolated nucleic acid
molecule encoding the chimeric antigen receptor, or (7) any
combination thereof, so as to reduce expression of CEACAM5 on the
surface of the cell; optionally, the cell is a tumor cell
expressing CEACAM5.
44. A method for inhibiting growth of a tumor cell expressing
CEACAM5 and/or killing the tumor cell, which comprises contacting
the tumor cell with an effective amount of the following: (1) the
antibody or antigen-binding fragment thereof according to claim 26,
or (2) a bispecific or multispecific molecule comprising the
antibody or antigen-binding fragment thereof, or (3) an
immunoconjugate comprising the antibody or antigen-binding fragment
thereof, or (4) a pharmaceutical composition comprising the
antibody or antigen-binding fragment thereof, or (5) a chimeric
antigen receptor comprising the antibody or antigen-binding
fragment thereof, or (6) a host cell comprising the isolated
nucleic acid molecule encoding the chimeric antigen receptor, or
(7) any combination thereof.
45. A method for preventing and/or treating a tumor in a subject,
the method comprising administering to a subject in need thereof an
effective amount of the following: (1) the antibody or
antigen-binding fragment thereof according to claim 26, or (2) a
bispecific or multispecific molecule comprising the antibody or
antigen-binding fragment thereof, or (3) an immunoconjugate
comprising the antibody or antigen-binding fragment thereof, or (4)
a pharmaceutical composition comprising the antibody or
antigen-binding fragment thereof, or (5) a chimeric antigen
receptor comprising the antibody or antigen-binding fragment
thereof, or (6) a host cell comprising the isolated nucleic acid
molecule encoding the chimeric antigen receptor; (7) any
combination thereof, optionally, the method is characterized by one
or more of the following: (1) the tumor involves a tumor cell
expressing CEACAM5; (2) the tumor is selected from the group
consisting of non-small cell lung cancer, small cell lung cancer,
renal cell carcinoma, colorectal cancer, ovarian cancer, breast
cancer, pancreatic cancer, gastric cancer, bladder cancer,
esophageal cancer, mesothelioma, melanoma, head and neck cancer,
thyroid cancer, sarcoma, prostate cancer, glioblastoma, cervical
cancer, thymic cancer, leukemia, lymphoma, myeloma, mycosis
fungoids, Merkel cell carcinoma hematological malignancies, primary
mediastinal large B-cell lymphoma, T cell/histiocytic B-cell-rich
lymphoma, EBV-positive and negative PTLD, EBV-related diffuse large
B cell lymphoma (DLBCL), plasmablastic lymphoma, extranodal NK/T
cell Lymphoma, nasopharyngeal carcinoma HHV8-related primary
exudative lymphoma, Hodgkin's lymphoma, central nervous system
(CNS) tumor, primary CNS lymphoma, spinal axis tumor, and brainstem
glioma; (3) the subject is a mammal; (4) the subject is a human;
(5) the method further comprises administering an additional drug
with an anti-tumor activity; (6) the method further comprises
administering alkylating agent, mitotic inhibitor, anti-tumor
antibiotic, antimetabolite, topoisomerase inhibitor, tyrosine
kinase inhibitor, radionuclide, radiosensitizer, anti-angiogenesis
agent, cytokine, molecular targeted drug, immune checkpoint
inhibitor or oncolytic virus; (7) the method further comprises
administering an additional an anti-tumor therapy; and (8) the
method further comprises administering a surgery, chemotherapy,
radiation therapy, targeted therapy, immunotherapy, hormone
therapy, gene therapy or palliative therapy.
46. A method for detecting the presence or amount of CEACAM5 in a
sample, which comprises the following steps: (1) contacting the
sample with the antibody or antigen-binding fragment thereof
according to claim 26; (2) detecting formation of a complex
comprising the antibody or antigen-binding fragment thereof and
CEACAM5, or detecting the amount of the complex; optionally, the
CEACAM5 is human CEACAM5.
47. A method for determining whether a tumor is capable of being
treated by an anti-tumor therapy targeting CEACAM5, which comprises
the following steps: (1) contacting a sample containing a cell of
the tumor with the antibody or antigen-binding fragment thereof
according to claim 26; (2) detecting formation of a complex
comprising the antibody or antigen-binding fragment thereof and
CEACAM5; optionally, the method is characterized by one or more of
the following: (1) the CEACAM5 is human CEACAM5; and (2) the tumor
is selected from the group consisting of non-small cell lung
cancer, small cell lung cancer, renal cell carcinoma, colorectal
cancer, ovarian cancer, breast cancer, pancreatic cancer, gastric
cancer, bladder cancer, esophageal cancer, mesothelioma, melanoma,
head and neck cancer, thyroid cancer, sarcoma, prostate cancer,
glioblastoma, cervical cancer, thymic cancer, leukemia, lymphoma,
myeloma, mycosis fungoids, Merkel cell carcinoma hematological
malignancies, primary mediastinal large B-cell lymphoma, T
cell/histiocytic B-cell-rich lymphoma, EBV-positive and negative
PTLD, EBV-related diffuse large B cell lymphoma (DLBCL),
plasmablastic lymphoma, extranodal NK/T cell Lymphoma,
nasopharyngeal carcinoma HHV8-related primary exudative lymphoma,
Hodgkin's lymphoma, central nervous system (CNS) tumor, primary CNS
lymphoma, spinal axis tumor, and brainstem glioma.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a United States National Phase
Application filed under 35 U.S.C. .sctn. 371 from International
Patent Application No. PCT/CN2020/094053, filed on Jun. 3, 2020,
which claims the benefit of priority from Chinese Application No.
201910481112.6, filed on Jun. 4, 2019. The contents and disclosure
of each of the foregoing applications are incorporated by reference
herein in their entireties.
SEQUENCE LISTING
[0002] The instant application contains a Sequence Listing which
has been submitted electronically in ASCII format and is hereby
incorporated by reference in its entirety. Said ASCII copy, created
on Dec. 3, 2021, is named 000362-0002-301-SL.txt and is 12,764
bytes in size.
TECHNICAL FIELD
[0003] The present application pertains to the field of biological
immunity technology, and specifically relates to a monoclonal
antibody and antigen-binding fragment thereof that can specifically
bind to human carcinoembryonic antigen cell adhesion molecule 5
(CEACAM5). The present application also relates to a preparation
method and use of the antibody and antigen-binding fragment
thereof.
BACKGROUND
[0004] The human carcinoembryonic antigen cell adhesion molecule
(CEACAM) gene family was discovered as early as the 1960s,
including 35 genes/pseudogenes located on chromosome 19 (between
q13.1 and 13.3), among which there are 21 that encode proteins.
CEACAM belongs to the immunoglobulin superfamily of adhesion
molecules, its domains are highly glycosylated and usually include
1 to 2 immunoglobulin variable region-like domains (N domains) and
0 to 6 immunoglobulin constant region-like domains. CEACAM proteins
are located outside the cell membrane, in which CEACAM1, CEACAM3
and CEACAM4 are connected to the cell membrane through a
hydrophobic transmembrane domain; CEACAM5-8 is connected to the
cell membrane through glycosyl-phosphatidyl-inositol. These
extracellular domains usually act as adhesion molecules between
cells (for example, epithelium, endothelium, dendrites, and
leukocytes).
[0005] CEACAM involves a variety of cell functions, regulates cell
growth and differentiation through signal transduction based on the
adhesion function between cells, and plays an important role in
insulin homeostasis, angiogenesis and immune regulation. Members of
the CEACAM gene family are involved in a variety of
pathophysiological roles, including as receptors for microbial
pathogens. They play an important role in carcinogenesis,
especially in cancer detection, progression and metastasis. CEACAM5
(referred to as CEA, also known as CD66e) is a glycoprotein with a
molecular weight of about 180 kDa. CEACAM5 contains 7 domains
connected to the cell membrane via glycosyl-phosphatidyl-inositol
(GPI) anchors. The 7 domains include a single N-terminal Ig
variable domain and 6 domains (A1-B1-A2-B2-A3-B3) homologous to the
Ig constant domain. CEACAM5 was originally thought to be a protein
expressed in fetal tissues, and has now been identified in several
normal adult tissues. Overexpression of CEACAM5 has been observed
in many types of cancer. For example, CEACAM5 can be detected in
the blood of patients with colon cancer. Moreover, further studies
have determined that its overexpression is associated with many
malignant tumors, usually with poor prognosis. In prostate cancer
and colorectal cancer, the overexpression of CEACAM5 has been shown
to be a tumor biomarker.
[0006] In addition, CEACAM5/CEACAM6 have also been found to be
overexpressed in a variety of malignant tumors, such as breast,
pancreas, ovarian, colon, lung and gastric gland tumors, and are
related to tumor invasion and metastasis. During the initiation of
liver metastasis, CEACAM5 binds to its receptor CEAr, and their
interaction leads to the activation and production of
pro-inflammatory cytokines, mainly IL-1, IL-6, IL-10 and
TNF-.alpha.. In short, these cytokines change the microenvironment
of hepatocytes and Kupffer cells, as well as their interaction with
hepatic sinusoidal cells. These interactions not only affect tumor
cells or other liver cells, but also seem to promote the vitality
of CSC and other circulating tumor cells in the cerebrospinal
fluid.
[0007] Based on this, in addition to the known use of CEACAM5 as a
tumor marker in an immunological assay that measures elevated
CEACAM5 in the blood of cancer patients for clinical prognosis and
control of cancers, it is more important that CEACAM5 has become a
potentially useful tumor-associated antigen for targeted therapy.
There are two main methods that have been reported to use CEACAM5
for targeted immunotherapy of cancers. One method uses an
anti-CEACAM5 antibody to trigger the lytic activity of immune
cells, especially through antibody-dependent cytotoxicity (ADCC) or
complement-dependent cytotoxicity (CDC), so as to eliminate tumor
cells expressing CEACAM5; the other method comprises conjugating an
anti-CEACAM5 antibody or antibody fragment thereof with an effector
molecule such as drug, toxin, radioactive nucleotide,
immunomodulator or cytokine to specifically target a tumor cell
expressing CEACAM5, thereby exerting the therapeutic effect of the
effector molecule. In view of the fact that CEACAM5 is more
overexpressed in some solid tumors such as colorectal cancer,
pancreatic cancer, lung cancer, gastric cancer, hepatocellular
tumor, breast cancer and thyroid cancer, current research focuses
on the antigen recognition ability of anti-CEACAM5 antibodies.
[0008] In conclusion, the current research shows that treatments
targeting CEACAM5 will help to inhibit tumor metastasis. In
particular, antibodies with strong specificity to CEACAM5 can
better avoid the side effects caused by the off-target of the
antibodies. For example, CEACAM1 and CEACAM3 are widely distributed
in the human immune system and bone marrow, such as neutrophils,
etc., and a specific CEACAM5 antibody can reduce the possible side
effects of drugs and increase the treatment window.
[0009] Based on this, there is a demand for anti-CEACAM antibodies
with higher affinity and stronger specificity.
CONTENTS OF THE INVENTION
[0010] In the present application, unless otherwise specified, the
scientific and technical terms used herein have the meanings
commonly understood by those skilled in the art. In addition, the
laboratory procedures of cell culture, molecular genetics, nucleic
acid chemistry, and immunology used herein are all routine
procedures widely used in the corresponding fields. At the same
time, in order to better understand the present application,
definitions and explanations of related terms are provided
below.
Definition of Terms
[0011] The term "antibody" in the present application includes any
immunoglobulin, monoclonal antibody, polyclonal antibody,
multispecific antibody or bispecific (bivalent) antibody that can
bind to a specific antigen. A natural intact antibody contains two
heavy chains and two light chains. Each heavy chain is composed of
one variable region and first, second and third constant regions;
each light chain is composed of one variable region and one
constant region. The mammalian heavy chains can be divided into
.alpha., .delta., .beta., .gamma. and .mu., and the mammalian light
chains can be divided into .lamda. or .kappa.. The antibody is
presented in "Y" type, and the neck of the Y-type structure is
composed of the second and third constant regions of the two heavy
chains, which are linked by disulfide bonds. Each arm of the "Y"
type structure contains the variable region and the first constant
region of one of the heavy chains, which are linked with the
variable region and constant region of one light chain. The
variable regions of the light and heavy chains determine
antigen-binding. The variable region of each chain contains three
hypervariable regions, called complementarity determining regions
(CDRs). The CDRs of the light chain (L) include VLCDR1, VLCDR2, and
VLCDR3, and the CDRs of the heavy chain (H) include VHCDR1, VHCDR2,
and VHCDR3. The CDR boundaries of the antibody and antigen-binding
fragment thereof disclosed in the present application can be named
or identified by Kabat, Chothia or Al-Lazikani numbering system.
(Al-Lazikani, B., Chothia, C., Lesk, A M, J. Mol. Biol., 273(4):
927 (1997); Chothia, C., etc., J. Mol. Biol., 186(3): 651-63
(1985); Chothia, C. and Lesk, A M, J. Mol. Biol., 196: 901 (1987);
Chothia, C. et al., Nature, 342(6252): 877-83 (1989); Kabat, E A,
etc., National Institutes of Health, Bethesda, Md. (1991)).
Wherein, the three CDRs are separated by a continuous side part
called framework region (FR). The framework region is more highly
conserved than the CDRs and forms a scaffold to support the
hypervariable loop. The constant regions of heavy and light chains
are not related to the antigen-binding, but have multiple effector
functions. Antibodies can be divided into several categories based
on the amino acid sequence of the constant region of the heavy
chain. According to whether they contain .alpha., .delta.,
.epsilon., .gamma. and .mu. heavy chains, antibodies can be divided
into five main categories or isomers: IgA, IgD, IgE, IgG, and IgM.
Several major antibody categories can further be divided into
subclasses, such as IgG1 (.gamma.1 heavy chain), IgG2 (.gamma.2
heavy chain), IgG3 (.gamma.3 heavy chain), IgG4 (.gamma.4 heavy
chain), IgA1 (.alpha.1 heavy chain) or IgA2 (.alpha.2 heavy chain)
and so on.
[0012] The term "antigen-binding fragment" in the present
application refers to an antibody fragment formed by an antibody
portion containing one or more CDRs or any other antibody fragment
that binds to an antigen but does not have a complete antibody
structure. Examples of antigen-binding fragment include, but are
not limited to, such as diabody, Fab, Fab', F(ab').sub.2, Fv
fragment, disulfide bond-stabilized Fv fragment (dsFv),
(dsFv).sub.2, dual-specific dsFv (dsFv-dsFv'), disulfide
bond-stabilized difunctional antibody (ds diabody), single-chain
antibody molecule (scFv), scFv dimer (bivalent bifunctional
antibody), bivalent single-chain antibody (BsFv), multispecific
antibody, camelized single domain antibody, nanobody, domain
antibody and bivalent domain antibody. The antigen-binding fragment
can bind to the same antigen as the parent antibody. In some
embodiments, the antigen-binding fragment may contain one or more
CDRs from a specific human antibody, which are grafted into a
framework region derived from one or more different human
antibodies.
[0013] The "Fab" fragment of an antibody refers to a part of the
antibody molecule, which is composed of a light chain (including
the variable and constant regions), and a variable region and part
of a constant region of a heavy chain that are ligated via
disulfide bonds.
[0014] The "Fab'" fragment refers to a Fab fragment that contains a
part of the hinge region.
[0015] "F(ab').sub.2" refers to a dimer of Fab.
[0016] The Fc segment of an antibody is responsible for a variety
of different effector functions such as ADCC and CDC, but does not
participate in antigen-binding.
