U.S. patent application number 17/645344 was filed with the patent office on 2022-07-21 for compositions and methods related to antibodies that neutralize coagulase activity during staphylococcus aureus disease.
This patent application is currently assigned to The University of Chicago. The applicant listed for this patent is Janssen Pharmaceuticals, Inc., The University of Chicago. Invention is credited to Mark De Been, Carla Emolo, Jeroen Geurtsen, Molly McAdow, Dominique Missiakas, Olaf Schneewind, Lena Thomer.
Application Number | 20220227819 17/645344 |
Document ID | / |
Family ID | |
Filed Date | 2022-07-21 |
United States Patent
Application |
20220227819 |
Kind Code |
A1 |
Missiakas; Dominique ; et
al. |
July 21, 2022 |
COMPOSITIONS AND METHODS RELATED TO ANTIBODIES THAT NEUTRALIZE
COAGULASE ACTIVITY DURING STAPHYLOCOCCUS AUREUS DISEASE
Abstract
Embodiments concern methods and compositions for treating or
preventing a bacterial infection, particularly infection by a
Staphylococcus bacterium. Aspects include methods and compositions
for providing a passive immune response against the bacteria. In
certain embodiments, the methods and compositions involve an
antibody that binds Coagulase (Coa). Further aspects relate to
immunogenic compositions comprising at least one Staphylococcal
coagulase R Domain, wherein the R Domain is 80% identical in
sequence to a R Domain.
Inventors: |
Missiakas; Dominique;
(Chicago, IL) ; Schneewind; Olaf; (Chicago,
IL) ; Emolo; Carla; (Chicago, IL) ; Thomer;
Lena; (Chicago, IL) ; McAdow; Molly; (Chicago,
IL) ; Geurtsen; Jeroen; (Leiden, NL) ; De
Been; Mark; (Leiden, NL) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
The University of Chicago
Janssen Pharmaceuticals, Inc. |
Chicago
Titusville |
IL
NJ |
US
US |
|
|
Assignee: |
The University of Chicago
Chicago
IL
Janssen Pharmaceuticals, Inc.
Titusville
NJ
|
Appl. No.: |
17/645344 |
Filed: |
December 21, 2021 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16077213 |
Aug 10, 2018 |
11214600 |
|
|
PCT/IB17/50763 |
Feb 10, 2017 |
|
|
|
17645344 |
|
|
|
|
62294413 |
Feb 12, 2016 |
|
|
|
International
Class: |
C07K 14/31 20060101
C07K014/31; C07K 16/12 20060101 C07K016/12; C07K 16/40 20060101
C07K016/40; C12Q 1/689 20060101 C12Q001/689; A61K 39/085 20060101
A61K039/085; A61K 39/40 20060101 A61K039/40 |
Goverment Interests
STATEMENT OF GOVERNMENT SUPPORT
[0002] This invention was made with government support under Grant
Nos.: AI52747 and AI110937, awarded by the National Institute of
Allergy and Infectious Diseases and Grant No.: HD009007 awarded by
the National Institute of Health. The government has certain rights
in the invention.
Claims
1-29. (canceled)
30. An antibody or polypeptide comprising: i) a VL domain
comprising a CDR1, CDR2, and CDR3 that is least 85% identical to
SEQ ID NO:12, SEQ ID NO:13, and SEQ ID NO:14, respectively, and/or
a VH domain comprising a CDR1, CDR2, and CDR3 that is least 85%
identical to SEQ ID NO:9, SEQ ID NO:10, and SEQ ID NO:11,
respectively; or ii) a VL domain comprising a CDR1, CDR2, and CDR3
that is least 85% identical to SEQ ID NO:18, SEQ ID NO:19, and SEQ
ID NO:20, respectively, and/or a VH domain comprising a CDR1, CDR2,
and CDR3 that is least 85% identical to SEQ ID NO:15, SEQ ID NO:16,
and SEQ ID NO:17, respectively.
31. (canceled)
32. The antibody or polypeptide of claim 30, wherein the antibody
or polypeptide comprises: i) a VL domain comprising a CDR1, CDR2,
and CDR3 comprising SEQ ID NO:12, SEQ ID NO:13, and SEQ ID NO:14,
respectively, and a VH domain comprising a CDR1, CDR2, and CDR3
comprising SEQ ID NO:9, SEQ ID NO:10, and SEQ ID NO:11,
respectively; or ii) a VL domain comprising a CDR1, CDR2, and CDR3
comprising SEQ ID NO:18, SEQ ID NO:19, and SEQ ID NO:20,
respectively, and a VH domain comprising a CDR1, CDR2, and CDR3
comprising SEQ ID NO:15, SEQ ID NO:16, and SEQ ID NO:17,
respectively.
33. (canceled)
34. The antibody or polypeptide of claim 30, wherein the
polypeptide comprises a humanized or chimeric antibody.
35. The antibody or polypeptide of claim 30, wherein the
polypeptide has an association constant for a Staphylococcal Coa
polypeptide of between about 0.1 and 20 nM.sup.-1, 0.5 and 10
nM.sup.-1, or 1.0 and 10 nM.sup.-1 as measured by ELISA.
36. The antibody or polypeptide of claim 30, wherein the
polypeptide is operatively coupled to a recombinant polypeptide
that specifically binds to a second Staphylococcal protein.
37. The antibody or polypeptide of claim 30, wherein the
polypeptide is an antibody comprising (a) a heavy chain comprising
said VH region, and a human hinge, CH1, CH2, and CH3 regions from
an IgG1, IgG2, IgG3 or IgG4 subtype; and (b) a light chain
comprising said VL region, and either a human kappa CL or human
lambda CL.
38. A pharmaceutical composition comprising the antibody or
polypeptide of claim 30.
39. The pharmaceutical composition of claim 38, comprising a single
unit dose of the antibody or polypeptide in a sealed container.
40. The pharmaceutical composition of claim 38, comprising at least
a second anti-bacterial agent and optionally wherein the second
anti-bacterial agent is an antibiotic, a Staphylococcal vaccine
composition, or a polypeptide that specifically binds to a second
Staphylococcal protein.
41. One or more polynucleotide(s) comprising a nucleic acid
sequence encoding an antibody or polypeptide according to claim
30.
42. An expression vector comprising a nucleic acid sequence
encoding an antibody or polypeptide according to claim 30 operably
linked to an expression control sequence.
43. A host cell comprising the expression vector of claim 42.
44. A method of manufacturing the antibody or polypeptide of claim
30 comprising expressing one or more polynucleotides encoding the
polypeptide in a host cell, wherein the one or more polynucleotides
are operably linked to an expression control sequence.
45. A method of treating or inhibiting a Staphylococcus infection
in a subject determined to have or be at risk for Staphylococcus
infection comprising administering to the subject an effective
amount of the composition of the antibody or polypeptide of claim
30 to the subject.
46-58. (canceled)
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. patent
application Ser. No. 16/077,213 filed Aug. 10, 2018, which is a
national phase application under 35 U.S.C. .sctn. 371 of
International Application No. PCT/IB2017/050763 filed Feb. 10,
2017, which claims the benefit of priority of U.S. Provisional
Patent Application No. 62/294,413, filed Feb. 12, 2016. The entire
contents of each of the above-referenced disclosures are
specifically incorporated herein by reference.
BACKGROUND OF THE DISCLOSURE
Field of the Invention
[0003] The present invention relates generally to the fields of
immunology, microbiology, and pathology. More particularly, it
concerns methods and compositions involving antibodies to bacterial
proteins and bacterial peptides used to elicit such antibodies. The
proteins include Coagulase (Coa).
Background
[0004] North American hospitals are experiencing an epidemic of
Staphylococcus aureus. This organism causes a wide range of
diseases from minor skin infections to life-threatening sepsis,
endocarditis, and pneumonia [2]. S. aureus is endowed with a wide
range of virulence factors that enable its many disease
manifestations. One of the defining characteristics of S. aureus
that distinguishes it from less pathogenic species of Staphylococci
is its ability to clot anticoagulated blood [48,75]. This
characteristic is due to two proteins, coagulase (Coa) and von
Willebrand factor binding protein (vWbp). Coa and vWbp bind to and
induce a conformational change in host prothrombin, which mimics
the transition from the zymogen to activated thrombin, enabling the
complex to cleave fibrinogen to fibrin [66, 67, 71, 72, 133, 146,
188]. Fibrin forms the mesh network of a blood clot.
[0005] Coa and vWbp play an important role during the pathogenesis
of S. aureus infection [212]. Infection with double mutants in coa
and vwb results in delayed mortality in a murine sepsis model and
nearly eliminates the ability of Staphylococci to form abscesses
(Cheng et al. 2010). A humoral immune response against Coa and vWbp
provides protection against Staphylococcal infection (Cheng et al.
2010). Pharmacologic inhibition of the coagulases with direct
thrombin inhibitors neutralizes the activity of Coa and vWbp and
provides prophylactic protection against Staphylococcal sepsis
[20,177,213].
[0006] S. aureus can survive on dry surfaces, increasing the chance
of transmission. Any S. aureus infection can cause the
Staphylococcal scalded skin syndrome, a cutaneous reaction to
exotoxin absorbed into the bloodstream. S. aureus can also cause a
type of septicemia called pyaemia that can be life-threatening.
Methicillin-resistant Staphylococcus aureus (MRSA) has become a
major cause of hospital-acquired infections.
[0007] S. aureus infections are typically treated with antibiotics,
with penicillin being the drug of choice, but vancomycin being used
for methicillin resistant isolates. The percentage of
Staphylococcal strains exhibiting wide-spectrum resistance to
antibiotics has increased, posing a threat to effective
antimicrobial therapy. In addition, the recent appearance of
vancomycin-resistant S. aureus strain has aroused fear that MRSA
strains for which no effective therapy is available are starting to
emerge and spread.
[0008] An alternative approach to antibiotics in the treatment of
Staphylococcal infections has been the use of antibodies against
Staphylococcal antigens in passive immunotherapy. Examples of this
passive immunotherapy involves administration of polyclonal
antisera (WO00/15238, WO00/12132) as well as treatment with
monoclonal antibodies against lipoteichoic acid (WO98/57994).
[0009] The first generation of vaccines targeted against S. aureus
or against the exoproteins it produces have met with limited
success (Lee, 1996) and there remains a need to develop additional
therapeutic compositions for treatment of staphylococcus
infections.
SUMMARY
[0010] During infection, Staphylococcus aureus secrets two
coagulases, Coa and vWbp, which upon association with host
prothrombin and fibrinogen, convert soluble fibrinogen to insoluble
fibrin, induce the formation of fibrin clots and enable the
establishment of Staphylococcal disease. Coa and vWbp are important
factors for Staphylococcal coagulation and agglutination and for
promoting the pathogenesis of S. aureus abscess formation and
lethal bacteremia in mice. Here the inventors demonstrate that
polypeptides with the R Domain of Coa can be used as vaccines and
that antibodies directed against the R Domain of Coa are capable of
recognizing many different serotypes, providing broad-spectrum
protection against bloodstream infections caused by MRSA isolates.
Furthermore, antibodies described herein that are directed to the
D1 domain of Coa and/or vWbp also provide protection from
infection. Staphylococcus aureus is the most frequent cause of
bacteremia and hospital-acquired infection in the United States. An
FDA approved vaccine that prevents Staphylococcal disease is
currently unavailable.
[0011] In certain embodiments there are antibody compositions that
inhibit, ameliorate, and/or prevent Staphylococcal infection.
[0012] Certain embodiments are directed to methods of inhibiting
Staphylococcus infection in a subject determined to have or be at
risk for Staphylococcus infection comprising administering to the
subject an effective amount of a Coa binding polypeptide that
specifically binds to a Staphylococcal Coa polypeptide. In some
embodiments, the method further comprises administering an
effective amount of two or more Coa binding polypeptides. In some
embodiments, the method further comprises administering an
antibiotic or a Staphylococcal vaccine composition to the subject.
In other embodiments, there are methods for treating a subject with
or determined to have a Staphylococcus infection. In further
embodiments, there are methods for preventing a Staphylococcus
infection.
[0013] In some aspects, the Coa binding polypeptide specifically
binds to Domain 1 of a Staphylococcal Coa polypeptide. In other
aspects, the Coa binding polypeptide specifically binds to Domain 2
of a Staphylococcal Coa polypeptide. In some aspects, the Coa
binding polypeptide specifically binds to R Domain of a
Staphylococcal Coa polypeptide. In further embodiments, the Coa
binding polypeptide specifically binds to a region on both Domain 1
and Domain 2 of a Staphylococcal Coa polypeptide.
[0014] Certain embodiments are directed to a Coa binding
polypeptide that specifically binds to an epitope in a polypeptide
encoded by any of: 1) a R Domain from the S. aureus Coa
polypeptides corresponding to SEQ ID NOS:1-8 or 22-38; 2) a R
Domain of SEQ ID NOS:39-55, SEQ ID NOS:85-101, or a fragment
thereof, or 3) one or more R domain fragments of SEQ ID NOS:57-62
or SEQ ID NOS:102-127. In certain aspects, the Coa binding
polypeptide specifically binds to an epitope in amino acids 1-149,
150-282, or 1-282 of a polypeptide encoded by any of SEQ ID NOs:
1-8. In certain aspects, the Coa binding polypeptide specifically
binds to an epitope in amino acids 470-605 of S. aureus Newman. In
certain aspects the epitope comprises at least, or has at most 6,
7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23,
24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40,
41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57,
58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74,
75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91,
92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106,
107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119,
120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130,131, 132,
133, 134,135, 136, 137, 138, 139, 140, 141,142, 143, 144, 145, 146,
147, 148, 149,150, 151, 152, 153, 154, 155, 156, 157, 158, 159,
160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172,
173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185,
186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198,
199, 200 or more contiguous amino acids (or any range derivable
therein) from any of the sequences provided herein or encoded by
any of the sequences provided herein.
[0015] In particular embodiments, the Coa binding polypeptide
competes for binding of Staphylococcal Coa polypeptide with the
5D5.4 or 3B3.14 monoclonal antibody. In further embodiments, the
monoclonal antibody is 3B3.14 or 5D5.4. In some embodiments, the
Coa binding polypeptide has an association constant for the
Staphylococcal Coa polypeptide of between about 0.5 and 20
nM.sup.-1, 1.0 and 10 nM.sup.-1, or 1.0 and 6.0 nM.sup.-1 as
measured by ELISA. In certain embodiments, the Coa binding
polypeptide has an association constant for the Staphylococcal Coa
Domain 1-2 or R Domain of between about 0.5 and 20 nM.sup.-1 or 1.0
and 10 nM.sup.-1 as measured by ELISA.
[0016] The Coa binding polypeptide may be any polypeptide that
specifically binds Coa proteins from staphylococcus bacteria. In
certain embodiments, the Coa binding polypeptide is a purified
monoclonal antibody or a purified polyclonal antibody. The
polypeptide may be, for example, an antibody that is single domain,
humanized, or chimeric. In some embodiments, two or more Coa
binding polypeptides (e.g., two or more purified monoclonal
antibodies or purified polyclonal antibodies) may be administered
to the subject. In certain aspects, the Coa binding polypeptide is
recombinant. In other embodiments, there may be chemical
modifications to the polypeptide, such as the addition of one or
more chemical modifications or moieties.
[0017] Embodiments are provided in which the Coa binding
polypeptide comprises one or more CDR domains from an antibody that
specifically binds to Domains 1-2 of a Staphylococcal Coa
polypeptide. Embodiments are provided in which the Coa binding
polypeptide comprises one or more CDR domains from an antibody that
specifically binds to an R Domain of a Staphylococcal Coa
polypeptide. In particular embodiments, the Coa binding polypeptide
comprises one, two, three, four, five, six, or more CDR domains
from among the VH or VL domain of the 5D5.4 and 3B3.14 monoclonal
antibodies. In certain aspects, the Coa binding polypeptide
comprises six CDR domains from among the VH or VL domains of the
5D5.4 and 3B3.14 monoclonal antibodies. In some embodiments, the
Coa binding polypeptide comprises a sequence at least or at most
70%, 75%, 80%, 85%, 90%, 95%, or 99% (or any range derivable
therein) identical to the VH or VL domain of the 5D5.4 or 3B3.14
monoclonal antibodies. Embodiments are provided in which the Coa
binding polypeptide comprises the VH domain from the 5D5.4 or
3B3.14 monoclonal antibody and/or the VL domain the 5D5.4 or 3B3.14
monoclonal antibody. In further embodiments, the monoclonal
antibody is 5D5.4 or 3B3.14.
[0018] In some embodiments the Coa binding polypeptide comprises
one or more CDR domains from a Coa binding polypeptide that
specifically binds to Domain 1-2 of a Staphylococcal Coa
polypeptide and a scaffold from a polypeptide selected from the
group consisting of an immunoglobulin, a fibronectin or a S. aureus
protein Z.
[0019] In some embodiments the Coa binding polypeptide comprises
one or more CDR domains from a Coa binding polypeptide that
specifically binds to the R Domain of a Staphylococcal Coa
polypeptide and a scaffold from a polypeptide selected from the
group consisting of an immunoglobulin, a fibronectin or a S. aureus
protein Z.
[0020] The Coa binding polypeptide may be operatively coupled to a
second Coa binding polypeptide. In some aspects, the first and
second Coa binding peptides are operatively coupled recombinantly.
In other aspects, the first and second Coa binding peptides are
operatively coupled chemically.
[0021] Embodiments are provided in which the Coa binding
polypeptide is administered at a dose of about, at least about, or
at most about 0.1 mg/kg to 5 mg/kg, 1 mg/kg to 5 mg/kg, 0.1 mg/kg
to 1 mg/kg, or 2 mg/kg to 5 mg/kg (or any range derivable
therein).
[0022] Embodiments also provide a purified polypeptide comprising
one or more Coa binding polypeptide CDR domains from an antibody
that specifically binds to Domain 1-2 of a Staphylococcal Coa
polypeptide. In certain embodiments, the Coa binding polypeptide
competes for binding of a Staphylococcal Coa polypeptide with the
5D5.4 or 3B3.14 monoclonal antibody. In certain aspects, the
polypeptide has an association constant for a Staphylococcal Coa
polypeptide of between about 0.1 and 20 nM.sup.-1, 0.5 and 10
nM.sup.-1, or 1.0 and 10 nM.sup.-1 as measured by ELISA. The
polypeptide may comprise, for example, a single domain antibody Coa
binding polypeptide, a humanized antibody, or a chimeric
antibody.
[0023] In certain embodiments, the polypeptide is recombinant. In
certain aspects, the recombinant polypeptide comprises at least
90%, 95%, or 99% of one or more CDR domains from the VH or VL
domain of the 5D5.4 or 3B3.14 monoclonal antibodies. In some
embodiments, the recombinant polypeptide comprises two, three,
four, five, six, or more CDR domains from the VH or VL domain of
the 5D5.4 and/or 3B3.14 monoclonal antibodies.
[0024] In some embodiments, a recombinant polypeptide comprises i)
CDR1, CDR2, and/or CDR3 from the variable light chain of 5D5.4;
and/or ii) CDR1, CDR2, and/or CDR3 from the variable heavy chain of
5D5.4. In some embodiments, a recombinant polypeptide comprises i)
CDR1, CDR2, and/or CDR3 from the variable light chain of 3B3.14;
and/or ii) CDR1, CDR2, and/or CDR3 from the variable heavy chain of
3B3.14. The sequences for these CDRs are the following:
TABLE-US-00001 TABLE 1 CDR Sequences of 5D5.4 and 3B3.14 Monoclonal
Antibodies SEQ SEQ SEQ Variable ID ID ID Ab chain CDR1 NO: CDR2 NO:
CDR3 NO: 5D5.4 Heavy GASITTSY 9 ISYSGNT 10 ATYYDFNYDGY 11 LDV 5D5.4
Light SSVSSSY 12 STS 13 QQYHRSPPT 14 3B3.14 Heavy GYTFTSFD 15
IFPGDGSA 16 VKNHGGWYFDV 17 3B3.14 Light QSIVHSNGNTY 18 KVS 19
FQGSHVPLT 20
[0025] In some embodiments, there is a purified polypeptide
comprising one or more Coa binding polypeptide CDR domains from an
antibody that specifically binds to Domain 1-2 of a Staphylococcal
Coa polypeptide. In some embodiments, there is a purified
polypeptide comprising one or more Coa binding polypeptide CDR
domains from an antibody that specifically binds to the R Domain of
a Staphylococcal Coa polypeptide. As indicated above, the
polypeptide may comprise 1, 2, 3, 4, 5, or 6 CDRs from the light
and/or heavy chain variable regions of a Coa antibody. Table 1
provides 2 different Coa antibodies and their CDR1, CDR2, and CDR3
sequences from both the light and heavy chain variable regions. In
certain embodiments, a polypeptide contains CDR1, CDR2, and/or CDR3
from the light chain variable region of a particular antibody. It
is contemplated that while in some embodiments a polypeptide has a
CDR1, CDR2, and CDR3 from the variable region of a light chain
and/or the variable region of a heavy chain that the CDR1, CDR2,
and CDR3 need not be from the same antibody. While some
polypeptides have CDR1, CDR2, and CDR3 from the same antibody or
based on the same antibody, given the overlap in amino acid
sequences, a CDR1 from one antibody may be substituted with a CDR
from or based on another antibody. For example, a polypeptide may
comprise a CDR1 from or based on the light chain variable region of
5D5.4, a CDR2 from or based on the light chain variable region of
3B3.14, but have a CDR3 from or based on the variable light chain
region of 5D5.4. It is generally contemplated, however, that when a
single set of CDR1, CDR2, and CDR3 are employed together that they
all be from a light chain variable region or from a heavy chain
variable region, but not a mix from both.
[0026] Alternatively, the polypeptide may contain a CDR1 sequence
that is, is at most or is at least 70, 75, 80, 85, 90, 95, 96, 97,
98, 99, 100% identical (or any range derivable therein) to the
entire sequence set forth in SEQ ID NOs:12 and 18, which are CDR1
sequences from the light chain variable region of a Coa antibody.
Alternatively or additionally, the polypeptide may contain a CDR2
sequence that is, is at most or is at least 70, 75, 80, 85, 90, 95,
96, 97, 98, 99, 100% identical (or any range derivable therein) to
the entire sequence set forth in SEQ ID NOs:13 and 19, which are
CDR2 sequences from the light chain variable region of a Coa
antibody. Alternatively or additionally, the polypeptide may
contain a CDR3 sequence that is, is at most or is at least 70, 75,
80, 85, 90, 95, 96, 97, 98, 99, 100% identical (or any range
derivable therein) to the entire sequence set forth in SEQ ID
NOs:14 and 20, which are CDR3 sequences from the light chain
variable region of a Coa antibody. Alternatively or additionally,
the polypeptide may contain a CDR1 sequence that is, is at most or
is at least 70, 75, 80, 85, 90, 95, 96, 97, 98, 99, 100% identical
(or any range derivable therein) to the entire sequence set forth
in SEQ ID NOs:9 and 15, which are CDR1 sequences from the heavy
chain variable region of a Coa antibody. Alternatively or
additionally, the polypeptide may contain a CDR2 sequence that is,
is at most or is at least 70, 75, 80, 85, 90, 95, 96, 97, 98, 99,
100% identical (or any range derivable therein) to the entire
sequence set forth in SEQ ID NOs:10 and 16, which are CDR2
sequences from the heavy chain variable region of a Coa antibody.
Alternatively or additionally, the polypeptide may contain a CDR3
sequence that is, is at most or is at least 70, 75, 80, 85, 90, 95,
96, 97, 98, 99, 100% identical (or any range derivable therein) to
the entire sequence set forth in SEQ ID NOs:11 and 17, which are
CDR3 sequences from the heavy chain variable region of a Coa
antibody.
[0027] Other embodiments provide a recombinant polypeptide that
comprises one or more CDR domain(s) from an antibody that
specifically binds to Domains 1-2 or to the R Domain of a
Staphylococcal Coa polypeptide and a scaffold from a polypeptide
selected from the group consisting of an immunoglobulin, a
fibronectin or a S. aureus protein Z. It is further contemplated
that any polypeptide may be attached, fused or conjugated to an
agent or substance, such a therapeutic moiety or a detectable
moiety.
[0028] In certain aspects, the recombinant polypeptide is
operatively coupled to a recombinant polypeptide that specifically
binds to a second Staphylococcal protein.
[0029] In other embodiments, the polypeptide is an antibody
comprising (a) a heavy chain comprising said VH region, and a human
hinge, CH1, CH2, and CH3 regions from an IgG1, IgG2, IgG3 or IgG4
subtype; and (b) a light chain comprising said VL region, and
either a human kappa CL or human lambda CL.
[0030] Certain embodiments provide a purified monoclonal antibody
that specifically binds to a Staphylococcal Coa polypeptide,
wherein the purified monoclonal antibody is the 5D5.4 or 3B3.14
monoclonal antibody.
[0031] In some aspects, the purified polypeptide does not consist
of the mouse monoclonal antibody that is 5D5.4 or 3B3.14. In other
embodiments the purified polypeptide is not an isolated mouse
monoclonal antibody.
[0032] Other embodiments provide a pharmaceutical composition
comprising one or more purified Coa binding polypeptide. In some
embodiments, the pharmaceutical composition provides a single unit
dose of the purified polypeptide in a sealed container. The
pharmaceutical composition may comprise at least a second
anti-bacterial agent including, but not limited to, an antibiotic,
a Staphylococcal vaccine composition or a polypeptide that
specifically binds to a second Staphylococcal protein.
[0033] Certain embodiments, provide a polynucleotide comprising a
nucleic acid sequence encoding a Coa binding polypeptide.
[0034] Other embodiments provide an expression vector comprising a
nucleic acid sequence encoding a Coa binding polypeptide operably
linked to an expression control sequence. Some embodiments provide
a host cell comprising the expression vector.
[0035] Embodiments also provide a method manufacturing a Coa
binding polypeptide comprising expressing a nucleic acid sequence
encoding the polypeptide operably linked to an expression control
sequence in a host cell.
[0036] Embodiments also provide for the use of Coa antibodies in
methods and compositions for the treatment of bacterial and/or
Staphylococcal infection. In certain embodiments, compositions are
used in the manufacture of medicaments for the therapeutic and/or
prophylactic treatment of bacterial infections, particularly
staphylococcus infections. Furthermore, in some embodiments there
are methods and compositions that can be used to treat (e.g.,
limiting Staphylococcal abscess formation and/or persistence in a
subject) or prevent bacterial infection.
[0037] Certain aspects are directed to methods of reducing
Staphylococcus infection or abscess formation comprising
administering to a subject having or suspected of having a
Staphylococcus infection an effective amount of one or more
purified antibodies that specifically bind a Coa polypeptide. The
antibody can be a purified polyclonal antibody, a purified
monoclonal antibody, a recombinant polypeptide, or a fragment
thereof. In certain aspects the antibody is humanized or human. In
still further aspects the antibody is a recombinant antibody
segment. In certain aspects a monoclonal antibody includes one or
more of 5D5.4 or 3B3.14. An antibody can be administered at a dose
of 0.1, 0.5, 1, 5, 10, 50, 100 mg or .quadrature.g/kg to 5, 10, 50,
100, 500 mg or .quadrature.g/kg, or any range derivable therein.
The recombinant antibody segment can be operatively coupled to a
second recombinant antibody segment. In certain aspects the second
recombinant antibody segment binds a second Staphylococcal protein.
The method can further comprise administering a second antibody
that binds a second Staphylococcal protein. In certain aspects the
method further comprises administering an antibiotic.
[0038] Embodiments are directed to monoclonal antibody
polypeptides, polypeptides having one or more segments thereof, and
polynucleotides encoding the same. In certain aspects a polypeptide
can comprise all or part of the heavy chain variable region and/or
the light chain variable region of Coa-specific antibodies. In a
further aspect, a polypeptide can comprise an amino acid sequence
that corresponds to a first, second, and/or third complementary
determining regions (CDRs) from the light variable chain and/or
heavy variable chain of a Coa-specific antibody.
[0039] In still further aspects, embodiments provide a hybridoma
cell line that produces a monoclonal antibody of the embodiments.
In embodiments the hybridoma cell line is a line that produces the
5B5.4 or 3B3.14 monoclonal antibody. In a further aspect, 1, 2,
and/or 3 CDRs from the light and/or heavy chain variable region of
a mAb can be comprised in a humanized antibody or variant
thereof.
[0040] A further aspect of the disclosure relates to an immunogenic
composition comprising a polypeptide comprising a Staphylococcal
coagulase R Domain or segment thereof. For example, the R Domain
can comprise or consist of an amino acid sequence that is at least
80, 85, 90, 95, 98, 99 or 100% identical to an amino acid sequence
of the R Domain. In some aspects, a Staphylococcal coagulase R
Domain is comprised in a less than full-length coagulase protein.
For example, the R Domain can be comprised in a less than
full-length Coa protein (e.g., that lacks all or part of a L, 1, or
2 Domain segment). In some aspects, a R Domain is a R Domain
segment/fragment wherein the secretion signal sequence has been
removed. In some aspects, the R Domain is a R Domain
segment/fragment comprising at least one repeat element from the R
Domain. In some aspects, the R Domain comprises R Domain
segments/fragments (also referred to as R-repeats) comprising 1, 2,
3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 repeat elements from the R
Domain. In some embodiments, the R Domain is the full R Domain or a
segment/fragment that is repeated in tandem units. In some
embodiments, the full R Domain or a segment is repeated in 2, 3, 4,
5, 6, 7, 8, 9, or 10 tandem units (or any derivable range therein).
In certain embodiments, an immunogenic composition is provided
comprising at least one Staphylococcal coagulase R domain or
segment thereof. For example, a composition can comprise at least
one Staphylococcal R Domain (or segment/fragment thereof) from a
Staphylococcal Coa protein. In some embodiments, the immunogenic
composition comprises at least one R Domain. In some embodiments,
the immunogenic composition comprises at least two R Domains. In
some embodiments, the immunogenic composition comprises at least
two different R Domains. In some embodiments, the R Domain (or
segment) is comprised in a less than full-length coagulase protein.
In certain aspects, the sequence of the R Domain comprises or
consists of an amino acid sequence that is at least 80% identical
to an amino acid sequence of the R domain (FIG. 1A, a.a. 470-605 of
S. aureus Newman, for example). Sequences of R domains are
described herein. In certain aspects, the sequence of the R Domain
comprises or consists of an amino acid sequence that is at least
85, 90, 95, 98, 99 or 100% identical to an amino acid sequence of
the R domain described herein. In some embodiments, the R Domains
are at least 85%, 90% or 95% identical to an amino acid sequence of
1) a R Domain from the S. aureus Coa polypeptides corresponding to
SEQ ID NOS:1-8 or 22-38; 2) a R Domain of SEQ ID NOS:39-55, SEQ ID
NOS:85-101, or a fragment thereof, or 3) one or more R domain
fragments of SEQ ID NOS:57-62 or SEQ ID NOS:102-127. In some
embodiments, the R Domains are at least 80, 81, 82, 83, 84, 85, 86,
87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% (or any
derivable range therein) identical to an amino acid sequence of a R
Domain of SEQ ID NOS:39-55, SEQ ID NOS:85-101, or a
segment/fragment thereof. In further aspects, at least one of the R
Domains is comprised in a less than full-length coagulase protein
sequence. In particular embodiments, the full length coagulase
protein is a Coa protein comprising the sequence of SEQ ID NO:1, 2,
3, 4, 5, 6, 7, 8, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,
34, 35, 36, 37 or 38. In still further aspects, the less than
full-length Coa protein lacks all or part of a L Domain
segment.
[0041] The polypeptides or the disclosure, including those
discussed in the above-identified embodiments, as well as the
antibody polypeptides, Staphylococcus coagulase polypeptides, R
domains, and R domain segments/fragments may comprise a sequence
that is at least, at most, or exactly 10, 11, 12, 13, 14, 15, 16,
17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,
34, 45, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50,
51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67,
68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80 85, 90, 95, 100,
105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165,
170, 175, 180, 185, 190, 195, 200, 205, 210, 215, 220, 225, 230,
235, 240, 245, 250, 255, 260, 265, 270, 275, 280, 285, 290, 295,
200 contiguous amino acids (or any derivable range therein) to a
polypeptide sequence described herein and may be at least 70, 75,
80, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or
100% (or any range derivable therein) identical to another
polypeptide and/or the contiguous polypeptide may be at least 70,
75, 80, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99,
or 100% (or any range derivable therein) to a contiguous amino acid
sequence described herein.
[0042] In certain embodiments, one of the Staphylococcal coagulase
R Domains (or segment thereof) is from a coagulase protein from a
S. aureus Newman, 85/2082, MW2, MSSA476, N315, Mu50, MRSA252,
CowanI, WIS or USA300 strain, or any other S. aureus strain.
[0043] In certain embodiments, one of the Staphylococcal coagulase
R Domains (or segment thereof) is from one of the dominant Coa
taken from one of the dominant S. aureus lineage ST5, ST8, ST22,
ST30, ST45, ST239.
[0044] In some aspects, one of the R Domains comprises a Coa R
Domain at least 80% identical to an amino acid sequence of the R
Domain. In further aspects, one of the R Domains comprises a Coa R
Domain at least 85, 90, 95, 98, 99% identical (or any derivable
range therein) to an amino acid sequence of the R Domain.
[0045] In certain embodiments, one of the R Domains is a Coa R
Domain, further comprising an L, 1 (D1), or 2 (D2) Domain from a
Staphylococcal Coa protein. In certain embodiments, the polypeptide
and/or immunogenic composition does not comprise an L Domain. In
certain embodiments, the polypeptide and/or immunogenic composition
does not comprise a D1 and or D2 Domain.
[0046] In some aspects, an immunogenic composition comprises or
consists of at least three, four, or five different Staphylococcal
coagulase R Domains. In further aspects, an immunogenic composition
comprise at least four different Staphylococcal coagulase R
Domains. In particular embodiments, the at least four different
Staphylococcal coagulase R Domains are Staphylococcal Coa R Domains
from strains MRSA252, MW2, N315 and USA300. In particular
embodiments, the at least four different Staphylococcal coagulase R
Domains are Staphylococcal Coa R Domains from ST5, ST8, ST22 and
ST239. In particular embodiments, the at least four different
Staphylococcal coagulase R Domains are Staphylococcal Coa R Domains
from ST5, ST8, ST22, ST30, ST45 and/or ST239. In some embodiments,
it is contemplated that an immunogenic composition comprises at
least two different Staphylococcal coagulase R Domains that are
comprised in a fusion protein (i.e. the two R domains are on the
same polypeptide). In some embodiments, the polypeptide comprises
one or more R domains or R domain segments/fragments; wherein the
polypeptide comprises a polypeptide linker before, after, and/or
between the R domains or segments/fragments thereof.