[0017] The "Fv" segment of an antibody refers to the smallest
antibody fragment that contains a complete antigen-binding site.
The Fv fragment is composed of a variable region of a light chain
and a variable region of a heavy chain.
[0018] The "single-chain Fv antibody" or "scFv" refers to an
engineered antibody in which a variable region of a light chain and
a variable region of a heavy chain are directly ligated or ligated
through a peptide chain (Huston J S et al., Proc Natl Acad Sci USA,
85: 5879 (1988)).
[0019] The "single-chain antibody Fv-Fc" or "scFv-Fc" refers to an
engineered antibody composed of scFv that is ligated to a Fc
segment of a certain antibody.
[0020] The "camelized single domain antibody", "heavy-chain
antibody" or "HCAb (heavy-chain-only antibodies, HCAb)" all refer
to antibodies containing two VH domains without light chain
(Riechmann L. and Muyldermans S., J Immunol Methods. 231(1-2):
25-38 (1999); Muyldermans S., J Biotechnol. 74(4): 277-302 (2001);
WO94/04678; WO94/25591; U.S. Pat. No. 6,005,079). The heavy chain
antibodies were originally derived from camelids (camels,
dromedaries, and llamas). Although their light chains are missing,
camelized antibodies have confirmed antigen-binding functions
(Hamers Casterman C. et al., Nature 363 (6428): 446-8 (1993);
Nguyen V K. et al., "Heavy-chain antibodies in Camelidae: a case of
evolutionary innovation, Immunogenetics. 54 (1): 39-47 (2002);
Nguyen V K. et al., Immunology. 109 (1): 93-101 (2003)). The
variable region of heavy chain antibody (VH domain) is the smallest
known antigen-binding unit produced by acquired immunity
(Koch-Nolte F. et al., FASEB J. 21 (13): 3490-8. Epub (2007)).
[0021] The "nanobody" refers to an antibody fragment, which is
composed of a VH domain derived from a heavy chain antibody and two
constant regions CH2 and CH3.
[0022] The "diabody" contains a small antibody fragment with two
antigen-binding sites, in which the fragment contains a VH domain
and a VL domain ligated to the same polypeptide chain (see,
Holliger P. et al., Proc Natl. Acad Sci US A. 90(14): 6444-8
(1993); EP404097; WO93/11161). The linker between the two domains
is so short that the two domains on the same chain cannot be paired
with each other, which forces the two domains to pair with the
complementary domains of the other chain to form two antibody
binding sites. These two antibody binding sites can target the same
or different antigens (or epitopes).
[0023] The "domain antibody" refers to an antibody fragment
containing only one heavy chain variable region or one light chain
variable region. In some cases, two or more VH domains are
covalently linked by a polypeptide linker to form a bivalent domain
antibody. The two VH domains of a bivalent domain antibody can
target the same or different antigens.
[0024] In some embodiments, "(dsFv).sub.2" contains three peptide
chains: two VH genes are linked by a polypeptide linker, and they
are ligated to two VL groups by disulfide bonds.
[0025] In some embodiments, the "bispecific ds bifunctional
antibody" contains VL1-VH2 (linked by a polypeptide linker) and
VH1-VL2 (also linked by a polypeptide linker), and the two are
linked between VH1 and VL1 via disulfide bonds.
[0026] The "dual-specific dsFv" or "dsFv-dsFv" contains three
polypeptide chains: VH1-VH2 group, in which the heavy chains of the
two are linked by a polypeptide linker (for example, a long elastic
linker), and they are respectively ligated to VL1 and VL2 groups
via disulfide bonds, and each pair of heavy and light chains paired
with disulfide bonds has a different antigen specificity.
[0027] In certain embodiments, the "scFv dimer" is a bivalent
difunctional antibody or bivalent single-chain antibody (BsFv),
containing two dimerized VH-VL (linked by a polypeptide linker)
groups, wherein the VH of one group and the VL of the other group
cooperate to form two binding sites, and the two binding sites can
target to the same antigen (or epitope) or different antigens (or
epitopes). In other embodiments, the "scFv dimer" is a
dual-specific difunctional antibody that contains VL1-VH2 (linked
by a polypeptide linker) and VH1-VL2 (linked by a polypeptide
linker), wherein VH1 and VL1 cooperate, VH2 and VL2 cooperate, and
each cooperated pair has a different antigen specificity.
[0028] For the term "fully human" used in the present application,
when it is applied to an antibody or antigen-binding fragment, it
refers to that the antibody or antigen-binding fragment has a
certain amino acid sequence or consists of the amino acid sequence,
in which the amino acid sequence corresponds to an amino acid
sequences of an antibody that is produced by a human or a human
immune cell, or derived from a non-human source such as a
transgenic non-human animal using a human antibody library, or
other sequence encoding a human antibody. In some embodiments, the
fully human antibody does not contain amino acid residues
(especially antigen-binding residues) derived from a non-human
antibody.
[0029] For the term "humanized" used in the present application,
when it is applied to an antibody or antigen-binding fragment, it
refers to that an antibody or antigen-binding fragment that
contains a CDR derived from a non-human animal, a FR region derived
from human, and a constant region derived from human (when
applicable). Since a humanized antibody or antigen-binding fragment
has a reduced immunogenicity, it can be used as a human therapeutic
in certain embodiments. In some embodiments, the non-human animal
is a mammal such as a mouse, rat, rabbit, goat, sheep, guinea pig,
or hamster. In some embodiments, the humanized antibody or
antigen-binding fragment consists essentially of human sequences,
except that the CDR sequence is non-human. In some embodiments, the
FR region derived from human may contain the same amino acid
sequence as the human antibody from which it is derived, or it may
contain some amino acid changes, for example, no more than 10, 9,
8, 7, 6, 5, 4, 3, 2 or 1 amino acid change. In some embodiments,
the amino acid change may be present only in the FR region of the
heavy chain, only in the FR region of the light chain, or in both
chains. In some preferred embodiments, the humanized antibody
comprises human FR1-3 and human JH and JK.
[0030] The term "chimeric" as used in the present application
refers to an antibody or antigen-binding fragment in which a part
of a heavy chain and/or light chain is derived from one species,
and the remaining part of the heavy chain and/or light chain is
derived from a different species. In an illustrative example, a
chimeric antibody may contain a constant region derived from a
human and a variable region derived from a non-human animal such as
a mouse.
[0031] The term "carcinoembryonic antigen cell adhesion molecule 5"
(CEACAM5, abbreviated as CEA, also known as CD66e; see, for
example, AAA51967.1/GI. 180223, 702 amino acids) refers to a
glycoprotein with a molecular weight of about 180 kDa. CEACAM5
contains 7 Ig-like domains, these 7 domains comprise a single
N-terminal Ig variable domain and 6 domains (A1-B1-A2-B2-A3-B3)
that are homologous to Ig constant domain. CEACAM is ligated to the
cell membrane via the carboxy-terminal
glycosyl-phosphatidyl-inositol (GPI) anchor.
[0032] The "specifically bind" or "specific binding" in the present
application refers to a non-random binding reaction between two
molecules, such as a reaction between an antibody and an antigen.
In some embodiments, the antibody or antigen-binding fragment
thereof of the present application specifically binds to a human
and/or monkey carcinoembryonic antigen cell adhesion molecule 5,
and its binding affinity (KD) is .ltoreq.10.sup.-6M. In the present
application, KD refers to a ratio of dissociation rate to binding
rate (koff/kon), which can be measured by surface plasmon
resonance, for example, using an instrument such as Biacore.
[0033] The "selective binding" in the present application refers to
that the antibody or antigen-binding fragment thereof of the
present application specifically binds to a CEACAM5 protein, but
does not substantially bind or binds at a significantly lower level
to another CEACAM protein, such as CEACAM1 protein, CEACAM3
Protein, CEACAM7 protein.
[0034] In some embodiments, the heavy chain constant region of the
antibody described in the present application is of human IgG1
type. In some embodiments, the light chain constant region of the
antibody described in the present application is a .kappa. chain.
In some embodiments, the heavy chain and light chain constant
regions of the antibody described in the present application are
human IgG1 and .kappa. chain, respectively.
[0035] In the present application, when "conservative substitution"
is applied to an amino acid sequence, it refers to that one amino
acid residue is replaced with another amino acid residue, in which
they have a side chain with similar physical and chemical
properties. For example, a conservation substitution may be
performed between amino acid residues with hydrophobic side chain
(for example, Met, Ala, Val, Leu and Ile), between residues with
neutral hydrophilic side chain (for example, Cys, Ser, Thr, Asn and
Gln), between residues with acidic side chain (for example, Asp,
Glu), between amino acids with basic side chain (for example, His,
Lys, and Arg), or between residues with aromatic side chain (for
example, Trp, Tyr, and Phe). It is known in the art that a
conservative substitution usually does not cause significant
changes in the conformational structure of the protein, and
therefore the biological activity of the protein can be
retained.
[0036] When "percent sequence identity" is applied to an amino acid
sequence (or nucleic acid sequence), it refers to that after
sequence alignment is performed, and intervals are introduced when
necessary to maximize the number of identical amino acids (or
nucleic acids), the percentage of the amino acid (or nucleic acid)
residues of a candidate sequence that are identical to the amino
acid (or nucleic acid) residues of a reference sequence. The amino
acid residues of conservative substitution may or may not be
considered as the identical residues. The sequence alignment can be
performed by tools disclosed in the art to determine the percent
sequence identity of amino acid (or nucleic acid) sequences. Those
skilled in the art can use the default parameters of the tools or
adjust the parameters appropriately according to the needs of the
alignment, for example, by selecting a suitable algorithm.
[0037] The "T cell" used in the present application includes
CD4.sup.+ T cell, CD8.sup.+ T cell, T helper type 1 T cell, T
helper type 2 T cell, T helper type 17 T cell, and suppressor T
cell.
[0038] The "effector function" as used in the present application
refers to the biological activity of the Fc region of an antibody
binding to its effector such as C1 complex and Fc receptor.
Exemplary effector function includes complement-dependent
cytotoxicity (CDC) induced by the interaction of the antibody with
C1q on the C1 complex, antibody-dependent cell-mediated
cytotoxicity (ADCC) induced by the binding of the Fc region of the
antibody to the Fc receptor on the effector cell, and
phagocytosis.
[0039] The "cancer" or "cancerous symptom" in the present
application refers to any medical condition that is mediated by
tumor or malignant cell growth, proliferation or metastasis, and
causes a solid tumor and non-solid tumor such as leukemia. The
"tumor" in the present application refers to a solid substance of
tumor and/or malignant cell.
[0040] The "treatment" or "therapy" of a certain condition
comprises preventing or alleviating a certain condition, reducing
the rise or development rate of a certain condition, reducing the
risk of developing a certain condition, and preventing or delaying
the development of a symptom associated with a certain condition,
reducing or terminating a symptom associated with a certain
condition, producing a complete or partial reversal of a certain
condition, curing a certain condition, or any combination thereof.
For a cancer, the "treatment" or "therapy" can refer to inhibiting
or slowing the growth, reproduction or metastasis of tumor or
malignant cells, or any combination of some of the above. For a
tumor, the "treatment" or "therapy" comprises removing all or part
of the tumor, inhibiting or slowing the growth and metastasis of
the tumor, preventing or delaying the development of the tumor, or
combination of some of the above.
[0041] The "isolated" material refers to that it has been
artificially changed from its natural state. If a certain
"isolated" substance or component appears in nature, it has been
changed or deviated from its original state, or both. For example,
polynucleotides or polypeptides naturally occurring in a living
animal has not been isolated, but if these polynucleotides or
polypeptides are sufficiently separated from the coexisting
substances in their natural state and exist in a sufficiently pure
state, they can be considered as being "isolated". In some
embodiments, the purity of antibody and antigen-binding fragment
thereof is at least 90%, 93%, 95%, 96%, 97%, 98%, 99%, which can be
determined by electrophoresis methods (for example, SDS-PAGE,
isoelectric focusing, capillary electrophoresis), or chromatography
(for example, ion exchange chromatography or reverse phase
HPLC).
[0042] The "vector" in the present application refers to a vehicle
into which a polynucleotide encoding a certain protein can be
operatively inserted to allow the protein be expressed. The vector
can be used to transform, transduce or transfect a host cell so
that a genetic material element it carries can be expressed in the
host cell. For example, the vector includes: plasmid, phagemid,
cosmid, artificial chromosome such as yeast artificial chromosome
(YAC), bacterial artificial chromosome (BAC) or P1-derived
artificial chromosome (PAC), bacteriophage such as X phage or M13
bacteriophage, and animal virus, etc. The types of animal virus
used as vector include retrovirus (including lentivirus,
adenovirus, adeno-associated virus, herpes virus (for example,
herpes simplex virus), poxvirus, baculovirus, papilloma virus,
papilloma vacuole virus (for example, SV40). The vector may contain
a variety of elements that control expression, including promoter
sequence, transcription initiation sequence, enhancer sequence,
selection element and reporter gene. In addition, the vector may
also contain a replication origin. The vector may also contain a
component that assists it to enter the cell, including but not
limited to, viral particle, liposome, or protein shell.
[0043] In the present application, "a host cell" refers to a cell
into which an exogenous polynucleotide and/or vector is introduced.
The host cell described in the present application includes, but is
not limited to, prokaryotic cell such as E. coli or Bacillus
subtilis, fungal cell such as yeast cell or Aspergillus, insect
cell such as S2 Drosophila cell or Sf9, or animal cell such as
fibroblast, CHO cell, COS cell, NSO cell, HeLa cell, BHK cell, HEK
293 cell or human cell.
[0044] In the present application, "chimeric antigen receptor" is
referred to as CAR, which refers to a cell surface receptor that
can recognize a specific antigen (for example, a tumor antigen),
which comprises an extracellular domain for recognizing the
specific antigen (for example, an antigen-binding fragment that can
recognize and bind to the specific antigen) and an intracellular
domain for transmit an extracellular signal to inside of the cell
(also referred to as intracellular signal transduction region, for
example, the .delta. chain of CD3 or the intracellular part of
Fc.epsilon.RI.gamma.). The T cell that carries and expresses such
chimeric antigen receptor is called CAR-T cell, which can recognize
and bind to the specific antigen and a cell (for example, tumor
cell) expressing the specific antigen through the extracellular
domain, and by the intracellular signal transduction function, it
can activate immune response, release a large number of various
effectors, and efficiently kills a cell expressing the specific
antigen (for example, tumor cell), thereby exerting a therapeutic
effect (for example, treatment of tumor).
[0045] Based on the shortcomings of the prior art, one of the main
objects of the present application is to provide an anti-CEACAM5
antibody with stronger specificity and better selectivity. The
present application also provides a preparation method and use of
the antibody, and the anti-CEACAM5 antibody of the present
application can be used for detection and/or treatment of a
tumor.
Antibody of the Present Application
[0046] In one aspect, the present application provides an antibody
or antigen-binding fragment thereof that specifically binds to
CEACAM5 protein, wherein the antibody or antigen-binding fragment
thereof comprises: [0047] (a) a heavy chain variable region (VH)
comprising the following 3 complementarity determining regions
(CDRs): [0048] (i) VH CDR1, which consists of the following
sequence: SEQ ID NO: 1, or a sequence having a substitution,
deletion or addition of one or several amino acids (for example, a
substitution, deletion or addition of 1, 2 or 3 amino acids) as
compared therewith, [0049] (ii) VH CDR2, which consists of the
following sequence: SEQ ID NO: 2, or a sequence having a
substitution, deletion or addition of one or several amino acids
(for example, a substitution, deletion or addition of 1, 2 or 3
amino acids) as compared therewith, and [0050] (iii) VH CDR3, which
consists of the following sequence: SEQ ID NO: 3, or a sequence
having a substitution, deletion or addition of one or several amino
acids (for example, a substitution, deletion or addition of 1, 2 or
3 amino acids) as compared therewith; [0051] and/or, [0052] (b) a
light chain variable region (VL) comprising the following 3
complementarity determining regions (CDRs): [0053] (iv) VL CDR1,
which consists of the following sequence: SEQ ID NO: 4, or a
sequence having a substitution, deletion or addition of one or
several amino acids (for example, a substitution, deletion or
addition of 1, 2 or 3 amino acids) as compared therewith, [0054]
(v) VL CDR2, which consists of the following sequence: SEQ ID NO:
5, or a sequence having a substitution, deletion or addition of one
or several amino acids (for example, a substitution, deletion or
addition of 1, 2 or 3 amino acids) as compared therewith, and
[0055] (vi) VL CDR3, which consists of the following sequence: SEQ
ID NO: 6, or a sequence having a substitution, deletion or addition
of one or several amino acids (for example, a substitution,
deletion or addition of 1, 2 or 3 amino acids) as compared
therewith.
[0056] In certain embodiments, the substitution described in any
one of (i) to (vi) is a conservative substitution.
[0057] In certain embodiments, the CDRs described in any one of (i)
to (vi) are defined according to the Kabat numbering system.
[0058] In certain embodiments, the antibody or antigen-binding
fragment thereof comprises the following three heavy chain CDRs: VH
CDR1 having a sequence as shown in SEQ ID NO: 1, VH CDR2 having a
sequence as shown in SEQ ID NO: 2, and VH CDR3 having a sequence as
shown in SEQ ID NO: 3; and/or, the following three light chain
CDRs: VL CDR1 having a sequence as shown in SEQ ID NO: 4, VL CDR2
having a sequence as shown in SEQ ID NO: 5, and VL CDR3 having a
sequence as shown in SEQ ID NO: 6. In certain embodiments, the
heavy chain CDRs and light chain CDRs are defined according to the
Kabat numbering system.
[0059] In one aspect, the present application provides an antibody
or antigen-binding fragment thereof that specifically binds to
CEACAM5 protein, wherein the antibody or antigen-binding fragment
thereof comprises: 3 CDRs contained in a heavy chain variable
region (VH) as shown in SEQ ID NO: 7 and/or 3 CDRs contained in a
light chain variable region (VL) as shown in SEQ ID NO: 8. In
certain embodiments, the 3 CDRs contained in the VH and/or the 3
CDRs contained in the VL are defined by the Kabat, IMGT or Chothia
numbering system.
[0060] In certain embodiments, the antibody or antigen-binding
fragment thereof comprises: [0061] (a) a heavy chain variable
region (VH), which comprises an amino acid sequence selected from
the following: [0062] (i) the sequence shown in SEQ ID NO: 7;
[0063] (ii) a sequence having a substitution, deletion or addition
of one or several amino acids (for example, a substitution,
deletion or addition of 1, 2, 3, 4 or 5 amino acids) as compared
with the sequence shown in SEQ ID NO: 7; or [0064] (iii) a sequence
having a sequence identity of at least 80%, at least 85%, at least
90%, at least 91%, at least 92%, at least 93%, at least 94%, at
least 95%, at least 96%, at least 97%, at least 98%, at least 99%,
or 100% as compared with the sequence shown in SEQ ID NO: 7; [0065]
and/or [0066] (b) a light chain variable region (VL), which
comprises an amino acid sequence selected from the following:
[0067] (iv) the sequence shown in SEQ ID NO: 8; [0068] (v) a
sequence having a substitution, deletion or addition of one or
several amino acids (for example, a substitution, deletion or
addition of 1, 2, 3, 4 or 5 amino acids) as compared with the
sequence shown in SEQ ID NO: 8; or [0069] (vi) a sequence having a
sequence identity of at least 80%, at least 85%, at least 90%, at
least 91%, at least 92%, at least 93%, at least 94%, at least 95%,
at least 96%, at least 97%, at least 98%, at least 99%, or 100% as
compared with the sequence shown in SEQ ID NO: 8.
[0070] In certain embodiments, the substitution described in (ii)
or (v) is a conservative substitution.
[0071] In certain exemplary embodiments, the antibody or
antigen-binding fragment thereof comprises: VH comprising the
sequence shown in SEQ ID NO: 7 and VL comprising the sequence shown
in SEQ ID NO: 8.
[0072] The antibody or antigen-binding fragment thereof of the
present application may comprise a constant region sequence derived
from a mammalian (for example, murine or human) immunoglobulin or a
variant thereof, in which the variant has a substitution, deletion
or addition of one or several amino acids or any combination
thereof (for example, a substitution, deletion or addition of at
most 20, at most 15, at most 10, or at most 5 amino acids, or any
combination thereof; for example, a substitution, deletion or
addition of 1, 2, 3, 4 or 5 amino acids, or any combination
thereof) as compared with the sequence from which it is
derived.
[0073] In certain embodiments, the antibody or antigen-binding
fragment thereof of the present application has a heavy chain
comprising a heavy chain constant region (CH) of a human
immunoglobulin or a variant thereof, wherein the variant has a
substitution, deletion or addition of one or several amino acids or
any combination thereof (for example, a substitution, deletion or
addition of at most 20, at most 15, at most 10, or at most 5 amino
acids, or any combination thereof; for example, a substitution,
deletion or addition of 1, 2, 3, 4 or 5 amino acids, or any
combination thereof) as compared with the sequence from which it is
derived; and/or,
[0074] in certain embodiments, the antibody or antigen-binding
fragment thereof of the present application has a light chain
comprising a light chain constant region (CL) of a human
immunoglobulin or a variant thereof, wherein the variant has a
substitution, deletion or addition of one or several amino acids or
any combination thereof (for example, a substitution, deletion or
addition of at most 20, at most 15, at most 10, or at most 5 amino
acids, or any combination thereof; for example, a substitution,
deletion or addition of 1, 2, 3, 4 or 5 amino acids, or any
combination thereof) as compared with the sequence from which it is
derived.
[0075] In some embodiments, the variant of the heavy chain constant
region (CH) may have conservative substitution of one or several
amino acids (for example, conservative substitution of 1, 2, 3, 4
or 5 amino acids) as compared with the sequence from which it is
derived.
[0076] In some embodiments, the variant of the light chain constant
region (CL) may have conservative substitution of one or several
amino acids (for example, conservative substitution of 1, 2, 3, 4
or 5 amino acids) as compared with the sequence from which it is
derived.
[0077] In certain embodiments, the heavy chain constant region is
an IgG heavy chain constant region, such as IgG1, IgG2, IgG3, or
IgG4 heavy chain constant region. In certain embodiments, the heavy
chain constant region is a human IgG1, IgG2, IgG3, or IgG4 heavy
chain constant region.
[0078] In certain embodiments, the light chain constant region is a
.kappa. light chain constant region. In certain embodiments, the
light chain constant region is a human .kappa. light chain constant
region.
[0079] In certain exemplary embodiments, the antibody or
antigen-binding fragment thereof of the present application
comprises a heavy chain constant region (CH) shown in SEQ ID NO: 9;
and/or, a light chain constant region (CL) shown in SEQ ID NO:
11.
[0080] In certain embodiments, the antigen-binding fragment is
selected from the group consisting of Fab, Fab', (Fab').sub.2, Fv,
disulfide-linked Fv, scFv, diabody, and single domain antibody
(sdAb).
[0081] In certain embodiments, the antibody is a murine antibody,
chimeric antibody, humanized antibody, bispecific antibody, or
multispecific antibody.
[0082] The antibody or antigen-binding fragment thereof of the
present application has one or more activities selected from the
following: [0083] 1) specifically binding to CEACAM5 protein or a
cell expressing CEACAM5 protein; [0084] 2) basically not binding to
CEACAM1, CEACAM3, CEACAM6, CEACAM7 proteins or a cell expressing
CEACAM1, CEACAM3, CEACAM6, CEACAM7 proteins; [0085] 3) only weakly
binding to CEACAM8 protein or a cell expressing CEACAM8 protein, in
which the binding affinity is significantly lower than the binding
affinity to CEACAM5 protein or a cell expressing CEACAM5 protein;
[0086] 4) having ADCC activity; [0087] 5) capable of inhibiting or
killing a tumor cell expressing CEACAM5 protein (for example, colon
cancer cell, gastric cancer cell), thereby having tumor treatment
activity.
[0088] In certain embodiments, the antibody or antigen-binding
fragment thereof of the present application comprises a label. In
some embodiments, the antibody or antigen-binding fragment thereof
comprises a detectable label, such as enzyme (for example,
horseradish peroxidase), radionuclide, fluorescent dye, luminescent
substance (for example, chemiluminescent substance) or biotin.
[0089] In certain embodiments, the present application provides an
exemplary anti-CEACAM5 antibody UM05-6L.
[0090] Those skilled in the art should understand that the
aforementioned CDR sequences can be modified to include
substitution of one or more amino acids, thereby obtaining improved
biological activity such as improved binding affinity to human
carcinoembryonic antigen cell adhesion molecule 5. For example, the
phage display technology can be used to produce and express an
antibody variant library (for example, Fab or FcFv variants), and
then screen for an antibody that has affinity with CEACAM5. In
another example, computer software can be used to simulate the
binding of the antibody to CEACAM5 and identify the amino acid
residues on the antibody that form the binding interface. The
substitution of these residues may be avoided to prevent a decrease
in binding affinity, or these residues can be targeted for
substitution to form stronger binding. In certain embodiments, at
least one (or all) substitutions in the CDR sequences is
conservative substitution.
[0091] In certain embodiments, the antibody or antigen-binding
fragment comprises one or several CDR sequences, and these CDR
sequences have a sequence identity of at least 80% (for example, at
least 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%)
as compared with SEQ ID NO: 1-6, and at the same time retain
similar or even higher binding affinity to CEACAM5 as compared with
their parent antibody. The parent antibody has substantially the
same sequences, but its corresponding CDR sequences have a sequence
identity of 100% compared with the sequences listed in SEQ ID NO:
1-6.
[0092] In some embodiments, the antibody or antigen-binding
fragment described in the present application can specifically bind
to CEACAM5 with a binding affinity (KD) of .ltoreq.10.sup.-7M,
which can be measured by surface plasmon resonance. The binding
affinity value can be expressed by a KD value, which is obtained by
the calculation of a ratio of dissociation rate to binding rate
(koff/kon) when the binding of the antigen to the antigen-binding
molecule reaches equilibrium. The antigen-binding affinity (for
example, KD) can be appropriately determined by a suitable method
known in the art, for example, a plasmon resonance binding method
comprising the use of an instrument such as Biacore.
[0093] In some embodiments, the antibody or antigen-binding
fragment described in the present application binds to CEACAM5 at
an EC50 (i.e., half-binding concentration) of 1 ng/mL to 10 g/mL.
The binding of the antibody or antigen-binding fragment to CEACAM5
can be determined by a method known in the art, such as a sandwich
method such as ELISA, Western blot, FACS or other binding assays.
In an exemplary example, the antibody to be tested (i.e., primary
antibody) is bound to immobilized CEACAM5 or cells expressing
CEACAM5, then the unbound antibody is washed away, and a labeled
secondary antibody is introduced, which can bind to the primary
antibody, and therefore the bound secondary antibody is detected.
When immobilized carcinoembryonic antigen cell adhesion molecule 5
is used, the detection can be performed on a microplate reader, or
when cells expressing CEACAM5 are used, FACS analysis can be used
for the detection.
[0094] In some embodiments, the antibody or antigen-binding
fragment described in the present application binds to CEACAM5 at
an EC50 (i.e., effective concentration of 50%) of 10 ng/mL to g/mL
(determined by FACS analysis).
[0095] The antibody is specific for CEACAM5. In certain
embodiments, the antibody optionally does not bind to CEACAM1,
CEACAM3, CEACAM6, CEACAM7, and binds to CEACAM8 with a binding
affinity that is significantly lower than that of CEACAM5.
[0096] In some embodiments, the antibody described in the present
application can be used in combination with an immunogenic
substance, such as tumor cell, purified tumor antigen, cells
transfected with encoding immunostimulatory factor, and tumor
vaccine. In addition, the anti-CEACAM5 antibody and antigen-binding
fragment thereof can be comprised in a combination therapy,
including standard chemotherapy and radiation therapy, target-based
small molecule therapy, and other emerging immune checkpoint
modulator therapy. In some embodiments, the antibody and
antigen-binding fragment thereof can be used as a basic molecule of
antibody-drug conjugate, bispecific or multivalent antibody.
[0097] In some embodiments, the antibody and antigen-binding
fragment thereof described in the present application is camelized
single chain domain antibody, diabody, scFv, scFv dimer, BsFv,
dsFv, (dsFv).sub.2, dsFv-dsFv', Fv fragment, Fab, Fab',
F(ab').sub.2, ds diabody, nanobody, domain antibody or bivalent
domain antibody.
[0098] In some embodiments, the antibody described in the present
application comprises an immunoglobulin constant region. In some
embodiments, the immunoglobulin constant region comprises a heavy
chain and/or light chain constant region. The heavy chain constant
region comprises CH1, CH1-CH2 or CH1-CH3 regions. In some
embodiments, the immunoglobulin constant region may further
comprise one or more modifications to obtain a desired property.
For example, the constant region can be modified to reduce or
eliminate one or several effector functions, enhance FcRn receptor
binding, or introduce one or several cysteine residues.
[0099] In some embodiments, the antibody and antigen-binding
fragment thereof further comprises a conjugate. It is conceivable
that the antibody or antigen-binding fragment thereof of the
present application can be linked to a variety of conjugates (see,
for example, "Conjugate Vaccines", Contributions to Microbiology
and Immunology, J M Cruse and R E Lewis, Jr. (eds.), Carger Press,
New York (1989)). These conjugates can be linked to the antibody or
antigen-binding fragment by other means such as covalent binding,
affinity binding, embedding, coordinate binding, complexation,
binding, mixing or addition. In some embodiments, the antibody and
antigen-binding fragment disclosed in the present application can
be engineered to contain specific sites other than the epitope
binding portion, and these sites can be used to bind one or several
conjugates. For example, such a site may comprise one or several
reactive amino acid residues, such as cysteine residues and
histidine residues, to facilitate covalent attachment to the
conjugate. In certain embodiments, the antibody may be attached to
the conjugate indirectly, or be attached to the conjugate through
another conjugate. For example, the antibody or antigen-binding
fragment thereof can bind to biotin and then indirectly bind to a
second conjugate, which is linked to avidin. The conjugate may be a
detectable label, pharmacokinetic modification part, purification
part or cytotoxic part. Examples of detectable label may include
fluorescent label (for example, fluorescein, rhodamine, dansyl,
phycoerythrin or Texas red), enzyme substrate label (for example,
horseradish peroxidase, alkaline phosphatase), luciferase,
glucoamylase, lysozyme, glucose oxidase or 3-D galactosidase),
stable isotope or radioisotope, chromophore moiety, digoxin,
biotin/avidin, DNA molecule or gold for testing. In certain
embodiments, the conjugate may be a pharmacokinetic modification
part such as PEG, which helps extend the half-life of the antibody.