[0047] Embodiments include a recombinant polypeptide comprising at
least one Staphylococcal coagulase R Domain. In some embodiments,
the recombinant polypeptide comprises at least two different R
Domains. The sequences of the R Domains are at least 80% identical
to an amino acid sequence of the R Domain. In some aspects, the
sequence of the R Domains are at least 85, 90, 95, 98, 99%
identical (or any derivable range therein) to an amino acid
sequence of the R Domain. In some embodiments, the R Domains are at
least 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94,
95, 96, 97, 98, 99, or 100% identical (or any derivable range
therein) to an amino acid sequence of: 1) a R Domain from the S.
aureus Coa polypeptides corresponding to SEQ ID NOS:1-8 or 22-38;
2) a R Domain of SEQ ID NOS:39-55, SEQ ID NOS:85-101, or a fragment
thereof, or 3) one or more R domain fragments of SEQ ID NOS:57-62
or SEQ ID NOS:102-127.
[0048] In further embodiments, a polynucleotide molecule comprising
a nucleic acid sequence encoding a recombinant polypeptide
comprising sequence encoding at least one Staphylococcal coagulase
R Domain or segment/fragment is contemplated. In some embodiments,
the polynucleotide molecule comprises a nucleic acid sequence
encoding for at least two different R Domains. In further aspects,
an expression vector comprises the nucleic acid sequence operably
linked to an expression control sequence. In still further aspects,
a host cell comprising the expression vector is also
contemplated.
[0049] Embodiments include the use of the compositions, the
polypeptides, recombinant polypeptides, immunoglobulin
preparations, the polynucleotide molecule and the expression vector
described throughout the disclosure to treat or prevent a
Staphylococcal infection in a subject. In some aspects, a
composition comprising at least one Staphylococcal coagulase R
Domain is used to treat or prevent a Staphylococcal infection. In
some embodiments, the composition comprises at least two different
R Domains. The sequences of the R Domains are at least 80%
identical to an amino acid sequence of the R domain and at least
one of the R Domains is a truncated coagulase protein sequence.
[0050] Embodiments include methods of preventing or treating
staphylococcal infection comprising the step of administering an
immunogenic composition comprising a Staphylococcal coagulase or an
immunogenic segment thereof, such as the R domains and R domain
fragment/segments described herein.
[0051] Certain embodiments are directed to methods of preparing an
immunoglobulin for use in prevention or treatment of staphylococcal
infection comprising the steps of immunizing a recipient with a
coagulase polypeptide polypeptide such as a polypeptide comprising
a R domain or R domain segment/fragment described herein and
isolating immunoglobulin from the recipient.
[0052] In one embodiment, there is a method of preparing an
immunoglobulin for use in prevention or treatment of staphylococcal
infection comprising the steps of immunizing a recipient with a
vaccine, polypeptide, or immunogenic composition of the disclosure
and isolating antibody-producing cells from the recipient, fusing
the isolated cells with a myeloma cell, and isolating
immunoglobulin from the fused cell. In some embodiments, the
antibody producing cell comprises a spleen, peripheral blood, or
lymph node cell. In some embodiments, the method further comprises
sequencing the isolated immunoglobulin. In some embodiments, the
method further comprises testing the isolated immunoglobulin for
binding to an antigen, wherein the antigen comprises: 1) a R Domain
from the S. aureus Coa polypeptides corresponding to SEQ ID NOS:1-8
or 22-38; 2) a R Domain of SEQ ID NOS:39-55, SEQ ID NOS:85-101, or
a fragment thereof, or 3) one or more R domain fragments of SEQ ID
NOS:57-62 or SEQ ID NOS:102-127.
[0053] A further embodiment is directed to an immunoglobulin
prepared by a method described herein.
[0054] A further embodiment is directed to an immunoglobulin that
specifically binds to a polypeptide comprising: 1) a R Domain from
the S. aureus Coa polypeptides corresponding to SEQ ID NOS:1-8 or
22-38; 2) a R Domain of SEQ ID NOS:39-55, SEQ ID NOS:85-101, or a
fragment thereof, or 3) one or more R domain fragments of SEQ ID
NOS:57-62 or SEQ ID NOS:102-127. The polypeptide that is
specifically recognized by the immunoglobulin may be a polypeptide
described throughout this disclosure.
[0055] A further embodiment is directed to methods for treatment or
prevention of staphylococcal infection comprising a step of
administering to a subject an effective amount of pharmaceutical
preparation of immunoglobulin that binds to a R domain and/or R
domain fragment/segments described herein.
[0056] Other embodiments are directed to a use of the
pharmaceutical preparation of coagulase immunoglobulins in the
manufacture of a medicament for the treatment or prevention of
staphylococcal infection.
[0057] Yet still further embodiments include vaccines comprising a
pharmaceutically acceptable composition having an isolated
polypeptide described herein, such as the R Domains and/or R domain
segments/fragments set forth in SEQ ID NOS:1-8, 22-55, or 85-101 or
fragments thereof, or any other combination or permutation of
protein(s) or peptide(s) described herein, wherein the composition
is capable of stimulating an immune response against a
staphylococcus bacterium. The vaccine may comprise an isolated
polypeptide described herein, or any other combination or
permutation of protein(s) or peptide(s) described throughout the
disclosure. In certain aspects of the invention the isolated
polypeptide, or any other combination or permutation of protein(s)
or peptide(s) described are multimerized, e.g., dimerized or
concatamerized. In a further aspect, the vaccine composition is
contaminated by less than about 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, 0.5,
0.25, 0.05% (or any range derivable therein) of other
Staphylococcal proteins. A composition may further comprise an
isolated non-coagulase polypeptide. Typically the vaccine comprises
an adjuvant. In certain aspects a protein or peptide of the
invention is linked (covalently or non-covalently) to the adjuvant,
preferably the adjuvant is chemically conjugated to the
protein.
[0058] In still yet further embodiments, a vaccine composition is a
pharmaceutically acceptable composition having a recombinant
nucleic acid encoding all or part of a polypeptide described
herein, or any other combination or permutation of protein(s) or
peptide(s) described herein, wherein the composition is capable of
stimulating an immune response against a staphylococcus bacterium.
The vaccine composition may comprise a recombinant nucleic acid
encoding all or part of a polypeptide of the disclosure, or any
other combination or permutation of protein(s) or peptide(s)
described herein. In certain embodiments the recombinant nucleic
acid contains a heterologous promoter. Preferably the recombinant
nucleic acid is a vector. More preferably the vector is a plasmid
or a viral vector. In some aspects the vaccine includes a
recombinant, non-staphylococcus bacterium containing the nucleic
acid. The recombinant non-staphylococci may be Salmonella or
another gram-positive bacteria. The vaccine may comprise a
pharmaceutically acceptable excipient, more preferably an
adjuvant.
[0059] In some embodiments, a method to manufacture an immunogenic
composition comprising mixing at least one Staphylococcal coagulase
R Domain polypeptide with a carrier is contemplated. In some
embodiments, the method comprises mixing at least two, three, four,
five, six, seven, eight, nine, or ten different (having different
amino acid sequences) R Domains. The sequences of the R Domains are
at least 80% identical to an amino acid sequence of the R Domain
and at least one of the R Domains is a truncated coagulase protein
sequence.
[0060] In some embodiments, the R Domain is not a full-length Coa
protein or comprises less than a full-length Coa protein. In some
embodiments, the R Domain (or fragment thereof) comprises at least,
at most, or exactly 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70,
75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180,
190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290 or 300 amino
acids (or any range derivable therein). In some embodiments, the R
Domain comprises a post-translational modification that is not
present in the natural form in the S. aureus cell (i.e.
bacterial-produced form). In some embodiments, the polypeptide is
produced in a eukaryotic cell.
[0061] In some embodiments, the polypeptide has or lacks one or
more post-translational modifications such as myristoylation,
palmitoylation, isoprenylation or prenylation, farnesylation,
geranylgeranylation, glypiation, acylation, acetylation,
formylation, alkylation, methylation, amide bond formation,
amidation at C-terminus, arginylation, polyglutamylation,
polyglycylation, butyrylation, glycosylation, glycation,
polysialylation, malonylation, hydroxylation, iodination,
phosphorylation, adenylylation, propionylation,
S-glutathionylation, S-nitrosylation, S-sulfenylation (aka
S-sulphenylation), succinylation, sulfation, biotinylation,
pegylation, SUMOylation, ubiquitination, Neddylation, Pupylation,
disulfide bridges, or racemization.
[0062] Embodiments include the use of at least one Staphylococcal
coagulase R Domain described herein in methods and compositions for
the treatment of bacterial and/or Staphylococcal infection.
Furthermore, certain embodiments provide methods and compositions
that can be used to treat (e.g., limiting Staphylococcal abscess
formation and/or persistence in a subject) or prevent bacterial
infection. In some cases, methods for stimulating an immune
response involve administering to the subject an effective amount
of the immunogenic composition described herein and in certain
aspects other bacterial proteins. Other bacterial proteins include,
but are not limited to (i) a secreted virulence factor, and/or a
cell surface protein or peptide, or (ii) a recombinant nucleic acid
molecule encoding a secreted virulence factor, and/or a cell
surface protein or peptide.
[0063] Certain aspects are directed to methods of treating a
subject having or suspected of having a Staphylococcus infection
comprising administering to a subject having or suspected of having
a Staphylococcus infection an effective amount of a purified
antibody or polypeptide that specifically binds a polypeptide of
the disclosure.
[0064] In a further aspect methods are directed to treating a
subject at risk of a Staphylococcus infection comprising
administering to a subject at risk of a Staphylococcus infection an
effective amount of an antibody that binds a polypeptide of the
disclosure prior to infection with Staphylococcus.
[0065] Certain embodiments are directed to an antibody or binding
polypeptide composition comprising an isolated and/or recombinant
antibody or polypeptide that specifically binds a peptide segment
as described above. In certain aspects the antibody or polypeptide
has a sequence that is, is at least, or is at most 80, 85, 90, 95,
96, 97, 98, 99, or 100% identical (or any range derivable therein)
to all or part of any monoclonal antibody provided herein.
[0066] In additional embodiments, there are pharmaceutical
compositions comprising one or more polypeptides, immunogenic
compositions, or antibodies or antibody fragments that are
discussed herein. Such a composition may or may not contain
additional active ingredients.
[0067] In certain embodiments there is a pharmaceutical composition
consisting essentially of a polypeptide comprising one or more
antibodies or antibody fragments, polypeptides, or immunogenic
compositions discussed herein. It is contemplated that the
composition may contain non-active ingredients.
[0068] Other aspects are directed to pharmaceutical compositions
comprising an effective anti-bacterial amount of an antibody that
specifically binds to a peptide described above and a
pharmaceutically acceptable carrier.
[0069] The term "providing" is used according to its ordinary
meaning to indicate "to supply or furnish for use." In some
embodiments, the protein is provided directly by administering a
composition comprising antibodies or fragments thereof that are
described herein.
[0070] The subject typically will have (e.g., diagnosed with a
persistent Staphylococcal infection), will be suspected of having,
or will be at risk of developing a Staphylococcal infection. In
some embodiments, the subject has been diagnosed with a
Staphylococcus infection, has been previously treated for a
Staphylococcus infection, has been determined to be resistant to a
previous treatment for a Staphylococcus infection, is immune
deficient, is immunocompromised, is hospitalized, is undergoing an
invasive medical procedure, has a respiratory infection, is
infected with influenza virus or is on a respirator.
[0071] Compositions include Coa-binding polypeptides in amounts
effective to achieve the intended purpose--treatment or protection
of Staphylococcal infection. The term "binding polypeptide" refers
to a polypeptide that specifically binds to a target molecule, such
as the binding of an antibody to an antigen. Binding polypeptides
may but need not be derived from immunoglobulin genes or fragments
of immunoglobulin genes. More specifically, an effective amount
means an amount of active ingredients necessary to provide
resistance to, amelioration of, or mitigation of infection. In more
specific aspects, an effective amount prevents, alleviates or
ameliorates symptoms of disease or infection, or prolongs the
survival of the subject being treated. Determination of the
effective amount is well within the capability of those skilled in
the art, especially in light of the detailed disclosure provided
herein. For any preparation used in the methods described herein,
an effective amount or dose can be estimated initially from in
vitro, cell culture, and/or animal model assays. For example, a
dose can be formulated in animal models to achieve a desired
response. Such information can be used to more accurately determine
useful doses in humans.
[0072] Compositions can comprise an antibody that binds Coa. An
antibody can be an antibody fragment, a humanized antibody, a
monoclonal antibody, a single chain antibody or the like. In
certain aspects, the Coa antibody is elicited by providing a Coa
peptide or antigen or epitope that results in the production of an
antibody that binds Coa in the subject. The Coa antibody is
typically formulated in a pharmaceutically acceptable composition.
The Coa antibody composition can further comprise at least 1, 2, 3,
4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or 19 for
more Staphylococcal antigens or immunogenic fragments thereof. The
Staphylococcal antigen, or immunogenic fragment or segment can be
administered concurrently with the Coa antibody. The Staphylococcal
antigen or immunogenic fragment and the Coa antibody can be
administered in the same or different composition and at the same
or different times. The composition may comprises multiple (e.g.,
2, 3, 4, or more) Coa antibodies that bind Coa polypeptides from
multiple strains of S. aureus.
[0073] The Coa antibody composition can further comprise
antibodies, antibody fragments or antibody subfragments to at least
1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or
19 of more (or any range derivable therein) Staphylococcal antigens
or immunogenic fragments thereof. The antibodies, antibody
fragments or antibody subfragments to other Staphylococcal antigens
or immunogenic fragments thereof can be administered concurrently
with the Coa antibody. The antibodies, antibody fragments or
antibody subfragments to other Staphylococcal antigens or
immunogenic fragments thereof can be administered in the same or
different composition to the Coa antibody and at the same or
different times.
[0074] In other aspects, the subject can be administered with the
immunogenic composition, the recombinant polypeptide, or the vector
described herein. The recombinant polypeptide or the vector can be
formulated in a pharmaceutically acceptable composition.
[0075] The Staphylococcal antigen or immunogenic fragment can be
administered concurrently with the immunogenic composition
comprising at least one coagulase R Domain, the recombinant
polypeptide comprising at least one R Domain, and/or the vector
comprising a nucleic acid sequence encoding at least one R Domain
described herein. The Staphylococcal antigen or immunogenic
fragment can be administered in the same composition with the
immunogenic composition comprising at least one R Domains, the
recombinant polypeptide comprising at least one R Domains, and/or
the vector comprising a nucleic acid sequence encoding at least one
R Domains described herein. As used herein, the term "modulate" or
"modulation" encompasses the meanings of the words "enhance," or
"inhibit." "Modulation" of activity may be either an increase or a
decrease in activity. As used herein, the term "modulator" refers
to compounds that effect the function of a moiety, including
up-regulation, induction, stimulation, potentiation, inhibition,
down-regulation, or suppression of a protein, nucleic acid, gene,
organism or the like.
[0076] A recombinant nucleic acid molecule can encode at least one
Staphylococcal coagulase R Domain and at least one Staphylococcal
antigen or immunogenic fragment thereof. In particular aspects, the
Staphylococcal coagulase R Domain is a Coa R Domain at least 80%
identical to an amino acid sequence of the R Domain. In particular
embodiments, the coagulase protein is a Coa protein comprising the
sequence of SEQ ID NO: 1-8 or 22-38 or fragment thereof. In some
embodiments, the R Domain comprises the sequence of SEQ ID
NO:39-55, SEQ ID NOS:85-101, or a fragment thereof. In some
embodiments the R domain comprises one or more R domain fragments
of SEQ ID NOS:57-62 or SEQ ID NOS:102-127.
[0077] In some embodiments, the R Domain comprises an amino acid
sequence of X.sub.d:
RP(T/R)(F/Q)(N/K)K(P/A)S(E/K)TNAYNVTT(H/N)(A/G/Q)(N/D)G(Q/T)V(S/T)YGARPT(-
Y/Q)(K/N)KPS(E/K)TNAYNVTTH(A/G)NGQVSYGAR(L/P)T(Q/Y)(N/K)KPS(K/E)TNA
YNVTTHA(D/N)GTATYGP (SEQ ID NO:57); In some embodiments, the R
Domain polypeptide comprises or further comprises an amino acid
sequence of X.sub.a, X.sub.b, and/or X.sub.c wherein: X.sub.a is
RPRFNKPSETNAYNVTTNQDGTV(S/T)YGA (SEQ ID NO:58); X.sub.b is
RP(T/R)(Q/F)NKPS(K/E)TNAYNVTTHANGQVSYGA (SEQ ID NO:59); and X.sub.c
is RP(T/R)(F/Y/Q)(N/K)KPS(E/K)TNAYNVTT(H/N)(Q/A/R)(N/D)G(Q/T)VSYGA
(SEQ ID NO:60). In some embodiments, the R Domain comprises an
amino acid sequence of X.sub.aX.sub.bX.sub.cX.sub.d. In some
embodiments, the R Domain comprises one or more of X.sub.a,
X.sub.b, X.sub.c, and/or X.sub.d. In some embodiments, the R Domain
comprises one or more tandem repeated X.sub.a, X.sub.b, X.sub.c,
and/or X.sub.d elements.
[0078] In some embodiments, the R Domain comprises an amino acid
sequence of X.sub.h:
ARP(T/R)(F/Q)(N/K)K(P/A)S(E/K)TNAYNVTT(H/N)(A/G/Q)(N/D)G(Q/T)V(S/T)YGARP
T(Y/Q)(K/N)KPS(E/K)TNAYNVTTH(A/G)NGQVSYGAR(L/P)T(Q/Y)(N/K)KPS(K/E)TN
AYNVTTHA(D/N)GTATYG (SEQ ID NO:123); In some embodiments, the R
Domain polypeptide comprises or further comprises an amino acid
sequence of X.sub.e, X.sub.f, and/or X.sub.g wherein: X.sub.e is
ARPRFNKPSETNAYNVTTNQDGTV(S/T)YG (SEQ ID NO:124); X.sub.f is
ARP(T/R)(Q/F)NKPS(K/E)TNAYNVTTHANGQVSYG (SEQ ID NO:125); and
X.sub.g is
ARP(T/R)(F/Y/Q)(N/K)KPS(E/K)TNAYNVTT(H/N)(Q/A/R)(N/D)G(Q/T)VSYG
(SEQ ID NO:126).
[0079] In some embodiments, the R domain fragment comprises one or
more polypeptides with an amino acid sequence of
ARX.sub.1X.sub.2X.sub.3X.sub.4KX.sub.5SX.sub.6TNAYNVTTX.sub.7X.sub.8X.sub-
.9GX.sub.10X.sub.11X.sub.12YG (SEQ ID NO:61) or
ARPTX.sub.3X.sub.4KPSX.sub.6TNAYNVTTHX.sub.8X.sub.9GX.sub.10X.sub.11X.sub-
.12YG (SEQ ID NO:62), wherein X.sub.1, X.sub.2, X.sub.3, X.sub.4,
X.sub.5, X.sub.6, X.sub.7, X.sub.8, X.sub.9, X.sub.10, X.sub.11,
and X.sub.12 are any amino acid. In some embodiments, X.sub.1 is
proline or leucine. In some embodiments, X.sub.2 is arginine or
threonine. In some embodiments, X.sub.3 is phenylalanine,
glutamine, or tyrosine. In some embodiments, X.sub.4 is asparagine
or lysine. In some embodiments, X.sub.5 is proline or alanine. In
some embodiments, X.sub.6 is lysine or glutamate. In some
embodiments, X.sub.7 is histidine or asparagine. In some
embodiments, X.sub.8 is alanine, glutamine, glycine, or arginine.
In some embodiments, X.sub.9 is aspartate or asparagine. In some
embodiments, X.sub.10 is threonine or glutamine. In some
embodiments, X.sub.11 is valine or alanine. In some embodiments,
X.sub.12 is threonine or serine. The polypeptide may comprise one
or more segments as defined by SEQ ID NO:61, 62, or any of SEQ ID
NO:102-126. For example, the polypeptide may comprises at least, at
most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
20, 25, 30, 35, or 40 (or any derivable rage therein) segments,
wherein each segment comprises SEQ ID NO:61, 62, or any of SEQ ID
NO:102-126. The segments, which are all in the same continuous
polypeptide, may have a peptide linker between the segments or may
be joined without any linking amino acids. In some embodiments, the
polypeptide comprises two to six segments of SEQ ID NO:61, 62, or
any of SEQ ID NO:102-126. Furthermore, it is specifically
contemplated that the R domain fragments, as defined by SEQ ID
NO:61, 62, or any of SEQ ID NO:102-126 may be used with respect to
any embodiment involving a R domain or R domain fragment/segment
described throughout this disclosure.
[0080] In still further aspects, the isolated recombinant
polypeptide comprising at least two different Staphylococcal
coagulase R Domains (or segment thereof) described herein is
multimerized, e.g., dimerized or a linear fusion of two or more
polypeptides or peptide segments. In certain aspects of the
disclosure, a composition comprises multimers or concatamers of 1,
2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20
or more isolated cell surface proteins or segments thereof.
Concatamers are linear polypeptides having one or more repeating
peptide units. The at least two different Staphylococcal coagulase
R Domains (or segment thereof) can be consecutive or separated by a
spacer or other peptide sequences, e.g., one or more additional
bacterial peptide.
[0081] Certain embodiments include methods for eliciting an immune
response against a staphylococcus bacterium or Staphylococci in a
subject comprising providing to the subject an effective amount of
an immunogenic composition or a recombinant polypeptide comprising
at least one Staphylococcal coagulase R Domain (or segment thereof)
or a vector comprising a nucleic acid sequence encoding the
same.
[0082] Embodiments of the disclosure include compositions that
include a polypeptide, peptide, or protein that comprises a
sequence that is or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%,
97%, 98%, or 99% identical or similar to a Staphylococcal coagulase
R Domains (or segment thereof), in particular, a Coa R Domain (or
segment thereof) (see, the R Domain of FIG. 1A), or a second
protein or peptide that is a secreted bacterial protein or a
bacterial cell surface protein. Similarity or identity, with
identity being preferred, is known in the art and a number of
different programs can be used to identify whether a protein (or
nucleic acid) has sequence identity or similarity to a known
sequence. Sequence identity and/or similarity is determined using
standard techniques known in the art, including, but not limited
to, the local sequence identity algorithm of Smith & Waterman
(1981), by the sequence identity alignment algorithm of Needleman
& Wunsch (1970), by the search for similarity method of Pearson
& Lipman (1988), by computerized implementations of these
algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin
Genetics Software Package, Genetics Computer Group, 575 Science
Drive, Madison, Wis.), the Best Fit sequence program described by
Devereux et al. (1984), preferably using the default settings, or
by inspection. Preferably, percent identity is calculated by using
alignment tools known to and readily ascertainable to those of
skill in the art. Percent identity is essentially the number of
identical amino acids divided by the total number of amino acids
compared times one hundred.
[0083] Still further embodiments include methods for stimulating in
a subject a protective or therapeutic immune response against a
staphylococcus bacterium comprising administering to the subject an
effective amount of a composition including (i) a immunogenic
composition comprising at least one Staphylococcal coagulase R
Domain (or segment/fragment thereof), e.g., a Coa R Domain (see,
the R Domain of FIG. 1A or of SEQ ID NO:1-8 or of SEQ ID NO: 22-38;
a R Domain of SEQ ID NOS:39-55, SEQ ID NOS:85-101, or a fragment
thereof, or 3) one or more R domain fragments of SEQ ID NOS:57-62
or SEQ ID NOS:101-127 or a homologue thereof, or, (ii) a
recombinant polypeptide comprising at least one Staphylococcal
coagulase R Domain or homogues thereof; or, (iii) a nucleic acid
molecule comprises a sequence encoding the at least one
Staphylococcal R Domais or homologue thereof, or (iv) administering
any of (i)-(iii) with any combination or permutation of bacterial
proteins described herein. In a preferred embodiment the
composition is not a staphylococcus bacterium. In certain aspects
the subject is a human or a cow. In some embodiments, the subject
is a mammal. In a further aspect the composition is formulated in a
pharmaceutically acceptable formulation. The Staphylococci may be
Staphylococcus aureus.
[0084] Yet still further embodiments include vaccines comprising a
pharmaceutically acceptable composition having at least one
Staphylococcal coagulase R Domain described herein, or any other
combination or permutation of protein(s) or peptide(s) described
herein, wherein the composition is capable of stimulating an immune
response against a staphylococcus bacterium. The vaccine may
comprise at least one different Staphylococcal coagulase R Domain
described herein, or any other combination or permutation of
protein(s) or peptide(s) described. In certain aspects, at least
one Staphylococcal coagulase R Domain described herein, or any
other combination or permutation of protein(s) or peptide(s)
described are multimerized, e.g., dimerized or concatamerized. In a
further aspect, the vaccine composition is contaminated by less
than about 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, 0.5, 0.25, 0.05% (or any
range derivable therein) of other Staphylococcal proteins. A
composition may further comprise an isolated non-coagulase
polypeptide. Typically the vaccine comprises an adjuvant. In
certain aspects a protein or peptide of the disclosure is linked
(covalently or non-covalently) to the adjuvant, preferably the
adjuvant is chemically conjugated to the protein.
[0085] Yet further embodiments include a method comprising
performing a binding assay to test the binding of an antibody and
an antigen, wherein the antigen comprises at least 80% identity to:
1) a R Domain from the S. aureus Coa polypeptides corresponding to
SEQ ID NOS:1-8 or 22-38; 2) a R Domain of SEQ ID NOS:39-55, SEQ ID
NOS:85-101, or a fragment thereof, or 3) one or more R domain
fragment of SEQ ID NOS:57-62 or SEQ ID NOS:102-127. In some
embodiments, the binding assay comprises an ELISA (enzyme-linked
immunosorbent assay). Other binding assays are known in the art and
include, for example, western blotting, competition assays, capture
assays, and FRET. In some embodiments, the method further comprises
treating or inhibiting a Staphylococcus infection in a subject
determined to have or be at risk for Staphylococcus infection by
administering the tested antibody to the subject. In some
embodiments, the method further comprises testing the concentration
of the antibody, testing the purity of the antibody, and testing
the binding of the antibody to S. aureus infected cells.
[0086] In still yet further embodiments, a vaccine composition is a
pharmaceutically acceptable composition having a recombinant
nucleic acid encoding a recombinant polypeptide containing at least
one different Staphylococcal coagulase R Domain described herein,
or any other combination or permutation of protein(s) or peptide(s)
described herein, wherein the composition is capable of stimulating
an immune response against a staphylococcus bacteria. In certain
embodiments the recombinant nucleic acid contains a heterologous
promoter. Preferably the recombinant nucleic acid is a vector. More
preferably the vector is a plasmid or a viral vector. In some
aspects the vaccine includes a recombinant, non-staphylococcus
bacterium containing the nucleic acid. The recombinant
non-Staphylococci may be Salmonella or another gram-positive
bacteria. The vaccine may comprise a pharmaceutically acceptable
excipient, more preferably an adjuvant.
[0087] Still further embodiments include methods for stimulating in
a subject a protective or therapeutic immune response against a
staphylococcus bacterium comprising administering to the subject an
effective amount of a composition of at least one different
Staphylococcal coagulase R Domain described herein, or a
recombinant polypeptide containing at least one Staphylococcal
coagulase R Domain.
[0088] In certain embodiments of the compositions and methods
described herein, the Staphylococcal infection is a Staphylococcal
aureus infection. In some embodiments, the Staphylococcal infection
is methicillin resistant. In some embodiments, the Staphylococcal
infection is methicillin resistant Staphylococcal aureus infection
(MRSA).
[0089] In certain aspects, a bacterium delivering a composition of
the disclosure will be limited or attenuated with respect to
prolonged or persistent growth or abscess formation. In yet a
further aspect, at least one Staphylococcal coagulase R Domain can
be overexpressed in an attenuated bacterium to further enhance or
supplement an immune response or vaccine formulation.
[0090] The term "vWbp protein" refers to a protein that includes
isolated wild-type vWbp (von Willebrand factor binding protein)
polypeptides from staphylococcus bacteria and segments thereof, as
well as variants that stimulate an immune response against
staphylococcus bacteria vWbp proteins.
[0091] The term "vWh protein" refers to a protein that includes
isolated wild-type vWh (von Willebrand factor binding protein
homolog) polypeptides from staphylococcus bacteria and segments
thereof, as well as variants that stimulate an immune response
against staphylococcus bacteria vWh proteins. An immune response
refers to a humoral response, a cellular response, or both a
humoral and cellular response in an organism. An immune response
can be measured by assays that include, but are not limited to,
assays measuring the presence or amount of antibodies that
specifically recognize a protein or cell surface protein, assays
measuring T-cell activation or proliferation, and/or assays that
measure modulation in terms of activity or expression of one or
more cytokines.
[0092] In yet still further embodiments of the disclosure a
composition may include a polypeptide, peptide, or protein that is
or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%
identical or similar to a Coa protein.
[0093] In yet still further embodiments of the disclosure a
composition may include a polypeptide, peptide, or protein that is
or is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%
identical or similar to a vWbp protein.
[0094] In certain aspects, a polypeptide or segment/fragment can
have a sequence that is at least 85%, at least 90%, at least 95%,
at least 98%, or at least 99% or more identical to the amino acid
sequence of the reference polypeptide. The term "similarity" refers
to a polypeptide that has a sequence that has a certain percentage
of amino acids that are either identical with the reference
polypeptide or constitute conservative substitutions with the
reference polypeptides.
[0095] The polypeptides described herein may include 1, 2, 3, 4, 5,
6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or more variant amino acids
within at least, or at most 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13,
14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30,
31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47,
48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64,
65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81,
82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98,
99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111,
112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124,
125, 126,127, 128, 129, 130,131, 132, 133, 134, 135, 136, 137,138,
139, 140, 141, 142, 143, 144, 145,146, 147, 148, 149, 150, 151,
152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164,
165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177,
178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190,
191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203,
204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216,
217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229,
230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242,
243, 244, 245, 246, 247, 248, 249, 250, 300, 400, 500, 550, 1000 or
more contiguous amino acids, or any range derivable therein, of the
sequence of the R domain.
[0096] A polypeptide segment as described herein may include 3, 4,
5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22,
23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39,
40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56,
57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73,
74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90,
91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105,
106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118,
119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131,
132, 133, 134, 135, 136,137, 138, 139, 140, 141, 142, 143, 144,145,
146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158,
159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171,
172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184,
185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197,
198, 199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210,
211, 212, 213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223,
224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236,
237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249,
250, 300, 400, 500, 550, 1000 or more contiguous amino acids, or
any range derivable therein, of the sequence of the R Domain.
[0097] In yet still further embodiments, a composition may include
a polynucleotide that is or is at least 70%, 75%, 80%, 85%, 90%,
95%, 96%, 97%, 98%, or 99% identical or similar to a nucleic acid
sequence encoding a Coa protein. In certain aspects, the nucleic
acid sequence encoding a Coa protein of strain USA300 will have all
or part of the nucleic acid sequence provided herein. In certain
aspects, the nucleic acid sequence encoding a Coa protein of strain
N315 will have all or part of the nucleic acid sequence provided
herein. In certain aspects, the nucleic acid sequence encoding a
Coa protein of strain MW2 will have all or part of the nucleic acid
sequence provided herein. In certain aspects, the nucleic acid
sequence encoding a Coa protein of strain MRSA252 will have all or
part of the nucleic acid sequence provided herein. In certain
aspects, the nucleic acid sequence encoding a Coa protein of strain
WIS will have all or part of the nucleic acid sequence provided
herein. In certain aspects, the nucleic acid sequence encoding a
Coa protein of strain MU50 will have all or part of the nucleic
acid sequence provided herein. In certain aspects, the nucleic acid
sequence encoding a Coa protein of strain 85/2082 will have all or
part of the nucleic acid sequence provided herein. In certain
aspects, the nucleic acid sequence encoding a Coa protein of strain
Newman will have all or part of the nucleic acid sequence provided
herein.
[0098] In yet still further embodiments, a composition may include
a polynucleotide that is or is at least 70%, 75%, 80%, 85%, 90%,
95%, 96%, 97%, 98%, or 99% identical or similar to a nucleic acid
sequence encoding a Coa R Domain. In certain aspects, the nucleic
acid sequence encoding a Coa R Domain of strain N315 will have all
or part of the nucleic acid sequence provided herein. In certain
aspects, the nucleic acid sequence encoding a Coa R Domain of
strain MW2 will have all or part of the nucleic acid sequence
provided herein. In certain aspects, the nucleic acid sequence
encoding a Coa R Domain of strain MRSA252 will have all or part of
the nucleic acid sequence provided herein. In certain aspects, the
nucleic acid sequence encoding a Coa R Domain of strain WIS will
have all or part of the nucleic acid sequence provided herein.
[0099] In particular aspects, a composition may comprise a
polynucleotide that is or is at least 70%, 75%, 80%, 85%, 90%, 95%,
96%, 97%, 98%, or 99% identical or similar to a nucleic acid
sequence encoding five different Coa R Domains from strains WIS,
MRSA252, N315, MW2, and USA300, respectively. In still further
aspects, the nucleic acid sequence encoding five different Coa R
Domains will have all or part of the nucleic acid sequence provided
herein.
[0100] The compositions may be formulated in a pharmaceutically
acceptable composition. In certain aspects of the disclosure the
staphylococcus bacterium is an S. aureus bacterium.
[0101] In further aspects, a composition may be administered more
than one time to the subject, and may be administered 1, 2, 3, 4,
5, 6, 7, 8, 9, 10, 15, 20 or more times. The administration of the
compositions include, but is not limited to oral, parenteral,
subcutaneous, intramuscular, intravenous, or various combinations
thereof, including inhalation or aspiration.
[0102] In still further embodiments, a composition comprises a
recombinant nucleic acid molecule encoding a polypeptide described
herein or segments/fragments thereof. Typically a recombinant
nucleic acid molecule encoding a polypeptide described herein
contains a heterologous promoter. In certain aspects, a recombinant
nucleic acid molecule of the disclosure is a vector, in still other
aspects the vector is a plasmid. In certain embodiments the vector
is a viral vector. In certain aspects a composition includes a
recombinant, non-staphylococcus bacterium containing or expressing
a polypeptide described herein. In particular aspects the
recombinant non-staphylococcus bacteria is Salmonella or another
gram-positive bacteria. A composition is typically administered to
mammals, such as human subjects, but administration to other
animals that are capable of eliciting an immune response is
contemplated. In further aspects the staphylococcus bacterium
containing or expressing the polypeptide is Staphylococcus aureus.
In further embodiments the immune response is a protective immune
response.
[0103] Compositions discussed herein are typically administered to
human subjects, but administration to other animals that are
capable of eliciting an immune response to a staphylococcus
bacterium is contemplated, particularly cattle, horses, goats,
sheep and other domestic animals, i.e., mammals.
[0104] In certain aspects the staphylococcus bacterium is a
Staphylococcus aureus. In further embodiments the immune response
is a protective immune response. In still further aspects, the
methods and compositions of the disclosure can be used to prevent,
ameliorate, reduce, or treat infection of tissues or glands, e.g.,
mammary glands, particularly mastitis and other infections. Other
methods include, but are not limited to prophylactically reducing
bacterial burden in a subject not exhibiting signs of infection,
particularly those subjects suspected of or at risk of being
colonized by a target bacteria, e.g., subjects that are or will be
at risk or susceptible to infection during a hospital stay,
treatment, and/or recovery.