Other suitable polymers include, for example, carboxymethyl
cellulose, dextran, polyvinyl alcohol, polyvinylpyrrolidone,
ethylene glycol/propylene glycol copolymer, and the like. In some
embodiments, the conjugate may be a purified part such as magnetic
beads. The "cytotoxic part" can be any agent that is harmful to a
cell or may damage or kill a cell. Examples of the cytotoxic part
include, but are not limited to, paclitaxel, cytochalasin B,
gramicidin D, ethidium bromide, emetine, mitomycin, etoposide,
teniposide, vincristine, vinblastine, colchicine, doxorubicin,
daunorubicin, dihydroxy-anthracin-dione, mitoxantrone, mithramycin,
actinomycin D, 1-dehydrotestosterone, glucocorticoid, procaine,
tetracaine, lidocaine, propranolol, puromycin and analogue thereof,
antimetabolite (for example, methotrexate, 6-mercaptopurine,
6-mercaptoguanine, cytarabine, 5-fluorouracil, dacarbazine),
alkylating agent (for example, chlormethine, thiotepa chlorambucil,
melphalan, carmustine (BSNU) and lomustine (CCNU),
cyclophosphamide, Busulfan, dibromomannitol, streptozotocin,
mitomycin C, and cis-dichlorodiamine platinum (DDP) cisplatin),
anthracycline antibiotic (for example, daunorubicin (formerly known
as daunomycin) and adriamycin), antibiotic (for example,
dactinomycin (formerly known as actinomycin), bleomycin,
mithramycin, and ampicillin (AMC)), and antimitotic agent (for
example, vincristine and vinblastine).
Nucleic Acid Molecule and Recombination Method
[0100] The antibody of the present application can be prepared by
various methods known in the art, for example, obtained by genetic
engineering recombination technology. For example, a DNA molecule
encoding the antibody or antigen-binding fragment thereof of the
present application can be obtained by chemical synthesis or PCR
amplification. The resulting DNA molecule is inserted into an
expression vector and then transfected into a host cell. Then, the
transfected host cell is cultured under a specific condition, and
the antibody or antigen-binding fragment thereof of the present
application is expressed.
[0101] The antigen-binding fragment of the present application can
be obtained by hydrolyzing an intact antibody molecule (see
Morimoto et al., J. Biochem. Biophys. Methods 24:107-117 (1992);
and Brennan et al., Science 229:81 (1985)). In addition, these
antigen-binding fragments can also be directly produced by
recombinant host cells (reviewed in Hudson, Curr. Opin. Immunol.
11: 548-557 (1999); Little et al., Immunol. Today, 21: 364-370
(2000))). For example, Fab' fragments can be obtained directly from
the host cells; Fab' fragments can be chemically coupled to form
F(ab').sub.2 fragments (Carter et al., Bio/Technology, 10: 163-167
(1992)). In addition, Fv, Fab or F(ab').sub.2 fragments can also be
directly isolated from the recombinant host cell culture medium.
Those of ordinary skill in the art are fully aware of other
techniques for preparing these antigen-binding fragments.
[0102] In some specific embodiments, the preparation method of the
anti-CEACAM5 antibody or antigen-binding fragment thereof provided
in the present application comprises the following steps: [0103] 1)
using a Balb/c mouse immunized with a CHO cell line overexpressing
carcinoembryonic antigen cell adhesion molecule 5 as a material,
extracting and fusing a spleen cell with a mouse myeloma cell line
SP2/0-AG14 to obtain a hybridoma cell line capable of expressing
anti-CEACAM5 antibody or antigen-binding fragment thereof, [0104]
2) cloning and expressing a gene of anti-CEACAM5 antibody or
antigen-binding fragment thereof in the hybridoma cell line
obtained in step 1); [0105] 3) providing an expression vector, the
expression vector comprising the gene cloned in step [0106] 2) and
an expression control sequence operatively ligated to the gene;
[0107] 4) transforming a host cell with the expression vector
described in step 3); [0108] 5) culturing the host cell obtained in
step 4); [0109] 6) separating and purifying to obtain a monoclonal
antibody.
[0110] In another aspect, the present application provides a
hybridoma cell line used in the above preparation method.
[0111] In the present application, a human-mouse hybridoma that
secretes a specific anti-CEACAM5 antibody is prepared, the heavy
chain and light chain sequences (100% human genes) of the antibody
are cloned by using molecular biology techniques, and an anti-human
carcinoembryonic antigen cell adhesion molecule 5 human monoclonal
antibody is constructed, that the antibody is expressed and
produced by CHO cells. Compared with existing antibodies, these
antibodies as drugs have stronger binding capacity and
specificity.
[0112] In another aspect, the present application provides an
isolated nucleic acid molecule, which comprises a nucleotide
sequence encoding the antibody or antigen-binding fragment thereof
of the present application, or the heavy chain variable region of
and/or light chain variable region thereof. In certain embodiments,
the nucleic acid molecule comprises a nucleotide coding sequence as
shown in SEQ ID NO: 14 and/or SEQ ID NO: 15.
[0113] In another aspect, the present application provides a vector
(for example, cloning vector or expression vector), which comprises
the isolated nucleic acid molecule as described above. In certain
embodiments, the vector of the present application is a plasmid,
cosmid, bacteriophage, or the like.
[0114] In certain embodiments, the vector comprises a first
nucleotide sequence encoding a heavy chain variable region of the
antibody or antigen-binding fragment thereof of the present
application, and/or a second nucleotide sequence encoding a light
chain variable region of the antibody or antigen-binding fragment
thereof of the present application. In some embodiments, the first
nucleotide sequence and the second nucleotide sequence are provided
on the same or different vectors.
[0115] In another aspect, the present application provides a host
cell, which comprises the isolated nucleic acid molecule or vector
as described above. In certain embodiments, the host cell is a
mammalian cell. In certain embodiments, the host cell is a human,
murine, sheep, horse, dog, or cat cell. In certain embodiments, the
host cell is a Chinese hamster ovary cell.
[0116] In another aspect, a method for preparing the antibody or
antigen-binding fragment thereof of the present application is
provided, which comprises culturing the host cell as described
above under a condition that allows expression of the antibody or
antigen-binding fragment thereof, and recovering the antibody or
antigen-binding fragment thereof from a culture of the host
cell.
[0117] In another aspect, the present application also provides a
bispecific or multispecific molecule, which comprises the antibody
or antigen-binding fragment thereof. In certain embodiments, the
bispecific or multispecific molecule specifically binds to CEACAM5,
and additionally specifically binds to one or several other
targets. In certain embodiments, the bispecific or multispecific
molecule further comprises at least one molecule (for example, a
second antibody) with a second binding specificity for a second
target.
[0118] In another aspect, the present application also provides an
immunoconjugate, which comprises the antibody or antigen-binding
fragment thereof and a therapeutic agent conjugated to the antibody
or antigen-binding fragment thereof. In certain embodiments, the
therapeutic agent is selected from cytotoxic agents. In certain
embodiments, the therapeutic agent is selected from the group
consisting of alkylating agent, mitotic inhibitor, anti-tumor
antibiotic, antimetabolite, topoisomerase inhibitor,
tyrosine-kinase inhibitor, radionuclide agent, and any combination
thereof. In certain embodiments, the immunoconjugate is an
antibody-drug conjugate (ADC).
[0119] Using genetic engineering techniques well-known in the art,
an amino acid sequence of the antibody and antigen-binding fragment
thereof described in the present application can be converted into
a corresponding DNA coding sequence. Due to the degeneracy of the
genetic code, the DNA sequence obtained by the conversion may not
be completely consistent, while the encoded protein sequence
remains unchanged.
[0120] Using recombinant techniques well-known in the art, a vector
comprising a polynucleotide encoding the antibody and
antigen-binding fragment thereof can be introduced into a host cell
for cloning (amplification of DNA) or gene expression. In another
embodiment, the antibody and antigen-binding fragment thereof can
be prepared by homologous recombination methods known in the art. A
variety of vectors are available. Vector components usually
include, but are not limited to, two or more of the following:
signal sequence, replication origin, one or several marker genes,
enhancer sequence, promoters (for example: SV40, CMV, EF-1a) and
transcription termination sequence.
[0121] In some embodiments, the vector system includes mammalian,
bacterial, yeast system, etc., and will comprise vectors such as
plasmids, including but not limited to pALTER, pBAD, pcDNA, pCal,
pL, pELpGEMEX, pGEX, pCLpCMV, pEGFP, pEGFT, pSV2, pFUSE, pVITRO,
pVIVO, pMAL, pMONO, pSELECT, pUNO, pDUO, Psg5L, pBABE, pWPXL, pBI,
p15TV-L, pPro18, pTD, pRS420, pLexA, pACT2 and other vectors that
can be obtained from laboratories or are commercially available.
Suitable vector may include plasmid or viral vector (for example,
replication-defective retrovirus, adenovirus, and adeno-associated
virus).
[0122] The vector comprising a polynucleotide encoding the antibody
and antigen-binding fragment thereof can be introduced into a host
cell for cloning or gene expression. The host cell suitable for
cloning or expressing the DNA in the vector in the present
application is a prokaryotic cell, yeast or the above-mentioned
higher eukaryotic cell. Prokaryotic cell suitable for use in the
present application includes eubacteria, such as Gram-negative
bacteria or Gram-positive bacteria, such as Enterobacteriaceae (for
example, Escherichia coli), Enterobacter spp., Erwinia spp.,
Klebsiella spp., Proteus spp., Salmonella spp. such as Salmonella
typhimurium, Serratia spp. such as Serratia marcescens, and
Shigella spp., and Bacillus spp. such as Bacillus subtilis and
Bacillus licheniformis, Pseudomonas spp. such as Pseudomonas
aeruginosa and Streptomyces.
[0123] In addition to prokaryotic cells, eukaryotic microorganisms
such as filamentous fungi or yeast can also be used as host cells
for cloning or expressing the vector encoding the antibody.
Saccharomyces cerevisiae, or bread yeast, is the most commonly used
lower eukaryotic host microorganism. However, many other genera,
species and strains are more commonly used and applicable in the
present application, such as Schizosaccharomyces pombe;
Kluyveromyces hosts such as Kluyveromyces lactis, Kluyveromyces
fragilis (ATCC12424), Kluyveromyces bulgaricus (ATCC16045),
Kluyveromyces weichii (ATCC24178), Kluyveromyces (ATCC56500),
Kluyveromyces drosophila (ATCC36906), Kluyveromyces thermotolerans
and Kluyveromyces marxianus: Yarrowia lipolytica (EP402226); Pichia
pastoris (EP183070); Candida: Trichoderma reesei (EP244234);
Neurospora; Schwann yeast, such as: Schwanniomyces occidentalis;
and filamentous fungi, such as Neurospora, Penicillium, Curvularia,
and Aspergillus, such as Aspergillus nidulans and Aspergillus
niger.
[0124] The host cell suitable for expressing glycosylated antibody
or antigen-binding fragment thereof provided in the present
application is derived from a multicellular organism. Examples of
invertebrate cells include plant and insect cells. A variety of
baculoviral strains and their variants, as well as the
corresponding permissive insect host cells, have been discovered,
from hosts such as the following: Spodoptera frugiperda
(caterpillar), Aedes aegypti (mosquito), Aedes albopictus
(mosquito), Drosophila melanogaster (drosophila) and Bombyx mori
(silkworm). A variety of virus strains used for transfection are
publicly available, such as Autographa californica nuclear
polyhedrosis virus and Bm-5 variant of Bombyx mori nuclear
polyhedrosis virus. These viruses can be used in the present
application, especially used to transfect Spodoptera frugiperda
cells. Plant cell cultures of cotton, corn, potato, soybean,
petunia, tomato and tobacco can also be used as hosts.
[0125] However, the most interesting is spinal cells, and the
cultivation of spinal cells (tissue culture) has become a routine
operation. Examples of available mammalian host cells include
SV40-transformed monkey kidney cell line CV1 (COS-7, ATCC CRL
1651); human embryonic kidney cell line (293 or suspension cultured
293 cell subclone, Graham et al.]. Gen Virol. 36:59 (1977)); young
hamster kidney cell (B blood, ATCC CCL 10); Chinese hamster ovary
cell/-DHFR (CHO, Urlaub et al., Proc. Natl. Acad. Sci. USA 77: 4216
(1980)); mouse sertoli cell (TM4, Mather J P, Biol. Reprod.
23:243-252 (1980)); monkey kidney cell (CV1ATCC CCL 70); African
green monkey kidney cell (VERO-76, ATCC CRL-1587); human cervical
cancer cell (HELA, ATCC CCL 2); canine kidney cell (MDCK, ATCC CCL
34); Buffalo rat liver cell (BRL 3A, ATCC CRL 1442); human lung
cell (W138, ATCC CCL75); human liver cell (Hep G2, HB 8065); mouse
breast tumor (MMT 060562, ATCC CCL51); TRI cell (Mather et al.,
Annals NY Acad. Sci. 383: 44-68 (1982)); MRC 5 cell; FS4 cell; and
human liver cancer cell line (HepG2). In certain preferred
embodiments, the host cell is a 293F cell.
[0126] The host cell is introduced with the above-mentioned
expression or cloning vector that can produce the antibody and
antigen-binding fragment thereof, and it was cultured in a
conventional nutrient medium, in which the nutrient medium is
modified to be suitable for promoter induction and selective
transformation of cell or amplification of gene encoding a target
sequence.
[0127] The host cell used in the present application to produce the
antibody and antigen-binding fragment thereof can be cultured in a
variety of media well-known in the art. The medium may further
contain any other necessary additives in appropriate concentrations
known in the art. The conditions of the medium, such as
temperature, pH and the like, are the conditions previously used
for selecting host cells for expression, and are well known to
those of ordinary skill.
[0128] When using recombinant technology, the antibody can be
produced intracellularly, in the periplasmic space, or directly
secreted into the culture medium. If the antibody is produced
intracellularly, the particulate remains of the host cells or lysed
fragments are first removed, for example, by centrifugation or
ultrasound. Carter et al., Bio/Technology 10:163-167 (1992)
describe a method for separating an antibody secreted into the
periplasmic space of E. coli. Briefly, the cell paste is melted for
more than 30 minutes in the presence of uranyl acetate (pH 3.5),
EDTA and PMSF. Centrifugation is performed to remove cell debris.
If the antibody is secreted into the culture medium, a commercially
available protein concentration filter, such as Iamicon or
Millipore Pellicon ultrafiltration unit, is usually first used to
concentrate the supernatant of the expression system. In any of the
foregoing steps, a protease inhibitor such as PMSF to inhibit
protein degradation, and an antibiotic to prevent the growth of
accidental contaminants can be added.
[0129] The antibody produced from the cells can be purified by a
purification method, such as hydroxyapatite chromatography, gel
electrophoresis, dialysis, DEAE-cellulose ion exchange
chromatography column, ammonium sulfate precipitation, salting out,
and affinity chromatography, in which affinity chromatography is
the preferred purification technique. The type of the antibody and
the presence of any immunoglobulin Fc domain in the antibody
determine whether protein A is suitable as an affinity ligand.
Protein A can be used to purify an antibody based on human
.gamma.1, .gamma.2, or .gamma.4 heavy chain (Lindmark et al., J.
Immunol. Meth. 62:13 (1983)). Protein G is suitable for all murine
isoforms and human .gamma.3 (Guss et al., EMBO J. 5:1567 1575
(1986)). Agarose is the most commonly used affinity ligand
attachment matrix, but other matrices can also be used.
Mechanically stable substrates such as controlled pore glass or
polystyrene can achieve faster flow rate and shorter processing
time in comparison with agarose. If the antibody contains the CH3
domain, it can be purified with Bakerbond ABX.TM. resin (J. T.
Baker, Phillipsburg, N.J.). Other protein purification techniques
can also be determined according to the antibodies that need to be
obtained, such as fractionation in ion exchange column, ethanol
precipitation, reversed-phase HPLC, silica gel chromatography,
heparin sepharose chromatography based on anion or cation exchange
resins (for example, polyaspartate column), chromatographic
focusing, SDS-PAGE, and ammonium sulfate precipitation.
[0130] After any preliminary purification steps, the mixture
containing the antibody of interest and impurities can be treated
by low pH hydrophobic interaction chromatography using an elution
buffer with a pH of about 2.5 to 4.5, preferably at a low salt
concentration (for example, a salt concentration from about 0 to
0.25M).
Pharmaceutical Composition and Therapeutic Use
[0131] In another aspect, the present application provides a
pharmaceutical composition, which comprises the antibody or
antigen-binding fragment thereof of the present application, the
bispecific or multispecific molecule of the present application or
the immunoconjugate of the present application, and a
pharmaceutically acceptable carrier and/or excipient.
[0132] In certain embodiments, the pharmaceutical composition may
also comprise an additional pharmaceutically active agent.
[0133] In certain embodiments, the additional pharmaceutically
active agent is a drug with an anti-tumor activity, such as
alkylating agent, mitotic inhibitor, anti-tumor antibiotic,
antimetabolite, topoisomerase inhibitor, tyrosine kinase inhibitor,
radionuclide agent, radiosensitizer, anti-angiogenesis agent,
cytokine, molecular-targeted drug, immune checkpoint inhibitor or
oncolytic virus.
[0134] In certain embodiments, the antibody or antigen-binding
fragment thereof, bispecific or multispecific molecule or
immunoconjugate and the additional pharmaceutically active agent
are provided as separate components or as components of the same
composition. The antibody or antigen-binding fragment thereof of
the present application and the additional pharmaceutically active
agent can be administered simultaneously, separately or
sequentially.
[0135] The present application further provides a pharmaceutical
composition comprising the antibody and one or several
pharmaceutically acceptable carriers.
[0136] The pharmaceutically acceptable carrier used in the
pharmaceutical composition disclosed in the present application may
include, for example, a pharmaceutically acceptable liquid, gel or
solid carrier, aqueous phase medium, non-aqueous phase medium,
antimicrobial substance, isotonic substance, buffer, antioxidant,
anesthetic, suspending agent/dispersant, integrating agent,
diluent, adjuvant, excipient or non-toxic auxiliary substance,
other components known in the art, or any combination of the
above.
[0137] Suitable component may include, for example, antioxidant,
filler, binder, disintegrant, buffer, preservative, lubricant,
flavor, thickener, colorant, emulsifier or stabilizer such as sugar
and cyclodextrin. Suitable antioxidant may include, for example,
methionine, ascorbic acid, EDTA, sodium thiosulfate, platinum,
catalase, citric acid, cysteine, mercaptoglycerol, thioglycolic
acid, mercaptosorbitol, butylmethylanisole, butylated
hydroxytoluene and/or propyl gallate. If one or several
antioxidants such as methionine is present in a composition
containing the antibody disclosed in the present application, the
oxidation of the antibody may be reduced. The reduction in
oxidation can prevent or reduce the decrease in binding affinity,
thereby improving antibody stability and extending shelf life.
[0138] Furthermore, the pharmaceutically acceptable carrier may
include, for example, aqueous medium such as sodium chloride
injection, Ringer's solution injection, isotonic dextrose
injection, sterile water injection, or glucose and lactate Ringer's
injections, non-aqueous medium such as: plant-derived fixed oil,
cotton seed oil, corn oil, sesame oil, or peanut oil, antibacterial
substance at bacterial or fungal inhibitory concentration, isotonic
agent such as sodium chloride or glucose, buffer such as phosphate
or citrate buffer, antioxidant such as sodium bisulfate, local
anesthetic such as procaine hydrochloride, suspending aid and
dispersing agent such as sodium carboxymethylcellulose,
hydroxypropylmethylcellulose or polyvinylpyrrolidone, emulsifier
such as polysorbate 80 (Tween-80), integration reagent such as EDTA
(ethylenediaminetetraacetic acid) or EGTA (ethylene
glycol-bis(2-aminoethyl ether) tetraacetic acid), ethanol,
polyethylene glycol, propylene glycol, sodium hydroxide,
hydrochloric acid, citric acid or lactic acid. The antibacterial
agent as a carrier can be added to the pharmaceutical composition
in a multi-dose container, which includes phenols or cresols,
mercury preparation, benzyl alcohol, chlorobutanol, methyl and
propyl parabens, merthiolate, benzalkonium chloride, and
triethylbenzonium chloride. Suitable excipient may include, for
example, water, salt, glucose, glycerol or ethanol. Suitable
non-toxic auxiliary substance may include, for example, emulsifier,
pH buffer, stabilizer, solubilizer, or sodium acetate, sorbitan
laurate, triethanolamine oleate or cyclodextrin.
[0139] The pharmaceutical composition can be a liquid solution,
suspension, emulsion, pill, capsule, tablet, sustained release
formulation or powder. Oral preparation may comprise standard
carrier such as pharmaceutical grade mannitol, lactose, starch,
magnesium stearate, polyvinylpyrrolidone, sodium saccharin,
cellulose, magnesium carbonate and the like.
[0140] In certain embodiments, the pharmaceutical composition is
formulated as a composition for injection. The pharmaceutical
composition for injection can be prepared in any conventional form,
for example, liquid solution, suspension, emulsion, or any solid
form suitable for producing liquid solution, suspension, or
emulsion. Injection preparation may comprise currently used sterile
and/or pyrogen-free solution, sterile dry solvent that is combined
with solvent before use, such as lyophilized powder, including
subcutaneous tablet, sterile suspension ready for injection,
sterile dry insoluble product that is combined with medium before
use, and sterile and/or pyrogen-free emulsion. The solvent can be
an aqueous phase or a non-aqueous phase.
[0141] In some embodiments, the unit-dose injection preparation is
packaged in an ampoule, a tube, or a syringe with needle. It is
known in the art that all preparations for injection administration
should be sterile and pyrogen-free.
[0142] In some embodiments, a sterile lyophilized powder can be
prepared by dissolving the antibody or antigen-binding fragment
thereof disclosed in the present application in a suitable solvent.
The solvent may contain a kind of other pharmacological component
that can improve the stability of the powder or the reconstituted
solution prepared from the powder, or improve the powder or the
reconstituted solution. Suitable excipients include, but are not
limited to, water, glucose, sorbitol, fructose, corn syrup,
xylitol, glycerol, glucose, brown sugar or other applicable
substances. The solvent may comprise a buffer, such as citrate
buffer, sodium phosphate or potassium phosphate buffer, or other
buffers known to those skilled in the art. In one embodiment, the
pH of the buffer is neutral. The solution is subjected to
subsequent filtration and sterilization under standard conditions
known in the art, and then lyophilized to obtain an ideal
formulation. In one embodiment, the resulting solvent is divided
into small vials and lyophilized. Each vial may contain a single
dose or multiple doses of the anti-CEACAM5 antibody or
antigen-binding fragment thereof or combination thereof. The
filling amount in each vial may be slightly higher than that
required for each dose or multiple doses (for example, 10%
overdose), so as to ensure accurate sampling and accurate
administration. The lyophilized powder can be stored under
appropriate conditions, such as in the range of about 4.degree. C.
to room temperature.
[0143] The lyophilized powder is re-dissolved with water for
injection to obtain a preparation for injection administration. In
one embodiment, the lyophilized powder can be reconstituted in
sterile pyrogen-free water or other suitable liquid carrier. Its
precise amount is determined by the selected therapy and can be
determined based on empirical values.
Antibody Derivatization and Immunoconjugate
[0144] The antibody or antigen-binding fragment thereof of the
present application can be derivatized, for example, linked to
another molecule (for example, another polypeptide or protein).
Generally, the derivatization (e.g., labeling) of the antibody or
antigen-binding fragment thereof will not adversely affect its
binding to CEACAM5. Therefore, the antibody or antigen-binding
fragment thereof of the present application is also intended to
comprise such derivatization forms. For example, the antibody or
antigen-binding fragment thereof of the present application can be
functionally linked (by chemical coupling, gene fusion,
non-covalent linkage or other means) to one or several other
molecular groups, such as another antibody (for example, to form a
bispecific antibody), detection reagent, pharmaceutical reagent,
and/or protein or polypeptide capable of mediating the binding of
the antibody or antigen-binding fragment thereof to another
molecule (for example, avidin or polyhistidine tag). In addition,
the antibody or antigen-binding fragment thereof of the present
application can also be derivatized with a chemical group, such as
polyethylene glycol (PEG), methyl or ethyl, or glycosyl. These
groups can be used to improve the biological properties of the
antibody, such as increasing serum half-life.
[0145] Therefore, in one aspect, the present application provides
an immunoconjugate, which comprises the antibody or antigen-binding
fragment thereof described in the present application and a
therapeutic agent conjugated to the antibody or antigen-binding
fragment thereof.
[0146] In certain embodiments, the therapeutic agent is selected
from cytotoxic agents.
[0147] In certain embodiments, the therapeutic agent is selected
from alkylating agent, mitotic inhibitor, anti-tumor antibiotic,
antimetabolite, topoisomerase inhibitor, tyrosine kinase inhibitor,
radionuclide agent, and any combination thereof.
[0148] In certain embodiments, the immunoconjugate is an
antibody-drug conjugate (ADC).
Kit and Detection Use
[0149] The antibody or antigen-binding fragment thereof of the
present application can specifically bind to CEACAM5 protein, and
basically does not bind to CEACAM1, CEACAM3, CEACAM6, CEACAM7
proteins, and only weakly binds to CEACAM8 protein. Therefore, the
antibody or antigen-binding fragment thereof of the present
application has higher specificity and accuracy in detection.
[0150] Therefore, in another aspect, the present application
provides a kit, which comprises the antibody or antigen-binding
fragment thereof of the present application, or the conjugate of
the present application.
[0151] In some embodiments, the antibody or antigen-binding
fragment thereof comprises a detectable label, such as an enzyme
(for example, horseradish peroxidase), radionuclide, fluorescent
dye, luminescent substance (for example, chemiluminescent
substance), or biotin.
[0152] In some embodiments, the kit further comprises a second
antibody, which specifically recognizes the antibody or
antigen-binding fragment thereof.
[0153] In some embodiments, the second antibody further comprises a
detectable label, such as an enzyme (for example, horseradish
peroxidase), radionuclide, fluorescent dye, luminescent substance
(for example, chemiluminescent substance), or biotin.
[0154] In some embodiments, the kit of the present application may
further comprise a reagent for allowing the corresponding
detectable label to be detected. For example, when the detectable
label is an enzyme, the kit may also comprise a chromogenic
substrate for the corresponding enzyme, such as o-phenylenediamine
(OPD) for horseradish peroxidase, and tetramethylbenzidine (TMB),
ABTS or luminol compound, or p-nitrophenyl phosphate (p-NPP) or
AMPPD for alkaline phosphatase. For example, when the detectable
label is a chemiluminescent reagent (for example, an acridine ester
compound), the kit may further comprise a pre-excitation solution
and/or an excitation solution for chemiluminescence.
[0155] In another aspect, the present application also provides a
use of the antibody or antigen-binding fragment thereof in the
manufacture of a kit, the kit is used for determining whether a
tumor can be treated by an anti-tumor therapy targeting
CEACAM5.
[0156] In certain embodiments, the antibody or antigen-binding
fragment thereof comprises a detectable label.
[0157] In certain embodiments, the CEACAM5 is human CEACAM5.
[0158] In certain embodiments, the tumor is selected from the group
consisting of non-small cell lung cancer, small cell lung cancer,
renal cell carcinoma, colorectal cancer, ovarian cancer, breast
cancer, pancreatic cancer, gastric cancer, bladder cancer,
esophageal cancer, mesothelioma, melanoma, head and neck cancer,
thyroid cancer, sarcoma, prostate cancer, glioblastoma, cervical
cancer, thymic cancer, leukemia, lymphoma, myeloma, mycosis
fungoids, Merkel cell cancer and other hematological malignancies,
such as typical Hodgkin's lymphoma (CHL), primary mediastinal large
B-cell lymphoma, T-cell/histiocytic B-cell-rich lymphoma,
EBV-positive and negative PTLD and EBV-related diffuse large B-cell
lymphoma (DLBCL), plasmablastic lymphoma, extranodal NK/T cell
lymphoma, nasopharyngeal carcinoma and HHV8-related primary
exudative lymphoma, Hodgkin's lymphoma, central nervous system
(CNS) tumor, such as primary CNS lymphoma, spinal axis tumor,
brainstem glioma.
[0159] The present application provides a kit comprising the
antibody or antigen-binding fragment thereof. In some embodiments,
the kit is used to detect the presence or level of CEACAM5 in a
biological sample. The biological sample may comprise cells or
tissues.
[0160] In some embodiments, the kit comprises an antibody or
antigen-binding fragment thereof conjugated to a detectable label.
In some embodiments, the kit comprises an unlabeled antibody, and
further comprises a labeled secondary antibody capable of binding
to the unlabeled antibody. The kit may further comprise an
instruction for use, and a wrappage that separates each component
in the kit.
[0161] In some embodiments, the antibody is linked to a substrate
or an instrument for sandwich assays such as ELISA or
immunochromatographic assays. Suitable substrate or instrument can
be, for example, microplate and test paper.
Chimeric Antigen Receptor
[0162] In another aspect, the present application also provides a
chimeric antigen receptor, which comprises an antigen-binding
domain of the antibody or antigen-binding fragment thereof.
[0163] In certain embodiments, the antigen-binding domain comprises
a heavy chain variable region and a light chain variable region of
the antibody or antigen-binding fragment thereof.
[0164] In certain embodiments, the antigen-binding domain is a
scFv.
[0165] In certain embodiments, the chimeric antigen receptor
comprises the antigen-binding fragment of the antibody.
[0166] In certain embodiments, the chimeric antigen receptor is
expressed by an immune effector cell (for example, T cell).
[0167] In another aspect, the present application also provides an
isolated nucleic acid molecule, which encodes the chimeric antigen
receptor.
[0168] In another aspect, the present application also provides a
vector, which comprises the isolated nucleic acid molecule; in some
embodiments, it is used to prepare a chimeric antigen receptor T
cell.
[0169] In another aspect, the present application also provides a
host cell, which comprises the isolated nucleic acid molecule or
vector.
[0170] In certain embodiments, the host cell is an immune effector
cell (for example, T cell or NK cell).
[0171] In certain embodiments, the host cell is a chimeric antigen
receptor T cell (CAR-T).
Detection Method and Treatment Method
[0172] In many malignant tumors, the overexpression of CEACAM5 can
be used as a tumor biomarker. Therefore, the measurement of CEACAM5
in the blood of patients can be used for the prognosis and control
of cancer, and the targeted therapy of CEACAM5 has also become a
potential cancer treatment method. The antibody of the present
application (for example, UM05-6L) can bind to CEACAM5 protein with
high affinity and high specificity, and has ADCC activity, which
can inhibit tumor growth and kill tumor cells.
[0173] Therefore, in another aspect, the present application also
provides a method for inhibiting growth of a tumor cell expressing
CEACAM5 and/or killing the tumor cell, which comprises contacting
the tumor cell with an effective amount of the antibody or
antigen-binding fragment thereof, or the bispecific or
multispecific molecule, or the immunoconjugate, or the
pharmaceutical composition, or the chimeric antigen receptor, or
the host cell.