[0105] Any embodiment discussed with respect to one aspect of the
disclosure applies to other aspects of the disclosure as well. In
particular, any embodiment discussed in the context of a
composition comprising at least one Staphylococcal coagulase R
Domain or a recombinant polypeptide comprising the same or a
nucleic acid encoding the same may be implemented with respect to
other antigens such as the fragments of the R Domain defined
herein.
[0106] Embodiments of the disclosure include a method of treating
or inhibiting a Staphylococcus infection in a subject determined to
have or be at risk for Staphylococcus infection comprising
administering to the subject an effective amount of the composition
comprising an antibody that specifically recognizes an antigenic
fragment of the Staphylococcal coagulase protein; wherein the
antigenic fragment is less than 200 amino acids in total length;
comprises a R domain or fragment thereof, and wherein the R domain
or fragment comprises SEQ ID NO:61 wherein X.sub.1 is proline or
leucine, X.sub.2 is arginine or threonine, X.sub.3 is
phenylalanine, glutamine, or tyrosine, X.sub.4 is asparagine or
lysine, X.sub.5 is proline or alanine, X.sub.6 is lysine or
glutamate, X.sub.7 is histidine or asparagine, X.sub.8 is alanine,
glutamine, glycine, or arginine, X.sub.9 is aspartate or
asparagine, X.sub.10 is threonine or glutamine, X.sub.11 is valine
or alanine, and X.sub.12 is threonine or serine. A further
embodiment relates to an immunogenic composition comprising a
polypeptide comprising an R domain or fragment thereof, wherein the
R domain or fragment comprises SEQ ID NO:61, wherein X.sub.1 is
proline or leucine, X.sub.2 is arginine or threonine, X.sub.3 is
phenylalanine, glutamine, or tyrosine, X.sub.4 is asparagine or
lysine, X.sub.5 is proline or alanine, X.sub.6 is lysine or
glutamate, X.sub.7 is histidine or asparagine, X.sub.8 is alanine,
glutamine, glycine, or arginine, X.sub.9 is aspartate or
asparagine, X.sub.10 is threonine or glutamine, X.sub.11 is valine
or alanine, and X.sub.12 is threonine or serine, and wherein the
polypeptide is less than 200 amino acids in length.
[0107] Moieties, such as polypeptides, peptides, antigens, or
immunogens, may be conjugated or linked covalently or noncovalently
to other moieties such as adjuvants, proteins, peptides, supports,
fluorescence moieties, or labels. The term "conjugate" or
"immunoconjugate" is broadly used to define the operative
association of one moiety with another agent and is not intended to
refer solely to any type of operative association, and is
particularly not limited to chemical "conjugation." Recombinant
fusion proteins are particularly contemplated. Compositions of the
disclosure may further comprise an adjuvant or a pharmaceutically
acceptable excipient. An adjuvant may be covalently or
non-covalently coupled to a polypeptide or peptide of the
disclosure. In certain aspects, the adjuvant is chemically
conjugated to a protein, polypeptide, or peptide.
[0108] The subject will have (e.g., are diagnosed with a
Staphylococcal infection), will be suspected of having, or will be
at risk of developing a Staphylococcal infection. Compositions of
the present disclosure include immunogenic compositions wherein the
antigen(s) or epitope(s) are contained in an amount effective to
achieve the intended purpose. More specifically, an effective
amount means an amount of active ingredients necessary to stimulate
or elicit an immune response, or provide resistance to,
amelioration of, or mitigation of infection. In more specific
aspects, an effective amount prevents, alleviates or ameliorates
symptoms of disease or infection, or prolongs the survival of the
subject being treated. Determination of the effective amount is
well within the capability of those skilled in the art, especially
in light of the detailed disclosure provided herein. For any
preparation used in the methods of the disclosure, an effective
amount or dose can be estimated initially from in vitro studies,
cell culture, and/or animal model assays. For example, a dose can
be formulated in animal models to achieve a desired immune response
or circulating antibody concentration or titer. Such information
can be used to more accurately determine useful doses in
humans.
[0109] The embodiments in the Example section are understood to be
embodiments of the disclosure that are applicable to all aspects of
the disclosure.
[0110] Embodiments include compositions that contain or do not
contain a bacterium. A composition may or may not include an
attenuated or viable or intact Staphylococcal bacterium. In certain
aspects, the composition comprises a bacterium that is not a
Staphylococci bacterium or does not contain Staphylococci bacteria.
In certain embodiments a bacterial composition comprises an
isolated or recombinantly expressed Coa antibody or a nucleic acid
encoding the same. In still further aspects, the Coa antibody is
multimerized, e.g., a dimer, a trimer, a tertramer, etc.
[0111] In certain aspects, a peptide or an antigen or an epitope
can be presented as multimers of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or
more peptide segments or peptide mimetics.
[0112] The term "isolated" can refer to a nucleic acid or
polypeptide that is substantially free of cellular material,
bacterial material, viral material, or culture medium (when
produced by recombinant DNA techniques) of their source of origin,
or chemical precursors or other chemicals (when chemically
synthesized). Moreover, an isolated compound refers to one that can
be administered to a subject as an isolated compound; in other
words, the compound may not simply be considered "isolated" if it
is adhered to a column or embedded in an agarose gel. Moreover, an
"isolated nucleic acid fragment" or "isolated peptide" is a nucleic
acid or protein fragment that is not naturally occurring as a
fragment and/or is not typically in the functional state.
[0113] In some embodiments, the polypeptides of the disclosure are
non-naturally occurring polypeptides. In some embodiments, the
polypeptides of the disclosure are truncated, chimeric, and/or
modified. In some embodiments, the modification comprises a
post-translational modification.
[0114] Compositions such as antibodies, peptides, antigens, or
immunogens may be conjugated or linked covalently or noncovalently
to other moieties such as adjuvants, proteins, peptides, supports,
fluorescence moieties, or labels. The term "conjugate" or
"immunoconjugate" is broadly used to define the operative
association of one moiety with another agent and is not intended to
refer solely to any type of operative association, and is
particularly not limited to chemical "conjugation." Recombinant
fusion proteins are particularly contemplated.
[0115] The term "Coa antibody" refers to an antibody that
specifically binds Coa proteins from Staphylococcus bacteria. In
certain embodiments the antibody may bind a specific Coa protein
from a particular Staphylococcus bacteria strain. In some
embodiments, the antibody is humanized or chimeric.
[0116] In further aspects a composition may be administered more
than one time to the subject, and may be administered 1, 2, 3, 4,
5, 6, 7, 8, 9, 10, 15, 20 or more times (or any range derivable
therein). The administration of the compositions include, but is
not limited to oral, parenteral, subcutaneous and intravenous
administration, or various combinations thereof, including
inhalation or aspiration.
[0117] Compositions may be administered to human or non-human
subjects. For example, administration to non-human animals that are
capable of providing a therapeutic benefit against a Staphylococcus
bacterium are contemplated, particularly cattle, horses, goats,
sheep, birds and other domesticated animals. In further aspects the
Staphylococcus bacterium is a Staphylococcus aureus. In some
embodiments, the subject is non-human. In some embodiments, the
compositions are administered to non-human subjects for the
purposes of generating monoclonal antibodies directed to an
antigenic component in the composition. In still further aspects,
the methods and compositions may be used to prevent, ameliorate,
reduce, or treat infection of tissues or glands. Other methods
include, but are not limited to prophylactically reducing bacterial
burden in a subject not exhibiting signs of infection, particularly
those subjects suspected of or at risk of being colonized by a
target bacteria, e.g., subjects that are or will be at risk or
susceptible to infection during a hospital stay, treatment, and/or
recovery.
[0118] Still further embodiments include methods for providing a
subject a protective or therapeutic composition against a
staphylococcus bacterium comprising administering to the subject an
effective amount of a composition including (i) a Coa antibody; or,
(ii) a nucleic acid molecule encoding the same, or (iii)
administering a Coa antibody with any combination or permutation of
bacterial proteins described herein.
[0119] Further embodiments are described in Internation
Publications: WO/2013/162746 and WO/2013/162751, each of which are
incorporated by reference for all purposes.
[0120] The embodiments in the Example section are understood to be
embodiments that are applicable to all aspects of the disclosure,
including compositions and methods.
[0121] The use of the term "or" in the claims is used to mean
"and/or" unless explicitly indicated to refer to alternatives only
or the alternatives are mutually exclusive, although the disclosure
supports a definition that refers to only alternatives and
"and/or." It is also contemplated that anything listed using the
term "or" may also be specifically excluded.
[0122] Throughout this application, the term "about" is used to
indicate that a value includes the standard deviation of error for
the device or method being employed to determine the value.
[0123] Following long-standing patent law, the words "a" and "an,"
when used in conjunction with the word "comprising" in the claims
or specification, denotes one or more, unless specifically
noted.
[0124] As used in this specification and claim(s), the words
"comprising" (and any form of comprising, such as "comprise" and
"comprises"), "having" (and any form of having, such as "have" and
"has"), "including" (and any form of including, such as "includes"
and "include") or "containing" (and any form of containing, such as
"contains" and "contain") are inclusive or open-ended and do not
exclude additional, unrecited elements or method steps.
[0125] Other objects, features and advantages of the present
disclosure will become apparent from the following detailed
description. It should be understood, however, that the detailed
description and the specific examples, while indicating specific
embodiments of the invention, are given by way of illustration
only, since various changes and modifications within the spirit and
scope of the invention will become apparent to those skilled in the
art from this detailed description.
DESCRIPTION OF THE DRAWINGS
[0126] So that the matter in which the above-recited features,
advantages and objects of the invention as well as others which
will become clear are attained and can be understood in detail,
more particular descriptions and certain embodiments of the
invention briefly summarized above are illustrated in the appended
drawings. These drawings form a part of the specification. It is to
be noted, however, that the appended drawings illustrate certain
embodiments of the invention and therefore are not to be considered
limiting in their scope.
[0127] FIGS. 1A-1E: The repeat domain of coagulase contributes to
Staphylococcus aureus bloodstream infections. (A) Primary structure
of coagulase (Coa) with signal sequence (SS), variable D1 and D2
domains involved in prothrombin binding (D1-D2), linker (L) and
repeat (R) domains. In S. aureus Newman, R comprises of five tandem
repeats of a 27 residue peptide that bind fibrinogen. The binding
sites for monoclonal antibodies (mAbs) 5D5 (blue) and 3B3 (red) are
identified. (B) Secreted proteins of S. aureus Newman (wild-type)
and coagulase variants were analyzed by immunoblotting with
polyclonal .alpha.-Coa or .alpha.-vWbp and mAbs 5D5 or 3B3.
Migratory positions of 72 and 95 kDa markers are indicated. (C)
Calcium-chelated mouse blood was inoculated with S. aureus strains
(1.times.10.sup.6 CFU) at room temperature for 24 hours and
coagulation analyzed by inversion of tubes. (D-E) Mice (n=10) were
challenged by intravenous injection with 8.times.10.sup.7 CFU of S.
aureus Newman wild-type or coagulase variant strains. Data are
representative of two independent analyses; (D-E) statistical
significance was assessed with the Log-rank test.
[0128] FIGS. 2A-B: The repeat domain of coagulase promotes assembly
of a fibrin sheet on the surface of S. aureus. (A) Human plasma (+)
or PBS control (-) were subjected to chromatography on Strep-Tactin
resin pre-charged with full-length coagulase (Coa.sub.ST),
coagulase truncated for the R domain (Coa.sub..DELTA.R/ST), the R
domain (R.sub.ST) alone or without affinity bait. Proteins retained
on the affinity column were analyzed by Coomassie-stained SDS-PAGE
or immunoblotting with antibodies against prothrombin (.alpha.-PT).
FG denotes fibrinogen. (B) Human plasma (+) or PBS (-) was added to
cultures of S. aureus Newman (wild-type) or the coa.sub..DELTA.R
variant or to medium control (-). Plasma proteins in the
supernatant and sediment containing fibrin clots or not (+/-plasma)
were separated by centrifugation and analyzed by Coomassie-stained
SDS-PAGE or immunobloting against Coa (.alpha.-Coa). Asterisks
identifies albumin; its abundance affects the eletrophoretic
mobility of Coa.sub..DELTA.R (lower left panel). Numbers indicate
the migratory positions of mass standards. FN denotes fibrin. (C)
S. aureus wild-type or coa.sub..DELTA.R bacteria expressing mCherry
were mixed with human citrate-plasma supplemented with 5%
Alexa488-conjugated human fibrinogen and incubated at room
temperature for 5 minutes. Incorporation of Alexa488-fibrinogen
into fibrin and association with bacteria was imaged by
fluorescence microscopy. Data are representative of two independent
analyses.
[0129] FIGS. 3A-F: Monoclonal antibody against the R domain of
coagulase protects against S. aureus bloodstream infection.
Purified monoclonal antibodies 5D5, 3B3, or IgG1 isotype control,
were injected at a concentration of 5 mg kg.sup.1 body weight into
the peritoneal cavity of naive BALB/c mice. Animal cohorts (n=10)
were challenged by intravenous injection with S. aureus strains
Newman (A), the .DELTA.vwb variant of Newman (B), MRSA USA300 (C),
MRSA N315 (D), MRSA252 (E), or WIS (F) and survival monitored over
10 days. Data are representative of two independent analyses;
statistical significance was assessed with the Logrank test.
[0130] FIG. 4A-F: Monoclonal antibody against the repeat domain of
coagulase promotes opsonophagocytic killing of Staphylococci. (A)
Anticoagulated human plasma or serum were inoculated with
5.times.10.sup.6 CFU S. aureus Newman (WT), .DELTA.coa/.DELTA.vwb,
or MRSA isolate USA300 LAC and incubated for 60 min prior to
dilution and plating for CFU. Agglutinated Staphylococci were
released by streptokinase (SK) treatment. Experiments were
performed in duplicate, results averaged, SEM calculated and data
recorded as percent inoculum. The bars representing the data show,
from left to right, plasma, plasma+SK (WT group 1), plasma,
plasma+SK (.DELTA.coa/vwb group 2), and serum, serum_SK, plasma,
plasma+SK (WT, group 3). (B) Anticoagulated blood from human
volunteers was inoculated with 5.times.10.sup.6 CFU USA300 LAC,
incubated for 60 min and CFU enumerated with or without SK
treatment. Blood samples were pre-treated with cytochalasin D (CD)
to block phagocytosis. The bars represent, from left to right 0
min, 60 min, and 60 min+SK for each X-axis group of data. (C)
Addition of mAb 3B3 to blood samples promoted OPK of USA300 LAC.
The bars represent, from left to right 0 min, 60 min-3B3, and 60
min+3B3 for each X-axis group of data. (D) Mouse blood was
incubated for 30 minutes with wild-type S. aureus in the absence or
presence of mAb 3B3, stained with Giemsa and viewed by microscopy.
(E) S. aureus Newman was incubated with anticoagulated mouse blood
without or with cytochalasin D (CD) and without (mock) or with mAb
3B3; Staphylococcal survival and replication was assessed by CFU
enumeration at timed intervals. (A-E) Data were generated from at
least two trials. (F) mAb 3B3 or an IgG1 isotype antibody were
administered into the peritoneal cavity of mice (n=10). Animals
were challenged by intravenous injection with S. aureus Newman
(wild-type) or the coa/i variant. After 30 min, animals were bled
via cardiac puncture and CFU enumerated. Data are representative of
two independent analyses; error bars indicate SEM. Statistical
analyses were performed with the two-tailed Student's t-test (A-C,
F) or with two-way ANOVA with Bonferroni post-test (E); *,
P<0.05 and **, P<0.01.
[0131] FIG. 5A-D: Monoclonal antibodies 5D5 and 3B3 disrupt
specific activities of Coa. (A) Association of Coa with human
prothrombin was measured by ELISA and perturbed with increasing
concentrations of affinity-purified 5D5, affinity-purified 3B3,
polyclonal antibodies (.alpha.-Coa), or IgG1 isotype control. (B)
Association of Coa with human fibrinogen was measured by ELISA and
perturbed with increasing concentrations of affinity-purified 5D5,
affinity-purified 3B3, polyclonal antibodies (.alpha.-Coa), or IgG1
isotype control. (C) Calcium-chelated mouse blood was inoculated
with S. aureus Newman wild-type bacteria (1.times.10.sup.6 CFU) in
the presence of 3 .mu.M of 5D5, 3B3, polyclonal antibodies
(.alpha.-Coa), or IgG1 isotype control. Samples were incubated at
room temperature and monitored for coagulation. (D) Rabbit
EDTA-plasma was mixed with SYTO9 stained S. aureus Newman wild-type
bacteria (1.times.10.sup.7 CFU) in the presence of 3 .mu.M of 5D5,
3B3, polyclonal antibodies (.alpha.-Coa) or IgG1 isotype control.
Samples were incubated at room temperature for 10 minutes, analyzed
by fluorescence microscopy, and quantified by calculating
means.+-.SEM from 12 fields of microscopic view. Statistical
significance was assessed with one-way ANOVA and Bonferroni
post-test: *, P<0.01; **, P<0.001; ***, P<0.0001.
[0132] FIG. 6A-C: Agglutination impedes S. aureus killing in human
blood. (A) Staphylococcus epidermidis (5.times.10.sup.6 CFU) was
incubated with desirudin anticoagulated human blood for 0 and 60
minutes with or without cytochalasin D (CD). Samples were treated
with PBS saponin buffer or agglutination lysis buffer (+SK).
Experiments were performed in duplicate, results averaged, SEM
calculated and data recorded as percent inoculum. Statistical
analysis was performed with the two-tailed Student's t-test. The
bars represent, from left to right 0 min, 60 min, and 60 min+SK for
each X-axis group of data. (B) Anticoagulated mouse blood with or
without mAb 3B3 was inoculated with S. aureus Newman (pGFP), S.
aureus coa.DELTA.R (pGFP) or left uninfected. At 0, 30 and 60 min,
extracellular bacteria were first killed with lysostaphin and
neutrophils were stained with .alpha.-GR1. The mean fluorescence
intensity (MFI) of GFP was used as a measure for phagocytosed
bacteria. (C) Mouse blood was supplemented with 5%
Alexa488-conjugated human fibrinogen. Incorporation of
Alexa488-fibrinogen into fibrin and association with neutrophils
was measured by FITC fluorescence. Data in B and C are
representative of two independent analyses conducted in triplicate;
error bars indicate SEM. Statistical significance between wild-type
-/+3B3 was assessed using two-way ANOVA with Bonferroni post-test:
*, P<0.05; **, P<0.01.
[0133] FIG. 7A-E: Alignment of Coa sequences from USA300 (SEQ ID
NO:63), N315 (SEQ ID NO:64), MRSA252 (SEQ ID NO:65), MW2 (SEQ ID
NO:66), and WIS (SEQ ID NO:67). The polypeptide sequences of these
genes are provided as SEQ ID NOS:1-5, respectively.
[0134] FIG. 8: Alignment of Coa R Domain sequences. (SEQ ID
NOS:68-84).
[0135] FIG. 9: Anti-R domain IgG enhances opsonophagocytic killing
of S. aureus by human whole blood. As shown in FIG. 10, anti-R
domain IgG improves survival of mice in a S. aureus lethal
challenge model. The bars represent, from left to right
+Cytochalasin D, +PBS, and +anti-R domain IgG for each X-axis group
of data.
[0136] FIG. 10: Anti-R domain IgG improves survival of mice in a S.
aureus lethal challenge model.
DETAILED DESCRIPTION
[0137] Host immunity against bacterial pathogens typically involves
antibodies that recognize the microbial surface and promote
phagocytic killing. Methicillin-resistant Staphylococcus aureus
(MRSA) is a frequent cause of lethal bloodstream infection, however
vaccines and antibody therapeutics targeting Staphylococcal surface
molecules have thus far failed to achieve clinical efficacy. S.
aureus secretes coagulase (Coa), which activates host prothrombin
and generates fibrin fibrils that protect the pathogen against
phagocytosis by immune cells. Because of negative selection, the
coding sequence for the prothrombin binding D1-D2 domain is highly
variable and does not elicit cross-protective immune responses. The
R domain, tandem repeats of a 27-residue peptide that bind
fibrinogen, is conserved at the C-terminus of all Coa molecules, We
show here that the R domain enables bloodstream infections by
directing fibrinogen to the Staphylococcal surface, generating a
protective fibrin shield that inhibits phagocytosis. The fibrin
shield can be marked with R-specific antibodies, which trigger
phagocytic killing of Staphylococci and protect mice against lethal
bloodstream infections caused by a broad spectrum of MRSA isolates.
These findings emphasize the critical role of coagulase in
Staphylococcal escape from opsonophagocytic killing and as a
protective antigen for S. aureus vaccines.
[0138] Staphylococcus aureus, a Gram-positive bacterium and
colonizer of the human nares and skin, is also an invasive pathogen
and cause of soft tissue and bloodstream infections (David and
Daum, 2010). Drug-resistant strains, designated MRSA
(methicillin-resistant S. aureus), emerged with antibiotic use for
the prevention or therapy of Staphylococcal infections. The recent
pandemic of MRSA infections is associated with increased failure of
antibiotic therapy and increased mortality of infection (David and
Daum, 2010). To address this public health crisis, several vaccines
and antibody therapeutics have been developed, each targeting
molecules on the Staphylococcal surface including capsule,
polyglycerol phosphate lipoteichoic acid, iron-regulated surface
determinant protein B (IsdB) and clumping factor A (ClfA)(Spellberg
and Daum, 2012). However, the corresponding clinical trials failed
to reach their designated endpoints (Fowler et al., 2013;
Shinefield et al., 2002).
[0139] A distinguishing feature of clinical S. aureus isolates is
their ability to clot human plasma. This unique trait is based on
the secretion of coagulase (Coa; FIG. 1A) (Tager, 1956), which
associates with human prothrombin to form enzymatically active
staphylothrombin, cleaving the A and B peptides of fibrinogen and
generating fibrin fibrils (Friedrich et al., 2003).
Staphylothrombin does not cut other endogenous substrates of
thrombin, causing exuberant polymerization of fibrin while avoiding
activation of other clotting and inflammatory factors (McAdow et
al., 2012b; Panizzi et al., 2004). The resulting fibrin meshwork
protects bacteria from phagocytes and is essential for the
formation of S. aureus abscess lesions (Cheng et al., 2010; Smith
et al., 1947). Activation of prothrombin is mediated by the
N-terminal D1-D2 domain of Coa and blocked by specific antibodies,
which provide protection from S. aureus bloodstream infection in
animal models (Cheng et al., 2010; Rammelkamp et al., 1950).
Because of negative selection, coa is one of the most variable
genes in the core genome of S. aureus. Up to 50% sequence variation
occurs in the coding sequence for the D1-D2 domain and the
corresponding products can be categorized into serotypes without
cross-protecting epitopes for the neutralization of
staphylothrombin (McAdow et al., 2012a; Watanabe et al., 2009). S.
aureus secretes a second staphylothrombin, designated von
Willebrand factor binding protein (vWbp) with the conserved D1-D2
domain structure mediating association with prothrombin (Bjerketorp
et al., 2004). This complex displays different catalytic activity
than Coa-staphylothrombin, generating fibrin fibrils at a reduced
rate and contributing to abscess formation without affecting
Staphylococcal escape from phagocytosis (Guggenberger et al., 2012;
Kroh et al., 2009). The structural gene for vWbp, vwb, displays
limited sequence variation, and is presumably not subject to
negative selection (McAdow et al., 2012a).
[0140] Staphylococcus aureus is a commensal of the human skin and
nares, and the leading cause of bloodstream, skin and soft tissue
infections (Klevens et al., 2007). Recent dramatic increases in the
mortality of Staphylococcal diseases are attributed to the spread
of methicillin-resistant S. aureus (MRSA) strains often not
susceptible to antibiotics (Kennedy et al., 2008). In a large
retrospective study, the incidence of MRSA infections was 4.6% of
all hospital admissions in the United States (Klevens et al.,
2007). The annual health care costs for 94,300 MRSA infected
individuals in the United States exceed $2.4 billion (Klevens et
al., 2007). The current MRSA epidemic has precipitated a public
health crisis that needs to be addressed by development of a
preventive vaccine (Boucher and Corey, 2008). To date, an FDA
licensed vaccine that prevents S. aureus diseases is not
available.
[0141] Coagulase (Coa) is an important virulence factor in the
pathogenesis of Staphylococcal sepsis. The conversion of fibrinogen
to fibrin by the Coa:prothrombin complex enables Staphylococcus
aureus to evade immune defenses and disseminate throughout the
body. Humoral immunity toward Coa is protective in a murine sepsis
model. Previous work demonstrated that there are protective
epitopes in both the N- and C-terminus and that there is
type-specific immunity, attributable to the genetic variation in
the N-terminus of Coa among strains.
[0142] The inventors describe here Staphylococcal coagulase-binding
antibodies and the antigen binding determinants thereof. In
particular, a panel of monoclonal antibodies were generated against
Coa and characterized based on their affinity for individual
domains of the protein and their disturbance of clotting. Based on
in vitro characteristics, several monoclonal antibodies were tested
for protection in a murine sepsis model resulting in the
identification of a protective epitope in the conserved portion of
the N-terminus. Importantly, antibodies targeting this epitope are
able, when administered to animals, to reduce Staphylococcal sepsis
following challenge with virulent S. aureus. Because these
molecules are able to block the prothrombin-activating effects of
Coa, such antibodies may also enhance host immune response
following Staphylococcal infection. Thus, the Coa-binding molecules
of the embodiments offer a new and effective avenue to treat or
prevent Staphylococcal disease.
I. COAGULASE POLYPEPTIDES
[0143] Certain aspects of the embodiments concern coagulase (Coa)
polypeptides. An illustration of the primary structure of Coa from
S. aureus Newman (Coa.sub.NM) is provided in FIG. 1A. Amino acid
sequences for Coa from eight S. aureus strains are provided in SEQ
ID NOs: 1-8 as follows: USA300 (SEQ ID NO: 1), N315 (SEQ ID NO: 2),
MW2 (SEQ ID NO: 3), MRSA252 (SEQ ID NO: 4), WIS (SEQ ID NO: 5),
MU50 (SEQ ID NO: 6), 85/2082 (SEQ ID NO: 7), and Newman (SEQ ID NO:
8). An alignment of Coa sequences from nucleic acids encoding
USA300 (SEQ ID NO: 1), N315 (SEQ ID NO: 2), MRSA252 (SEQ ID NO: 4),
MW2 (SEQ ID NO: 3), and WIS (SEQ ID NO: 5) is provided in FIG.
7.
[0144] Amino acid sequences from 17 Coa R Domains from one of the
dominant Coa taken from dominant S. aureus lineages are provided as
follows: ST5_1 (SEQ ID NO:22), ST5_2 (SEQ ID NO:23), ST5_3 (SEQ ID
NO:24), ST8_1 (SEQ ID NO:25), ST8_2 (SEQ ID NO:26), ST22_1 (SEQ ID
NO:27), ST22_2 (SEQ ID NO:28), ST22_3 (SEQ ID NO:29), ST30_1 (SEQ
ID NO:30), ST30_2 (SEQ ID NO:31), ST30_3 (SEQ ID NO:32), ST45_1
(SEQ ID NO:33), ST45_2 (SEQ ID NO:34), ST45_3 (SEQ ID NO:35),
ST239_1 (SEQ ID NO:36), ST239_2 (SEQ ID NO:37), ST239_3 (SEQ ID
NO:38).
[0145] Coagulase interacts with host prothrombin through its
N-terminal domains, D1 and D2. The three-helix bundles of D1 and D2
share structural similarity but are poorly conserved at the
sequence level [66]. The first 150 amino acids comprise the D1
domain [68]. The amino-terminal tetrapeptide of Coa inserts into
the activation pocket of prothrombin and forms a salt bridge with
prothrombin Asp194 [66]. The first of two high-affinity binding
interactions between Coa and prothrombin occurs through a
hydrophobic surface groove in D1 with the 148 loop of prothrombin
[66]. SC.sub.150-282 comprises the D2 domain [68]. The second
high-affinity binding interaction is between the side chain of
Tyr76 of the prothrombin exosite I and D2 alpha helices [66]. Coa
forms a dimer in solution, with each monomer binding one molecule
of prothrombin [66]. A complex formed by prothrombin and a
recombinant construct of the D1D2 domain (SC.sub.1-325) is able to
bind fibrinogen through a distinct interaction from the substrate
binding exosite on prothrombin [133].
[0146] Two other domains of Coa are less well understood. Following
D2, there is a highly conserved Linker (L) region with unknown
function [77]. Near the C-terminus is a region of tandem repeats of
a 27 amino acid peptide, and the number of repeats varies among
strains [77]. The repeat region is thought to be responsible for
high affinity binding to fibrinogen [133, 214].
[0147] The gene encoding Coa (coa) is found on all S. aureus
chromosomes, yet it is one of the most variable proteins, with
twelve known types (Watanabe et al. 2005, Watanabe et al. 2009).
The majority of variability among Coa alleles resides in the D1 and
D2 domains. The linker region is relatively conserved with 86.7%
identity among serotypes (Watanabe et al. 2005). Of note, the amino
terminal end of mature Coa, i.e. the first seven residues following
the signal peptidase cleavage site, activate prothrombin and these
residues are conserved among all strains analyzed [68]. The
C-terminal tandem repeats of a 27 residue peptide vary in number
from five to nine but have greater than 90% identity among
serotypes (Watanabe et al. 2005). Antibodies that recognize
epitopes in SC.sub.1-282 are necessary to block the enzymatic
activities of the Coa-prothrombin complex [215]. In vivo,
antibodies against the C-terminal repeats also confer protection
[215], though the mechanism of protection is not yet clear.
[0148] Coa polypeptides can be used as subunit vaccines and raise
humoral immune responses and confer protective immunity against S.
aureus challenge. In certain embodiments, polyvalent vaccines
targeting Coa variation across multiple S. aureus strains are
contemplated. This embodiment is discussed in a U.S. Provisional
Patent Application filed on Apr. 26, 2012 entitled "STAPHYLOCOCCAL
COAGULASE ANTIGENS AND METHODS OF THEIR USE" in the names of Molly
McAdow, Andrea DeDent, Alice Cheng, Carla Emolo, Dominique
Missiakas, Olaf Schneewind, which is hereby incorporated by
reference in its entirety.
II. PROTEINACEOUS COMPOSITIONS
[0149] As used herein, a "protein" or "polypeptide" refers to a
molecule comprising at least ten amino acid residues. In some
embodiments, a wild-type version of a protein or polypeptide are
employed, however, in many embodiments of the disclosure, a
modified protein or polypeptide is employed to generate an immune
response. The terms described above may be used interchangeably. A
"modified protein" or "modified polypeptide" or a "variant" refers
to a protein or polypeptide whose chemical structure, particularly
its amino acid sequence, is altered with respect to the wild-type
protein or polypeptide. In some embodiments, a modified/variant
protein or polypeptide has at least one modified activity or
function (recognizing that proteins or polypeptides may have
multiple activities or functions). It is specifically contemplated
that a modified/variant protein or polypeptide may be altered with
respect to one activity or function yet retain a wild-type activity
or function in other respects, such as immunogenicity.
[0150] In certain embodiments the size of a protein or polypeptide
(wild-type or modified) may comprise, but is not limited to, 5, 6,
7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23,
24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40,
41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57,
58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74,
75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91,
92, 93, 94, 95, 96, 97, 98, 99, 100, 110, 120, 130, 140, 150, 160,
170, 180, 190, 200, 210, 220, 230, 240, 250, 275, 300, 325, 350,
375, 400, 425, 450, 475, 500, 525, 550, 575, 600, 625, 650, 675,
700, 725, 750, 775, 800, 825, 850, 875, 900, 925, 950, 975, 1000,
1100, 1200, 1300, 1400, 1500, 1750, 2000, 2250, 2500 amino
molecules or greater, and any range derivable therein, or
derivative of a corresponding amino sequence described or
referenced herein. It is contemplated that polypeptides may be
mutated by truncation, rendering them shorter than their
corresponding wild-type form, but also they might be altered by
fusing or conjugating a heterologous protein sequence with a
particular function (e.g., for targeting or localization, for
enhanced immunogenicity, for purification purposes, etc.).
[0151] As used herein, an "amino molecule" refers to any amino
acid, amino acid derivative, or amino acid mimic known in the art.
In certain embodiments, the residues of the proteinaceous molecule
are sequential, without any non-amino molecule interrupting the
sequence of amino molecule residues. In other embodiments, the
sequence may comprise one or more non-amino molecule moieties. In
particular embodiments, the sequence of residues of the
proteinaceous molecule may be interrupted by one or more non-amino
molecule moieties.
[0152] Accordingly, the term "proteinaceous composition"
encompasses amino molecule sequences comprising at least one of the
20 common amino acids in naturally synthesized proteins, or at
least one modified or unusual amino acid.
[0153] Proteinaceous compositions may be made by any technique
known to those of skill in the art, including (i) the expression of
proteins, polypeptides, or peptides through standard molecular
biological techniques, (ii) the isolation of proteinaceous
compounds from natural sources, or (iii) the chemical synthesis of
proteinaceous materials. The nucleotide as well as the protein,
polypeptide, and peptide sequences for various genes have been
previously disclosed, and may be found in the recognized
computerized databases. One such database is the National Center
for Biotechnology Information's Genbank and GenPept databases (on
the World Wide Web at ncbi.nlm.nih.gov/). The coding regions for
these genes may be amplified and/or expressed using the techniques
disclosed herein or as would be known to those of ordinary skill in
the art.
[0154] Amino acid sequence variants of coagulases, in particular,
of coagulase R Domains, SpA and other polypeptides of the
disclosure can be substitutional, insertional, or deletion
variants. A variation in a polypeptide of the disclosure may affect
1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36,
37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or more
non-contiguous or contiguous amino acids of the polypeptide, as
compared to wild-type. A variant can comprise an amino acid
sequence that is at least 50%, 60%, 70%, 80%, or 90%, including all
values and ranges there between, identical to any sequence provided
or referenced herein, e.g., a sequence of the R Domain. A variant
can include 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17,
18, 19, 20, or more substitute amino acids. A polypeptide processed
or secreted by the Ess pathway or other surface proteins (see Table
3) or sortase substrates from any staphylococcus species and strain
are contemplated for use in compositions and methods described
herein.
[0155] Deletion variants typically lack one or more residues of the
native or wild-type protein. Individual residues can be deleted or
a number of contiguous amino acids can be deleted. A stop codon may
be introduced (by substitution or insertion) into an encoding
nucleic acid sequence to generate a truncated protein. Insertional
mutants typically involve the addition of material at a
non-terminal point in the polypeptide. This may include the
insertion of one or more residues. Terminal additions, called
fusion proteins, may also be generated. These fusion proteins
include multimers or concatamers of one or more peptides or
polypeptides described or referenced herein.
[0156] The following is a discussion based upon changing of the
amino acids of a protein to create a variant polypeptide or
peptide. For example, certain amino acids may be substituted for
other amino acids in a protein structure with or without
appreciable loss of interactive binding capacity with structures
such as, for example, antigen-binding regions of antibodies or
binding sites on substrate molecules. Since it is the interactive
capacity and nature of a protein that defines that protein's
functional activity, certain amino acid substitutions can be made
in a protein sequence, and in its underlying DNA coding sequence,
and nevertheless produce a protein with a desirable property. It is
thus contemplated by the inventors that various changes may be made
in the DNA sequences of genes.