[0174] In another aspect, the present application also provides a
method for reducing the expression level of CEACAM5 on the surface
of a cell, which comprises contacting the cell with an effective
amount of the antibody or antigen-binding fragment thereof, or the
bispecific or multispecific molecule, or the immunoconjugate, or
the pharmaceutical composition, or the chimeric antigen receptor,
or the host cell, so as to reduce expression of CEACAM5 on the cell
surface; wherein, the cell expresses CEACAM5 on its surface.
[0175] In certain embodiments, the cell is a tumor cell expressing
CEACAM5.
[0176] In another aspect, the present application also provides a
method for preventing and/or treating a tumor in a subject (for
example, a human), the method comprising administering to the
subject in need thereof an effective amount of the antibody or
antigen-binding fragment thereof, or the bispecific or
multispecific molecule, or the immunoconjugate, or the
pharmaceutical composition, or the chimeric antigen receptor, or
the host cell.
[0177] In certain embodiments, the tumor expresses CEACAM5.
[0178] In certain embodiments, the tumor involves a tumor cell that
expresses CEACAM5. In certain embodiments, the CEACAM5 is expressed
on the surface of the tumor cell.
[0179] In certain embodiments, the tumor is selected from the group
consisting of non-small cell lung cancer, small cell lung cancer,
renal cell carcinoma, colorectal cancer, ovarian cancer, breast
cancer, pancreatic cancer, gastric cancer, bladder cancer,
esophageal cancer, mesothelioma, melanoma, head and neck cancer,
thyroid cancer, sarcoma, prostate cancer, glioblastoma, cervical
cancer, thymic cancer, leukemia, lymphoma, myeloma, mycosis
fungoids, Merkel cell cancer and other hematological malignancies,
such as typical Hodgkin's lymphoma (CHL), primary mediastinal large
B-cell lymphoma, T cell/histiocytic rich B cell lymphoma,
EBV-positive and negative PTLD and EBV-related diffuse large B-cell
lymphoma (DLBCL), plasmablastic lymphoma, extranodal NK/T-cell
lymphoma, nasopharyngeal carcinoma, and HHV8-related primary
exudative lymphoma, Hodgkin's lymphoma, central nervous system
(CNS) tumor, such as primary CNS lymphoma, spinal axis tumor,
brainstem glioma.
[0180] In certain embodiments, the subject is a mammal, such as a
human.
[0181] In certain embodiments, the method further comprises
administering an additional drug with an anti-tumor activity, such
as alkylating agent, mitotic inhibitor, anti-tumor antibiotic,
antimetabolite, topoisomerase inhibitor, tyrosine kinase inhibitor,
radionuclide agent, radiosensitizer, anti-angiogenesis agent,
cytokine, molecular targeted drug, immune checkpoint inhibitor or
oncolytic virus.
[0182] In certain embodiments, the method further comprises
administering an additional anti-tumor therapy, such as surgery,
chemotherapy, radiation therapy, targeted therapy, immunotherapy,
hormone therapy, gene therapy, or palliative therapy.
[0183] In another aspect, the present application also provides a
use of the antibody or antigen-binding fragment thereof, or the
bispecific or multispecific molecule, or the immunoconjugate, or
the pharmaceutical composition, or the chimeric antigen receptor,
or the host cell, in the manufacture of a medicament for the
prevention and/treatment of a tumor in a subject (for example, a
human).
[0184] In certain embodiments, the medicament further comprises an
additional pharmaceutically active agent.
[0185] In certain embodiments, the additional pharmaceutically
active agent is a drug with anti-tumor activity, such as alkylating
agent, mitotic inhibitor, anti-tumor antibiotic, antimetabolite,
topoisomerase inhibitor, tyrosine kinase inhibitor, radionuclide
agent, radiosensitizer, anti-angiogenesis agent, cytokine,
molecular targeted drug, immune checkpoint inhibitor or oncolytic
virus.
[0186] In certain embodiments, the tumor expresses CEACAM5.
[0187] In certain embodiments, the tumor involves a tumor cell that
expresses CEACAM5; preferably, the CEACAM5 is expressed on the
surface of the tumor cell.
[0188] In certain embodiments, the tumor is selected from the group
consisting of non-small cell lung cancer, small cell lung cancer,
renal cell carcinoma, colorectal cancer, ovarian cancer, breast
cancer, pancreatic cancer, gastric cancer, bladder cancer,
esophageal cancer, mesothelioma, melanoma, head and neck cancer,
thyroid cancer, sarcoma, prostate cancer, glioblastoma, cervical
cancer, thymic cancer, leukemia, lymphoma, myeloma, mycosis
fungoids, Merkel cell cancer and other hematological malignancies,
such as typical Hodgkin's lymphoma (CHL), primary mediastinal large
B-cell lymphoma, T-cell/histiocytic B-cell-rich lymphoma,
EBV-positive and negative PTLD and EBV-related diffuse large B-cell
lymphoma (DLBCL), plasmablastic lymphoma, extranodal NK/T cell
lymphoma, nasopharyngeal carcinoma and HHV8-related primary
exudative lymphoma, Hodgkin's lymphoma, central nervous system
(CNS) tumor, such as primary CNS lymphoma, spinal axis tumor,
brainstem glioma.
[0189] In certain embodiments, the subject is a mammal, such as a
human.
[0190] In another aspect, the present application also provides a
method for detecting the presence or amount of CEACAM5 (for
example, human CEACAM5) in a sample, which comprises the following
steps: [0191] (i) contacting the sample with the antibody or
antigen-binding fragment thereof, [0192] (ii) detecting formation
of a complex comprising the antibody or antigen-binding fragment
thereof and CEACAM5, or detecting an amount of the complex.
[0193] In certain embodiments, the antibody or antigen-binding
fragment thereof comprises a detectable label.
[0194] In certain embodiments, the CEACAM5 is human CEACAM5.
[0195] In another aspect, the present application also provides a
method for determining whether a tumor can be treated by an
anti-tumor therapy targeting CEACAM5, which comprises the following
steps: [0196] (i) contacting a sample containing a cell of the
tumor with the antibody or antigen-binding fragment thereof, [0197]
(ii) detecting formation of a complex comprising the antibody or
antigen-binding fragment thereof and CEACAM5.
[0198] In certain embodiments, the antibody or antigen-binding
fragment thereof comprises a detectable label.
[0199] In certain embodiments, the CEACAM5 is human CEACAM5.
[0200] In certain embodiments, the tumor is selected from the group
consisting of non-small cell lung cancer, small cell lung cancer,
renal cell carcinoma, colorectal cancer, ovarian cancer, breast
cancer, pancreatic cancer, gastric cancer, bladder cancer,
esophageal cancer, mesothelioma, melanoma, head and neck cancer,
thyroid cancer, sarcoma, prostate cancer, glioblastoma, cervical
cancer, thymic cancer, leukemia, lymphoma, myeloma, mycosis
fungoids, Merkel cell cancer and other hematological malignancies,
such as typical Hodgkin's lymphoma (CHL), primary mediastinal large
B-cell lymphoma, T-cell/histiocytic B-cell-rich lymphoma,
EBV-positive and negative PTLD and EBV-related diffuse large B-cell
lymphoma (DLBCL), plasmablastic lymphoma, extranodal NK/T cell
lymphoma, nasopharyngeal carcinoma and HHV8-related primary
exudative lymphoma, Hodgkin's lymphoma, central nervous system
(CNS) tumor, such as primary CNS lymphoma, spinal axis tumor,
brainstem glioma.
[0201] The present application also provides a therapeutic method,
comprising administering a therapeutically effective amount of the
antibody described in the present application to a subject in need
thereof.
[0202] The therapeutically effective amount of the antibody
provided in the present application depends on a variety of factors
known in the art, such as weight, age, past medical history,
current treatment, subject's health status and cross-infection
potential, allergies, hypersensitivity and side effect, and
administration route and tumor development degree. Those skilled in
the art (for example, doctors or veterinarians) can reduce or
increase the amount in proportion according to these or other
conditions or requirements.
[0203] In certain embodiments, the antibody provided in the present
application can be administered at a therapeutically effective dose
between about 0.01 mg/kg and about 100 mg/kg. In some embodiments,
the antibody is administered at a dose of about 50 mg/kg or less.
In some embodiments, the administration dose is 10 mg/kg or less, 5
mg/kg or less, 1 mg/kg or less, 0.5 mg/kg or less, or 0.1 mg/kg or
less. A specific dose can be administered at multiple intervals,
such as once per day, twice or more per day, twice or more per
month, once per week, once every two weeks, once every three weeks,
once per month, or once every two or more months. In certain
embodiments, the administration dose can vary with the course of
treatment. For example, in certain embodiments, the initial
administration dose may be higher than the subsequent
administration dose. In some embodiments, the administration dose
is adjusted according to the subject's response to the
administration during the course of treatment.
[0204] The dosage regimen can be adjusted to achieve the optimal
response (for example, treatment response). For example, the
administration can be performed in a single dose or in multiple
divided doses over a period of time.
[0205] The antibody disclosed in the present application can be
administered by a method known in the art, such as injection
administration (for example, subcutaneous injection,
intraperitoneal injection, intravenous injection, including
intravenous drip, intramuscular injection or intradermal injection)
or non-injection administration (for example, oral administration,
nasal administration, sublingual administration, rectal
administration, or topical administration).
[0206] In certain embodiments, the antibody can be used for the
treatment of a disease associated with its molecular mechanism,
including tumor and cancer, such as non-small cell lung cancer,
small cell lung cancer, renal cell carcinoma, colorectal cancer,
ovarian cancer, breast cancer, pancreas cancer, stomach cancer,
bladder cancer, esophageal cancer, mesothelioma, melanoma, head and
neck cancer, thyroid cancer, sarcoma, prostate cancer,
glioblastoma, cervical cancer, thymic cancer, leukemia, lymphoma,
myeloma, mycosis fungoids, Merkel cell carcinoma and other
hematological malignancies, such as typical Hodgkin's lymphoma
(CHL), primary mediastinal large B-cell lymphoma, T
cell/histiocytic B-cell lymphoma, EBV-positive and negative PTLD
and EBV-related diffuse large B-cell lymphoma (DLBCL),
plasmablastic lymphoma, extranodal NK/T-cell lymphoma,
nasopharyngeal carcinoma and HHV8-related primary exudative
lymphoma, Hodgkin's lymphoma, central nervous system (CNS) tumor,
such as primary CNS lymphoma, spinal axis tumor, brainstem
glioma.
Usage
[0207] The present application further provides a method for using
the antibody.
[0208] In some embodiments, the present application provides a
method of treating a condition or disease related to a mechanism of
the antibody in an individual, comprising administering a
therapeutically effective amount of the antibody described
herein.
[0209] The antibody disclosed in the present application can be
administered alone or in combination with one or several other
therapeutic means or substances. For example, the antibody
disclosed in the present application can be used in combination
with chemotherapy, radiotherapy, cancer treatment surgery (for
example, tumor resection), antiviral drug, one or several
antiemetic drugs or other therapies for chemotherapy-induced
complication, or any other therapeutic substances for cancer or
virus. In some such embodiments, when the antibody disclosed in the
present application is used in combination with one or several
therapeutic substances, it can be administered simultaneously with
the one or several therapeutic substances. In some such
embodiments, the antibody can be administered simultaneously as
part of the same pharmaceutical composition. However, antibody that
is "used in combination" with another therapeutic substance does
not need to be administered at the same time or in the same
composition with the therapeutic substance. The meaning of "used in
combination" in the present application also comprises that an
antibody administered before or after another therapeutic substance
is also considered to be "used in combination" with the therapeutic
substance, even if the antibody and the second substance are
administered in different ways. Where possible, other therapeutic
substances used in combination with the antibody disclosed in the
present application can be administered by referring to the product
instructions of the other therapeutic substances, or refer to the
surgeon's desk reference 2003 (Physicians' Desk Reference, 57th Ed;
Medical Economics Company; ISBN: 1563634457; 57th edition (November
2002)), or refer to other methods known in the art.
[0210] In some embodiments, the therapeutic substance can induce or
enhance an immune response against a cancer. For example, a tumor
vaccine can be used to induce an immune response to a certain tumor
or cancer. Cytokine therapy can be used to increase the
presentation of a tumor antigen to the immune system. Examples of
cytokine therapy include but are not limited to interferon such as
interferon .alpha., .beta. and .gamma., colony stimulating factor
such as macrophage CSF, granulocyte macrophage CSF and granulocyte
CSF, and interleukin such as IL-1, IL-1a, IL-2, IL-3, IL-4, IL-5,
IL-6, IL-7, IL-8, IL-9, IL-10, IL-11 and IL-12, tumor necrosis
factor such as TNF-.alpha. and TNF-.beta.. Reagents that inactivate
immunosuppressive targets can also be used, and the examples
include PD-1 antibody, TGF-.beta. inhibitor, IL-10 inhibitor, and
Fas ligand inhibitor. Another group of reagents includes those that
activate an immune response to a tumor or cancer cell, for example,
those that increase T cell activation (for example, T cell
costimulatory signaling pathway, for example pathway such as
CTLA-4, ICOS, OX40, 4-1BB, etc.), and those that improve dendritic
cell function and antigen presentation.
[0211] The following examples are intended to better illustrate the
present application, and should not be construed as limiting the
scope of the present application. All of the following specific
compositions, materials and methods, in whole or in part, are
within the scope of the present application. These specific
compositions, materials and methods are not intended to limit the
present application, but only to illustrate specific embodiments
within the scope of the present application. Those skilled in the
art can develop equivalent compositions, materials and methods
without adding creativity and without departing from the scope of
the present application. It should be understood that various
changes made to the method of the present application may still
fall into the scope of the present application. The present
inventors intend to include such changes within the scope of the
present application.
Sequence Information
[0212] The information of some sequences involved in the present
application is shown in Table 1 below.