[0157] It is contemplated that in compositions of the disclosure,
there is between about 0.001 mg and about 10 mg of total
polypeptide, peptide, and/or protein per ml. The concentration of
protein in a composition can be about, at least about or at most
about 0.001, 0.010, 0.050, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8,
0.9, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5,
7.0, 7.5, 8.0, 8.5, 9.0, 9.5, 10.0 mg/ml or more (or any range
derivable therein). Of this, about, at least about, or at most
about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17,
18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34,
35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51,
52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68,
69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85,
86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100% may be
a coagulase R Domain or a coagulase or its variant and may be used
in combination with other peptides or polypeptides, such as other
bacterial peptides and/or antigens.
[0158] The present disclosure contemplates the administration of
Staphylococcal coagulase R Domains (or segments thereof) or
variants thereof to effect a preventative therapy or therapeutic
effect against the development of a disease or condition associated
with infection by a staphylococcus pathogen.
[0159] In certain aspects, combinations of Staphylococcal antigens
are used in the production of an immunogenic composition that is
effective at treating or preventing Staphylococcal infection.
Staphylococcal infections progress through several different
stages. For example, the Staphylococcal life cycle involves
commensal colonization, initiation of infection by accessing
adjoining tissues or the bloodstream, and/or anaerobic
multiplication in the blood. The interplay between S. aureus
virulence determinants and the host defense mechanisms can induce
complications such as endocarditis, metastatic abscess formation,
and sepsis syndrome. Different molecules on the surface of the
bacterium are involved in different steps of the infection cycle.
Combinations of certain antigens can elicit an immune response
which protects against multiple stages of Staphylococcal infection.
The effectiveness of the immune response can be measured either in
animal model assays and/or using an opsonophagocytic assay.
[0160] Proteins may be recombinant, or synthesized in vitro.
Alternatively, a non-recombinant or recombinant protein may be
isolated from bacteria. It is also contemplated that a bacteria
containing such a variant may be implemented in compositions and
methods. Consequently, a protein need not be isolated.
[0161] The term "functionally equivalent codon" is used herein to
refer to codons that encode the same amino acid, such as the six
codons for arginine or serine, and also refers to codons that
encode biologically equivalent amino acids (see Codon Table,
below).
TABLE-US-00002 Codon Table Amino Acids Codons Alanine Ala A GCA GCC
GCG GCU Cysteine Cys C UGC UGU Aspartic acid Asp D GAC GAU Glutamic
acid Glu E GAA GAG Phenylalanine Phe F UUC UUU Glycine Gly G GGA
GGC GGG GGU Histidine His H CAC CAU Isoleucine Ile I AUA AUC AUU
Lysine Lys K AAA AAG Leucine Leu L UUA UUG CUA CUC CUG CUU
Methionine Met M AUG Asparagine Asn N AAC AAU Proline Pro P CCA CCC
CCG CCU Glutamine Gln Q CAA CAG Arginine Arg R AGA AGG CGA CGC CGG
CGU Serine Ser S AGC AGU UCA UCC UCG UCU Threonine Thr T ACA ACC
ACG ACU Valine Val V GUA GUC GUG GUU Tryptophan Trp W UGG Tyrosine
Tyr Y UAC UAU
[0162] It also will be understood that amino acid and nucleic acid
sequences may include additional residues, such as additional N- or
C-terminal amino acids, or 5' or 3' sequences, respectively, and
yet still be essentially as set forth in one of the sequences
disclosed herein, so long as the sequence meets the criteria set
forth above, including the maintenance of biological protein
activity where protein expression is concerned. The addition of
terminal sequences particularly applies to nucleic acid sequences
that may, for example, include various non-coding sequences
flanking either of the 5' or 3' portions of the coding region.
[0163] Substitutional variants typically contain the exchange of
one amino acid for another at one or more sites within the protein,
and may be designed to modulate one or more properties of the
polypeptide, with or without the loss of other functions or
properties. Substitutions may be conservative, that is, one amino
acid is replaced with one of similar shape and charge. Conservative
substitutions are well known in the art and include, for example,
the changes of: alanine to serine; arginine to lysine; asparagine
to glutamine or histidine; aspartate to glutamate; cysteine to
serine; glutamine to asparagine; glutamate to aspartate; glycine to
proline; histidine to asparagine or glutamine; isoleucine to
leucine or valine; leucine to valine or isoleucine; lysine to
arginine; methionine to leucine or isoleucine; phenylalanine to
tyrosine, leucine or methionine; serine to threonine; threonine to
serine; tryptophan to tyrosine; tyrosine to tryptophan or
phenylalanine; and valine to isoleucine or leucine. Alternatively,
substitutions may be non-conservative such that a function or
activity of the polypeptide is affected. Non-conservative changes
typically involve substituting a residue with one that is
chemically dissimilar, such as a polar or charged amino acid for a
nonpolar or uncharged amino acid, and vice versa.
[0164] The following is a discussion based upon changing of the
amino acids of a protein to create an equivalent, or even an
improved, second-generation molecule. For example, certain amino
acids may be substituted for other amino acids in a protein
structure without appreciable loss of interactive binding capacity
with structures such as, for example, antigen-binding regions of
antibodies or binding sites on substrate molecules. Since it is the
interactive capacity and nature of a protein that defines that
protein's biological functional activity, certain amino acid
substitutions can be made in a protein sequence, and in its
underlying DNA coding sequence, and nevertheless produce a protein
with like properties. It is thus contemplated by the inventors that
various changes may be made in the DNA sequences of genes without
appreciable loss of their biological utility or activity.
[0165] In making such changes, the hydropathic index of amino acids
may be considered. The importance of the hydropathic amino acid
index in conferring interactive biologic function on a protein is
generally understood in the art (Kyte and Doolittle, 1982). It is
accepted that the relative hydropathic character of the amino acid
contributes to the secondary structure of the resultant protein,
which in turn defines the interaction of the protein with other
molecules, for example, enzymes, substrates, receptors, DNA,
antibodies, antigens, and the like.
[0166] It also is understood in the art that the substitution of
like amino acids can be made effectively on the basis of
hydrophilicity. U.S. Pat. No. 4,554,101, incorporated herein by
reference, states that the greatest local average hydrophilicity of
a protein, as governed by the hydrophilicity of its adjacent amino
acids, correlates with a biological property of the protein. It is
understood that an amino acid can be substituted for another having
a similar hydrophilicity value and still produce a biologically
equivalent and immunologically equivalent protein.
[0167] As outlined above, amino acid substitutions generally are
based on the relative similarity of the amino acid side-chain
substituents, for example, their hydrophobicity, hydrophilicity,
charge, size, and the like. Exemplary substitutions that take into
consideration the various foregoing characteristics are well known
and include: arginine and lysine; glutamate and aspartate; serine
and threonine; glutamine and asparagine; and valine, leucine and
isoleucine.
[0168] It is contemplated that in compositions there is between
about 0.001 mg and about 10 mg of total polypeptide, peptide,
and/or protein per ml. Thus, the concentration of protein in a
composition can be about, at least about or at most about 0.001,
0.010, 0.050, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0,
1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5,
8.0, 8.5, 9.0, 9.5, 10.0 mg/ml or more (or any range derivable
therein). Of this, about, at least about, or at most about 1, 2, 3,
4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21,
22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,
39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55,
56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72,
73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89,
90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100% may be an antibody
that binds Coa, and may be used in combination with other
Staphylococcal proteins or protein-binding antibodies described
herein.
A. Polypeptides and Polypeptide Production
[0169] Embodiments involve polypeptides, peptides, and proteins and
immunogenic fragments thereof for use in various aspects described
herein. For example, specific antibodies are assayed for or used in
neutralizing or inhibiting Staphylococcal infection. In specific
embodiments, all or part of proteins described herein can also be
synthesized in solution or on a solid support in accordance with
conventional techniques. Various automatic synthesizers are
commercially available and can be used in accordance with known
protocols. See, for example, Stewart and Young, (1984); Tam et al.,
(1983); Merrifield, (1986); and Barany and Merrifield (1979), each
incorporated herein by reference. Alternatively, recombinant DNA
technology may be employed wherein a nucleotide sequence that
encodes a peptide or polypeptide is inserted into an expression
vector, transformed or transfected into an appropriate host cell
and cultivated under conditions suitable for expression.
[0170] One embodiment includes the use of gene transfer to cells,
including microorganisms, for the production and/or presentation of
proteins. The gene for the protein of interest may be transferred
into appropriate host cells followed by culture of cells under the
appropriate conditions. A nucleic acid encoding virtually any
polypeptide may be employed. The generation of recombinant
expression vectors, and the elements included therein, are
discussed herein. Alternatively, the protein to be produced may be
an endogenous protein normally synthesized by the cell used for
protein production.
[0171] In a certain aspects an immunogenic Coa fragment comprises
substantially all of the D1 and/or D2 domains and/or R domain of a
Coa protein isolatable from S. aureus.
[0172] Also included in immunogenic compositions are fusion
proteins composed of Staphylococcal proteins, or immunogenic
fragments of Staphylococcal proteins (e.g., Coa). Alternatively,
embodiments also include individual fusion proteins of
Staphylococcal proteins or immunogenic fragments thereof, as a
fusion protein with heterologous sequences such as a provider of
T-cell epitopes or purification tags, for example:
.quadrature.-galactosidase, glutathione-S-transferase, green
fluorescent proteins (GFP), epitope tags such as FLAG, myc tag,
poly histidine, or viral surface proteins such as influenza virus
haemagglutinin, or bacterial proteins such as tetanus toxoid,
diphtheria toxoid, CRM197.
[0173] The present disclosure describes polypeptides, peptides, and
proteins and immunogenic fragments thereof for use in various
embodiments of the present disclosure. For example, specific
polypeptides are assayed for or used to elicit an immune response.
In specific embodiments, all or part of the proteins of the
disclosure can also be synthesized in solution or on a solid
support in accordance with conventional techniques. Various
automatic synthesizers are commercially available and can be used
in accordance with known protocols. See, for example, Stewart and
Young, (1984); Tam et al., (1983); Merrifield, (1986); and Barany
and Merrifield (1979), each incorporated herein by reference.
[0174] Alternatively, recombinant DNA technology may be employed
wherein a nucleotide sequence which encodes a peptide of the
disclosure is inserted into an expression vector, transformed or
transfected into an appropriate host cell and cultivated under
conditions suitable for expression.
[0175] One embodiment of the disclosure includes the use of gene
transfer to cells, including microorganisms, for the production
and/or presentation of polypeptides or peptides. The gene for the
polypeptide or peptide of interest may be transferred into
appropriate host cells followed by culture of cells under the
appropriate conditions. The generation of recombinant expression
vectors, and the elements included therein, are well known in the
art and briefly discussed herein. Alternatively, the protein to be
produced may be an endogenous protein normally synthesized by the
cell that is isolated and purified.
[0176] Another embodiment of the present disclosure uses autologous
B lymphocyte cell lines, which are transfected with a viral vector
that expresses an immunogen product, and more specifically, a
protein having immunogenic activity. Other examples of mammalian
host cell lines include, but are not limited to Vero and HeLa
cells, other B- and T-cell lines, such as CEM, 721.221, H9, Jurkat,
Raji, as well as cell lines of Chinese hamster ovary, W138, BHK,
COS-7, 293, HepG2, 3T3, RIN and MDCK cells. In addition, a host
cell strain may be chosen that modulates the expression of the
inserted sequences, or that modifies and processes the gene product
in the manner desired. Such modifications (e.g., glycosylation) and
processing (e.g., cleavage) of protein products may be important
for the function of the protein. Different host cells have
characteristic and specific mechanisms for the post-translational
processing and modification of proteins. Appropriate cell lines or
host systems can be chosen to ensure the correct modification and
processing of the foreign protein expressed.
[0177] A number of selection systems may be used including, but not
limited to HSV thymidine kinase, hypoxanthine-guanine
phosphoribosyltransferase, and adenine phosphoribosyltransferase
genes, in tk-, hgprt- or aprt-cells, respectively. Also,
anti-metabolite resistance can be used as the basis of selection:
for dhfr, which confers resistance to trimethoprim and
methotrexate; gpt, which confers resistance to mycophenolic acid;
neo, which confers resistance to the aminoglycoside G418; and
hygro, which confers resistance to hygromycin.
[0178] Animal cells can be propagated in vitro in two modes: as
non-anchorage-dependent cells growing in suspension throughout the
bulk of the culture or as anchorage-dependent cells requiring
attachment to a solid substrate for their propagation (i.e., a
monolayer type of cell growth).
[0179] Non-anchorage dependent or suspension cultures from
continuous established cell lines are the most widely used means of
large scale production of cells and cell products. However,
suspension cultured cells have limitations, such as tumorigenic
potential and lower protein production than adherent cells.
[0180] Where a protein is specifically mentioned herein, it is
preferably a reference to a native or recombinant protein or
optionally a protein in which any signal sequence has been removed.
The protein may be isolated directly from the Staphylococcal strain
or produced by recombinant DNA techniques. Immunogenic fragments of
the protein may be incorporated into the immunogenic composition of
the disclosure. These are fragments comprising at least 10 amino
acids, 20 amino acids, 30 amino acids, 40 amino acids, 50 amino
acids, or 100 amino acids, including all values and ranges there
between, taken contiguously from the amino acid sequence of the
protein. In addition, such immunogenic fragments are
immunologically reactive with antibodies generated against the
Staphylococcal proteins or with antibodies generated by infection
of a mammalian host with Staphylococci. Immunogenic fragments also
include fragments that when administered at an effective dose,
(either alone or as a hapten bound to a carrier), elicit a
protective or therapeutic immune response against Staphylococcal
infection, in certain aspects it is protective against S. aureus
and/or S. epidermidis infection. Such an immunogenic fragment may
include, for example, the protein lacking an N-terminal leader
sequence, and/or a transmembrane domain and/or a C-terminal anchor
domain. In a preferred aspect the immunogenic fragment according to
the disclosure comprises substantially all of the extracellular
domain of a protein which has at least 80% identity, at least 85%
identity, at least 90% identity, at least 95% identity, or at least
97-99% identity, including all values and ranges there between, to
a sequence selected segment of a polypeptide described or
referenced herein.
[0181] Also included in immunogenic compositions of the disclosure
are fusion proteins composed of one or more Staphylococcal
proteins, or immunogenic fragments of Staphylococcal proteins. Such
fusion proteins may be made recombinantly and may comprise one
portion of at least 1, 2, 3, 4, 5, or 6 Staphylococcal proteins or
segments. Alternatively, a fusion protein may comprise multiple
portions of at least 1, 2, 3, 4 or 5 Staphylococcal proteins. These
may combine different Staphylococcal proteins and/or multiples of
the same protein or protein fragment, or immunogenic fragments in
the same protein (forming a multimer or a concatemer).
Alternatively, the disclosure also includes individual fusion
proteins of Staphylococcal proteins or immunogenic fragments
thereof, as a fusion protein with heterologous sequences such as a
provider of T-cell epitopes or purification tags, for example:
.quadrature.-galactosidase, glutathione-S-transferase, green
fluorescent proteins (GFP), epitope tags such as FLAG, myc tag,
poly histidine, or viral surface proteins such as influenza virus
haemagglutinin, or bacterial proteins such as tetanus toxoid,
diphtheria toxoid, or CRM197.
B. Antibodies and Antibody-Like Molecules
[0182] In certain aspects, one or more antibodies or antibody-like
molecules (e.g., polypeptides comprising antibody CDR domains) may
be obtained or produced which have a specificity for a Coa. In
particular embodiments, one or more antibodies or antibody-like
molecules (e.g., polypeptides comprising antibody CDR domains) may
be obtained or produced which have a specificity for the D1 and/or
D2 domain of Coa. These antibodies may be used in various
diagnostic or therapeutic applications described herein.
[0183] As used herein, the term "antibody" is intended to refer
broadly to any immunologic binding agent such as IgG, IgM, IgA, IgD
and IgE as well as polypeptides comprising antibody CDR domains
that retain antigen binding activity. Thus, the term "antibody" is
used to refer to any antibody-like molecule that has an antigen
binding region, and includes antibody fragments such as Fab', Fab,
F(ab')2, single domain antibodies (DABs), Fv, scFv (single chain
Fv), and polypeptides with antibody CDRs, scaffolding domains that
display the CDRs (e.g., anticalins) or a nanobody. For example, the
nanobody can be antigen-specific VHH (e.g., a recombinant VHH) from
a camelid IgG2 or IgG3, or a CDR-displaying frame from such camelid
Ig. The techniques for preparing and using various antibody-based
constructs and fragments are well known in the art. Means for
preparing and characterizing antibodies are also well known in the
art (See, e.g., Antibodies: A Laboratory Manual, Cold Spring Harbor
Laboratory, 1988; incorporated herein by reference).
[0184] "Mini-antibodies" or "minibodies" are also contemplated for
use with embodiments. Minibodies are sFv polypeptide chains which
include oligomerization domains at their C-termini, separated from
the sFv by a hinge region. Pack et al. (1992). The oligomerization
domain comprises self-associating .alpha.-helices, e.g., leucine
zippers, that can be further stabilized by additional disulfide
bonds. The oligomerization domain is designed to be compatible with
vectorial folding across a membrane, a process thought to
facilitate in vivo folding of the polypeptide into a functional
binding protein. Generally, minibodies are produced using
recombinant methods well known in the art. See, e.g., Pack et al.
(1992); Cumber et al. (1992).
[0185] Antibody-like binding peptidomimetics are also contemplated
in embodiments. Liu et al. (2003) describe "antibody like binding
peptidomimetics" (ABiPs), which are peptides that act as pared-down
antibodies and have certain advantages of longer serum half-life as
well as less cumbersome synthesis methods.
[0186] Alternative scaffolds for antigen binding peptides, such as
CDRs are also available and can be used to generate Coa-binding
molecules in accordance with the embodiments. Generally, a person
skilled in the art knows how to determine the type of protein
scaffold on which to graft at least one of the CDRs arising from
the original antibody. More particularly, it is known that to be
selected such scaffolds must meet the greatest number of criteria
as follows (Skerra, 2000): good phylogenetic conservation; known
three-dimensional structure (as, for example, by crystallography,
NMR spectroscopy or any other technique known to a person skilled
in the art); small size; few or no post-transcriptional
modifications; and/or easy to produce, express, and purify.
[0187] The origin of such protein scaffolds can be, but is not
limited to, the structures selected among: fibronectin and
preferentially fibronectin type III domain 10, lipocalin, anticalin
(Skerra, 2001), protein Z arising from domain B of protein A of
Staphylococcus aureus, thioredoxin A or proteins with a repeated
motif such as the "ankyrin repeat" (Kohl et al., 2003), the
"armadillo repeat", the "leucine-rich repeat" and the
"tetratricopeptide repeat". For example, anticalins or lipocalin
derivatives are a type of binding proteins that have affinities and
specificities for various target molecules and can be used as SpA
binding molecules. Such proteins are described in US Patent
Publication Nos. 20100285564, 20060058510, 20060088908,
20050106660, and PCT Publication No. WO2006/056464, incorporated
herein by reference.
[0188] Scaffolds derived from toxins such as, for example, toxins
from scorpions, insects, plants, mollusks, etc., and the protein
inhibiters of neuronal NO synthase (PIN) may also be used in
certain aspects.
[0189] Monoclonal antibodies (mAbs) are recognized to have certain
advantages, e.g., reproducibility and large-scale production.
Embodiments include monoclonal antibodies of the human, murine,
monkey, rat, hamster, rabbit, and chicken origin.
[0190] "Humanized" antibodies are also contemplated, as are
chimeric antibodies from mouse, rat, or other species, bearing
human constant and/or variable region domains, bispecific
antibodies, recombinant and engineered antibodies and fragments
thereof. As used herein, the term "humanized" immunoglobulin refers
to an immunoglobulin comprising a human framework region and one or
more CDR's from a non-human (usually a mouse or rat)
immunoglobulin. The non-human immunoglobulin providing the CDR's is
called the "donor" and the human immunoglobulin providing the
framework is called the "acceptor". A "humanized antibody" is an
antibody comprising a humanized light chain and a humanized heavy
chain immunoglobulin.
C. Methods for Generating Antibodies
[0191] Methods for generating antibodies (e.g., monoclonal
antibodies and/or monoclonal antibodies) are known in the art.
Briefly, a polyclonal antibody is prepared by immunizing an animal
with a Coa polypeptide or a portion thereof in accordance with
embodiments and collecting antisera from that immunized animal.
[0192] A wide range of animal species can be used for the
production of antisera. Typically the animal used for production of
antisera is a rabbit, a mouse, a rat, a hamster, a guinea pig, or a
goat. The choice of animal may be decided upon the ease of
manipulation, costs or the desired amount of sera, as would be
known to one of skill in the art. It will be appreciated that
antibodies can also be produced transgenically through the
generation of a mammal or plant that is transgenic for the
immunoglobulin heavy and light chain sequences of interest and
production of the antibody in a recoverable form therefrom. In
connection with the transgenic production in mammals, antibodies
can be produced in, and recovered from, the milk of goats, cows, or
other mammals. See, e.g., U.S. Pat. Nos. 5,827,690, 5,756,687,
5,750,172, and 5,741,957.
[0193] As is also well known in the art, the immunogenicity of a
particular immunogen composition can be enhanced by the use of
non-specific stimulators of the immune response, known as
adjuvants. Suitable adjuvants include any acceptable
immunostimulatory compound, such as cytokines, chemokines,
cofactors, toxins, plasmodia, synthetic compositions, or vectors
encoding such adjuvants.
[0194] Adjuvants that may be used in accordance with embodiments
include, but are not limited to, IL-1, IL-2, IL-4, IL-7, IL-12,
interferon, GMCSP, BCG, aluminum hydroxide, MDP compounds, such as
thur-MDP and nor-MDP, CGP (MTP-PE), lipid A, and monophosphoryl
lipid A (MPL). RIBI, which contains three components extracted from
bacteria, MPL, trehalose dimycolate (TDM), and cell wall skeleton
(CWS) in a 2% squalene/Tween 80 emulsion is also contemplated. MHC
antigens may even be used. Exemplary adjuvants may include complete
Freund's adjuvant (a non-specific stimulator of the immune response
containing killed Mycobacterium tuberculosis), incomplete Freund's
adjuvants and/or aluminum hydroxide adjuvant.
[0195] In addition to adjuvants, it may be desirable to
coadminister biologic response modifiers (BRM), which have been
shown to upregulate T cell immunity or downregulate suppressor cell
activity. Such BRMs include, but are not limited to, Cimetidine
(CIM; 1200 mg/d) (Smith/Kline, PA); low-dose Cyclophosphamide (CYP;
300 mg/m2) (Johnson/Mead, NJ), cytokines such as interferon, IL-2,
or IL-12 or genes encoding proteins involved in immune helper
functions, such as B-7.
[0196] The amount of immunogen composition used in the production
of antibodies varies upon the nature of the immunogen as well as
the animal used for immunization. A variety of routes can be used
to administer the immunogen including but not limited to
subcutaneous, intramuscular, intradermal, intraepidermal,
intravenous, and intraperitoneal. The production of antibodies may
be monitored by sampling blood of the immunized animal at various
points following immunization.
[0197] A second, booster dose (e.g., provided in an injection), may
also be given. The process of boosting and titering is repeated
until a suitable titer is achieved. When a desired level of
immunogenicity is obtained, the immunized animal can be bled and
the serum isolated and stored, and/or the animal can be used to
generate mAbs.
[0198] For production of rabbit polyclonal antibodies, the animal
can be bled through an ear vein or alternatively by cardiac
puncture. The removed blood is allowed to coagulate and then
centrifuged to separate serum components from whole cells and blood
clots. The serum may be used as is for various applications or else
the desired antibody fraction may be purified by well-known
methods, such as affinity chromatography using another antibody, a
peptide bound to a solid matrix, or by using, e.g., protein A or
protein G chromatography, among others.
[0199] mAbs may be readily prepared through use of well-known
techniques, such as those exemplified in U.S. Pat. No. 4,196,265,
incorporated herein by reference. Typically, this technique
involves immunizing a suitable animal with a selected immunogen
composition, e.g., a purified or partially purified protein,
polypeptide, peptide or domain, be it a wild-type or mutant
composition. The immunizing composition is administered in a manner
effective to stimulate antibody producing cells.
[0200] The methods for generating monoclonal antibodies (mAbs)
generally begin along the same lines as those for preparing
polyclonal antibodies. In some embodiments, rodents such as mice
and rats are used in generating monoclonal antibodies. In some
embodiments, rabbit, sheep, or frog cells are used in generating
monoclonal antibodies. The use of rats is well known and may
provide certain advantages (Goding, 1986, pp. 60 61). Mice (e.g.,
BALB/c mice) are routinely used and generally give a high
percentage of stable fusions.
[0201] The animals are injected with antigen, generally as
described above. The antigen may be mixed with adjuvant, such as
Freund's complete or incomplete adjuvant. Booster administrations
with the same antigen or DNA encoding the antigen may occur at
approximately two-week intervals.
[0202] Following immunization, somatic cells with the potential for
producing antibodies, specifically B lymphocytes (B cells), are
selected for use in the mAb generating protocol. These cells may be
obtained from biopsied spleens, tonsils or lymph nodes, or from a
peripheral blood sample. Generally, spleen cells are a rich source
of antibody-producing cells that are in the dividing plasmablast
stage. Typically, peripheral blood cells may be readily obtained,
as peripheral blood is easily accessible.
[0203] In some embodiments, a panel of animals will have been
immunized and the spleen of an animal with the highest antibody
titer will be removed and the spleen lymphocytes obtained by
homogenizing the spleen with a syringe. Typically, a spleen from an
immunized mouse contains approximately 5.times.10.sup.7 to
2.times.10.sup.8 lymphocytes.
[0204] The antibody producing B lymphocytes from the immunized
animal are then fused with cells of an immortal myeloma cell,
generally one of the same species as the animal that was immunized.
Myeloma cell lines suited for use in hybridoma producing fusion
procedures preferably are non antibody producing, have high fusion
efficiency, and enzyme deficiencies that render then incapable of
growing in certain selective media which support the growth of only
the desired fused cells (hybridomas).
[0205] Any one of a number of myeloma cells may be used, as are
known to those of skill in the art (Goding, pp. 65 66, 1986;
Campbell, pp. 75 83, 1984). For example, where the immunized animal
is a mouse, one may use P3 X63/Ag8, X63 Ag8.653, NS1/1.Ag 4 1,
Sp210 Agl4, FO, NSO/U, MPC 11, MPC11 X45 GTG 1.7 and 5194/5XX0 Bul;
for rats, one may use R210.RCY3, Y3 Ag 1.2.3, IR983F and 4B210; and
U 266, GM1500 GRG2, LICR LON HMy2 and UC729 6 are all useful in
connection with human cell fusions. See Yoo et al. (2002), for a
discussion of myeloma expression systems.
[0206] One murine myeloma cell is the NS-1 myeloma cell line (also
termed P3-NS-1-Ag4-1), which is readily available from the NIGMS
Human Genetic Mutant Cell Repository by requesting cell line
repository number GM3573. Another mouse myeloma cell line that may
be used is the 8 azaguanine resistant mouse murine myeloma SP2/0
non producer cell line.
[0207] Methods for generating hybrids of antibody producing spleen
or lymph node cells and myeloma cells usually comprise mixing
somatic cells with myeloma cells in a 2:1 proportion, though the
proportion may vary from about 20:1 to about 1:1, respectively, in
the presence of an agent or agents (chemical or electrical) that
promote the fusion of cell membranes. Fusion methods using Sendai
virus have been described by Kohler and Milstein (1975; 1976), and
those using polyethylene glycol (PEG), such as 37% (v/v) PEG, by
Gefter et al., (1977). The use of electrically induced fusion
methods is also appropriate (Goding pp. 71 74, 1986).
[0208] Fusion procedures usually produce viable hybrids at low
frequencies, about 1.times.10.sup.-6 to 1.times.10.sup.-8. However,
this does not pose a problem, as the viable, fused hybrids are
differentiated from the parental, unfused cells (particularly the
unfused myeloma cells that would normally continue to divide
indefinitely) by culturing in a selective medium. The selective
medium is generally one that contains an agent that blocks the de
novo synthesis of nucleotides in the tissue culture media.
Exemplary and preferred agents are aminopterin, methotrexate, and
azaserine. Aminopterin and methotrexate block de novo synthesis of
both purines and pyrimidines, whereas azaserine blocks only purine
synthesis. Where aminopterin or methotrexate is used, the media is
supplemented with hypoxanthine and thymidine as a source of
nucleotides (HAT medium). Where azaserine is used, the media is
supplemented with hypoxanthine.
[0209] The preferred selection medium is HAT. Only cells capable of
operating nucleotide salvage pathways are able to survive in HAT
medium. The myeloma cells are defective in key enzymes of the
salvage pathway, e.g., hypoxanthine phosphoribosyl transferase
(HPRT), and they cannot survive. The B cells can operate this
pathway, but they have a limited life span in culture and generally
die within about two weeks. Therefore, the only cells that can
survive in the selective media are those hybrids formed from
myeloma and B cells.
[0210] This culturing provides a population of hybridomas from
which specific hybridomas are selected. Typically, selection of
hybridomas is performed by culturing the cells by single-clone
dilution in microtiter plates, followed by testing the individual
clonal supernatants (after about two to three weeks) for the
desired reactivity. The assay should be sensitive, simple and
rapid, such as radioimmunoassays, enzyme immunoassays, cytotoxicity
assays, plaque assays, dot immunobinding assays, and the like.
[0211] The selected hybridomas would then be serially diluted and
cloned into individual antibody producing cell lines, whose clones
can then be propagated indefinitely to provide mAbs. The cell lines
may be exploited for mAb production in two basic ways. First, a
sample of the hybridoma can be injected (often into the peritoneal
cavity) into a histocompatible animal of the type that was used to
provide the somatic and myeloma cells for the original fusion
(e.g., a syngeneic mouse). Optionally, the animals are primed with
a hydrocarbon, especially oils such as pristane
(tetramethylpentadecane) prior to injection. The injected animal
develops tumors secreting the specific monoclonal antibody produced
by the fused cell hybrid. The body fluids of the animal, such as
serum or ascites fluid, can then be tapped to provide mAbs in high
concentration. Second, the individual cell lines could be cultured
in vitro, where the mAbs are naturally secreted into the culture
medium from which they can be readily obtained in high
concentrations.
[0212] Further, expression of antibodies (or other moieties
therefrom) from production cell lines can be enhanced using a
number of known techniques. For example, the glutamine synthetase
and DHFR gene expression systems are common approaches for
enhancing expression under certain conditions. High expressing cell
clones can be identified using conventional techniques, such as
limited dilution cloning and Microdrop technology. The GS system is
discussed in whole or part in connection with European Patent Nos.
0 216 846, 0 256 055, and 0 323 997 and European Patent Application
No. 89303964.4.
[0213] mAbs produced by either means may be further purified, if
desired, using filtration, centrifugation, and various
chromatographic methods such as HPLC or affinity chromatography.
Fragments of the monoclonal antibodies can be obtained from the
monoclonal antibodies so produced by methods which include
digestion with enzymes, such as pepsin or papain, and/or by
cleavage of disulfide bonds by chemical reduction. Alternatively,
monoclonal antibody fragments can be synthesized using an automated
peptide synthesizer.
[0214] It is also contemplated that a molecular cloning approach
may be used to generate monoclonal antibodies. In one embodiment,
combinatorial immunoglobulin phagemid libraries are prepared from
RNA isolated from the spleen of the immunized animal, and phagemids
expressing appropriate antibodies are selected by panning using
cells expressing the antigen and control cells. The advantages of
this approach over conventional hybridoma techniques are that
approximately 104 times as many antibodies can be produced and
screened in a single round, and that new specificities are
generated by H and L chain combination which further increases the
chance of finding appropriate antibodies.
[0215] Another embodiment concerns producing antibodies, for
example, as is found in U.S. Pat. No. 6,091,001, which describes
methods to produce a cell expressing an antibody from a genomic
sequence of the cell comprising a modified immunoglobulin locus
using Cre-mediated site-specific recombination is disclosed. The
method involves first transfecting an antibody-producing cell with
a homology-targeting vector comprising a lox site and a targeting
sequence homologous to a first DNA sequence adjacent to the region
of the immunoglobulin loci of the genomic sequence which is to be
converted to a modified region, so the first lox site is inserted
into the genomic sequence via site-specific homologous
recombination. Then the cell is transfected with a lox-targeting
vector comprising a second lox site suitable for Cre-mediated
recombination with the integrated lox site and a modifying sequence
to convert the region of the immunoglobulin loci to the modified
region. This conversion is performed by interacting the lox sites
with Cre in vivo, so that the modifying sequence inserts into the
genomic sequence via Cre-mediated site-specific recombination of
the lox sites.
[0216] Alternatively, monoclonal antibody fragments can be
synthesized using an automated peptide synthesizer, or by
expression of full-length gene or of gene fragments in E. coli.
D. Antibody and Polypeptide Conjugates
[0217] Embodiments provide antibodies and antibody-like molecules
against Coa proteins, polypeptides and peptides that are linked to
at least one agent to form an antibody conjugate or payload. In
order to increase the efficacy of antibody molecules as diagnostic
or therapeutic agents, it is conventional to link or covalently
bind or complex at least one desired molecule or moiety. Such a
molecule or moiety may be, but is not limited to, at least one
effector or reporter molecule. Effector molecules comprise
molecules having a desired activity, e.g., cytotoxic activity.
Non-limiting examples of effector molecules which have been
attached to antibodies include toxins, therapeutic enzymes,
antibiotics, radio-labeled nucleotides and the like. By contrast, a
reporter molecule is defined as any moiety which may be detected
using an assay. Non-limiting examples of reporter molecules which
have been conjugated to antibodies include enzymes, radiolabels,
haptens, fluorescent labels, phosphorescent molecules,
chemiluminescent molecules, chromophores, luminescent molecules,
photoaffinity molecules, colored particles or ligands, such as
biotin.
[0218] Certain examples of antibody conjugates are those conjugates
in which the antibody is linked to a detectable label. "Detectable
labels" are compounds and/or elements that can be detected due to
their specific functional properties, and/or chemical
characteristics, the use of which allows the antibody to which they
are attached to be detected, and/or further quantified if
desired.
[0219] Antibody conjugates are generally preferred for use as
diagnostic agents. Antibody diagnostics generally fall within two
classes, those for use in in vitro diagnostics, such as in a
variety of immunoassays, and/or those for use in vivo diagnostic
protocols, generally known as "antibody directed imaging". Many
appropriate imaging agents are known in the art, as are methods for
their attachment to antibodies (see, for e.g., U.S. Pat. Nos.
5,021,236; 4,938,948; and 4,472,509, each incorporated herein by
reference). The imaging moieties used can be paramagnetic ions;
radioactive isotopes; fluorochromes; NMR-detectable substances;
X-ray imaging.
[0220] In the case of paramagnetic ions, one might mention by way
of example ions such as chromium (III), manganese (II), iron (III),
iron (II), cobalt (II), nickel (II), copper (II), neodymium (III),
samarium (III), ytterbium (III), gadolinium (III), vanadium (II),
terbium (III), dysprosium (III), holmium (III) and/or erbium (III),
with gadolinium being particularly preferred. Ions useful in other
contexts, such as X-ray imaging, include but are not limited to
lanthanum (III), gold (III), lead (II), and especially bismuth
(III).
[0221] In the case of radioactive isotopes for therapeutic and/or
diagnostic application, one might use astatine.sup.211,
.sup.14carbon, .sup.51chromium, .sup.36chlorine, .sup.57cobalt,
.sup.58cobalt, copper.sup.67, .sup.152Eu, gallium.sup.67,
.sup.3hydrogen, iodine.sup.123, iodine.sup.125, iodine.sup.31,
indium.sup.111, .sup.59iron, .sup.32phosphorus, rhenium.sup.186,
rhenium.sup.188, .sup.75selenium, .sup.35sulphur,
technicium.sup.99m and/or yttrium.sup.90. .sup.125I is often used
in certain embodiments, and technicium.sup.99m and/or indium are
also often used due to their low energy and suitability for long
range detection. Radioactively labeled monoclonal antibodies may be
produced according to well-known methods in the art. For instance,
monoclonal antibodies can be iodinated by contact with sodium
and/or potassium iodide and a chemical oxidizing agent such as
sodium hypochlorite, or an enzymatic oxidizing agent, such as
lactoperoxidase. Monoclonal antibodies may be labeled with
technetium.sup.99m by ligand exchange process, for example, by
reducing pertechnate with stannous solution, chelating the reduced
technetium onto a Sephadex column and applying the antibody to this
column. Alternatively, direct labeling techniques may be used,
e.g., by incubating pertechnate, a reducing agent such as
SNCl.sub.2, a buffer solution such as sodium-potassium phthalate
solution, and the antibody. Intermediary functional groups which
are often used to bind radioisotopes which exist as metallic ions
to antibody are diethylenetriaminepentaacetic acid (DTPA) or
ethylene diaminetetracetic acid (EDTA).
[0222] Among the fluorescent labels contemplated for use as
conjugates include Alexa 350, Alexa 430, AMCA, BODIPY 630/650,
BODIPY 650/665, BODIPY-FL, BODIPY-R6G, BODIPY-TMR, BODIPY-TRX,
Cascade Blue, Cy3, Cy5,6-FAM, Fluorescein Isothiocyanate, HEX,
6-JOE, Oregon Green 488, Oregon Green 500, Oregon Green 514,
Pacific Blue, REG, Rhodamine Green, Rhodamine Red, Renographin,
ROX, TAMRA, TET, Tetramethylrhodamine, and/or Texas Red, among
others.
[0223] Antibody conjugates include those intended primarily for use
in vitro, where the antibody is linked to a secondary binding
ligand and/or to an enzyme (an enzyme tag) that will generate a
colored product upon contact with a chromogenic substrate. Examples
of suitable enzymes include, but are not limited to, urease,
alkaline phosphatase, (horseradish) hydrogen peroxidase or glucose
oxidase. Preferred secondary binding ligands are biotin and/or
avidin and streptavidin compounds. The use of such labels is well
known to those of skill in the art and are described, for example,
in U.S. Pat. Nos. 3,817,837; 3,850,752; 3,939,350; 3,996,345;
4,277,437; 4,275,149 and 4,366,241; each incorporated herein by
reference.
[0224] Yet another known method of site-specific attachment of
molecules to antibodies comprises the reaction of antibodies with
hapten-based affinity labels. Essentially, hapten-based affinity
labels react with amino acids in the antigen binding site, thereby
destroying this site and blocking specific antigen reaction.
However, this may not be advantageous since it results in loss of
antigen binding by the antibody conjugate.
[0225] Molecules containing azido groups may also be used to form
covalent bonds to proteins through reactive nitrene intermediates
that are generated by low intensity ultraviolet light (Potter &
Haley, 1983). In particular, 2- and 8-azido analogues of purine
nucleotides have been used as site-directed photoprobes to identify
nucleotide binding proteins in crude cell extracts (Owens &
Haley, 1987; Atherton et al., 1985). The 2- and 8-azido nucleotides
have also been used to map nucleotide binding domains of purified
proteins (Khatoon et al., 1989; King et al., 1989; and Dholakia et
al., 1989) and may be used as antibody binding agents.
[0226] Several methods are known in the art for the attachment or
conjugation of an antibody to its conjugate moiety. Some attachment
methods involve the use of a metal chelate complex employing, for
example, an organic chelating agent such a
diethylenetriaminepentaacetic acid anhydride (DTPA);
ethylenetriaminetetraacetic acid; N-chloro-p-toluenesulfonamide;
and/or tetrachloro-3-6-diphenylglycouril-3 attached to the antibody
(U.S. Pat. Nos. 4,472,509 and 4,938,948, each incorporated herein
by reference). Monoclonal antibodies may also be reacted with an
enzyme in the presence of a coupling agent such as glutaraldehyde
or periodate. Conjugates with fluorescein markers are prepared in
the presence of these coupling agents or by reaction with an
isothiocyanate. In U.S. Pat. No. 4,938,948, imaging of breast
tumors is achieved using monoclonal antibodies and the detectable
imaging moieties are bound to the antibody using linkers such as
methyl-p-hydroxybenzimidate or
N-succinimidyl-3-(4-hydroxyphenyl)propionate.
[0227] In some embodiments, derivatization of immunoglobulins by
selectively introducing sulfhydryl groups in the Fc region of an
immunoglobulin, using reaction conditions that do not alter the
antibody combining site are contemplated. Antibody conjugates
produced according to this methodology are disclosed to exhibit
improved longevity, specificity and sensitivity (U.S. Pat. No.
5,196,066, incorporated herein by reference). Site-specific
attachment of effector or reporter molecules, wherein the reporter
or effector molecule is conjugated to a carbohydrate residue in the
Fc region have also been disclosed in the literature (O'Shannessy
et al., 1987). This approach has been reported to produce
diagnostically and therapeutically promising antibodies which are
currently in clinical evaluation.
[0228] In some embodiments, anti-Coa antibodies are linked to
semiconductor nanocrystals such as those described in U.S. Pat.
Nos. 6,048,616; 5,990,479; 5,690,807; 5,505,928; 5,262,357 (all of
which are incorporated herein in their entireties); as well as PCT
Publication No. 99/26299 (published May 27, 1999). In particular,
exemplary materials for use as semiconductor nanocrystals in the
biological and chemical assays include, but are not limited to,
those described above, including group II-VI, III-V and group IV
semiconductors such as ZnS, ZnSe, ZnTe, CdS, CdSe, CdTe, MgS, MgSe,
MgTe, CaS, CaSe, CaTe, SrS, SrSe, SrTe, BaS, BaSe, BaTe, GaN, GaP,
GaAs, GaSb, InP, InAs, InSb, AlS, AlP, AlSb, PbS, PbSe, Ge and Si
and ternary and quaternary mixtures thereof. Methods for linking
semiconductor nanocrystals to antibodies are described in U.S. Pat.
Nos. 6,630,307 and 6,274,323.
III. NUCLEIC ACIDS
[0229] In certain embodiments, there are recombinant
polynucleotides encoding the proteins, polypeptides, or peptides
described herein. Polynucleotide sequences contemplated include
those encoding antibodies to Coa or Coa-binding portions
thereof.
[0230] As used in this application, the term "polynucleotide"
refers to a nucleic acid molecule that either is recombinant or has
been isolated free of total genomic nucleic acid. Included within
the term "polynucleotide" are oligonucleotides (nucleic acids 100
residues or less in length), recombinant vectors, including, for
example, plasmids, cosmids, phage, viruses, and the like.
Polynucleotides include, in certain aspects, regulatory sequences,
isolated substantially away from their naturally occurring genes or
protein encoding sequences. Polynucleotides may be single-stranded
(coding or antisense) or double-stranded, and may be RNA, DNA
(genomic, cDNA or synthetic), analogs thereof, or a combination
thereof. Additional coding or non-coding sequences may, but need
not, be present within a polynucleotide.
[0231] In this respect, the term "gene," "polynucleotide," or
"nucleic acid" is used to refer to a nucleic acid that encodes a
protein, polypeptide, or peptide (including any sequences required
for proper transcription, post-translational modification, or
localization). As will be understood by those in the art, this term
encompasses genomic sequences, expression cassettes, cDNA
sequences, and smaller engineered nucleic acid segments that
express, or may be adapted to express, proteins, polypeptides,
domains, peptides, fusion proteins, and mutants. A nucleic acid
encoding all or part of a polypeptide may contain a contiguous
nucleic acid sequence encoding all or a portion of such a
polypeptide. It also is contemplated that a particular polypeptide
may be encoded by nucleic acids containing variations having
slightly different nucleic acid sequences but, nonetheless, encode
the same or substantially similar protein (see above). A nucleic
acid encoding all or part of a polypeptide may contain a contiguous
nucleic acid sequence of: 10, 20, 30, 40, 50, 60, 70, 80, 90, 100,
110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230,
240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360,
370, 380, 390, 400, 410, 420, 430, 440, 441, 450, 460, 470, 480,
490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590, 600, 610,
620, 630, 640, 650, 660, 670, 680, 690, 700, 710, 720, 730, 740,
750, 760, 770, 780, 790, 800, 810, 820, 830, 840, 850, 860, 870,
880, 890, 900, 910, 920, 930, 940, 950, 960, 970, 980, 990, 1000,
1010, 1020, 1030, 1040, 1050, 1060, 1070, 1080, 1090, 1095, 1100,
1500, 2000, 2500, 3000, 3500, 4000, 4500, 5000, 5500, 6000, 6500,
7000, 7500, 8000, 9000, 10000, or more nucleotides, nucleosides, or
base pairs, including all values and ranges therebetween, of a
polynucleotide encoding one or more amino acid sequence described
or referenced herein. It also is contemplated that a particular
polypeptide may be encoded by nucleic acids containing variations
having slightly different nucleic acid sequences but, nonetheless,
encode the same or substantially similar protein.
[0232] In particular embodiments, there are isolated nucleic acid
segments and recombinant vectors incorporating nucleic acid
sequences that encode a polypeptide (e.g., an antibody or fragment
thereof) that binds to Coa. The term "recombinant" may be used in
conjunction with a polypeptide or the name of a specific
polypeptide, and this generally refers to a polypeptide produced
from a nucleic acid molecule that has been manipulated in vitro or
that is a replication product of such a molecule.
[0233] The nucleic acid segments, regardless of the length of the
coding sequence itself, may be combined with other nucleic acid
sequences, such as promoters, polyadenylation signals, additional
restriction enzyme sites, multiple cloning sites, other coding
segments, and the like, such that their overall length may vary
considerably. It is therefore contemplated that a nucleic acid
fragment of almost any length may be employed, with the total
length preferably being limited by the ease of preparation and use
in the intended recombinant nucleic acid protocol. In some cases, a
nucleic acid sequence may encode a polypeptide sequence with
additional heterologous coding sequences, for example to allow for
purification of the polypeptide, transport, secretion,
post-translational modification, or for therapeutic benefits such
as targeting or efficacy. As discussed above, a tag or other
heterologous polypeptide may be added to the modified
polypeptide-encoding sequence, wherein "heterologous" refers to a
polypeptide that is not the same as the modified polypeptide.
[0234] In certain embodiments, there are polynucleotide variants
having substantial identity to the sequences disclosed herein;
those comprising at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%,
98%, or 99% or higher sequence identity, including all values and
ranges there between, compared to a polynucleotide sequence
provided herein using the methods described herein (e.g., BLAST
analysis using standard parameters). In certain aspects, the
isolated polynucleotide will comprise a nucleotide sequence
encoding a polypeptide that has at least 90%, preferably 95% and
above, identity to an amino acid sequence described herein, over
the entire length of the sequence; or a nucleotide sequence
complementary to said isolated polynucleotide.
A. Vectors
[0235] Polypeptides may be encoded by a nucleic acid molecule. The
nucleic acid molecule can be in the form of a nucleic acid vector.
The term "vector" is used to refer to a carrier nucleic acid
molecule into which a heterologous nucleic acid sequence can be
inserted for introduction into a cell where it can be replicated
and expressed. A nucleic acid sequence can be "heterologous," which
means that it is in a context foreign to the cell in which the
vector is being introduced or to the nucleic acid in which is
incorporated, which includes a sequence homologous to a sequence in
the cell or nucleic acid but in a position within the host cell or
nucleic acid where it is ordinarily not found. Vectors include
DNAs, RNAs, plasmids, cosmids, viruses (bacteriophage, animal
viruses, and plant viruses), and artificial chromosomes (e.g.,
YACs). One of skill in the art would be well equipped to construct
a vector through standard recombinant techniques (for example
Sambrook et al., 2001; Ausubel et al., 1996, both incorporated
herein by reference). Vectors may be used in a host cell to produce
an antibody that binds Coa.
[0236] The term "expression vector" refers to a vector containing a
nucleic acid sequence coding for at least part of a gene product
capable of being transcribed. In some cases, RNA molecules are then
translated into a protein, polypeptide, or peptide. Expression
vectors can contain a variety of "control sequences," which refer
to nucleic acid sequences necessary for the transcription and
possibly translation of an operably linked coding sequence in a
particular host organism. In addition to control sequences that
govern transcription and translation, vectors and expression
vectors may contain nucleic acid sequences that serve other
functions as well and are described herein.
[0237] Vectors can include a multiple cloning site (MCS), which is
a nucleic acid region that contains multiple restriction enzyme
sites, any of which can be used in conjunction with standard
recombinant technology to digest the vector. (See Carbonelli et
al., 1999, Levenson et al., 1998, and Cocea, 1997, incorporated
herein by reference.)
[0238] Most transcribed eukaryotic RNA molecules will undergo RNA
splicing to remove introns from the primary transcripts. Vectors
containing genomic eukaryotic sequences may require donor and/or
acceptor splicing sites to ensure proper processing of the
transcript for protein expression. (See Chandler et al., 1997,
incorporated herein by reference.)
[0239] The vectors or constructs will generally comprise at least
one termination signal. A "termination signal" or "terminator" is
comprised of the DNA sequences involved in specific termination of
an RNA transcript by an RNA polymerase. Thus, in certain
embodiments a termination signal that ends the production of an RNA
transcript is contemplated. A terminator may be necessary in vivo
to achieve desirable message levels. In eukaryotic systems, the
terminator region may also comprise specific DNA sequences that
permit site-specific cleavage of the new transcript so as to expose
a polyadenylation site. This signals a specialized endogenous
polymerase to add a stretch of about 200 A residues (polyA) to the
3' end of the transcript. RNA molecules modified with this polyA
tail appear to more stable and are translated more efficiently.
Thus, in other embodiments involving eukaryotes, it is preferred
that that terminator comprises a signal for the cleavage of the
RNA, and it is more preferred that the terminator signal promotes
polyadenylation of the message.
[0240] In expression, particularly eukaryotic expression, one will
typically include a polyadenylation signal to effect proper
polyadenylation of the transcript.
[0241] In order to propagate a vector in a host cell, it may
contain one or more origins of replication sites (often termed
"ori"), which is a specific nucleic acid sequence at which
replication is initiated. Alternatively an autonomously replicating
sequence (ARS) can be employed if the host cell is yeast.
[0242] 1. Promoters and Enhancers
[0243] A "promoter" is a control sequence. The promoter is
typically a region of a nucleic acid sequence at which initiation
and rate of transcription are controlled. It may contain genetic
elements at which regulatory proteins and molecules may bind such
as RNA polymerase and other transcription factors. The phrases
"operatively positioned," "operatively linked," "under control,"
and "under transcriptional control" mean that a promoter is in a
correct functional location and/or orientation in relation to a
nucleic acid sequence to control transcriptional initiation and
expression of that sequence. A promoter may or may not be used in
conjunction with an "enhancer," which refers to a cis-acting
regulatory sequence involved in the transcriptional activation of a
nucleic acid sequence.
[0244] Naturally, it may be important to employ a promoter and/or
enhancer that effectively directs the expression of the DNA segment
in the cell type or organism chosen for expression. Those of skill
in the art of molecular biology generally know the use of
promoters, enhancers, and cell type combinations for protein
expression (see Sambrook et al., 2001, incorporated herein by
reference). The promoters employed may be constitutive,
tissue-specific, or inducible and in certain embodiments may direct
high level expression of the introduced DNA segment under specified
conditions, such as large-scale production of recombinant proteins
or peptides.
[0245] Various elements/promoters may be employed in the context of
the present disclosure to regulate the expression of a gene.
Examples of such inducible elements, which are regions of a nucleic
acid sequence that can be activated in response to a specific
stimulus, include but are not limited to Immunoglobulin Heavy Chain
(Banerji et al., 1983; Gilles et al., 1983; Grosschedl et al.,
1985; Atchinson et al., 1986, 1987; Imler et al., 1987; Weinberger
et al., 1984; Kiledjian et al., 1988; Porton et al.; 1990),
Immunoglobulin Light Chain (Queen et al., 1983; Picard et al.,
1984), T Cell Receptor (Luria et al., 1987; Winoto et al., 1989;
Redondo et al.; 1990), HLA DQ .quadrature. and/or DQ
.quadrature..quadrature..quadrature. Sullivan et al., 1987),
.quadrature. Interferon (Goodbourn et al., 1986; Fujita et al.,
1987; Goodbourn et al., 1988), Interleukin-2 (Greene et al., 1989),
Interleukin-2 Receptor (Greene et al., 1989; Lin et al., 1990), MHC
Class II 5 (Koch et al., 1989), MHC Class II HLA-DR
.quadrature..quadrature..quadrature. Sherman et al., 1989), D-Actin
(Kawamoto et al., 1988; Ng et al.; 1989), Muscle Creatine Kinase
(MCK) (Jaynes et al., 1988; Horlick et al., 1989; Johnson et al.,
1989), Prealbumin (Transthyretin) (Costa et al., 1988), Elastase I
(Ornitz et al., 1987), Metallothionein (MTII) (Karin et al., 1987;
Culotta et al., 1989), Collagenase (Pinkert et al., 1987; Angel et
al., 1987), Albumin (Pinkert et al., 1987; Tronche et al., 1989,
1990), .quadrature.-Fetoprotein (Godbout et al., 1988; Campere et
al., 1989), .gamma.-Globin (Bodine et al., 1987; Perez-Stable et
al., 1990), .quadrature.-Globin (Trudel et al., 1987), c-fos (Cohen
et al., 1987), c-Ha-Ras (Triesman, 1986; Deschamps et al., 1985),
Insulin (Edlund et al., 1985), Neural Cell Adhesion Molecule (NCAM)
(Hirsh et al., 1990), .quadrature.1-Antitrypain (Latimer et al.,
1990), H2B (TH2B) Histone (Hwang et al., 1990), Mouse and/or Type I
Collagen (Ripe et al., 1989), Glucose-Regulated Proteins (GRP94 and
GRP78) (Chang et al., 1989), Rat Growth Hormone (Larsen et al.,
1986), Human Serum Amyloid A (SAA) (Edbrooke et al., 1989),
Troponin I (TN I) (Yutzey et al., 1989), Platelet-Derived Growth
Factor (PDGF) (Pech et al., 1989), Duchenne Muscular Dystrophy
(Klamut et al., 1990), SV40 (Banerji et al., 1981; Moreau et al.,
1981; Sleigh et al., 1985; Firak et al., 1986; Herr et al., 1986;
Imbra et al., 1986; Kadesch et al., 1986; Wang et al., 1986; Ondek
et al., 1987; Kuhl et al., 1987; Schaffner et al., 1988), Polyoma
(Swartzendruber et al., 1975; Vasseur et al., 1980; Katinka et al.,
1980, 1981; Tyndell et al., 1981; Dandolo et al., 1983; de Villiers
et al., 1984; Hen et al., 1986; Satake et al., 1988; Campbell et
al., 1988), Retroviruses (Kriegler et al., 1982, 1983; Levinson et
al., 1982; Kriegler et al., 1983, 1984a, b, 1988; Bosze et al.,
1986; Miksicek et al., 1986; Celander et al., 1987; Thiesen et al.,
1988; Celander et al., 1988; Choi et al., 1988; Reisman et al.,
1989), Papilloma Virus (Campo et al., 1983; Lusky et al., 1983;
Spandidos and Wilkie, 1983; Spalholz et al., 1985; Lusky et al.,
1986; Cripe et al., 1987; Gloss et al., 1987; Hirochika et al.,
1987; Stephens et al., 1987), Hepatitis B Virus (Bulla et al.,
1986; Jameel et al., 1986; Shaul et al., 1987; Spandau et al.,
1988; Vannice et al., 1988), Human Immunodeficiency Virus (Muesing
et al., 1987; Hauber et al., 1988; Jakobovits et al., 1988; Feng et
al., 1988; Takebe et al., 1988; Rosen et al., 1988; Berkhout et
al., 1989; Laspia et al., 1989; Sharp et al., 1989; Braddock et
al., 1989), Cytomegalovirus (CMV) IE (Weber et al., 1984; Boshart
et al., 1985; Foecking et al., 1986), Gibbon Ape Leukemia Virus
(Holbrook et al., 1987; Quinn et al., 1989).
[0246] Inducible elements include, but are not limited to MT
II--Phorbol Ester (TFA)/Heavy metals (Palmiter et al., 1982;
Haslinger et al., 1985; Searle et al., 1985; Stuart et al., 1985;
Imagawa et al., 1987, Karin et al., 1987; Angel et al., 1987b;
McNeall et al., 1989); MMTV (mouse mammary tumor
virus)--Glucocorticoids (Huang et al., 1981; Lee et al., 1981;
Majors et al., 1983; Chandler et al., 1983; Lee et al., 1984; Ponta
et al., 1985; Sakai et al., 1988);
.quadrature.-Interferon--poly(rI)x/poly(rc) (Tavernier et al.,
1983); Adenovirus 5 E2--E1A (Imperiale et al., 1984);
Collagenase--Phorbol Ester (TPA) (Angel et al., 1987a);
Stromelysin--Phorbol Ester (TPA) (Angel et al., 1987b);
SV40--Phorbol Ester (TPA) (Angel et al., 1987b); Murine MX
Gene--Interferon, Newcastle Disease Virus (Hug et al., 1988); GRP78
Gene--A23187 (Resendez et al., 1988);
.quadrature.-2-Macroglobulin--IL-6 (Kunz et al., 1989);
Vimentin--Serum (Rittling et al., 1989); MHC Class I Gene
H-2.quadrature.b--Interferon (Blanar et al., 1989); HSP70--E1A/SV40
Large T Antigen (Taylor et al., 1989, 1990a, 1990b);
Proliferin--Phorbol Ester/TPA (Mordacq et al., 1989); Tumor
Necrosis Factor--PMA (Hensel et al., 1989); and Thyroid Stimulating
Hormone .quadrature. Gene--Thyroid Hormone (Chatterjee et al.,
1989).
[0247] The particular promoter that is employed to control the
expression of peptide or protein encoding polynucleotide of the
disclosure is not believed to be critical, so long as it is capable
of expressing the polynucleotide in a targeted cell, preferably a
bacterial cell. Where a human cell is targeted, it is preferable to
position the polynucleotide coding region adjacent to and under the
control of a promoter that is capable of being expressed in a human
cell. Generally speaking, such a promoter might include either a
bacterial, human or viral promoter.
[0248] In embodiments in which a vector is administered to a
subject for expression of the protein, it is contemplated that a
desirable promoter for use with the vector is one that is not
down-regulated by cytokines or one that is strong enough that even
if down-regulated, it produces an effective amount of at least one
Staphylococcal coagulase R Domain for eliciting an immune response.
Non-limiting examples of these are CMV IE and RSV LTR. Tissue
specific promoters can be used, particularly if expression is in
cells in which expression of an antigen is desirable, such as
dendritic cells or macrophages. The mammalian MHC I and MHC II
promoters are examples of such tissue-specific promoters.
[0249] 2. Initiation Signals and Internal Ribosome Binding Sites
(IRES)
[0250] A specific initiation signal also may be required for
efficient translation of coding sequences. These signals include
the ATG initiation codon or adjacent sequences. Exogenous
translational control signals, including the ATG initiation codon,
may need to be provided. One of ordinary skill in the art would
readily be capable of determining this and providing the necessary
signals.
[0251] In certain embodiments of the disclosure, the use of
internal ribosome entry sites (IRES) elements are used to create
multigene, or polycistronic, messages. IRES elements are able to
bypass the ribosome scanning model of 5' .quadrature. methylated
Cap dependent translation and begin translation at internal sites
(Pelletier and Sonenberg, 1988; Macejak and Sarnow, 1991). IRES
elements can be linked to heterologous open reading frames.
Multiple open reading frames can be transcribed together, each
separated by an IRES, creating polycistronic messages. Multiple
genes can be efficiently expressed using a single promoter/enhancer
to transcribe a single message (see U.S. Pat. Nos. 5,925,565 and
5,935,819, herein incorporated by reference).
[0252] 3. Selectable and Screenable Markers
[0253] In certain embodiments of the disclosure, cells containing a
nucleic acid construct of the present disclosure may be identified
in vitro or in vivo by encoding a screenable or selectable marker
in the expression vector. When transcribed and translated, a marker
confers an identifiable change to the cell permitting easy
identification of cells containing the expression vector.
Generally, a selectable marker is one that confers a property that
allows for selection. A positive selectable marker is one in which
the presence of the marker allows for its selection, while a
negative selectable marker is one in which its presence prevents
its selection. An example of a positive selectable marker is a drug
resistance marker.
B. Host Cells
[0254] As used herein, the terms "cell," "cell line," and "cell
culture" may be used interchangeably. All of these terms also
include their progeny, which is any and all subsequent generations.
It is understood that all progeny may not be identical due to
deliberate or inadvertent mutations. In the context of expressing a
heterologous nucleic acid sequence, "host cell" refers to a
prokaryotic or eukaryotic cell, and it includes any transformable
organism that is capable of replicating a vector or expressing a
heterologous gene encoded by a vector. A host cell can, and has
been, used as a recipient for vectors or viruses. A host cell may
be "transfected" or "transformed," which refers to a process by
which exogenous nucleic acid, such as a recombinant
protein-encoding sequence, is transferred or introduced into the
host cell. A transformed cell includes the primary subject cell and
its progeny.
[0255] Some vectors may employ control sequences that allow it to
be replicated and/or expressed in both prokaryotic and eukaryotic
cells. One of skill in the art would further understand the
conditions under which to incubate all of the above described host
cells to maintain them and to permit replication of a vector. Also
understood and known are techniques and conditions that would allow
large-scale production of vectors, as well as production of the
nucleic acids encoded by vectors and their cognate polypeptides,
proteins, or peptides.
C. Expression Systems
[0256] Numerous expression systems exist that comprise at least a
part or all of the compositions discussed above. Prokaryote- and/or
eukaryote-based systems can be employed for use with an embodiment
to produce nucleic acid sequences, or their cognate polypeptides,
proteins and peptides. Many such systems are commercially and
widely available.
[0257] The insect cell/baculovirus system can produce a high level
of protein expression of a heterologous nucleic acid segment, such
as described in U.S. Pat. Nos. 5,871,986, 4,879,236, both herein
incorporated by reference, and which can be bought, for example,
under the name MAXBAC.RTM. 2.0 from INVITROGEN.RTM. and BACPACK.TM.
BACULOVIRUS EXPRESSION SYSTEM FROM CLONTECH.RTM..
[0258] In addition to the disclosed expression systems, other
examples of expression systems include STRATAGENE.RTM.'s COMPLETE
CONTROL.quadrature. Inducible Mammalian Expression System, which
involves a synthetic ecdysone-inducible receptor, or its pET
Expression System, an E. coli expression system. Another example of
an inducible expression system is available from INVITROGEN.RTM.,
which carries the T-REX.TM. (tetracycline-regulated expression)
System, an inducible mammalian expression system that uses the
full-length CMV promoter. INVITROGEN.RTM. also provides a yeast
expression system called the Pichia methanolica Expression System,
which is designed for high-level production of recombinant proteins
in the methylotrophic yeast Pichia methanolica. One of skill in the
art would know how to express a vector, such as an expression
construct, to produce a nucleic acid sequence or its cognate
polypeptide, protein, or peptide.
D. Methods of Gene Transfer
[0259] Suitable methods for nucleic acid delivery to effect
expression of compositions are believed to include virtually any
method by which a nucleic acid (e.g., DNA, including viral and
nonviral vectors) can be introduced into a cell, a tissue or an
organism, as described herein or as would be known to one of
ordinary skill in the art. Such methods include, but are not
limited to, direct delivery of DNA such as by injection (U.S. Pat.
Nos. 5,994,624, 5,981,274, 5,945,100, 5,780,448, 5,736,524,
5,702,932, 5,656,610, 5,589,466 and 5,580,859, each incorporated
herein by reference), including microinjection (Harland and
Weintraub, 1985; U.S. Pat. No. 5,789,215, incorporated herein by
reference); by electroporation (U.S. Pat. No. 5,384,253,
incorporated herein by reference); by calcium phosphate
precipitation (Graham and Van Der Eb, 1973; Chen and Okayama, 1987;
Rippe et al., 1990); by using DEAE dextran followed by polyethylene
glycol (Gopal, 1985); by direct sonic loading (Fechheimer et al.,
1987); by liposome mediated transfection (Nicolau and Sene, 1982;
Fraley et al., 1979; Nicolau et al., 1987; Wong et al., 1980;
Kaneda et al., 1989; Kato et al., 1991); by microprojectile
bombardment (PCT Application Nos. WO 94/09699 and 95/06128; U.S.
Pat. Nos. 5,610,042; 5,322,783, 5,563,055, 5,550,318, 5,538,877 and
5,538,880, and each incorporated herein by reference); by agitation
with silicon carbide fibers (Kaeppler et al., 1990; U.S. Pat. Nos.
5,302,523 and 5,464,765, each incorporated herein by reference); by
Agrobacterium mediated transformation (U.S. Pat. Nos. 5,591,616 and
5,563,055, each incorporated herein by reference); or by PEG
mediated transformation of protoplasts (Omirulleh et al., 1993;
U.S. Pat. Nos. 4,684,611 and 4,952,500, each incorporated herein by
reference); by desiccation/inhibition mediated DNA uptake (Potrykus
et al., 1985). Through the application of techniques such as these,
organelle(s), cell(s), tissue(s) or organism(s) may be stably or
transiently transformed.
IV. IMMUNE RESPONSE AND ASSAYS
[0260] As discussed above, the disclosure concerns evoking or
inducing an immune response in a subject against a coagulase or one
or more coagulase R Domains or variants thereof. In one embodiment,
the immune response can protect against or treat a subject having,
suspected of having, or at risk of developing an infection or
related disease, particularly those related to Staphylococci. One
use of the immunogenic compositions of the disclosure is to prevent
nosocomial infections by inoculating a subject prior to undergoing
procedures in a hospital or other environment having an increased
risk of infection.
A. Immunoassays
[0261] The present disclosure includes the implementation of
serological assays to evaluate whether and to what extent an immune
response is induced or evoked by compositions of the disclosure.
There are many types of immunoassays that can be implemented.
Immunoassays encompassed by the present disclosure include, but are
not limited to, those described in U.S. Pat. No. 4,367,110 (double
monoclonal antibody sandwich assay) and U.S. Pat. No. 4,452,901
(western blot). Other assays include immunoprecipitation of labeled
ligands and immunocytochemistry, both in vitro and in vivo.
[0262] Immunoassays generally are binding assays. Certain preferred
immunoassays are the various types of enzyme linked immunosorbent
assays (ELISAs) and radioimmunoassays (RIA) known in the art.
Immunohistochemical detection using tissue sections is also
particularly useful. In one example, antibodies or antigens are
immobilized on a selected surface, such as a well in a polystyrene
microtiter plate, dipstick, or column support. Then, a test
composition suspected of containing the desired antigen or
antibody, such as a clinical sample, is added to the wells. After
binding and washing to remove non-specifically bound immune
complexes, the bound antigen or antibody may be detected. Detection
is generally achieved by the addition of another antibody, specific
for the desired antigen or antibody that is linked to a detectable
label. This type of ELISA is known as a "sandwich ELISA." Detection
also may be achieved by the addition of a second antibody specific
for the desired antigen, followed by the addition of a third
antibody that has binding affinity for the second antibody, with
the third antibody being linked to a detectable label.
[0263] Competition ELISAs are also possible implementations in
which test samples compete for binding with known amounts of
labeled antigens or antibodies. The amount of reactive species in
the unknown sample is determined by mixing the sample with the
known labeled species before or during incubation with coated
wells. The presence of reactive species in the sample acts to
reduce the amount of labeled species available for binding to the
well and thus reduces the ultimate signal. Irrespective of the
format employed, ELISAs have certain features in common, such as
coating, incubating or binding, washing to remove non-specifically
bound species, and detecting the bound immune complexes.
[0264] Antigen or antibodies may also be linked to a solid support,
such as in the form of plate, beads, dipstick, membrane, or column
matrix, and the sample to be analyzed is applied to the immobilized
antigen or antibody. In coating a plate with either antigen or
antibody, one will generally incubate the wells of the plate with a
solution of the antigen or antibody, either overnight or for a
specified period. The wells of the plate will then be washed to
remove incompletely-adsorbed material. Any remaining available
surfaces of the wells are then "coated" with a nonspecific protein
that is antigenically neutral with regard to the test antisera.
These include bovine serum albumin (BSA), casein, and solutions of
milk powder. The coating allows for blocking of nonspecific
adsorption sites on the immobilizing surface and thus reduces the
background caused by nonspecific binding of antisera onto the
surface.
B. Diagnosis of Bacterial Infection
[0265] In addition to the use of proteins, polypeptides, and/or
peptides, as well as antibodies binding these polypeptides,
proteins, and/or peptides, to treat or prevent infection as
described above, the present disclosure contemplates the use of
these polypeptides, proteins, peptides, and/or antibodies in a
variety of ways, including the detection of the presence of
Staphylococci to diagnose an infection, whether in a subject or on
medical equipment which may also become infected. In accordance
with the disclosure, a preferred method of detecting the presence
of infections involves the steps of obtaining a sample suspected of
being infected by one or more Staphylococcal bacteria species or
strains, such as a sample taken from an individual, for example,
from one's blood, saliva, tissues, bone, muscle, cartilage, or
skin. Following isolation of the sample, diagnostic assays
utilizing the polypeptides, proteins, peptides, and/or antibodies
of the present disclosure may be carried out to detect the presence
of Staphylococci, and such assay techniques for determining such
presence in a sample are well known to those skilled in the art and
include methods such as radioimmunoassay, western blot analysis and
ELISA assays. In general, in accordance with the disclosure, a
method of diagnosing an infection is contemplated wherein a sample
suspected of being infected with Staphylococci has added to it the
polypeptide, protein, peptide, antibody, or monoclonal antibody in
accordance with the present disclosure, and Staphylococci are
indicated by antibody binding to the polypeptides, proteins, and/or
peptides, or polypeptides, proteins, and/or peptides binding to the
antibodies in the sample.