TABLE-US-00001 TABLE 1 Information of some sequences SEQ ID
Sequence NO: description Sequence information 1 VH CDR1 DYYLN 2 VH
CDR2 NINPINDFTTYNQKFKA 3 VH CDR3 YDGYFAY 4 VL CDR1 HASQNINVWLS 5 VL
CDR2 KASNLHT 6 VL CDR3 QQGQSYPWT 7 VH
EVQLQQSGPELVKPGASVKISCKASGYTFTDYYLNWVKQSPGKSLEWIGNIN
PINDFTTYNQKFKAKATLTVDKSSTTSYMALRSLTSEDSAVYYCTRYDGYFA YWGQGTTLTVSS 8
VL DIQMNQSPSSLSASLGDTITITCHASQNINVWLSWYQQKPGNIPKLLIYKASN
LHTGVPSRFSGSGSGTGFTLTISSLQPEDIATYYCQQGQSYPWTFGGGTKLEIK 9 IgG1 heavy
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHT chain
FPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDK constant
THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF region
NWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI
AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM
HEALHNHYTQKSLSLSPGK 10 Nucleotide
GCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAG sequence
CACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCC encoding
CCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGT IgG1 heavy
GCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGCA chain
GCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGC constant
AACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAAAGTTGAGC region
CCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCAGCACCTGAA
CTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACAC
CCTCATGATCTCCCGGACCCCCGAGGTCACATGCGTGGTGGTGGACGTGA
GCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGA
GGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACG
TACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGG
CAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATC
GAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGT
ACACCCTGCCCCCATCCCGGGAGGAGATGACCAAGAACCAGGTCAGCCT
GACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGG
AGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCT
GGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGA
GCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCATGAGGCT
CTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATG A 11 .kappa.
chain RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNS constant
QESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNR region GEC 12
Nucleotide CGTACGGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAG
sequence TTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATCCC
encoding .kappa. AGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTA
chain ACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAG constant
CCTCAGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAA region
GTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGTTCGCCCGTCACAAA
GAGCTTCAACAGGGGAGAGTGTTGA 13 VH-G4S3-
EVQLQQSGPELVKPGASVKISCKASGYTFTDYYLNWVKQSPGKSLEWIGNIN VL
PINDFTTYNQKFKAKATLTVDKSSTTSYMALRSLTSEDSAVYYCTRYDGYFA
YWGQGTTLTVSSGGGGSGGGGSGGGGSDIQMNQSPSSLSASLGDTITITCHA
SQNINVWLSWYQQKPGNIPKLLIYKASNLHTGVPSRFSGSGSGTGFTLTISSL
QPEDIATYYCQQGQSYPWTFGGGTKLEIK 14 VH gene
GAGGTCCAGCTGCAACAATCTGGACCTGAGCTGGTGAAGCCTGGGGCTTC
AGTGAAGATATCCTGTAAGGCTTCTGGATACACGTTCACTGACTACTACT
TGAACTGGGTAAAACAGAGCCCTGGAAAGAGCCTTGAGTGGATTGGAAA
CATTAATCCTATCAATGATTTTACTACCTACAACCAGAAGTTCAAGGCCA
AGGCCACATTGACTGTAGACAAGTCCTCTACCACTTCCTACATGGCGCTC
CGCAGCCTGACATCTGAGGACTCTGCAGTCTATTACTGTACAAGATATGA
TGGTTACTTCGCCTACTGGGGCCAAGGCACCACTCTCACAGTCTCCTCA 15 VL gene
GACATCCAGATGAACCAGTCTCCATCCAGTCTGTCTGCATCCCTTGGAGA
CACAATTACCATCACTTGCCATGCCAGTCAGAACATTAATGTTTGGTTAA
GCTGGTACCAGCAGAAACCAGGAAATATTCCTAAACTATTGATCTATAAG
GCTTCCAATTTGCACACAGGCGTCCCATCAAGGTTTAGTGGCAGTGGATC
TGGAACAGGTTTCACATTAACCATCAGCAGCCTGCAGCCTGAAGACATTG
CCACTTACTACTGTCAACAGGGTCAAAGTTATCCGTGGACGTTCGGTGGA
GGCACCAAGCTGGAAATCAAA
Beneficial Effect
[0213] The monoclonal antibody of the present application (for
example, UM05-6L antibody) can bind to CEACAM5 protein or a cell
expressing CEACAM5 protein with high specificity and selectivity,
and it does not substantially bind to CEACAM1, CEACAM3, CEACAM6,
CEACAM7 proteins, and only weakly binds with CEACAM8 protein. At
the same time, the antibody UM05-6L also has ADCC activity. The
UM05-6L-CAR constructed based on the antibody UM05-6L can be
expressed on the surface of a human T cell, can recognize a tumor
cell in vivo, secrete cytokine, and has a strong tumor-inhibiting
effect. Therefore, the monoclonal antibody of the present
application (for example, UM05-6L antibody) has high clinical
application value.
BRIEF DESCRIPTION OF THE DRAWINGS
[0214] FIG. 1A to 1B show the overexpression level of CEACAM5 in
the CHO cell line constructed in the present application; as
compared with conventional CHO cells, the overexpression level of
CEACAM5 in the CHO cell line constructed in the present application
is up to 904 times.
[0215] FIG. 2 shows the results of the ELISA experiment of the
binding of antibody UM05-6L to CEACAM5 protein.
[0216] FIG. 3 shows the detection results of the binding ability of
antibody UM05-6L to LOVO cells.
[0217] FIG. 4A to 4B show the ADCC reporter gene activity of
antibody UM05-6L; in which, FIG. 4A shows the ADCC reporter gene
activity of the positive control (Erbitux antibody) and the
negative control, and FIG. 4B shows the ADCC reporter gene activity
of UM05-6L.
[0218] FIG. 5A to 5B show the results of flow cytometry; in which
FIG. 5A shows the expression efficiency of control T cells (Mock
T), and FIG. 5B shows the expression efficiency of UM05-6L-CAR.
[0219] FIG. 6A to 6B show the results of the secretion of cytokines
IFN.gamma. (left) and IL-2 (right) after UM05-6L-CAR-T is mixed
with tumor cells.
[0220] FIG. 7 shows the killing results of UM05-6L-CAR-T cells on
tumor cell KATO3.
[0221] FIG. 8 shows the expansion results of UM05-6L-CAR-T cells
stimulated by tumor cell LS174T.
[0222] FIG. 9 shows the results of UM05-6L-CAR-T inhibiting tumors
in mice.
[0223] FIG. 10 shows the release of IFN.gamma. in mice receiving
UM05-6L-CAR-T.
SPECIFIC MODELS FOR CARRYING OUT THE INVENTION
[0224] The present application will now be described with reference
to the following examples which are intended to illustrate the
present application (not limit the present application).
[0225] Unless otherwise specified, the molecular biology
experimental methods and immunoassay methods used in the present
application basically referred to J. Sambrook et al., Molecular
Cloning: Laboratory Manual, 2nd Edition, Cold Spring Harbor
Laboratory Press, 1989, and F M Ausubel et al., Compiled Molecular
Biology Experiment Guide, 3rd edition, John Wiley & Sons, Inc.,
1995; the restriction enzymes were used in accordance with the
conditions recommended by the product manufacturer. If specific
conditions were not indicated in the examples, it should be carried
out in accordance with the conventional conditions or the
conditions recommended by the manufacturer. The reagents or
instruments used without the manufacturer's indication were all
conventional products that were purchased commercially. Those
skilled in the art know that the examples describe the present
application by way of example, and are not intended to limit the
scope of protection claimed by the present application.
Example 1: Acquisition of Monoclonal Antibody Against Human CEACAM5
Protein
[0226] In the present application, a CHO cell line overexpressing
CEACAM5 protein was constructed. In short, the CEACAM5 plasmid
(Beijing Yiqiao Shenzhou Technology Co., Ltd., HG11077-UT) was
transfected into a CHO cell line (ATCC) and expressed. The plasmid
was resistant to hygromycin (Hygromycin), so that a cell stably
transfected with this plasmid could be stably passaged in a medium
containing hygromycin. The cells were picked and the expression of
CEACAM was measured. As shown in FIGS. 1A and 1B, the CHO-CEACAM5
cell detected by FACS had a CEACAM overexpression factor of 904
times.
[0227] The CHO-CEACAM5 cells and the CEACAM5 protein (L2C01001)
purified from tumor patients were used to immunize 6 Balb/c mice
aged 5-8 weeks (Shanghai Slack) according to the immunization
schedule in Table 2.
TABLE-US-00002 TABLE 2 Immunization schedule in mice Date Operation
Antigen Adjuvant Day 1 Immunization by CHO-CEACAM5 cells CFA
intraperitoneal injection Day 26 Immunization by CHO-CEACAM5 cells
IFA intraperitoneal injection Day 49 Immunization by
CHO-CEACAM5cells IFA intraperitoneal injection Day 91 Immunization
by CEACAM5 protein Gerbu(MM3001) intraperitoneal injection Day 104
Immunization by CEACAM5 protein Gerbu(MM3001) intraperitoneal
injection Day 105 Immunization by CEACAM5 protein Gerbu(MM3001)
intraperitoneal injection Day 106 Immunization by CEACAM5 protein
Gerbu(MM3001) intraperitoneal injection
[0228] On the second day after the immunization, the spleen cells
of the immunized mice were taken, and fused with SP2/0-AG14 cells
(ATCC) to prepare hybridoma cells, and an appropriate amount of the
fused cells were plated on a 96-well plate. About 10 days after the
fusion, the supernatant of each well was taken, and the binding
activity of the mouse antibody secreted by the hybridoma cells to
human CEACAM5 was detected by ELISA.
[0229] Furthermore, the supernatant of the well with strong
positivity detected by ELISA was taken, its binding activity to
LOVO cells (Shanghai Institute of Cell Biology, Chinese Academy of
Sciences) was detected by flow cytometry, and hybridoma cells with
high binding activity to LOVO cells were obtained. These cells were
subcloned to obtain monoclonal cells. Table 3 showed the detection
data of some hybridoma cells.
TABLE-US-00003 TABLE 3 Binding results of hybridoma cells to CEACAM
Hybridoma cells ELISA OD value LOVO FACS binding 1-2C5 1.0690 12.1
1-9G3 1.0390 7.01 3-2F3 1.4480 11 3-6F5 1.3520 6.51 3-8C10 2.3030
137 3-8G8 1.9270 82.9 2A10A5 2.392 / 2A10C4 2.434 /
[0230] The hybridoma cell 3-8G8 with better binding activity was
selected for sequencing. After sequencing, an antibody was
obtained, named UM05-6, and the CDR sequences of the UM05-6
antibody were determined by using the Kabat numbering system (Kabat
et al., Sequences of Proteins of Immunological Interest, fifth
edition, Public Health Service, National Institutes of Health,
Bethesda, Md. (1991), pages 647-669), and shown in Table 4.
TABLE-US-00004 TABLE 4 UM05-6 variable region sequences SEQ ID NO:
Monoclonal Numbering antibody VH VL system HCDR1 HCDR2 HCDR3 LCDR1
LCDR2 LCDR3 UM05-6 7 8 Kabat 1 2 3 4 5 6
Example 2: Preparation of Human-Mouse Chimeric Antibody
[0231] According to the sequence of UM05-6 in Table 4, a
human-mouse chimeric antibody was designed and expressed, and named
as UM05-6L. In short, the sequences encoding the mouse antibody VH
and VL were respectively linked to the sequence encoding the human
IgG1 heavy chain constant region (its amino acid sequence was shown
in SEQ ID NO: 9, and its nucleotide sequence was shown in SEQ ID
NO: 10) and the .kappa. chain constant region sequence (its amino
acid sequence was shown in SEQ ID NO: 11, and its nucleotide
sequence was shown in SEQ ID NO: 12) to obtain the human-mouse
chimeric antibody UM05-6L.
[0232] The nucleotide sequences encoding the heavy chain and light
chain of the antibody were cloned into the mammalian cell
expression vector pcDNA3.4, respectively. The heavy chain
expression vector and light chain expression vector were
transfected into HEK293 cells with Lipofectamine 2000 transfection
reagent (Invitrogen) at a molar ratio of 2:1, and cultured at
37.degree. C. and 5% carbon dioxide for 7 days. The culture medium
supernatant was collected, and the antibody in the supernatant was
purified by Protein A affinity chromatography. After the
purification, the antibody was dialyzed with PBS solution,
freeze-dried and concentrated, and stored at -20.degree. C.
Example 3: Binding of Antibody to CEACAM5 Protein
[0233] A 96-well high-affinity plate was coated with a human
CEACAM5 protein solution with a concentration of 1 .mu.g/mL, 100
.mu.L/well at 4.degree. C., and shaken overnight. On the next day,
it was first washed with 300 .mu.L of PBST (Tween20: 0.5.Salinity.)
for 3 times, then blocked with 100 .mu.L/well of 5% BSA/PBS for 1
hour, and shaken at room temperature. Washing was performed 3 times
with 300 .mu.L of PBST. A series of dilution solutions of antibody
samples were prepared with PBS, and added at 100 .mu.L/well to the
96-well plate and shaken at room temperature for 1 hour. Washing
was performed 3 times with 300 .mu.L of PBST. A secondary antibody
goat anti-human IgG HRP solution was prepared, added at 100
.mu.L/well to the 96-well plate, and shaken at room temperature for
30 minutes. Washing was performed 4 times with 300 .mu.L of PBST.
100 .mu.L/well TMB was added to perform color development for 20
min. 100 .mu.L/well of 0.6N H.sub.2SO.sub.4 was added to stop the
color development, and OD450 nm was detected. After detection, the
results were shown in FIG. 2. The EC50 of the binding of the
chimeric antibody UM05-6L to CEACAM5 protein was 47.47 ng/mL.
Example 4: Binding of Antibody to Cells Expressing CEACAM5
[0234] Flow cytometry (FACS) was used to detect the binding of
antibody to LOVO tumor cells that naturally expressed human CEACAM5
protein or cells that overexpressed different CEACAM proteins. In
short, cells were first collected, washed with PBS, counted, and
diluted to obtain 2*10.sup.6/ml cell suspension; 10 .mu.l of an
antibody working solution was added to 100 .mu.l of the cell
suspension, and incubated at 4.degree. C. for 30 min in the dark;
after washing twice with PBS, a corresponding fluorescent-labeled
secondary antibody Goat-anti-Human IgG (H+L) (Invitrogen) was
added, incubated at 4.degree. C. for 30 min in the dark, after
washing twice with PBS, it was suspended in 400 .mu.l of FACS
buffer, and the binding situations of the antibody to the cells
were detected by FACS.
[0235] The binding situations of the supernatants of the chimeric
antibody UM05-6L and the control antibody UM05-8 (anti-CEACAM5
antibody, prepared by the hybridoma method in our laboratory) to
different cells at a concentration of 3 .mu.g/mL were detected, in
which SW620-CEACAM1 was a cell overexpressing CEACAM1 protein,
SW620-CEACAM3 was a cell overexpressing CEACAM3 protein,
CHO-CEACAM6 was a cell overexpressing CEACAM6 protein, CHO-CEACAM7
was a cell overexpressing CEACAM7 protein, and CHO-CEACAM8 was a
cell overexpressing CEACAM8 protein. On the basis that the binding
activity (that was, the detection value of FACS) of antibody to
LOVO cells (which expressed CEACEM5) was 100%, the relative binding
activity of the antibody to different cells (which expressed
different CEACAM proteins) were calculated, and the detection
results were shown in Table 5.
TABLE-US-00005 TABLE 5 Binding of antibodies to LOVO cells and
cells overexpressing different CEACAM proteins Cell name UM05-6L
UM05-8 LOVO 100.00% 100.00% SW620-CEACAM1 1.20% 120.47%
SW620-CEACAM3 0.84% 91.56% CHO-CEACAM6 1.35% 69.61% CHO-CEACAM7
0.36% 13.71% CHO-CEACAM8 15.23% 61.60%
[0236] It could be seen from Table 5 that the chimeric antibody
UM05-6L had particularly outstanding selectivity: it bound to
CEACAM5 with high affinity, but did not obviously bind to CEACAM1,
CEACAM3, CEACAM6, CEACAM7, and only weakly bound to CEACAM8. While
the ordinary antibody (for example, the control antibody UM05-8)
could bind to CEACAM5, and simultaneously bind to CEACAM1, CEACAM3,
CEACAM6, CEACAM7 and CEACAM8 at a high level, and showed no
selectivity.
[0237] Furthermore, we used FACS to detect the EC50 of the chimeric
antibody UM05-6L binding to LOVO tumor cells that naturally
expressed human CEACAM5. The results were shown in FIG. 3, in which
the EC50 of the chimeric antibody UM05-6L binding to LOVO cells was
276.1 ng/mL. Based on the above results, the chimeric antibody
UM05-6L had excellent binding affinity, specificity and selectivity
to CEACAM5.