[0266] Accordingly, antibodies in accordance with the disclosure
may be used for the prevention of infection from Staphylococcal
bacteria (i.e., passive immunization), for the treatment of an
ongoing infection, or for use as research tools. The term
"antibodies" as used herein includes monoclonal, polyclonal,
chimeric, single chain, bispecific, simianized, and humanized or
primatized antibodies as well as Fab fragments, such as those
fragments which maintain the binding specificity of the antibodies,
including the products of a Fab immunoglobulin expression library.
Accordingly, the disclosure contemplates the use of single chains
such as the variable heavy and light chains of the antibodies.
Generation of any of these types of antibodies or antibody
fragments is well known to those skilled in the art. Specific
examples of the generation of an antibody to a bacterial protein
can be found in U.S. Patent Application Pub. No. 20030153022, which
is incorporated herein by reference in its entirety.
[0267] Any of the above described polypeptides, proteins, peptides,
and/or antibodies may be labeled directly with a detectable label
for identification and quantification of Staphylococcal bacteria.
Labels for use in immunoassays are generally known to those skilled
in the art and include enzymes, radioisotopes, and fluorescent,
luminescent and chromogenic substances, including colored particles
such as colloidal gold or latex beads. Suitable immunoassays
include enzyme-linked immunosorbent assays (ELISA).
C. Protective Immunity
[0268] In some embodiments of the disclosure, proteinaceous
compositions confer protective immunity to a subject. Protective
immunity refers to a body's ability to mount a specific immune
response that protects the subject from developing a particular
disease or condition that involves the agent against which there is
an immune response. An immunogenically effective amount is capable
of conferring protective immunity to the subject.
[0269] As used herein in the specification and in the claims
section that follows, the term polypeptide or peptide refer to a
stretch of amino acids covalently linked there amongst via peptide
bonds. Different polypeptides have different functionalities
according to the present disclosure. While according to one aspect,
a polypeptide is derived from an immunogen designed to induce an
active immune response in a recipient, according to another aspect
of the disclosure, a polypeptide is derived from an antibody which
results following the elicitation of an active immune response in,
for example, an animal, and which can serve to induce a passive
immune response in the recipient. In both cases, however, the
polypeptide is encoded by a polynucleotide according to any
possible codon usage.
[0270] As used herein the phrase "immune response" or its
equivalent "immunological response" refers to the development of a
humoral (antibody mediated), cellular (mediated by antigen-specific
T cells or their secretion products) or both humoral and cellular
response directed against a protein, peptide, carbohydrate, or
polypeptide of the disclosure in a recipient subject. Such a
response can be an active response induced by administration of
immunogen or a passive response induced by administration of
antibody, antibody containing material, or primed T-cells. A
cellular immune response is elicited by the presentation of
polypeptide epitopes in association with Class I or Class II MHC
molecules, to activate antigen-specific CD4 (+) T helper cells
and/or CD8 (+) cytotoxic T cells. The response may also involve
activation of monocytes, macrophages, NK cells, basophils,
dendritic cells, astrocytes, microglia cells, eosinophils, or other
components of innate immunity. As used herein "active immunity"
refers to any immunity conferred upon a subject by administration
of an antigen.
[0271] As used herein "passive immunity" refers to any immunity
conferred upon a subject without administration of an antigen to
the subject. "Passive immunity" therefore includes, but is not
limited to, administration of activated immune effectors including
cellular mediators or protein mediators (e.g., monoclonal and/or
polyclonal antibodies) of an immune response. A monoclonal or
polyclonal antibody composition may be used in passive immunization
for the prevention or treatment of infection by organisms that
carry the antigen recognized by the antibody. An antibody
composition may include antibodies that bind to a variety of
antigens that may in turn be associated with various organisms. The
antibody component can be a polyclonal antiserum. In certain
aspects the antibody or antibodies are affinity purified from an
animal or second subject that has been challenged with an
antigen(s). Alternatively, an antibody mixture may be used, which
is a mixture of monoclonal and/or polyclonal antibodies to antigens
present in the same, related, or different microbes or organisms,
such as gram-positive bacteria, gram-negative bacteria, including
but not limited to staphylococcus bacteria.
[0272] Passive immunity may be imparted to a patient or subject by
administering to the patient immunoglobulins (Ig) and/or other
immune factors obtained from a donor or other non-patient source
having a known immunoreactivity. In other aspects, an antigenic
composition of the present disclosure can be administered to a
subject who then acts as a source or donor for globulin, produced
in response to challenge with the antigenic composition
("hyperimmune globulin") that contains antibodies directed against
Staphylococcus or other organism. A subject thus treated would
donate plasma from which hyperimmune globulin would then be
obtained, via conventional plasma-fractionation methodology, and
administered to another subject in order to impart resistance
against or to treat staphylococcus infection. Hyperimmune globulins
according to the disclosure are particularly useful for
immune-compromised individuals, for individuals undergoing invasive
procedures or where time does not permit the individual to produce
their own antibodies in response to vaccination. See U.S. Pat. Nos.
6,936,258, 6,770,278, 6,756,361, 5,548,066, 5,512,282, 4,338,298,
and 4,748,018, each of which is incorporated herein by reference in
its entirety, for exemplary methods and compositions related to
passive immunity.
[0273] For purposes of this specification and the accompanying
claims the terms "epitope" and "antigenic determinant" are used
interchangeably to refer to a site on an antigen to which B and/or
T cells respond or recognize. B-cell epitopes can be formed both
from contiguous amino acids or noncontiguous amino acids juxtaposed
by tertiary folding of a protein. Epitopes formed from contiguous
amino acids are typically retained on exposure to denaturing
solvents whereas epitopes formed by tertiary folding are typically
lost on treatment with denaturing solvents. An epitope typically
includes at least 3, and more usually, at least 5 or 8-10 amino
acids in a unique spatial conformation. Methods of determining
spatial conformation of epitopes include, for example, x-ray
crystallography and 2-dimensional nuclear magnetic resonance. See,
e.g., Epitope Mapping Protocols (1996). Antibodies that recognize
the same epitope can be identified in a simple immunoassay showing
the ability of one antibody to block the binding of another
antibody to a target antigen. T-cells recognize continuous epitopes
of about nine amino acids for CD8 cells or about 13-15 amino acids
for CD4 cells. T cells that recognize the epitope can be identified
by in vitro assays that measure antigen-dependent proliferation, as
determined by .sup.3H-thymidine incorporation by primed T cells in
response to an epitope (Burke et al., 1994), by antigen-dependent
killing (cytotoxic T lymphocyte assay, Tigges et al., 1996) or by
cytokine secretion.
[0274] The presence of a cell-mediated immunological response can
be determined by proliferation assays (CD4 (+) T cells) or CTL
(cytotoxic T lymphocyte) assays. The relative contributions of
humoral and cellular responses to the protective or therapeutic
effect of an immunogen can be distinguished by separately isolating
IgG and T-cells from an immunized syngeneic animal and measuring
protective or therapeutic effect in a second subject.
[0275] As used herein and in the claims, the terms "antibody" or
"immunoglobulin" are used interchangeably and refer to any of
several classes of structurally related proteins that function as
part of the immune response of an animal or recipient, which
proteins include IgG, IgD, IgE, IgA, IgM and related proteins.
[0276] Under normal physiological conditions antibodies are found
in plasma and other body fluids and in the membrane of certain
cells and are produced by lymphocytes of the type denoted B cells
or their functional equivalent. Antibodies of the IgG class are
made up of four polypeptide chains linked together by disulfide
bonds. The four chains of intact IgG molecules are two identical
heavy chains referred to as H-chains and two identical light chains
referred to as L-chains.
[0277] In order to produce polyclonal antibodies, a host, such as a
rabbit or goat, is immunized with the antigen or antigen fragment,
generally with an adjuvant and, if necessary, coupled to a carrier.
Antibodies to the antigen are subsequently collected from the sera
of the host. The polyclonal antibody can be affinity purified
against the antigen rendering it monospecific.
[0278] Monoclonal antibodies can be produced by hyperimmunization
of an appropriate donor with the antigen or ex-vivo by use of
primary cultures of splenic cells or cell lines derived from spleen
(Anavi, 1998; Huston et al., 1991; Johnson et al., 1991; Mernaugh
et al., 1995).
[0279] As used herein and in the claims, the phrase "an
immunological portion of an antibody" includes a Fab fragment of an
antibody, a Fv fragment of an antibody, a heavy chain of an
antibody, a light chain of an antibody, a heterodimer consisting of
a heavy chain and a light chain of an antibody, a variable fragment
of a light chain of an antibody, a variable fragment of a heavy
chain of an antibody, and a single chain variant of an antibody,
which is also known as scFv. In addition, the term includes
chimeric immunoglobulins which are the expression products of fused
genes derived from different species, one of the species can be a
human, in which case a chimeric immunoglobulin is said to be
humanized. Typically, an immunological portion of an antibody
competes with the intact antibody from which it was derived for
specific binding to an antigen.
[0280] Optionally, an antibody or preferably an immunological
portion of an antibody, can be chemically conjugated to, or
expressed as, a fusion protein with other proteins. For purposes of
this specification and the accompanying claims, all such fused
proteins are included in the definition of antibodies or an
immunological portion of an antibody.
[0281] As used herein the terms "immunogenic agent" or "immunogen"
or "antigen" are used interchangeably to describe a molecule
capable of inducing an immunological response against itself on
administration to a recipient, either alone, in conjunction with an
adjuvant, or presented on a display vehicle.
V. METHODS OF TREATMENT
[0282] As discussed above, the compositions and methods of using
these compositions can treat a subject (e.g., limiting bacterial
load or abscess formation or persistence) having, suspected of
having, or at risk of developing an infection or related disease,
particularly those related to Staphylococci. One use of the
compositions is to prevent nosocomial infections by inoculating a
subject prior to hospital treatment.
[0283] As used herein the phrase "immune response" or its
equivalent "immunological response" refers to a humoral (antibody
mediated), cellular (mediated by antigen-specific T cells or their
secretion products) or both humoral and cellular response directed
against a protein, peptide, or polypeptide of the disclosure in a
recipient subject. Treatment or therapy can be an active immune
response induced by administration of immunogen or a passive
therapy effected by administration of antibody, antibody containing
material, or primed T-cells.
[0284] As used herein "passive immunity" refers to any immunity
conferred upon a subject by administration of immune effectors
including cellular mediators or protein mediators (e.g., a
polypeptide that binds to Coa protein). An antibody composition may
be used in passive immunization for the prevention or treatment of
infection by organisms that carry the antigen recognized by the
antibody. An antibody composition may include antibodies or
polypeptides comprising antibody CDR domains that bind to a variety
of antigens that may in turn be associated with various organisms.
The antibody component can be a polyclonal antiserum. In certain
aspects the antibody or antibodies are affinity purified from an
animal or second subject that has been challenged with an
antigen(s). Alternatively, an antibody mixture may be used, which
is a mixture of monoclonal and/or polyclonal antibodies to antigens
present in the same, related, or different microbes or organisms,
such as gram-positive bacteria, gram-negative bacteria, including
but not limited to staphylococcus bacteria.
[0285] Passive immunity may be imparted to a patient or subject by
administering to the subject immunoglobulins (Ig) or fragments
thereof and/or other immune factors obtained from a donor or other
non-patient source having a known immunoreactivity. In other
aspects, an antigenic composition can be administered to a subject
who then acts as a source or donor for globulin, produced in
response to challenge from the composition ("hyperimmune
globulin"), that contains antibodies directed against
Staphylococcus or other organism. A subject thus treated would
donate plasma from which hyperimmune globulin would then be
obtained, via conventional plasma-fractionation methodology, and
administered to another subject in order to impart resistance
against or to treat staphylococcus infection. Hyperimmune globulins
are particularly useful for immune-compromised individuals, for
individuals undergoing invasive procedures or where time does not
permit the individual to produce their own antibodies in response
to vaccination. See U.S. Pat. Nos. 6,936,258, 6,770,278, 6,756,361,
5,548,066, 5,512,282, 4,338,298, and 4,748,018, each of which is
incorporated herein by reference in its entirety, for exemplary
methods and compositions related to passive immunity.
[0286] For purposes of this specification and the accompanying
claims the terms "epitope" and "antigenic determinant" are used
interchangeably to refer to a site on an antigen to which B and/or
T cells respond or recognize. B-cell epitopes can be formed both
from contiguous amino acids or noncontiguous amino acids juxtaposed
by tertiary folding of a protein. Epitopes formed from contiguous
amino acids are typically retained on exposure to denaturing
solvents whereas epitopes formed by tertiary folding are typically
lost on treatment with denaturing solvents. An epitope typically
includes at least 3, and more usually, at least 5 or 8-10 amino
acids in a unique spatial conformation. Methods of determining
spatial conformation of epitopes include those methods described in
Epitope Mapping Protocols (1996). T cells recognize continuous
epitopes of about nine amino acids for CD8 cells or about 13-15
amino acids for CD4 cells. T cells that recognize the epitope can
be identified by in vitro assays that measure antigen-dependent
proliferation, as determined by .sup.3H-thymidine incorporation by
primed T cells in response to an epitope (Burke et al., 1994), by
antigen-dependent killing (cytotoxic T lymphocyte assay, Tigges et
al., 1996) or by cytokine secretion.
[0287] The presence of a cell-mediated immunological response can
be determined by proliferation assays (CD4 (+) T cells) or CTL
(cytotoxic T lymphocyte) assays. The relative contributions of
humoral and cellular responses to the protective or therapeutic
effect of an immunogen can be distinguished by separately isolating
IgG and T-cells from an immunized syngeneic animal and measuring
protective or therapeutic effect in a second subject. As used
herein and in the claims, the terms "antibody" or "immunoglobulin"
are used interchangeably.
[0288] Optionally, an antibody or preferably an immunological
portion of an antibody, can be chemically conjugated to, or
expressed as, a fusion protein with other proteins. For purposes of
this specification and the accompanying claims, all such fused
proteins are included in the definition of antibodies or an
immunological portion of an antibody.
[0289] In one embodiment a method includes treatment for a disease
or condition caused by a staphylococcus pathogen. In certain
aspects embodiments include methods of treatment of Staphylococcal
infection, such as hospital acquired nosocomial infections. In some
embodiments, the treatment is administered in the presence of
Staphylococcal antigens. Furthermore, in some examples, treatment
comprises administration of other agents commonly used against
bacterial infection, such as one or more antibiotics.
[0290] A method of the present disclosure includes treatment for a
disease or condition caused by a staphylococcus pathogen. An
immunogenic polypeptide of the disclosure can be given to induce an
immune response in a person infected with staphylococcus or
suspected of having been exposed to staphylococcus. Methods may be
employed with respect to individuals who have tested positive for
exposure to staphylococcus or who are deemed to be at risk for
infection based on possible exposure.
[0291] In particular, the disclosure encompasses a method of
treatment for Staphylococcal infection, particularly hospital
acquired nosocomial infections. The immunogenic compositions and
vaccines of the disclosure are particularly advantageous to use in
cases of elective surgery. Such patients will know the date of
surgery in advance and could be inoculated in advance. The
immunogenic compositions and vaccines of the disclosure are also
advantageous to use to inoculate health care workers.
[0292] In some embodiments, the treatment is administered in the
presence of adjuvants or carriers or other Staphylococcal antigens.
Furthermore, in some examples, treatment comprises administration
of other agents commonly used against bacterial infection, such as
one or more antibiotics.
[0293] The use of peptides for vaccination can require, but not
necessarily, conjugation of the peptide to an immunogenic carrier
protein, such as hepatitis B surface antigen, keyhole limpet
hemocyanin, or bovine serum albumin. Methods for performing this
conjugation are well known in the art.
[0294] The therapeutic compositions are administered in a manner
compatible with the dosage formulation, and in such amount as will
be therapeutically effective. The quantity to be administered
depends on the subject to be treated. Precise amounts of active
ingredient required to be administered depend on the judgment of
the practitioner. Suitable regimes for initial administration and
boosters are also variable, but are typified by an initial
administration followed by subsequent administrations.
[0295] The manner of application may be varied widely. Any of the
conventional methods for administration of a polypeptide
therapeutic are applicable. These are believed to include oral
application on a solid physiologically acceptable base or in a
physiologically acceptable dispersion, parenterally, by injection
and the like. The dosage of the composition will depend on the
route of administration and will vary according to the size and
health of the subject.
[0296] In certain instances, it will be desirable to have multiple
administrations of the composition, e.g., 2, 3, 4, 5, 6 or more
administrations. The administrations can be at 1, 2, 3, 4, 5, 6, 7,
8, to 5, 6, 7, 8, 9, 10, 11, 12 twelve week intervals, including
all ranges there between.
A. Antibodies And Passive Immunization
[0297] Certain aspects are directed to methods of preparing an
antibody for use in prevention or treatment of Staphylococcal
infection comprising the steps of immunizing a recipient with a
vaccine and isolating antibody from the recipient, or producing a
recombinant antibody. An antibody prepared by these methods and
used to treat or prevent a Staphylococcal infection is a further
aspect. A pharmaceutical composition comprising antibodies that
specifically bind Coa and a pharmaceutically acceptable carrier is
a further aspect that could be used in the manufacture of a
medicament for the treatment or prevention of Staphylococcal
disease. A method for treatment or prevention of Staphylococcal
infection comprising a step of administering to a subject an
effective amount of the pharmaceutical preparation is a further
aspect.
[0298] Inocula for polyclonal antibody production are typically
prepared by dispersing the antigenic composition (e.g., a peptide
or antigen or epitope of Coa or a consensus thereof) in a
physiologically tolerable diluent such as saline or other adjuvants
suitable for human use to form an aqueous composition. An
immunostimulatory amount of inoculum is administered to a mammal
and the inoculated mammal is then maintained for a time sufficient
for the antigenic composition to induce protective antibodies. The
antibodies can be isolated to the extent desired by well known
techniques such as affinity chromatography (Harlow and Lane,
Antibodies: A Laboratory Manual 1988). Antibodies can include
antiserum preparations from a variety of commonly used animals
e.g., goats, primates, donkeys, swine, horses, guinea pigs, rats or
man. The animals are bled and serum recovered.
[0299] An antibody can include whole antibodies, antibody fragments
or subfragments. Antibodies can be whole immunoglobulins of any
class (e.g., IgG, IgM, IgA, IgD or IgE), chimeric antibodies, human
antibodies, humanized antibodies, or hybrid antibodies with dual
specificity to two or more antigens. They may also be fragments
(e.g., F(ab')2, Fab', Fab, Fv and the like including hybrid
fragments). An antibody also includes natural, synthetic or
genetically engineered proteins that act like an antibody by
binding to specific antigens with a sufficient affinity.
[0300] A vaccine can be administered to a recipient who then acts
as a source of antibodies, produced in response to challenge from
the specific vaccine. A subject thus treated would donate plasma
from which antibody would be obtained via conventional plasma
fractionation methodology. The isolated antibody would be
administered to the same or different subject in order to impart
resistance against or treat Staphylococcal infection. Antibodies
are particularly useful for treatment or prevention of
Staphylococcal disease in infants, immune compromised individuals
or where treatment is required and there is no time for the
individual to produce a response to vaccination.
[0301] An additional aspect is a pharmaceutical composition
comprising two of more antibodies or monoclonal antibodies (or
fragments thereof, preferably human or humanized) reactive against
at least two constituents of the immunogenic composition, which
could be used to treat or prevent infection by Gram positive
bacteria, preferably Staphylococci, more preferably S. aureus or S.
epidermidis.
B. Combination Therapy
[0302] The compositions and related methods, particularly
administration of an antibody that binds Coa or a peptide or
consensus peptide thereof to a patient/subject, may also be used in
combination with the administration of traditional therapies. These
include, but are not limited to, the administration of antibiotics
such as streptomycin, ciprofloxacin, doxycycline, gentamycin,
chloramphenicol, trimethoprim, sulfamethoxazole, ampicillin,
tetracycline or various combinations of antibiotics.
[0303] In one aspect, it is contemplated that a therapy is used in
conjunction with antibacterial treatment. Alternatively, the
therapy may precede or follow the other agent treatment by
intervals ranging from minutes to weeks. In embodiments where the
other agents and/or a proteins or polynucleotides are administered
separately, one would generally ensure that a significant period of
time did not expire between the time of each delivery, such that
the therapeutic composition would still be able to exert an
advantageously combined effect on the subject. In such instances,
it is contemplated that one may administer both modalities within
about 12-24 h of each other and, more preferably, within about 6-12
h of each other. In some situations, it may be desirable to extend
the time period for administration significantly, however, where
several days (2, 3, 4, 5, 6 or 7) to several weeks (1, 2, 3, 4, 5,
6, 7 or 8) lapse between the respective administrations.
[0304] Various combinations of therapy may be employed, for example
antibiotic therapy is "A" and an antibody therapy that comprises an
antibody that binds Coa or a peptide or consensus peptide thereof
is "B":
TABLE-US-00003 A/B/A B/A/B B/B/A A/A/B A/B/B B/A/A A/B/B/B B/A/B/B
B/B/B/A B/B/A/B A/A/B/B A/B/A/B A/B/B/A B/B/A/A B/A/B/A B/A/A/B
A/A/A/B B/A/A/A A/B/A/A A/A/B/A
[0305] Administration of the antibody compositions to a
patient/subject will follow general protocols for the
administration of such compounds, taking into account the toxicity,
if any, of the composition. It is expected that the treatment
cycles would be repeated as necessary. It is also contemplated that
various standard therapies, such as hydration, may be applied in
combination with the described therapy.
C. Vaccines
[0306] The present disclosure includes methods for preventing or
ameliorating Staphylococcal infections, particularly hospital
acquired nosocomial infections. As such, the disclosure
contemplates vaccines for use in both active and passive
immunization embodiments. Immunogenic compositions, proposed to be
suitable for use as a vaccine, may be prepared from immunogenic
coagulases or a fragment thereof or a variant thereof, e.g., one or
more coagulase R Domains. In other embodiments, coagulases, a
fragment thereof or a variant thereof, can be used in combination
with other secreted virulence proteins, surface proteins or
immunogenic fragments thereof. In certain aspects, antigenic
material is extensively dialyzed to remove undesired small
molecular weight molecules and/or lyophilized for more ready
formulation into a desired vehicle.
[0307] Other options for a protein/peptide-based vaccine involve
introducing nucleic acids encoding the antigen(s) as DNA vaccines.
In this regard, recent reports described construction of
recombinant vaccinia viruses expressing either 10 contiguous
minimal CTL epitopes (Thomson, 1996) or a combination of B cell,
cytotoxic T-lymphocyte (CTL), and T-helper (Th) epitopes from
several microbes (An, 1997), and successful use of such constructs
to immunize mice for priming protective immune responses. Thus,
there is ample evidence in the literature for successful
utilization of peptides, peptide-pulsed antigen presenting cells
(APCs), and peptide-encoding constructs for efficient in vivo
priming of protective immune responses. The use of nucleic acid
sequences as vaccines is exemplified in U.S. Pat. Nos. 5,958,895
and 5,620,896.
[0308] The preparation of vaccines that contain polypeptide or
peptide sequence(s) as active ingredients is generally well
understood in the art, as exemplified by U.S. Pat. Nos. 4,608,251;
4,601,903; 4,599,231; 4,599,230; 4,596,792; and 4,578,770, all of
which are incorporated herein by reference. Typically, such
vaccines are prepared as injectables either as liquid solutions or
suspensions: solid forms suitable for solution in or suspension in
liquid prior to injection may also be prepared. The preparation may
also be emulsified. The active immunogenic ingredient is often
mixed with excipients that are pharmaceutically acceptable and
compatible with the active ingredient. Suitable excipients are, for
example, water, saline, dextrose, glycerol, ethanol, or the like
and combinations thereof. In addition, if desired, the vaccine may
contain amounts of auxiliary substances such as wetting or
emulsifying agents, pH buffering agents, or adjuvants that enhance
the effectiveness of the vaccines. In specific embodiments,
vaccines are formulated with a combination of substances, as
described in U.S. Pat. Nos. 6,793,923 and 6,733,754, which are
incorporated herein by reference.
[0309] Vaccines may be conventionally administered parenterally, by
injection, for example, either subcutaneously or intramuscularly.
Additional formulations which are suitable for other modes of
administration include suppositories and, in some cases, oral
formulations. For suppositories, traditional binders and carriers
may include, for example, polyalkalene glycols or triglycerides:
such suppositories may be formed from mixtures containing the
active ingredient in the range of about 0.5% to about 10%,
preferably about 1% to about 2%. Oral formulations include such
normally employed excipients as, for example, pharmaceutical grades
of mannitol, lactose, starch, magnesium stearate, sodium
saccharine, cellulose, magnesium carbonate and the like. These
compositions take the form of solutions, suspensions, tablets,
pills, capsules, sustained release formulations or powders and
contain about 10% to about 95% of active ingredient, preferably
about 25% to about 70%.
[0310] The polypeptides and polypeptide-encoding DNA constructs may
be formulated into a vaccine as neutral or salt forms.
Pharmaceutically-acceptable salts include the acid addition salts
(formed with the free amino groups of the peptide) and those that
are formed with inorganic acids such as, for example, hydrochloric
or phosphoric acids, or such organic acids as acetic, oxalic,
tartaric, mandelic, and the like.
[0311] Typically, vaccines are administered in a manner compatible
with the dosage formulation, and in such amount as will be
therapeutically effective and immunogenic. The quantity to be
administered depends on the subject to be treated, including the
capacity of the individual's immune system to synthesize antibodies
and the degree of protection desired. Precise amounts of active
ingredient required to be administered depend on the judgment of
the practitioner. However, suitable dosage ranges are of the order
of several hundred micrograms of active ingredient per vaccination.
Suitable regimes for initial administration and booster shots are
also variable, but are typified by an initial administration
followed by subsequent inoculations or other administrations.
[0312] The manner of application may be varied widely. Any of the
conventional methods for administration of a vaccine are
applicable. These are believed to include oral application within a
solid physiologically acceptable base or in a physiologically
acceptable dispersion, parenterally, by injection and the like. The
dosage of the vaccine will depend on the route of administration
and will vary according to the size and health of the subject.
[0313] In certain instances, it will be desirable to have multiple
administrations of the vaccine, e.g., 2, 3, 4, 5, 6 or more
administrations. The vaccinations can be at 1, 2, 3, 4, 5, 6, 7, 8,
to 5, 6, 7, 8, 9, 10, 11, 12 twelve week intervals, including all
ranges there between. Periodic boosters at intervals of 1-5 years
will be desirable to maintain protective levels of the antibodies.
The course of the immunization may be followed by assays for
antibodies against the antigens, as described in U.S. Pat. Nos.
3,791,932; 4,174,384 and 3,949,064.
[0314] 1. Carriers
[0315] A given composition may vary in its immunogenicity. It is
often necessary therefore to boost the host immune system, as may
be achieved by coupling a peptide or polypeptide to a carrier.
Exemplary and preferred carriers are keyhole limpet hemocyanin
(KLH) and bovine serum albumin (BSA). Other albumins such as
ovalbumin, mouse serum albumin, or rabbit serum albumin can also be
used as carriers. Means for conjugating a polypeptide to a carrier
protein are well known in the art and include glutaraldehyde,
m-maleimidobencoyl-N-hydroxysuccinimide ester, carbodiimyde, and
bis-biazotized benzidine.
[0316] 2. Adjuvants
[0317] The immunogenicity of polypeptide or peptide compositions
can be enhanced by the use of non-specific stimulators of the
immune response, known as adjuvants. Suitable adjuvants include all
acceptable immunostimulatory compounds, such as cytokines, toxins,
or synthetic compositions. A number of adjuvants can be used to
enhance an antibody response against a coagulase and or its
variant, such as one or more coagulase Domains 1-2, or any other
bacterial protein or combination contemplated herein. Adjuvants can
(1) trap the antigen in the body to cause a slow release; (2)
attract cells involved in the immune response to the site of
administration; (3) induce proliferation or activation of immune
system cells; or (4) improve the spread of the antigen throughout
the subject's body.
[0318] Adjuvants include, but are not limited to, oil-in-water
emulsions, water-in-oil emulsions, mineral salts, polynucleotides,
and natural substances. Specific adjuvants that may be used include
IL-1, IL-2, IL-4, IL-7, IL-12, Q-interferon, GMCSP, BCG, aluminum
salts, such as aluminum hydroxide or other aluminum compound, MDP
compounds, such as thur-MDP and nor-MDP, CGP (MTP-PE), lipid A, and
monophosphoryl lipid A (MPL). RIBI, which contains three components
extracted from bacteria, MPL, trehalose dimycolate (TDM), and cell
wall skeleton (CWS) in a 2% squalene/Tween 80 emulsion. MHC
antigens may even be used. Others adjuvants or methods are
exemplified in U.S. Pat. Nos. 6,814,971, 5,084,269, 6,656,462, each
of which is incorporated herein by reference).
[0319] Various methods of achieving adjuvant affect for the vaccine
includes use of agents such as aluminum hydroxide or phosphate
(alum), commonly used as about 0.05 to about 0.1% solution in
phosphate buffered saline, admixture with synthetic polymers of
sugars (Carbopol.RTM.) used as an about 0.25% solution, aggregation
of the protein in the vaccine by heat treatment with temperatures
ranging between about 700 to about 101.degree. C. for a 30-second
to 2-minute period, respectively. Aggregation by reactivating with
pepsin-treated (Fab) antibodies to albumin; mixture with bacterial
cells (e.g., C. parvum), endotoxins or lipopolysaccharide
components of Gram-negative bacteria; emulsion in physiologically
acceptable oil vehicles (e.g., mannide mono-oleate (Aracel A)); or
emulsion with a 20% solution of a perfluorocarbon (Fluosol-DA.RTM.)
used as a block substitute may also be employed to produce an
adjuvant effect.
[0320] Examples of and often preferred adjuvants include complete
Freund's adjuvant (a non-specific stimulator of the immune response
containing killed Mycobacterium tuberculosis), incomplete Freund's
adjuvants, and aluminum hydroxide.
[0321] In some aspects, it is preferred that the adjuvant be
selected to be a preferential inducer of either a Th1 or a Th2 type
of response. High levels of Th1-type cytokines tend to favor the
induction of cell mediated immune responses to a given antigen,
while high levels of Th2-type cytokines tend to favor the induction
of humoral immune responses to the antigen.
[0322] The distinction of Th1 and Th2-type immune response is not
absolute. In reality an individual will support an immune response
which is described as being predominantly Th1 or predominantly Th2.
However, it is often convenient to consider the families of
cytokines in terms of that described in murine CD4+ T cell clones
by Mosmann and Coffman (Mosmann, and Coffman, 1989). Traditionally,
Th1-type responses are associated with the production of the INF-7
and IL-2 cytokines by T-lymphocytes. Other cytokines often directly
associated with the induction of Th1-type immune responses are not
produced by T-cells, such as IL-12. In contrast, Th2-type responses
are associated with the secretion of IL-4, IL-5, IL-6, IL-10.
[0323] In addition to adjuvants, it may be desirable to
co-administer biologic response modifiers (BRM) to enhance immune
responses. BRMs have been shown to upregulate T cell immunity or
downregulate suppresser cell activity. Such BRMs include, but are
not limited to, Cimetidine (CIM; 1200 mg/d) (Smith/Kline, PA); or
low-dose Cyclophosphamide (CYP; 300 mg/m.sup.2) (Johnson/Mead, NJ)
and cytokines such as .quadrature.-interferon, IL-2, or IL-12 or
genes encoding proteins involved in immune helper functions, such
as B-7.
D. Lipid Components and Moieties
[0324] In certain embodiments, the present disclosure concerns
compositions comprising one or more lipids associated with a
nucleic acid or a polypeptide/peptide. A lipid is a substance that
is insoluble in water and extractable with an organic solvent.
Compounds other than those specifically described herein are
understood by one of skill in the art as lipids, and are
encompassed by the compositions and methods of the present
disclosure. A lipid component and a non-lipid may be attached to
one another, either covalently or non-covalently.
[0325] A lipid may be a naturally occurring lipid or a synthetic
lipid. However, a lipid is usually a biological substance.
Biological lipids are well known in the art, and include for
example, neutral fats, phospholipids, phosphoglycerides, steroids,
terpenes, lysolipids, glycosphingolipids, glucolipids, sulphatides,
lipids with ether and ester-linked fatty acids and polymerizable
lipids, and combinations thereof.
[0326] A nucleic acid molecule or a polypeptide/peptide, associated
with a lipid may be dispersed in a solution containing a lipid,
dissolved with a lipid, emulsified with a lipid, mixed with a
lipid, combined with a lipid, covalently bonded to a lipid,
contained as a suspension in a lipid or otherwise associated with a
lipid. A lipid or lipid-poxvirus-associated composition of the
present disclosure is not limited to any particular structure. For
example, they may also simply be interspersed in a solution,
possibly forming aggregates which are not uniform in either size or
shape. In another example, they may be present in a bilayer
structure, as micelles, or with a "collapsed" structure. In another
non-limiting example, a lipofectamine (Gibco BRL)-poxvirus or
Superfect (Qiagen)-poxvirus complex is also contemplated.
[0327] In certain embodiments, a composition may comprise about 1%,
about 2%, about 3%, about 4% about 5%, about 6%, about 7%, about
8%, about 9%, about 10%, about 11%, about 12%, about 13%, about
14%, about 15%, about 16%, about 17%, about 18%, about 19%, about
20%, about 21%, about 22%, about 23%, about 24%, about 25%, about
26%, about 27%, about 28%, about 29%, about 30%, about 31%, about
32%, about 33%, about 34%, about 35%, about 36%, about 37%, about
38%, about 39%, about 40%, about 41%, about 42%, about 43%, about
44%, about 45%, about 46%, about 47%, about 48%, about 49%, about
50%, about 51%, about 52%, about 53%, about 54%, about 55%, about
56%, about 57%, about 58%, about 59%, about 60%, about 61%, about
62%, about 63%, about 64%, about 65%, about 66%, about 67%, about
68%, about 69%, about 70%, about 71%, about 72%, about 73%, about
74%, about 75%, about 76%, about 77%, about 78%, about 79%, about
80%, about 81%, about 82%, about 83%, about 84%, about 85%, about
86%, about 87%, about 88%, about 89%, about 90%, about 91%, about
92%, about 93%, about 94%, about 95%, about 96%, about 97%, about
98%, about 99%, or any range therebetween, of a particular lipid,
lipid type, or non-lipid component such as an adjuvant, antigen,
peptide, polypeptide, sugar, nucleic acid or other material
disclosed herein or as would be known to one of skill in the art.
In a non-limiting example, a composition may comprise about 10% to
about 20% neutral lipids, and about 33% to about 34% of a
cerebroside, and about 1% cholesterol. In another non-limiting
example, a liposome may comprise about 4% to about 12% terpenes,
wherein about 1% of the micelle is specifically lycopene, leaving
about 3% to about 11% of the liposome as comprising other terpenes;
and about 10% to about 35% phosphatidyl choline, and about 1% of a
non-lipid component. Thus, it is contemplated that compositions of
the present disclosure may comprise any of the lipids, lipid types
or other components in any combination or percentage range.