Example 5: ADCC Activity of Antibodies
[0238] Using LOVO cells as target cells, the LOVO cells were
inoculated on a 96-well cell culture plate at a density of 20,000
cells/well, and incubated overnight at 37.degree. C. and 5%
CO.sub.2. On the second day, the antibody UM05-6L and the positive
control antibody Erbitux were prepared at 20 .mu.g/ml in the
culture medium, and were diluted by 3 times to obtain 8
concentrations. The supernatant medium of the LOVO cells was
removed by pipetting, and an antibody (positive control antibody
Erbitux, chimeric antibody UM05-6L or negative control irrelevant
antibody) with diluted to a specified concentration was added at 30
.mu.L/well to the LOVO cells. Subsequently, effector cells
Jurkat/ADC (Nanjing Nuoaixin Biotechnology Co., Ltd.) were plated
into LOVO cell wells at 120,000 cells/30 .mu.L/well, and incubated
at 37.degree. C. and 5% CO.sub.2 for 16 to 20 hours. After the
incubation, Bright-Glo kit (Promega, cat. E2620) was used to detect
the expression level of luciferase in the effector cells. The
luciferase level represented the degree of ADCC activation of the
effector cells. FIG. 4A showed the ADCC reporter gene activity of
the positive control Erbitux antibody and the negative control, and
FIG. 4B showed the ADCC reporter gene activity of UM05-6L. Based on
the above results, it could be seen that UM05-6L had strong ADCC
activity with an EC50 of 0.57 g/mL.
Example 6: Construction of CAR-T Cells Targeting CEACAM5
[0239] Based on the CAR-T structures of the second and third
generations, we used anti-CEACAM5 single-chain antibody as CAR-T
recognition antibody, and used one or several costimulatory
components such as 41BB, CD28, OX40 and others to carry out the
design of different CEA-CAR structures, and constructed
corresponding lentiviral plasmids to generate lentivirus that could
infect cells and express the corresponding CAR. The lentivirus
could be used to infect T cells isolated from the peripheral blood
of tumor patients, and produce CAR-T cells expressing corresponding
CAR receptors on the cell membrane surface. This kind of CAR-T
cells could effectively recognize and kill tumor cells expressing
CEACAM5. Both in vitro and in vivo experiments, it was seen that
this cellular immunotherapy had very good safety and
effectiveness.
[0240] The single chain antibody UM05-6L scFv (in the order of
VH-G4S3-VL) as shown in SEQ ID NO: 13 was ligated to the sequence
CD8.alpha.-CD137-CD3.zeta.-p2A-tEGFR to construct a chimeric
antigen receptor CAR, and then the nucleotide sequence encoding the
CAR was cloned into a lentiviral vector (Genechem, GV401), and the
vector was named UM05-6L-CAR. The expression cassette was EF1a
promoter-CAR-2A-tEGFR-WPRE.
[0241] The UM05-6L-CAR lentiviral vector and packaging plasmid were
transiently transfected into 293T cells for 16 hours, the medium
was changed, and the culture was continued for 24 to 48 hours. The
medium supernatant (containing the lentivirus) was collected and
stored at -80.degree. C.
[0242] PBMC cells derived from healthy people were activated with
CD3/28 antibody for 24 hours; the lentivirus and T cells were mixed
according to MOI=3:1 and cultured for 96 hours, and the expression
of UM05-6L-CAR was detected with PE fluorescent-labeled Cetuximab.
The results were shown in FIG. 5. As compared with the control
(FIG. 5A), UM05-6L-CAR (FIG. 5B) could be well expressed on the
surface of human T cells.
Example 7: Function Detection of CAR-T Cells Targeting CEACAM5
[0243] 1. Detection of Cytokine Release
[0244] UM05-6L-CAR-T cells and CEACAM5-expressing tumor cells (for
example, KATO3 and LS174T) were mixed, and a medium control (that
was, only UM05-6L-CAR-T cells were used) and a CEACAM5 negative
cell control (that was, UM05-6L-CAR-T cells and cells not
expressing CEACAM5 such as RKO cells were used) were set; the two
kinds of cells were mixed at a ratio of 1:1 and cultured for 16
hours, and the released IFN.gamma. and IL2 in the supernatant were
detected. The results were shown in FIG. 6, in which UM05-6L-CAR-T
could recognize the cell line expressing CEACAM5 and cause the
release of cytokines IFN.gamma. and IL-2.
[0245] 2. Detection of Killing Tumor Cells
[0246] UM05-6L-CAR-T and CEACAM5-expressing tumor cells (for
example, KATO3) were mixed and cultured in 96-well culture plate at
a specified E:T ratio (30:1, 10:1, 3:1, 1:1, 0.3:1). Promega LDH
detection kit was used to detect the release record data of lactate
dehydrogenase (LDH) in the culture supernatant. The calculation
results of killing tumor cells were shown in FIG. 7. It could be
seen from the figure that UM05-6L-CAR-T could kill tumor cells
efficiently and dose-dependently.
[0247] 3. Proliferation Experiment Stimulated by Tumor Cells
[0248] UM05-6L-CAR-T cells and CEACAM5-expressing tumor cells (for
example, LS174T) were mixed and cultured for 72 hours (without IL2
supplement) according to E:T=1:1, and their proliferation was
detected by cell counting. The results were shown in FIG. 8.
UM05-6L-CAR-T could be efficiently proliferated when stimulated by
the tumor cells expressing CEACAM5.
Example 8: In Vivo Pharmaceutical Efficacy Experiment of LS174T
Tumor Model
[0249] LS174T cells (ATCC CL-187) were inoculated subcutaneously
into NSG mice (Biocytometer) at 1.times.10.sup.7/mouse. When the
tumor volume reached 200 to 400 mm.sup.3, PBS control, unmodified T
cell control (Mock T) or UM05-6L CAR-T were administered via tail
vein at doses of 100 .mu.l, 1.times.10.sup.7 cells, and
1.times.10.sup.7 tEGFR+ cells, respectively. The tumor volume
changes were recorded and the IFN.gamma. release in peripheral
blood was analyzed. The results were shown in FIG. 9 and FIG. 10.
The UM05-6L recognized LS174T tumor cells in mice and released a
large amount of IFN.gamma., resulting in strong tumor suppression
effect.
Sequence CWU 1
1
1515PRTartificialVH CDR1 1Asp Tyr Tyr Leu Asn1 5217PRTartificialVH
CDR2 2Asn Ile Asn Pro Ile Asn Asp Phe Thr Thr Tyr Asn Gln Lys Phe
Lys1 5 10 15Ala37PRTartificialVH CDR3 3Tyr Asp Gly Tyr Phe Ala Tyr1
5411PRTartificialVL CDR1 4His Ala Ser Gln Asn Ile Asn Val Trp Leu
Ser1 5 1057PRTartificialVL CDR2 5Lys Ala Ser Asn Leu His Thr1
569PRTartificialVL CDR3 6Gln Gln Gly Gln Ser Tyr Pro Trp Thr1
57116PRTartificialVH 7Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu
Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Ile Ser Cys Lys Ala Ser Gly
Tyr Thr Phe Thr Asp Tyr 20 25 30Tyr Leu Asn Trp Val Lys Gln Ser Pro
Gly Lys Ser Leu Glu Trp Ile 35 40 45Gly Asn Ile Asn Pro Ile Asn Asp
Phe Thr Thr Tyr Asn Gln Lys Phe 50 55 60Lys Ala Lys Ala Thr Leu Thr
Val Asp Lys Ser Ser Thr Thr Ser Tyr65 70 75 80Met Ala Leu Arg Ser
Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95Thr Arg Tyr Asp
Gly Tyr Phe Ala Tyr Trp Gly Gln Gly Thr Thr Leu 100 105 110Thr Val
Ser Ser 1158107PRTartificialVL 8Asp Ile Gln Met Asn Gln Ser Pro Ser
Ser Leu Ser Ala Ser Leu Gly1 5 10 15Asp Thr Ile Thr Ile Thr Cys His
Ala Ser Gln Asn Ile Asn Val Trp 20 25 30Leu Ser Trp Tyr Gln Gln Lys
Pro Gly Asn Ile Pro Lys Leu Leu Ile 35 40 45Tyr Lys Ala Ser Asn Leu
His Thr Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr
Gly Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Ile
Ala Thr Tyr Tyr Cys Gln Gln Gly Gln Ser Tyr Pro Trp 85 90 95Thr Phe
Gly Gly Gly Thr Lys Leu Glu Ile Lys 100 1059330PRTartificialIgG1
heavy chain constant region 9Ala Ser Thr Lys Gly Pro Ser Val Phe
Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala
Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val
Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro
Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val
Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile Cys
Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Lys Val
Glu Pro Lys Ser Cys Asp Lys Thr His Thr Cys Pro Pro Cys 100 105
110Pro Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro
115 120 125Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val
Thr Cys 130 135 140Val Val Val Asp Val Ser His Glu Asp Pro Glu Val
Lys Phe Asn Trp145 150 155 160Tyr Val Asp Gly Val Glu Val His Asn
Ala Lys Thr Lys Pro Arg Glu 165 170 175Glu Gln Tyr Asn Ser Thr Tyr
Arg Val Val Ser Val Leu Thr Val Leu 180 185 190His Gln Asp Trp Leu
Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn 195 200 205Lys Ala Leu
Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly 210 215 220Gln
Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu225 230
235 240Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
Tyr 245 250 255Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln
Pro Glu Asn 260 265 270Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser
Asp Gly Ser Phe Phe 275 280 285Leu Tyr Ser Lys Leu Thr Val Asp Lys
Ser Arg Trp Gln Gln Gly Asn 290 295 300Val Phe Ser Cys Ser Val Met
His Glu Ala Leu His Asn His Tyr Thr305 310 315 320Gln Lys Ser Leu
Ser Leu Ser Pro Gly Lys 325 33010993DNAartificialNucleotide
sequence encoding IgG1 heavy chain constant region 10gctagcacca
agggcccatc ggtcttcccc ctggcaccct cctccaagag cacctctggg 60ggcacagcgg
ccctgggctg cctggtcaag gactacttcc ccgaaccggt gacggtgtcg
120tggaactcag gcgccctgac cagcggcgtg cacaccttcc cggctgtcct
acagtcctca 180ggactctact ccctcagcag cgtggtgacc gtgccctcca
gcagcttggg cacccagacc 240tacatctgca acgtgaatca caagcccagc
aacaccaagg tggacaagaa agttgagccc 300aaatcttgtg acaaaactca
cacatgccca ccgtgcccag cacctgaact cctgggggga 360ccgtcagtct
tcctcttccc cccaaaaccc aaggacaccc tcatgatctc ccggaccccc
420gaggtcacat gcgtggtggt ggacgtgagc cacgaagacc ctgaggtcaa
gttcaactgg 480tacgtggacg gcgtggaggt gcataatgcc aagacaaagc
cgcgggagga gcagtacaac 540agcacgtacc gtgtggtcag cgtcctcacc
gtcctgcacc aggactggct gaatggcaag 600gagtacaagt gcaaggtctc
caacaaagcc ctcccagccc ccatcgagaa aaccatctcc 660aaagccaaag
ggcagccccg agaaccacag gtgtacaccc tgcccccatc ccgggaggag
720atgaccaaga accaggtcag cctgacctgc ctggtcaaag gcttctatcc
cagcgacatc 780gccgtggagt gggagagcaa tgggcagccg gagaacaact
acaagaccac gcctcccgtg 840ctggactccg acggctcctt cttcctctac
agcaagctca ccgtggacaa gagcaggtgg 900cagcagggga acgtcttctc
atgctccgtg atgcatgagg ctctgcacaa ccactacacg 960cagaagagcc
tctccctgtc tccgggtaaa tga 99311107PRTartificial?? chain constant
region 11Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser
Asp Glu1 5 10 15Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu
Asn Asn Phe 20 25 30Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp
Asn Ala Leu Gln 35 40 45Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln
Asp Ser Lys Asp Ser 50 55 60Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu
Ser Lys Ala Asp Tyr Glu65 70 75 80Lys His Lys Val Tyr Ala Cys Glu
Val Thr His Gln Gly Leu Ser Ser 85 90 95Pro Val Thr Lys Ser Phe Asn
Arg Gly Glu Cys 100 10512324DNAartificialNucleotide sequence
encoding ?? chain constant region 12cgtacggtgg ctgcaccatc
tgtcttcatc ttcccgccat ctgatgagca gttgaaatct 60ggaactgcct ctgttgtgtg
cctgctgaat aacttctatc ccagagaggc caaagtacag 120tggaaggtgg
ataacgccct ccaatcgggt aactcccagg agagtgtcac agagcaggac
180agcaaggaca gcacctacag cctcagcagc accctgacgc tgagcaaagc
agactacgag 240aaacacaaag tctacgcctg cgaagtcacc catcagggcc
tgagttcgcc cgtcacaaag 300agcttcaaca ggggagagtg ttga
32413238PRTartificialVH-G4S3-VL 13Glu Val Gln Leu Gln Gln Ser Gly
Pro Glu Leu Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Ile Ser Cys Lys
Ala Ser Gly Tyr Thr Phe Thr Asp Tyr 20 25 30Tyr Leu Asn Trp Val Lys
Gln Ser Pro Gly Lys Ser Leu Glu Trp Ile 35 40 45Gly Asn Ile Asn Pro
Ile Asn Asp Phe Thr Thr Tyr Asn Gln Lys Phe 50 55 60Lys Ala Lys Ala
Thr Leu Thr Val Asp Lys Ser Ser Thr Thr Ser Tyr65 70 75 80Met Ala
Leu Arg Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95Thr
Arg Tyr Asp Gly Tyr Phe Ala Tyr Trp Gly Gln Gly Thr Thr Leu 100 105
110Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
115 120 125Gly Gly Ser Asp Ile Gln Met Asn Gln Ser Pro Ser Ser Leu
Ser Ala 130 135 140Ser Leu Gly Asp Thr Ile Thr Ile Thr Cys His Ala
Ser Gln Asn Ile145 150 155 160Asn Val Trp Leu Ser Trp Tyr Gln Gln
Lys Pro Gly Asn Ile Pro Lys 165 170 175Leu Leu Ile Tyr Lys Ala Ser
Asn Leu His Thr Gly Val Pro Ser Arg 180 185 190Phe Ser Gly Ser Gly
Ser Gly Thr Gly Phe Thr Leu Thr Ile Ser Ser 195 200 205Leu Gln Pro
Glu Asp Ile Ala Thr Tyr Tyr Cys Gln Gln Gly Gln Ser 210 215 220Tyr
Pro Trp Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys225 230
23514348DNAartificialVH gene 14gaggtccagc tgcaacaatc tggacctgag
ctggtgaagc ctggggcttc agtgaagata 60tcctgtaagg cttctggata cacgttcact
gactactact tgaactgggt aaaacagagc 120cctggaaaga gccttgagtg
gattggaaac attaatccta tcaatgattt tactacctac 180aaccagaagt
tcaaggccaa ggccacattg actgtagaca agtcctctac cacttcctac
240atggcgctcc gcagcctgac atctgaggac tctgcagtct attactgtac
aagatatgat 300ggttacttcg cctactgggg ccaaggcacc actctcacag tctcctca
34815321DNAartificialVL gene 15gacatccaga tgaaccagtc tccatccagt
ctgtctgcat cccttggaga cacaattacc 60atcacttgcc atgccagtca gaacattaat
gtttggttaa gctggtacca gcagaaacca 120ggaaatattc ctaaactatt
gatctataag gcttccaatt tgcacacagg cgtcccatca 180aggtttagtg
gcagtggatc tggaacaggt ttcacattaa ccatcagcag cctgcagcct
240gaagacattg ccacttacta ctgtcaacag ggtcaaagtt atccgtggac
gttcggtgga 300ggcaccaagc tggaaatcaa a 321
* * * * *