E. General Pharmaceutical Compositions
[0328] In some embodiments, pharmaceutical compositions are
administered to a subject. Different aspects may involve
administering an effective amount of a composition to a subject. In
some embodiments, an antibody that binds Coa or a peptide or
consensus peptide thereof may be administered to the subject to
protect against or treat infection by one or more bacteria from the
Staphylococcus genus. Alternatively, an expression vector encoding
one or more such antibodies or polypeptides or peptides may be
given to a subject as a preventative treatment. Additionally, such
compositions can be administered in combination with an antibiotic.
Such compositions will generally be dissolved or dispersed in a
pharmaceutically acceptable carrier or aqueous medium.
[0329] The phrases "pharmaceutically acceptable" or
"pharmacologically acceptable" refer to molecular entities and
compositions that do not produce an adverse, allergic, or other
untoward reaction when administered to an animal or human. As used
herein, "pharmaceutically acceptable carrier" includes any and all
solvents, dispersion media, coatings, antibacterial and antifungal
agents, isotonic and absorption delaying agents, and the like. The
use of such media and agents for pharmaceutical active substances
is well known in the art. Except insofar as any conventional media
or agent is incompatible with the active ingredients, its use in
immunogenic and therapeutic compositions is contemplated.
Supplementary active ingredients, such as other anti-infective
agents and vaccines, can also be incorporated into the
compositions.
[0330] The active compounds can be formulated for parenteral
administration, e.g., formulated for injection via the intravenous,
intramuscular, sub-cutaneous, or even intraperitoneal routes.
Typically, such compositions can be prepared as either liquid
solutions or suspensions; solid forms suitable for use to prepare
solutions or suspensions upon the addition of a liquid prior to
injection can also be prepared; and, the preparations can also be
emulsified.
[0331] The pharmaceutical forms suitable for injectable use include
sterile aqueous solutions or dispersions; formulations including
sesame oil, peanut oil, or aqueous propylene glycol; and sterile
powders for the extemporaneous preparation of sterile injectable
solutions or dispersions. In all cases the form must be sterile and
must be fluid to the extent that it may be easily injected. It also
should be stable under the conditions of manufacture and storage
and must be preserved against the contaminating action of
microorganisms, such as bacteria and fungi.
[0332] The proteinaceous compositions may be formulated into a
neutral or salt form. Pharmaceutically acceptable salts, include
the acid addition salts (formed with the free amino groups of the
protein) and which are formed with inorganic acids such as, for
example, hydrochloric or phosphoric acids, or such organic acids as
acetic, oxalic, tartaric, mandelic, and the like. Salts formed with
the free carboxyl groups can also be derived from inorganic bases
such as, for example, sodium, potassium, ammonium, calcium, or
ferric hydroxides, and such organic bases as isopropylamine,
trimethylamine, histidine, procaine and the like.
[0333] A pharmaceutical composition can include a solvent or
dispersion medium containing, for example, water, ethanol, polyol
(for example, glycerol, propylene glycol, and liquid polyethylene
glycol, and the like), suitable mixtures thereof, and vegetable
oils. The proper fluidity can be maintained, for example, by the
use of a coating, such as lecithin, by the maintenance of the
required particle size in the case of dispersion, and by the use of
surfactants. The prevention of the action of microorganisms can be
brought about by various antibacterial and antifungal agents, for
example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal,
and the like. In many cases, it will be preferable to include
isotonic agents, for example, sugars or sodium chloride. Prolonged
absorption of the injectable compositions can be brought about by
the use in the compositions of agents delaying absorption, for
example, aluminum monostearate and gelatin.
[0334] Sterile injectable solutions are prepared by incorporating
the active compounds in the required amount in the appropriate
solvent with various other ingredients enumerated above, as
required, followed by filtered sterilization or an equivalent
procedure. Generally, dispersions are prepared by incorporating the
various sterilized active ingredients into a sterile vehicle which
contains the basic dispersion medium and the required other
ingredients from those enumerated above. In the case of sterile
powders for the preparation of sterile injectable solutions, the
preferred methods of preparation are vacuum-drying and
freeze-drying techniques, which yield a powder of the active
ingredient, plus any additional desired ingredient from a
previously sterile-filtered solution thereof.
[0335] Administration of the compositions will typically be via any
common route. This includes, but is not limited to oral, nasal, or
buccal administration. Alternatively, administration may be by
orthotopic, intradermal, subcutaneous, intramuscular,
intraperitoneal, intranasal, or intravenous injection. In certain
embodiments, a vaccine composition may be inhaled (e.g., U.S. Pat.
No. 6,651,655, which is specifically incorporated by reference).
Such compositions would normally be administered as
pharmaceutically acceptable compositions that include
physiologically acceptable carriers, buffers or other
excipients.
[0336] An effective amount of therapeutic or prophylactic
composition is determined based on the intended goal. The term
"unit dose" or "dosage" refers to physically discrete units
suitable for use in a subject, each unit containing a predetermined
quantity of the composition calculated to produce the desired
responses discussed above in association with its administration,
i.e., the appropriate route and regimen. The quantity to be
administered, both according to number of treatments and unit dose,
depends on the protection desired.
[0337] Precise amounts of the composition also depend on the
judgment of the practitioner and are peculiar to each individual.
Factors affecting dose include physical and clinical state of the
subject, route of administration, intended goal of treatment
(alleviation of symptoms versus cure), and potency, stability, and
toxicity of the particular composition.
[0338] Upon formulation, solutions will be administered in a manner
compatible with the dosage formulation and in such amount as is
therapeutically or prophylactically effective. The formulations are
easily administered in a variety of dosage forms, such as the type
of injectable solutions described above.
F. In Vitro, Ex Vivo, or In Vivo Administration
[0339] As used herein, the term in vitro administration refers to
manipulations performed on cells removed from or outside of a
subject, including, but not limited to cells in culture. The term
ex vivo administration refers to cells which have been manipulated
in vitro, and are subsequently administered to a subject. The term
in vivo administration includes all manipulations performed within
a subject.
[0340] In certain aspects of the present disclosure, the
compositions may be administered either in vitro, ex vivo, or in
vivo. In certain in vitro embodiments, autologous B-lymphocyte cell
lines are incubated with a virus vector of the instant disclosure
for 24 to 48 hours or with a coagulase Domains 1-2 and/or a variant
thereof and/or any other composition described herein for two
hours. The transduced cells can then be used for in vitro analysis,
or alternatively for ex vivo administration. U.S. Pat. Nos.
4,690,915 and 5,199,942, both incorporated herein by reference,
disclose methods for ex vivo manipulation of blood mononuclear
cells and bone marrow cells for use in therapeutic
applications.
VI. SEQUENCES
[0341] Amino acid sequences from 8 reference S. aureus strains are
provided in SEQ ID NOs: 1-8 as follows: USA300 (SEQ ID NO: 1), N315
(SEQ ID NO: 2), MW2 (SEQ ID NO: 3), MRSA252 (SEQ ID NO: 4), WIS
(SEQ ID NO: 5), MU50 (SEQ ID NO: 6), 85/2082 (SEQ ID NO: 7), and
Newman (SEQ ID NO: 8). Amino acid sequences from 17 Coa R Domains
from one of the dominant Coa taken from dominant S. aureus lineages
are provided as follows: ST5_1 (SEQ ID NO:22), ST5_2 (SEQ ID
NO:23), ST5_3 (SEQ ID NO:24), ST8_1 (SEQ ID NO:25), ST8_2 (SEQ ID
NO:26), ST22_1 (SEQ ID NO:24), ST22_2 (SEQ ID NO:28), ST22_3 (SEQ
ID NO:29), ST30_1 (SEQ ID NO:30), ST30_2 (SEQ ID NO:31), ST30_3
(SEQ ID NO:32), ST45_1 (SEQ ID NO:33), ST45_2 (SEQ ID NO:34),
ST45_3 (SEQ ID NO:35), ST239_1 (SEQ ID NO:36), ST239_2 (SEQ ID
NO:37), ST239_3 (SEQ ID NO:38).
TABLE-US-00004 Coa of S. aureus USA300 - SEQ ID NO: 1
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKNGTLIDSRYLNSAL
YYLEDYIIYAIGLTNKYEYGDNIYKEAKDRLLEKVLREDQYLLERKKSQYEDYKQW
YANYKKENPRTDLKMANFHKYNLEELSMKEYNELQDALKRALDDFHREVKDIKDK
NSDLKTFNAAEEDKATKEVYDLVSEIDTLVVSYYGDKDYGEHAKELRAKLDLILGD
TDNPHKITNERIKKEMIDDLNSIIDDFFMETKQNRPKSITKYNPTTHNYKTNSDNKPNF
DKLVEETKKAVKEADDSWKKKTVKKYGETETKSPVVKEEKKVEEPQAPKVDNQQE
VKTTAGKAEETTQPVAQPLVKIPQGTITGEIVKGPEYPTMENKTVQGEIVQGPDFLTM
EQSGPSLSNNYTNPPLTNPILEGLEGSSSKLEIKPQGTESTLKGTQGESSDIEVKPQATE
TTEASQYGPRPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVT
THANGQVSYGARPTQNKPSKTNAYNVTTHGNGQVSYGARPTQNKPSKTNAYNVTT
HANGQVSYGARPTYKKPSKTNAYNVTTHADGTATYGPRVTK Coa of S. aureus N315 -
SEQ ID NO: 2
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNEKSKKGATVSDYYYWKII
DSLEAQFTGAIDLLEDYKYGDPIYKEAKDRLMTRVLGEDQYLLKKKIDEYELYKKW
YKSSNKNTNMLTFHKYNLYNLTMNEYNDIFNSLKDAVYQFNKEVKEIEHKNVDLK
QFDKDGEDKATKEVYDLVSEIDTLVVTYYADKDYGEHAKELRAKLDLILGDTDNPH
KITNERIKKEMIDDLNSIIDDFFMETKQNRPNSITKYDPTKHNFKEKSENKPNFDKLVE
ETKKAVKEADESWKNKTVKKYEETVTKSPVVKEEKKVEEPQLPKVGNQQEVKTTA
GKAEETTQPVAQPLVKIPQETIYGETVKGPEYPTMENKTLQGEIVQGPDFLTMEQNR
PSLSDNYTQPTTPNPILEGLEGSSSKLEIKPQGTESTLKGIQGESSDIEVKPQATETTEA
SQYGPRPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTNQ
DGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQKKPSKTNAYNVTTHAN
GQVSYGARPTQKKPSKTNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTTHANG
QVSYGARPTQKKPSETNAYNVTTHADGTATYGPRVTK Coa of S. aureus MW2 - SEQ ID
NO: 3 MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKNGKQIADGYYWGI
IENLENQFYNIFHLLDQHKYAEKEYKDAVDKLKTRVLEEDQYLLERKKEKYEIYKEL
YKKYKKENPNTQVKMKAFDKYDLGDLTMEEYNDLSKLLTKALDNFKLEVKKIESE
NPDLKPYSESEERTAYGKIDSLVDQAYSVYFAYVTDAQHKTEALNLRAKIDLILGDE
KDPIRVTNQRTEKEMIKDLESIIDDFFIETKLNRPKHITRYDGTKHDYHKHKDGFDAL
VKETREAVAKADESWKNKTVKKYEETVTKSPVVKEEKKVEEPQSPKFDNQQEVKIT
VDKAEETTQPVAQPLVKIPQGTITGEIVKGPEYPTMENKTLQGEIVQGPDFPTMEQNR
PSLSDNYTQPTTPNPILEGLEGSSSKLEIKPQGTESTLKGTQGESSDIEVKPQASETTEA
SHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTNQ
DGTVTYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHAN
GQVSYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYKKPSKTNAYNVTTHADG TATYGPRVTK
Coa of S. aureus MRSA252 - SEQ ID NO: 4
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNENSKYDTPIPDWYLGSIL
NRLGDQIYYAKELTNKYEYGEKEYKQAIDKLMTRVLGEDHYLLEKKKAQYEAYKK
WFEKHKSENPHSSLKKIKFDDFDLYRLTKKEYNELHQSLKEAVDEFNSEVKNIQSKQ
KDLLPYDEATENRVTNGIYDFVCEIDTLYAAYFNHSQYGHNAKELRAKLDIILGDAK
DPVRITNERIRKEMMDDLNSIIDDFFMDTNMNRPLNITKFNPNIHDYTNKPENRDNFD
KLVKETREAIANADESWKTRTVKNYGESETKSPVVKEEKKVEEPQLPKVGNQQEDK
ITVGTTEEAPLPIAQPLVKIPQGTIQGEIVKGPEYLTMENKTLQGEIVQGPDFPTMEQN
RPSLSDNYTQPTTPNPILKGIEGNSTKLEIKPQGTESTLKGTQGESSDIEVKPQATETTE
ASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTN
QDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKPSETNAYNVTTHA
NGQVSYGARPTQNKPSKTNAYNVTTHADGTATYGPRVTK Coa of S. aureus WIS - SEQ
ID NO: 5 MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKNGKQIADGYYWGI
IENLENQFYNIFHLLDQHKYAEKEYKDALDKLKTRVLEEDQYLLERKKEKYEIYKEL
YKKYKKENPNTQVKMKAFDKYDLGDLTMEEYNDLSKLLTKALDNFKLEVKKIESE
NPDLRPYSESEERTAYGKIDSLVDQAYSVYFAYVTDAQHKTEALNLRAKIDLILGDE
KDPIRVTNQRTEKEMIKDLESIIDDFFIETKLNRPQHITRYDGTKHDYHKHKDGFDAL
VKETREAVSKADESWKTKTVKKYGETETKYPVVKEEKKVEEPQSPKVSEKVDVQET
VGTTEEAPLPIAQPLVKLPQIGTQGEIVKGPDYPTMENKTLQGVIVQGPDFPTMEQNR
PSLSDNYTQPSVTLPSITGESTPTNPILKGIEGNSSKLEIKPQGTESTLKGIQGESSDIEV
KPQATETTEASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSET
NAYNVTTNQDGTVSYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYNKPSETN
AYNVTTNRDGTVSYGARPTQNKPSETNAYNVTTHGNGQVSYGARPTQKKPSKTNA
YNVTTHANGQVSYGARPTYNKPSKTNAYNVTTHADGTATYGPRVTK Coa of S. aureus
MU50 - SEQ ID NO: 6
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNEKSKKGATVSDYYYWKII
DSLEAQFTGAIDLLEDYKYGDPIYKEAKDRLMTRVLGEDQYLLKKKIDEYELYKKW
YKSSNKNTNMLTFHKYNLYNLTMNEYNDIFNSLKDAVYQFNKEVKEIEHKNVDLK
QFDKDGEDKATKEVYDLVSEIDTLVVTYYADKDYGEHAKELRAKLDLILGDTDNPH
KITNERIKKEMIDDLNSIIDDFFMETKQNRPNSITKYDPTKHNFKEKSENKPNFDKLVE
ETKKAVKEADESWKNKTVKKYEETVTKSPVVKEEKKVEEPQLPKVGNQQEVKTTA
GKAEETTQPVAQPLVKIPQETIYGETVKGPEYPTMENKTLQGEIVQGPDFLTMEQNR
PSLSDNYTQPTTPNPILEGLEGSSSKLEIKPQGTESTLKGIQGESSDIEVKPQATETTEA
SQYGPRPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTNQ
DGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQKKPSKTNAYNVTTHAN
GQVSYGARPTQKKPSKTNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTTHANG
QVSYGARPTQKKPSETNAYNVTTHADGTATYGPRVTK Coa of S. aureus 85/2082 -
SEQ ID NO: 7
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNENSKYDTPIPDWYLGSIL
NRLGDQIYYAKELTNKYEYGEKEYKQAIDKLMTRVLGEDHYLLEKKKAQYEAYKK
WFEKHKSENPHSSLKKIKFDDFDLYRLTKKEYNELHQSLKEAVDEFNSEVKNIQSKQ
KDLLPYDEATENRVTNGIYDFVCEIDTLYAAYFNHSQYGHNAKELRAKLDIILGDAK
DPVRITNERIRKEMMDDLNSIIDDFFMDTNMNRPLNITKFNPNIHDYTNKPENRDNFD
KLVKETREAVANADESWKTRTVKNYGESETKSPVVKEEKKVEEPQLPKVGNQQED
KITVGTTEEAPLPIAQPLVKIPQGTIQGEIVKGPEYLTMENKTLQGEIVQGPDFPTMEQ
NRPSLSDNYTQPTTPNPILKGIEGNSTKLEIKPQGTESTLKGTQGESSDIEVKPQATETT
EASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTT
NQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTTN
QDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKPSETNAYNVTTHA
NGQVSYGARPTQNKPSKTNAYNVTTHADGTATYGPRVTK Coa of S. aureus Newman -
SEQ ID NO : 8
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKNGTLIDSRYLNSAL
YYLEDYIIYAIGLTNKYEYGDNIYKEAKDRLLEKVLREDQYLLERKKSQYEDYKQW
YANYKKENPRTDLKMANFHKYNLEELSMKEYNELQDALKRALDDFHREVKDIKDK
NSDLKTFNAAEEDKATKEVYDLVSEIDTLVVSYYGDKDYGEHAKELRAKLDLILGD
TDNPHKITNERIKKEMIDDLNSIIDDFFMETKQNRPKSITKYNPTTHNYKTNSDNKPNF
DKLVEETKKAVKEADDSWKKKTVKKYGETETKSPVVKEEKKVEEPQAPKVDNQQE
VKTTAGKAEETTQPVAQPLVKIPQGTITGEIVKGPEYPTMENKTVQGEIVQGPDFLTM
EQSGPSLSNNYTNPPLTNPILEGLEGSSSKLEIKPQGTESTLKGTQGESSDIEVKPQATE
TTEASQYGPRPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVT
THANGQVSYGARPTYKKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTT
HGNGQVSYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYKKPSKTNAYNVTTH
ADGTATYGPRVTK CoaST5_1 - SEQ ID NO: 22
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNEKSKKGATVSDYYYWKII
DSLEAQFTGAIDLLEDYKYGDPIYKEAKDRLMTRVLGEDQYLLKKKIDEYELYKKW
YKSSNKNTNMLTFHKYNLYNLTMNEYNDIFNSLKDAVYQFNKEVKEIEHKNVDLK
QFDKDGEDKATKEVYDLVSEIDTLVVTYYADKDYGEHAKELRAKLDLILGDTDNPH
KITNERIKKEMIDDLNSIIDDFFMETKQNRPNSITKYDPTKHNFKEKSENKPNFDKLVE
ETKKAVKEADESWKNKTVKKYEETVTKSPVVKEEKKVEEPQLPKVGNQQEVKTTA
GKAEETTQPVAQPLVKIPQETIYGETVKGPEYPTMENKTLQGEIVQGPDFLTMEQNR
PSLSDNYTQPTTPNPILEGLEGSSSKLEIKPQGTESTLKGIQGESSDIEVKPQATETTEA
SQYGPRPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTNQ
DGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQKKPSKTNAYNVTTHAN
GQVSYGARPTQKKPSKTNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTTHANG
QVSYGARLTQKKPSETNAYNVTTHADGTATYGPRVTK CoaST5_2 - SEQ ID NO: 23
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNEKSKKGATVSDYYYWKII
DSLEAQFTGAIDLLEDYKYGDPIYKEAKDRLMTRVLGEDQYLLKKKIDEYELYKKW
YKSSNKNTNMLTFHKYNLYNLTMNEYNDIFNSLKDAVYQFNKEVKEIEHKNVDLK
QFDKDGEDKATKEVYDLVSEIDTLVVTYYADKDYGEHAKELRAKLDLILGDTDNPH
KITNERIKKEMIDDLNSIIDDFFMETKQNRPNSITKYDPTKHNFKEKSENKPNFDKLVE
ETKKAVKEADESWKNKTVKKYEETVTKSPVVKEEKKVEEPQLPKVGNQQEVKTTA
GKAEETTQPVAQPLVKIPQETIYGETVKGPEYPTMENKTLQGEIVQGPDFLTMEQNR
PSLSDNYTQPTTPNPILEGLEGSSSKLEIKPQGTESTLKGIQGESSDIEVKPQATETTEA
SQYGPRPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTNQ
DGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQKKPSKTNAYNVTTHAN
GQVSYGARPTQKKPSKTNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTTHANG
QVSYGARPTQKKPSETNAYNVTTHADGTATYGPRVTK CoaST5_3 - SEQ ID NO: 24
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNEKSKKGATVSDYYYWKII
DSLEAQFTGAIDLLEDYKYGDPIYKEAKDRLMTRVLGEDQYLLKKKIDEYELYKKW
YKSSNKNTNMLTFHKYNLYNLTMNEYNDIFNSLKDAVYQFNKEVKEIEHKNVDLK
QFDKDGEDKATKEVYDLVSEIDTLVVTYYADKDYGEHAKELRAKLDLILGDTDNPH
KITNERIKKEMIDDLNSIIDDFFMETKQNRPNSITKYDPTKHNFKEKSENKPNFDKLVE
ETKKAVKEADESWKNKTVKKYEETVTKSPVVKEEKKVEEPQLPKVGNQQEVKTTA
GKAEETTQPVAQPLVKIPQETIYGETVKGPEYPTMENKTLQGEIVQGPDFLTMEQNR
PSLSDNYTQPTTPNPILEGLEGSSSKLEIKPQGTESTLKGIQGESSDIEVKPQATETTEA
SQYGPRPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTNQ
DGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTTHAN
GQVSYGARPTQKKPSKTNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTTHANG
QVSYGARPTQKKPSETNAYNVTTHADGTATYGPRVTK CoaST8_1 - SEQ ID NO: 25
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKNGTLIDSRYLNSAL
YYLEDYIIYAIGLTNKYEYGDNIYKEAKDRLLEKVLREDQYLLERKKSQYEDYKQW
YANYKKENPRTDLKMANFHKYNLEELSMKEYNELQDALKRALDDFHREVKDIKDK
NSDLKTFNAAEEDKATKEVYDLVSEIDTLVVSYYGDKDYGEHAKELRAKLDLILGD
TDNPHKITNERIKKEMIDDLNSIIDDFFMETKQNRPKSITKYNPTTHNYKTNSDNKPNF
DKLVEETKKAVKEADDSWKKKTVKKYGETETKSPVVKEEKKVEEPQAPKVDNQQE
VKTTAGKAEETTQPVAQPLVKIPQGTITGEIVKGPEYPTMENKTVQGEIVQGPDFLTM
EQSGPSLSNNYTNPPLTNPILEGLEGSSSKLEIKPQGTESTLKGTQGESSDIEVKPQATE
TTEASQYGPRPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVT
THANGQVSYGARPTYKKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTT
HGNGQVSYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYKKPSKTNAYNVTTH
ADGTATYGPRVTK CoaST8_2 - SEQ ID NO: 26
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKNGTLIDSRYLNSAL
YYLEDYIIYAIGLTNKYEYGDNIYKEAKDRLLEKVLREDQYLLERKKSQYEDYKQW
YANYKKENPRTDLKMANFHKYNLEELSMKEYNELQDALKRALDDFHREVKDIKDK
NSDLKTFNAAEEDKATKEVYDLVSEIDTLVVSYYGDKDYGEHAKELRAKLDLILGD
TDNPHKITNERIKKEMIDDLNSIIDDFFMETKQNRPKSITKYNPTTHNYKTNSDNKPNF
DKLVEETKKAVKEADDSWKKKTVKKYGETETKSPVVKEEKKVEEPQAPKVDNQQE
VKTTAGKAEETTQPVAQPLVKIPQGTITGEIVKGPEYPTMENKTVQGEIVQGPDFLTM
EQSGPSLSNNYTNPPLTNPILEGLEGSSSKLEIKPQGTESTLKGTQGESSDIEVKPQATE
TTEASQYGPRPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVT
THANGQVSYGARPTQNKPSKTNAYNVTTHGNGQVSYGARPTQNKPSKTNAYNVTT
HANGQVSYGARPTYKKPSKTNAYNVTTHADGTATYGPRVTK CoaST22_1 - SEQ ID NO: 27
MKKQIISLGALAVASSLFTWDNKADAIVTKDYNGKSQVKKESKNGTLIDSRYYWEKI
EALEKQFSSALALTDEYQYGGNEYKEAKDKLMERILGEDQYLLKKKIDEYDYYKK
WYKATYPNDNSKMYSFHKYNVYYLTMNEYNEITNSLKDAVEKFNNEVRDIQSKNE
DLKPYDENTEKQETDKIYEFVSEIDTVFAAYYSHEKFGIHAKELRAKLDIILGDVHNP
NRITNERIKKEMMEDLNSIVDDFFMETNQNRPTTIKKYDPNIHDYTKKKENKENFDK
LVKETREAVEKADESWKNKTVKKYEETVTKSPFVKEEKKVEEPQLPKVGNQQEVKT
TAGKAEETTQPLVKIPQGTITGEIVKGPDYPTMENKTLQGEIVQGPDFPTMEQNRPSL
SDNYTQPTTTNPILEGLEGSSSKLEIKPQGTESTLQGTQGESSDIEVKPQATETTEASQ
YGPRPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTNQDG
TVTYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTTHANGQ
VSYGARPTQNKASETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHGNGQV
SYGARPTYKKPSETNAYNVTTHADGTATYGPRVTK CoaST22_2 - SEQ ID NO: 28
MKKQIISLGALAVASSLFTWDNKADAIVTKDYNGKSQVKKESKNGTLIDSRYYWEKI
EALEKQFSSALALTDEYQYGGNEYKEAKDKLMERILGEDQYLLKKKIDEYDYYKK
WYKATYPNDNSKMYSFHKYNVYYLTMNEYNEISNSLKDAVEKFNNEVRDIQSKNE
DLKPYDENTEKQETDKIYEFVSEIDTVFAAYYSHEKFGIHAKELRAKLDIILGDVHNP
NRITNERIKKEMMEDLNSIVDDFFMETNQNRPTTIKKYDPNIHDYTKKKENKENFDK
LVKETREAVEKADESWKNKTVKKYEETVTKSPFVKEEKKVEEPQLPKVGNQQEVKT
TAGKAEETTQPLVKIPQGTITGEIVKGPDYPTMENKTLQGEIVQGPDFPTMEQNRPSL
SDNYTQPTTTNPILEGLEGSSSKLEIKPQGTESTLQGTQGESSDIEVKPQATETTEASQ
YGPRPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTNQDG
TVTYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTTHANGQ
VSYGARPTQNKASETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHGNGQV
SYGARPTYKKPSETNAYNVTTHADGTATYGPRVTK CoaST22_3 - SEQ ID NO: 29
MKKQIISLGALAVASSLFTWDNKADAIVTKDYNGKSQVKKESKNGTLIDSRYYWEKI
EALEKQFSSALALTDEYQYGGNEYKEAKDKLMERILGEDQYLLKKKIDEYDYYKK
WYKATYPNDNSKMYSFHKYNVYYLTMNEYNEITNSLKDAVEKFNNEVRDIQSKNE
DLKPYDENTEKQETDKIYEFVSEIDTVFAAYYSHEKFGIHAKELRAKLDIILGDVHNP
NRITNERIKKEMMEDLNSIVDDFFMETNQNRPTTIKKYDPNIHDYTKKKENKENFDK
LVKETREAVEKADESWKNKTVKKYEETVTKSPFVKEEKKVEEPQLPKVGNQQEVKT
TAGKAEETTQPLVKIPQGTITGEIVKGPDYPTMENKTLQGEIVQGPDFPTMEQNRPSL
SDNYTQPTTTNPILEGLEGSSSKLEIKPQGTESTLQGTQGESSDIEVKPQATETTEASQ
YGPRPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTNQDG
TVTYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTTHANGT ATYGPRVTK
CoaST30_1 - SEQ ID NO: 30
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNENSKYDTPIPDWYLGSIL
NRLGDQIYYAKELTNKYEYGEKEYKQAIDKLMTRVLGEDHYLLEKKKAQYEAYKK
WFEKHKSENPHSSLKKIKFDDFDLYRLTKKEYNELHQSLKEAVDEFNSEVKNIQSKQ
KDLLPYDEATENRVTNGIYDFVCEIDTLYAAYFNHSQYGHNAKELRAKLDIILGDAK
DPVRITNERIRKEMMDDLNSIIDDFFMDTNMNRPLNITKFNPNIHDYTNKPENRDNFD
KLVKETREAIANADESWKTRTVKNYGESETKSPVVKEEKKVEEPQLPKVGNQQEDK
ITVGTTEEAPLPIAQPLVKIPQGTIQGEIVKGPEYLTMENKTLQGEIVQGPDFPTMEQN
RPSLSDNYTQPTTPNPILKGIEGNSTKLEIKPQGTESTLKGTQGESSDIEVKPQATETTE
ASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTN
QDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKPSETNAYNVTTHA
NGQVSYGARPTQNKPSKTNAYNVTTHADGTATYGPRVTK CoaST30_2 - SEQ ID NO: 31
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNENSKYDTPIPDWYLGSIL
NRLGDQIYYAKELTNKYEYGEKEYKQAIDKLMTRVLGEDHYLLEKKKAQYEAYKK
WFEKHKSENPHSSLKKIKFDDFDLYRLTKKEYNELHQSLKEAVDEFNSEVKNIQSKQ
KDLLPYDEATENRVTNGIYDFVCEIDTLYAAYFNHSQYGHNAKELRAKLDIILGDAK
DPVRITNERIRKEMMDDLNSIIDDFFMDTNMNRPLNITKFNPNIHDYTNKPENRDNFD
KLVKETREAVANADESWKTRTVKNYGESETKSPVVKEEKKVEEPQLPKVGNQQED
KITVGTTEEAPLPIAQPLVKIPQGTIQGEIVKGPEYLTMENKTLQGEIVQGPDFPTMEQ
NRPSLSDNYTQPTTPNPILKGIEGNSTKLEIKPQGTESTLKGTQGESSDIEVKPQATETT
EASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTT
NQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTTN
QDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKPSETNAYNVTTHA
NGQVSYGARPTQNKPSKTNAYNVTTHADGTATYGPRVTK CoaST30_3 - SEQ ID NO: 32
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNENSKYDTPIPDWYLGSIL
NRLGDQIYYAKELTNKYEYGEKEYKQAIDKLMTRVLGEDHYLLEKKKAQYEAYKK
WFEKHKSENPHSSLKKIKFDDFDLYRLTKKEYNELHQSLKEAVDEFNSEVKNIQSKQ
KDLLPYDEATENRVTNGIYDFVCEIDTLYAAYFNHSQYGHNAKELRAKLDIILGDAK
DPVRITNERIRKEMMDDLNSIIDDFFMDTNMNRPLNITKFNPNIHDYTNKPENRDNFD
KLVKETREAIANADESWKTRTVKNYGESETKSPVVKEEKKVEEPQLPKVGNQQEDK
ITVGTTEEAPLPIAQPLVKIPQGTIQGEIVKGPEYLTMENKTLQGEIVQGPDFPTMEQN
RPSLSDNYTQPTTPNPILKGIEGNSTKLEIKPQGTESTLKGTQGESSDIEVKPQATETTE
ASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTN
QDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTTNQ
DGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKPSETNAYNVTTHAN
GQVSYGARPTQNKPSKTNAYNVTTHADGTATYGPRVTK CoaST45_1 - SEQ ID NO: 33
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKNGKQIADGYYWGI
IENLENQFYNIFHLLDQHKYAEKEYKDALDKLKTRVLEEDQYLLERKKEKYEIYKEL
YKKYKKENPNTQVKMKAFDKYDLGDLTMEEYNDLSKLLTKALDNFKLEVKKIESE
NPDLRPYSESEERTAYGKIDSLVDQAYSVYFAYVTDAQHKTEALNLRAKIDLILGDE
KDPIRVTNQRTEKEMIKDLESIIDDFFIETKLNRPQHITRYDGTKHDYHKHKDGFDAL
VKETREAVSKADESWKTKTVKKYGETETKYPVVKEEKKVEEPQSPKVSEKVDVQET
VGTTEEAPLPIAQPLVKLPQIGTQGEIVKGPDYPTMENKTLQGVIVQGPDFPTMEQNR
PSLSDNYTQPSVTLPSITGESTPTNPILKGIEGNSSKLEIKPQGTESTLKGIQGESSDIEV
KPQATETTEASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSET
NAYNVTTNQDGTVSYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYNKPSKTN
AYNVTTHADGTATYGPRVTK CoaST45_2 - SEQ ID NO: 34
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKNGKQIADGYYWGI
IENLENQFYNIFHLLDQHKYAEKEYKDALDKLKTRVLEEDQYLLERKKEKYEIYKEL
YKKYKKENPNTQVKMKAFDKYDLGDLTMEEYNDLSKLLTKALDNFKLEVKKIESE
NPDLRPYSESEERTAYGKIDSLVDQAYSVYFAYVTDAQHKTEALNLRAKIDLILGDE
KDPIRVTNQRTEKEMIKDLESIIDDFFIETKLNRPQHITRYDGTKHDYHKHKDGFDAL
VKETREAVSKADESWKTKTVKKYGETETKYPVVKEEKKVEEPQSPKVSEKVDVQET
VGTTEEAPLPIAQPLVKLPQIGTQGEIVKGPDYPTMENKTLQGVIVQGPDFPTMEQNR
PSLSDNYTQPSVTLPSITGESTPTNPILKGIEGNSSKLEIKPQGTESTLKGIQGESSDIEV
KPQATETTEASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSET
NAYNVTTNQDGTVSYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYNKPSETN
AYNVTTNRDGTVSYGARPTQNKPSETNAYNVTTHGNGQVSYGARPTQKKPSKTNA
YNVTTHANGQVSYGARPTYNKPSKTNAYNVTTHADGTATYGPRVTK CoaST45_3 - SEQ ID
NO: 35 MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKNGKQIADGYYWGI
IENLENQFYNIFHLLDQHKYAEKEYKDALDKLKTRVLEEDQYLLERKKEKYEIYKEL
YKKYKKENPNTQVKMKAFDKYDLGDLTMEEYNDLSKLLTKALDNFKLEVKKIESE
NPDLRPYSESEERTAYGKIDSLVDQAYSVYFAYVTDAQHKTEALNLRAKIDLILGDE
KDPIRVTNQRTEKEMIKDLESIIDDFFIETKLNRPQHITRYDGTKHDYHKHKDGFDAL
VKETREAVSKADESWKTKTVKKYGETETKYPVVKEEKKVEEPQSPKVSEKVDVQET
VGTTEEAPLPIAQPLVKLPQIGTQGEIVKGPDYPTMENKTLQGVIVQGPDFPTMEQNR
PSLSDNYTQPSVTLPSITGESTSTNPILKGIEGNSSKLEIKPQGTESTLKGIQGESSDIEV
KPQATETTEASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSET
NAYNVTTNQDGTVSYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYNKPSETN
AYNVTTNRDGTVSYGARPTQNKPSETNAYNVTTHGNGQVSYGARPTQKKPSKTNA
YNVTTHANGQVSYGARPTQKKPSKTNAYNVTTHADGTATYGPRVTK CoaST239_1 - SEQ ID
NO: 36 MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNENSKYDTPIPDWYLGSIL
NRLGDQIYYAKELTNKYEYGEKEYKQAIDKLMTRVLGEDHYLLEKKKAQYEAYKK
WFEKHKSENPHSSLKKIKFDDFDLYRLTKKEYNELHQSLKEAVDEFNSEVKNIQSKQ
KDLLPYDEATENRVTNGIYDFVCEIDTLYAAYFNHSQYGHNAKELRAKLDIILGDAK
DPVRITNERIRKEMMDDLNSIIDDFFMDTNMNRPLNITKFNPNIHDYTNKPENRDNFD
KLVKETREAVANADESWKTRTVKNYGESETKSPVVKEEKKVEEPQLPKVGNQQED
KITVGTTEEAPLPIAQPLVKIPQGTIQGEIVKGPEYLTMENKTLQGEIVQGPDFPTMEQ
NRPSLSDNYTQPTTPNPILKGIEGNSTKLEIKPQGTESTLKGTQGESSDIEVKPQATETT
EASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTT
NQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTTN
QDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKPSETNAYNVTTHA
NGQVSYGARPTQNKPSKTNAYNVTTHADGTATYGPRVTK CoaST239_2 - SEQ ID NO: 37
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNENSKYDTPIPDWYLGSIL
NRLGDQIYYAKELTNKYEYGEKEYKQAIDKLMTRVLGEDHYLLEKKKAQYEAYKK
WFEKHKSENPHSSLKKIKFDDFDLYRLTKKEYNELHQSLKEAVDEFNSEVKNIQSKQ
KDLLPYDEATENRVTNGIYDFVCEIDTLYAAYFNHSQYGHNAKELRAKLDIILGDAK
DPVRITNERIRKEKMDDLNSIIDDFFMDTNMNRPLNITKFNPNIHDYTNKPENRDNFD
KLVKETREAVANADESWKTRTVKNYGESETKSPVVKEEKKVEEPQLPKVGNQQED
KITVGTTEEAPLPIAQPLVKIPQGTIQGEIVKGPEYLTMENKTLQGEIVQGPDFPTMEQ
NRPSLSDNYTQPTTPNPILKGIEGNSTKLEIKPQGTESTLKGTQGESSDIEVKPQATETT
EASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTT
NQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTTN
QDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKPSETNAYNVTTHA
NGQVSYGARPTQNKPSKTNAYNVTTHADGTATYGPRVTK CoaST239_3 - SEQ ID NO: 38
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNENSKYDTPIPDWYLGSIL
NRLGDQIYYAKELTNKYEYGEKEYKQAIDKLMTRVLGEDHYLLEKKKAQYEAYKK
WFEKHKSENPHSSLKKIKFDDFDLYRLTKKEYNELHQSLKEAVDEFNSEVKNIQSKQ
KDLLPYDEATENRVTNGIYDFVCEIDTLYAAYFNHSQYGHNAKELRAKLDIILGDAK
DPVRITNERIRKEKMDDLNSIIDDFFMDTNMNRPLNITKFNPNIHDYTNKPENRDNFD
KLVKETREAVANADESWKTRTVKNYGESETKSPVVKEEKKVEEPQLPKVGNQQED
KITVGTTEEAPLPIAQPLVKIPQGTIQGEIVKGPEYLTMENKTLQGEIVQGPDFPTMEQ
NRPSLSDNYTQPTTPNPILKGIEGNSTKLEIKPQGTESTLKGTQGESSDIEVKPQATETT
EASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTT
NQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKPSETNAYNVTTH
ANGQVSYGARPTQNKPSKTNAYNVTTHADGTATYGPRVTK
[0342] Antibody CDR sequences:
TABLE-US-00005 SEQ SEQ SEQ Variable ID ID ID Ab chain CDR1 NO: CDR2
NO: CDR3 NO: 5D5.4 Heavy GASITTSY 9 ISYSGNT 10 ATYYDFNYDGY 11 LDV
5D5.4 Light SSVSSSY 12 STS 13 QQYHRSPPT 14 3B3.14 Heavy GYTFTSFD 15
IFPGDGSA 16 VKNHGGWYFDV 17 3B3.14 Light QSIVHSNGNTY 18 KVS 19
FQGSHVPLT 20 Full length Coa polypeptide- Strain USA300 - SEQ ID
NO: 21: MKKQIISLGA LAVASSLFTW DNKADAIVTK DYSGKSQVNA GSKNGTLIDS 50
RYLNSALYYL EDYIIYAIGL TNKYEYGDNI YKEAKDRLLE KVLREDQYLL 100
ERKKSQYEDY KQWYANYKKE NPRTDLKMAN FHKYNLEELS MKEYNELQDA 150
LKRALDDFHR EVKDIKDKNS DLKTFNAAEE DKATKEVYDL VSEIDTLVVS 200
YYGDKDYGEH AKELRAKLDL ILGDTDNPHK ITNERIKKEM IDDLNSIIDD 250
FFMETKQNRP KSITKYNPTT HNYKTNSDNK PNFDKLVEET KKAVKEADDS 300
WKKKTVKKYG ETETKSPVVK EEKKVEEPQA PKVDNQQEVK TTAGKAEETT 350
QPVAQPLVKI PQGTITGEIV KGPEYPTMEN KTVQGEIVQG PDFLTMEQSG 400
PSLSNNYTNP PLTNPILEGL EGSSSKLEIK PQGTESTLKG TQGESSDIEV 450
KPQATETTEA SQYGPRPQFN KTPKYVKYRD AGTGIREYND GTFGYEARPR 500
FNKPSETNAY NVTTHANGQV SYGARPTQNK PSKTNAYNVT THGNGQVSYG 550
ARPTQNKPSK TNAYNVTTHA NGQVSYGARP TYKKPSKTNA YNVTTHADGT 600
ATYGPRVTK
[0343] Exemplary R Domains of the Coa polypeptides of SEQ ID
NO:22-38 are provided as SEQ ID NOS:39-55 and SEQ ID NOS:85-101 and
include fragments and contiguous sequences (see for example, para.
[0094]). It is specifically contemplated that R fragments comprise
a contiguous amino acid polypeptide comprising amino acid 1-161 of
SEQ ID NOs:39-41, 44, 45, 48, 49, and/or 51-54, amino acids 1-133
of SEQ ID NO:42, amino acids 1-107 of SEQ ID NO:43, amino acids
1-80 of SEQ ID NOS:46 and/or 50, and/or amino acids 1-107 of SEQ ID
NOS:47 or 55.
TABLE-US-00006
RPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARP
TQKKPSKTNAYNVTTHANGQVSYGARPTQKKPSKTNAYNVTTHANGQVSYGARPT
YKKPSETNAYNVTTHANGQVSYGARLTQKKPSETNAYNVTTHADGTATYGP (SEQ ID NO:
39); RPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARP
TQKKPSKTNAYNVTTHANGQVSYGARPTQKKPSKTNAYNVTTHANGQVSYGARPT
YKKPSETNAYNVTTHANGQVSYGARPTQKKPSETNAYNVTTHADGTATYGP (SEQ ID NO:
40); RPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARP
TYKKPSETNAYNVTTHANGQVSYGARPTQKKPSKTNAYNVTTHANGQVSYGARPT
YKKPSETNAYNVTTHANGQVSYGARPTQKKPSETNAYNVTTHADGTATYGP (SEQ ID NO:
41); RPRFNKPSETNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTTHANGQVSYGARP
TQNKPSKTNAYNVTTHGNGQVSYGARPTQNKPSKTNAYNVTTHANGQVSYGARPT
YKKPSKTNAYNVTTHADGTATYGP (SEQ ID NO: 42);
RPRFNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHGNGQVSYGAR
PTQNKPSKTNAYNVTTHANGQVSYGARPTYKKPSKTNAYNVTTHADGTATYGP (SEQ ID NO:
43); RPRFNKPSETNAYNVTTNQDGTVTYGARPTQNKPSKTNAYNVTTHANGQVSYGARP
TYKKPSETNAYNVTTHANGQVSYGARPTQNKASETNAYNVTTHANGQVSYGARPT
QNKPSKTNAYNVTTHGNGQVSYGARPTYKKPSETNAYNVTTHADGTATYGP (SEQ ID NO:
44); RPRFNKPSETNAYNVTTNQDGTVTYGARPTQNKPSKTNAYNVTTHANGQVSYGARP
TYKKPSETNAYNVTTHANGQVSYGARPTQNKASETNAYNVTTHANGQVSYGARPT
QNKPSKTNAYNVTTHGNGQVSYGARPTYKKPSETNAYNVTTHADGTATYGP (SEQ ID NO:
45); RPRFNKPSETNAYNVTTNQDGTVTYGARPTQNKPSKTNAYNVTTHANGQVSYGARP
TYKKPSETNAYNVTTHANGTATYGP (SEQ ID NO: 46);
RPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARP
TQNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHADGTATYGP (SEQ ID NO:
47); RPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARP
TYKKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPT
QNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHADGTATYGP (SEQ ID NO:
48); RPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARP
TYKKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPT
QNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHADGTATYGP (SEQ ID NO:
49); RPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSKTNAYNVTTHANGQVSYGARP
TYNKPSKTNAYNVTTHADGTATYGP (SEQ ID NO: 50);
RPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSKTNAYNVTTHANGQVSYGARP
TYNKPSETNAYNVTTNRDGTVSYGARPTQNKPSETNAYNVTTHGNGQVSYGARPTQ
KKPSKTNAYNVTTHANGQVSYGARPTYNKPSKTNAYNVTTHADGTATYGP (SEQ ID NO: 51);
RPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSKTNAYNVTTHANGQVSYGARP
TYNKPSETNAYNVTTNRDGTVSYGARPTQNKPSETNAYNVTTHGNGQVSYGARPTQ
KKPSKTNAYNVTTHANGQVSYGARPTQKKPSKTNAYNVTTHADGTATYGP (SEQ ID NO: 52);
RPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARP
TYKKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPT
QNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHADGTATYGP (SEQ ID NO:
53); RPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARP
TYKKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPT
QNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHADGTATYGP (SEQ ID NO:
54); RPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARP
TQNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHADGTATYGP (SEQ ID NO:
55); ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGAR
PTQKKPSKTNAYNVTTHANGQVSYGARPTQKKPSKTNAYNVTTHANGQVSYGARP
TYKKPSETNAYNVTTHANGQVSYGARLTQKKPSETNAYNVTTHADGTATYG (SEQ ID NO:
85); ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGAR
PTQKKPSKTNAYNVTTHANGQVSYGARPTQKKPSKTNAYNVTTHANGQVSYGARP
TYKKPSETNAYNVTTHANGQVSYGARPTQKKPSETNAYNVTTHADGTATYG (SEQ ID NO:
86); ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGAR
PTYKKPSETNAYNVTTHANGQVSYGARPTQKKPSKTNAYNVTTHANGQVSYGARP
TYKKPSETNAYNVTTHANGQVSYGARPTQKKPSETNAYNVTTHADGTATYG (SEQ ID NO:
87); ARPRFNKPSETNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTTHANGQVSYGA
RPTQNKPSKTNAYNVTTHGNGQVSYGARPTQNKPSKTNAYNVTTHANGQVSYGAR
PTYKKPSKTNAYNVTTHADGTATYG (SEQ ID NO: 88);
ARPRFNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHGNGQVSYGA
RPTQNKPSKTNAYNVTTHANGQVSYGARPTYKKPSKTNAYNVTTHADGTATYG (SEQ ID NO:
89); ARPRFNKPSETNAYNVTTNQDGTVTYGARPTQNKPSKTNAYNVTTHANGQVSYGA
RPTYKKPSETNAYNVTTHANGQVSYGARPTQNKASETNAYNVTTHANGQVSYGAR
PTQNKPSKTNAYNVTTHGNGQVSYGARPTYKKPSETNAYNVTTHADGTATYG (SEQ ID NO:
90); ARPRFNKPSETNAYNVTTNQDGTVTYGARPTQNKPSKTNAYNVTTHANGQVSYGA
RPTYKKPSETNAYNVTTHANGQVSYGARPTQNKASETNAYNVTTHANGQVSYGAR
PTQNKPSKTNAYNVTTHGNGQVSYGARPTYKKPSETNAYNVTTHADGTATYG (SEQ ID NO:
91); ARPRFNKPSETNAYNVTTNQDGTVTYGARPTQNKPSKTNAYNVTTHANGQVSYGA
RPTYKKPSETNAYNVTTHANGTATYG (SEQ ID NO: 92);
ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGAR
PTQNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHADGTATYG (SEQ ID
NO:93); ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGAR
PTYKKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPT
QNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHADGTATYG (SEQ ID NO: 94);
ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGAR
PTYKKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPT
QNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHADGTATYG (SEQ ID NO: 95);
ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSKTNAYNVTTHANGQVSYGA
RPTYNKPSKTNAYNVTTHADGTATYG (SEQ ID NO: 96);
ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSKTNAYNVTTHANGQVSYGA
RPTYNKPSETNAYNVTTNRDGTVSYGARPTQNKPSETNAYNVTTHGNGQVSYGARP
TQKKPSKTNAYNVTTHANGQVSYGARPTYNKPSKTNAYNVTTHADGTATYG (SEQ ID NO:
97); ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSKTNAYNVTTHANGQVSYGA
RPTYNKPSETNAYNVTTNRDGTVSYGARPTQNKPSETNAYNVTTHGNGQVSYGARP
TQKKPSKTNAYNVTTHANGQVSYGARPTQKKPSKTNAYNVTTHADGTATYG (SEQ ID NO:
98); ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGAR
PTYKKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPT
QNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHADGTATYG (SEQ ID NO: 99);
ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGAR
PTYKKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPT
QNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHADGTATYG (SEQ ID NO:
100); ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGAR
PTQNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHADGTATYG (SEQ ID NO:
101). Exemplary R Domain fragments: ARPTYNKPSETNAYNVTTNRDGTVSYG;
(SEQ ID NO: 102) ARPTYKKPSETNAYNVTTNQDGTVSYG; (SEQ ID NO: 103)
ARPRFNKPSETNAYNVTTNQDGTVSYG; (SEQ ID NO: 104)
ARPRFNKPSETNAYNVTTNQDGTVTYG; (SEQ ID NO: 105)
ARPTYNKPSKTNAYNVTTHADGTATYG; (SEQ ID NO: 106)
ARPTYKKPSKTNAYNVTTHADGTATYG; (SEQ ID NO: 107)
ARPTYKKPSETNAYNVTTHANGTATYG; (SEQ ID NO: 108)
ARPTYKKPSETNAYNVTTHADGTATYG; (SEQ ID NO: 109)
ARPTQNKPSKTNAYNVTTHADGTATYG; (SEQ ID NO: 110)
ARPTQKKPSKTNAYNVTTHADGTATYG; (SEQ ID NO: 111)
ARPTQKKPSETNAYNVTTHADGTATYG; (SEQ ID NO: 112)
ARLTQKKPSETNAYNVTTHADGTATYG; (SEQ ID NO: 113)
ARPTYKKPSETNAYNVTTHANGQVSYG; (SEQ ID NO: 114)
ARPRFNKPSETNAYNVTTHANGQVSYG; (SEQ ID NO: 115)
ARPTQKKPSKTNAYNVTTHANGQVSYG; (SEQ ID NO: 116)
ARPTQNKPSKTNAYNVTTHANGQVSYG; (SEQ ID NO: 117)
ARPTQNKPSKTNAYNVTTHGNGQVSYG; (SEQ ID NO: 118)
ARPTQNKASETNAYNVTTHANGQVSYG; (SEQ ID NO: 119)
ARPTQNKPSETNAYNVTTHANGQVSYG; (SEQ ID NO: 120)
ARPTQNKPSETNAYNVTTHGNGQVSYG; (SEQ ID NO: 121)
ARPTQNKPSETNAYNVTTHANGQVSYGA (SEQ ID NO: 122)
RPTQNKPSETNAYNVTTHANGQVSYG;
RP(T/R)(F/Q)(N/K)K(P/A)S(E/K)TNAYNVTT(H/N)(A/G/Q)(N/D)G(Q/T)
V(S/T)YGARPT(Y/Q)(K/N)KPS(E/K)TNAYNVTTH(A/G)NGQVSYGAR(L/P)
T(Q/Y)(N/K)KPS(K/E)TNAYNVTTHA(D/N)GTATYGP (SEQ ID NO: 57);
RPRFNKPSETNAYNVTTNQDGTV(S/T)YGA (SEQ ID NO: 58); X.sub.b is
RP(T/R)(Q/F)NKPS(K/E)TNAYNVTTHANGQVSYGA (SEQ ID NO: 59);
RP(T/R)(F/Y/Q)(N/K)KPS(E/K)TNAYNVTT(H/N)(Q/A/R)(N/D)G(Q/T) VSYGA
(SEQ ID NO: 60);
ARP(T/R)(F/Q)(N/K)K(P/A)S(E/K)TNAYNVTT(H/N)(A/G/Q)(N/D)
G(Q/T)V(S/T)YGARPT(Y/Q)(K/N)KPS(E/K)TNAYNVTTH(A/G)NGQVSYGAR
(L/P)T(Q/Y)(N/K)KPS(K/E)TNAYNVTTHA(D/N)GTATYG (SEQ ID NO: 123);
ARPRFNKPSETNAYNVTTNQDGTV(S/T)YG (SEQ ID NO: 124);
ARP(T/R)(Q/F)NKPS(K/E)TNAYNVTTHANGQVSYG (SEQ ID NO: 125);
ARP(T/R)(F/Y/Q)(N/K)KPS(E/K)TNAYNVTT(H/N)(Q/A/R)(N/D) G(Q/T)VSYG
(SEQ ID NO: 126); ARX1X2X3X4KX5SX6TNAYNVTTX7X8X9GX10X11X12YG (SEQ
ID NO: 61) or ARPTX3X4KPSX6TNAYNVTTHX8X9GX10X11X12YG (SEQ ID
NO:62),
wherein X.sub.1, X.sub.2, X.sub.3, X.sub.4, X.sub.5, X.sub.6,
X.sub.7, X.sub.8, X.sub.9, X.sub.10, X.sub.11, and X.sub.12 are any
amino acid. In some embodiments, X.sub.1 is proline or leucine. In
some embodiments, X.sub.2 is arginine or threonine. In some
embodiments, X.sub.3 is phenylalanine, glutamine, or tyrosine. In
some embodiments, X.sub.4 is asparagine or lysine. In some
embodiments, X.sub.5 is proline or alanine. In some embodiments,
X.sub.6 is lysine or glutamate. In some embodiments, X.sub.7 is
histidine or asparagine. In some embodiments, X.sub.8 is alanine,
glutamine, glycine, or arginine. In some embodiments, X.sub.9 is
aspartate or asparagine. In some embodiments, X.sub.10 is threonine
or glutamine. In some embodiments, X.sub.11 is valine or alanine.
In some embodiments, X.sub.12 is threonine or serine.
VI. EXAMPLES
[0344] The following examples are given for the purpose of
illustrating various embodiments and are not meant to limit the
present invention in any fashion. One skilled in the art will
appreciate readily that the present invention is well adapted to
carry out the objects and obtain the ends and advantages mentioned,
as well as those objects, ends and advantages inherent herein. The
present examples, along with the methods described herein are
presently representative of preferred embodiments, are exemplary,
and are not intended as limitations on the scope of the invention.
Changes therein and other uses which are encompassed within the
spirit of the invention as defined by the scope of the claims will
occur to those skilled in the art.
Example 1
Antibodies Against a Secreted Product of Staphylococcus aureus
Trigger Phagocytic Killing
[0345] Host immunity against bacterial pathogens typically involves
antibodies that recognize the microbial surface and promote
phagocytic killing. Methicillin-resistant Staphylococcus aureus
(MRSA) is a frequent cause of lethal bloodstream infection, however
vaccines and antibody therapeutics targeting Staphylococcal surface
molecules have thus far failed to achieve clinical efficacy. S.
aureus secretes coagulase (Coa), which activates host prothrombin
and generates fibrin fibrils that protect the pathogen against
phagocytosis by immune cells. Because of negative selection, the
coding sequence for the prothrombin binding D1-D2 domain is highly
variable and does not elicit cross-protective immune responses. The
R domain, tandem repeats of a 27-residue peptide that bind
fibrinogen, is conserved at the C-terminus of all Coa molecules,
however its functional significance is not known. Inventors show
here that the R domain enables bloodstream infections by directing
fibrinogen to the Staphylococcal surface, generating a protective
fibrin shield that inhibits phagocytosis. The fibrin shield can be
marked with R-specific antibodies, which trigger phagocytic killing
of Staphylococci and protect mice against lethal bloodstream
infections caused
A. R Domain of Coagulase Supports S. aureus Bloodstream
Infection
[0346] The C-terminal domain of Coa is conserved and comprised of
tandem repeats of a 27-residue peptide each of which binds
fibrinogen (FIG. 1A) (Panizzi et al., 2011; Watanabe et al., 2009).
The number of tandem repeats varies between Coa molecules from
different isolates of S. aureus (Watanabe et al., 2009). To
characterize the contribution of the R domain to the pathogenesis
of Staphylococcal disease, inventors generated isogenic S. aureus
variants with a truncated coa, lacking the R domain
(coa.sub..DELTA.R), in either wild-type or .DELTA.vwb backgrounds.
When probed by immunoblotting with Coa- and vWbp-specific
antibodies and compared with Coa from wild-type Staphylococci, S.
aureus coa.sub..DELTA.R and coa.sub..DELTA.R/.DELTA.vwb strains
secreted a truncated protein into the extracellular medium (FIG.
1). Monoclonal antibody mAb 5D5, which recognizes the D1 domain of
Coa (vide infra), bound to both Coa and Coa.sub..DELTA.R, whereas
mAb 3B3, specific for the R domain (vide infra), only bound Coa,
but not Coa.sub..DELTA.R (FIG. 1AB). When inoculated into
calcium-chelated mouse blood and incubated for 24 hours, wild-type
S. aureus produced a firm clot, whereas mock-infected blood did not
(FIG. 1C). Staphylococci rely on secretion of both coagulases for
clotting, as only .DELTA.coa .DELTA.vwb but not .DELTA.coa or
.DELTA.vwb variant strains displayed a defect in this assay (FIG.
1C). Compared to their respective parent strains, the
coa.sub..DELTA.R and coa.sub..DELTA.R/.DELTA.vwb mutants were also
not defective for clotting, indicating that the R domain of Coa is
dispensable for Staphylococcal clot formation (FIG. 1C).
[0347] When inoculated intravenously into BALB/c mice, wild-type S.
aureus Newman causes a lethal bloodstream infection within 2-3
days, where .DELTA.coa or .DELTA.vwb mutations each cause a delay
in time-to-death that is additive for the .DELTA.coa/.DELTA.vwb
mutant [median survival time 60 hours (wild-type), 108 hours
(.DELTA.coa or .DELTA.vwb) and 180 hours
(.DELTA.coa/.DELTA.vwb)](FIG. 1D, E). Surprisingly, the
coa.sub..DELTA.R mutation also caused a delay in time-to-death
[median survival time 72 (coa.sub..DELTA.R) and 126 hours
(coa.sub..DELTA.R/.DELTA.vwb)], which could be quantified in
strains with (wild-type vs. coa.sub..DELTA.R, P=0.0308; .DELTA.coa
vs. coa.sub..DELTA.R, P=0.0229) or without vwb expression
(.DELTA.vwb vs. coa.sub..DELTA.R/.DELTA.vwb, P=0.043; .DELTA.coa
.DELTA.vwb vs. coa.sub..DELTA.R .DELTA.vwb, P=0.0084). Thus, the R
domain of Coa, although dispensable for staphylothrombin-mediated
clotting, contributes to the pathogenesis of S. aureus infection in
mice.
B. R Domain Enables Assembly of the Staphylococcal Fibrin
Shield
[0348] Full-length strep-tagged Coa (Coa.sub.ST), Coa truncated for
the R domain (Co.sub..DELTA.R/ST), and R domain alone (R.sub.ST)
were purified and used for affinity chromatography experiments with
citrate-plasma (FIG. 2A). Coa.sub.ST and R.sub.ST retained molar
excess of fibrinogen, whereas Co.sub..DELTA.R/ST retained only
equimolar amounts of fibrinogen (FIG. 2A). This can be explained by
the equimolar association between fibrinogen and the exosite of
staphylothrombin within Coa.sub.ST or Co.sub..DELTA.R/ST, whereas
the R domain of Coa.sub.ST and R.sub.ST associates with 3-4 moles
of fibrinogen (FIG. 2A). As expected, Coa.sub.ST and
Co.sub..DELTA.R/ST bound prothrombin via their D1-D2 domain,
whereas R.sub.ST did not (FIG. 2A). Staphylococci display surface
proteins, for example clumping factor A (ClfA), that promote
association of bacteria with fibrinogen (McAdow et al., 2012a;
McDevitt et al., 1994). Mixed with dilute plasma, mid-log
Staphylococcal cultures formed fibrin clots that, when centrifuged,
sedimented with the bacteria and could be solubilized with urea
(FIG. 2B). When analyzed by Coomassie-stained SDS-PAGE, fibrin was
found associated with the bacterial sediment, whereas albumin
remained in the supernatant of agglutinated Staphylococci (FIG.
2B). Immunoblotting revealed that full-length Coa sedimented with
the bacterial clot, whereas Coa.sub..DELTA.R did not (FIG. 2B).
Association of Coa with Staphylococci occurred in the presence of
the fibrin clot and was not observed for Staphylococcal cultures
centrifuged without human plasma (FIG. 2B). To visualize the
contribution of the R domain towards Staphylococcal fibrin
formation, mCherry-expressing bacteria were added to plasma samples
with Alexa488-conjugated fibrinogen and clot formation was viewed
by fluorescence microscopy. Unlike wild-type Staphylococci, which
generated large fibrin deposits in the vicinity of bacteria, the
coa.sub..DELTA.R mutant produced long fibrin strands that were only
loosely associated with the pathogen (FIG. 2C). Thus, by augmenting
the recruitment of soluble fibrinogen, the C-terminal repeats favor
Coa-induced fibrin clots and limit diffusion of Coa away from
Staphylococci, thereby localizing the staphylothrombin-generated
fibrin shield in the immediate vicinity of the bacteria. R domain
interaction with fibrinogen may also explain early observations of
cell bound coagulase (Coa) and free coagulase (vWbp) (Duthie,
1954).
C. R Domain Antibody Protects Mice Against Bloodstream
Infection
[0349] Mouse monoclonal antibodies were raised by immunizing mice
with full-length Coa of S. aureus Newman. Thirteen antibodies
reactive to Coa, but not to vWbp or IsdA controls, were
characterized for their affinity and specificity to D1, D2, D1-D2,
D1 lacking the first 18 residues (D.sub..DELTA.1-18), L (linker)
and R domains (FIG. 1A). Two antibodies targeting the variable or
conserved domains of Coa, 5D5 and 3B3, were used for further study.
mAb 5D5, which bound to the D1 domain within the first 18 residues
of D1 that insert into the prothrombin active site to generate
active staphylothrombin (Table 1), prevented Coa.sub.ST binding to
prothrombin but not to fibrinogen (FIG. 5AB). mAb 3B3, on the other
hand, bound to the R domain (Table S) and blocked Coa.sub.ST
association with fibrinogen but not with prothrombin (FIG. 5AB).
Further, mAb 5D5, but not mAb 3B3, inhibited S. aureus Newman
mediated clotting of mouse blood in vitro, similar to polyclonal
antibodies raised against Coa from strain Newman (FIG. 5C). Neither
5D5, 3B3 nor polyclonal Coa antibodies inhibited S. aureus Newman
agglutination of EDTA-rabbit plasma in vitro (FIG. 5D). Purified
mAbs, 5D5 or 3B3, were injected at a concentration of 5 mg
antibody/kg body weight into the peritoneal cavity of BALB/c mice
and compared with IgG1 isotype control mAb (FIG. 3). Both 5D5 and
3B3 provided protection against lethal bloodstream infection with
S. aureus Newman (IgG1 vs. 5D5, P<0.0001; IgG1 vs. 3B3,
P<0.0001; FIG. 3A). Similar results were obtained when the S.
aureus .DELTA.vwb variant was used as a challenge strain (IgG1 vs.
5D5, P=0.0011; IgG1 vs. 3B3, P=0.0004; FIG. 3B). In ELISA assays,
mAb 3B3 was observed to bind coagulase from different serotypes
including type II (Coa.sub.N315), type III (Coa.sub.USA300), type
IV (Coa.sub.MRSA252 and Coa.sub.85/2082) and type VII (Coa.sub.WIS)
(Table 2). In contrast, mAb 5D5 recognized only Coa.sub.USA300 and
to a lesser degree Coa.sub.WIS (Table 2). When analyzed for the
prevention of lethal bloodstream infections, both 3B3 and 5D5
provided protection against MRSA strain USA300, with a type III
coagulase similar to S. aureus Newman (IgG1 vs. 5D5, P=0.0007; IgG1
vs. 3B3, P<0.0001; FIG. 3C). However, only mAb 3B3 protected
mice against lethal bloodstream challenge with S. aureus N315 (IgG1
vs. 5D5, P=0.1186; IgG1 vs. 3B3, P<0.0001), MRSA252 (IgG1 vs.
5D5, P=0.5993; IgG1 vs. 3B3, P<0.0001), and MRSA isolate WIS
(IgG1 vs. 5D5, P=0.4243; IgG1 vs. 3B3, P<0.0001; FIG. 3DEF).
Thus, monoclonal antibody against the R domain recognized coagulase
of all serotypes, providing broad-spectrum protection against
bloodstream infections caused by MRSA isolates.
TABLE-US-00007 TABLE 1 Attributes of mAbs raised against
Coa.sub.Newman Affinity (nM.sup.-1).sup.c mAb.sup.a Isotype.sup.b
Coa D1-D2 D1 D1.sub..DELTA.1-18 D2 L R 5D5 IgG1 5.02 5.4 4.09 1.32
< < < 3B3 IgG1 7.58 < < < < < 8.03
.sup.aMouse monoclonal antibodies were purified from isolated
hybridoma clones. .sup.bImmunoglobulin call and subclass of mAbs.
.sup.cAffinity was determined by ELISA as the association constant
(K.sub.a) in nM.sup.-1 for the coagulase protein (Coa) from strain
Newman. Mapping of mAb binding sites was performed by using either
the full-length Coa or its sub-domains D1-D2, D1,
D1.sub..DELTA.1-18, D2, linker (L) and repeat (R) domains.
TABLE-US-00008 TABLE 2 Affinity of mAbs toward Coa proteins of
different strains Affinity (nM.sup.-1).sup.c mAb.sup.a Domain.sup.b
Coa.sub.NM Coa.sub.USA300 Coa.sub.N315 Coa.sub.MRSA252
Coa.sub.85/2082 Coa.sub.WIS 5D5 D1 5.02 5.20 < < < 4.00
3B3 R 7.58 6.55 7.20 6.76 7.41 6.75 .sup.aMouse monoclonal
antibodies were purified from isolated hybridoma clones. .sup.bCoa
subdomains D1 or R recognized by mAb 5D5 and 3B3, respectively as
shown in Table S1. .sup.cAffinity was determined by ELISA as the
association constant (K.sub.a) in nM.sup.-1 for each protein
domain.
D. S. aureus Agglutination in Human Blood
[0350] Blood from human volunteers was anticoagulated with
desirudin to inhibit endogenous thrombin without affecting
staphylothromin (McAdow et al., 2011). Blood cells were removed by
centrifugation and 0.5 ml human plasma was inoculated with S.
aureus Newman (5.times.10.sup.6 CFU). At timed intervals, 0 min and
60 min incubation at 37.degree. C., Staphylococcal CFU were
enumerated. Within 60 min, CFU for wild-type S. aureus dropped from
5.times.10.sup.6 (100%) to 0.15.times.10.sup.6 (3%), whereas CFU
for the isogenic .DELTA.coa/.DELTA.vwb variant were not reduced
(FIG. 4A). Treatment of plasma samples with streptokinase (SK), the
plasminogen activator of fibrinolysis, did not affect bacterial CFU
in the 0 min samples yet liberated wild-type S. aureus agglutinated
over 60 min (FIG. 4A). USA300 LAC agglutinated in human plasma and
replicated quickly to generate a large bacterial load. USA300 LAC
agglutination did not occur in defibrinated human serum (FIG.
4A).
[0351] S. aureus phagocytosis and opsonophagocytic killing (OPK)
were measured in blood samples from 20 healthy human volunteers
infected with 5.times.10.sup.6 CFU USA300 LAC for 60 min. Bacterial
CFU were quantified with or without SK treatment (Table 3). Control
blood samples were pre-treated with cytochalasin D (CD), thereby
preventing S. aureus phagocytosis (Mimura and Asano, 1976). At a
challenge dose of 10 bacteria per leukocyte, the assay quantifies
OPK of 5.times.10.sup.6 CFU USA300 LAC as the percent CFU reduction
from 0 to 60 min in SK treated blood. Phagocytes in blood samples
of volunteer A killed 2.552.times.10.sup.6 CFU (51.04%) within 60
min (FIG. 4B). A fraction (64.62%) of the total Staphylococcal load
could be enumerated in blood without SK treatment (Table 3). When
pre-treated with CD, 97.92% of Staphylococcal CFU were agglutinated
in blood from volunteer A. Agglutination was calculated as the
percent S. aureus CFU requiring SK-treatment for enumeration after
60 min incubation. For volunteer A, 35.38% of the Staphylococcal
load had agglutinated within 60 min, whereas 64.62% had been
phagocytosed (Table 3). Phagocytes in blood samples from volunteer
G were unable to kill S. aureus: 99.68% of the inoculum was
recovered in SK-blood (FIG. 4B). Here, 21.93% of the bacterial load
had been phagocytosed, while 78.07% were agglutinated (Table 3).
USA300 LAC expanded in blood samples from volunteer I to 204.42% of
the initial inoculum; 85.75% of the load were agglutinated (FIG.
4B). On the basis of these phenotypes, inventors categorized human
blood samples as Staphylococcal killer, controller or prey (Table
3). This classification applies only to S. aureus, as both killer
and prey blood samples were active in phagocytosis and OPK of
Staphylococcus epidermidis, a commensal that does not express
coagulases (FIG. 6A). Antibody titers against the D1-D2 or the
C-terminal R domain were not correlated with OPK of USA300 LAC in
human blood (Table 3).
TABLE-US-00009 TABLE S3 Phagocytosis and opsonophagocytic killing
of MRSA USA300 LAC in human blood without cytochalasin D with
streptokinase cytochalasin D.sup.5 Serum IgG titer.sup.2 (SK)
streptokinase D1- mock (% mock (% Agglutinated Donor.sup.1 Hla
D2.sub.ST R.sub.N12D (% total).sup.3 inoculum).sup.4 (%
total).sup.3 inoculum).sup.4 (%).sup.6 OPK (%).sup.7 Category.sup.8
A 2599 320 716 64.62 48.96 2.08 145.59 35.38 51.04 K (.+-.20.53)
(.+-.4.48) (.+-.0.31) (.+-.32.82) B 1936 546 245 63.16 124.77 5.07
236.51 36.84 0 P (.+-.8.01) (.+-.6.02) (.+-.0.57) (.+-.6.14) C 3176
1550 276 31.28 90.4 3.98 87.65 68.72 9.60 K (.+-.0.53) (.+-.2.95)
(.+-.2.81) (.+-.18.98) D 1134 85 134 37.79 139.97 1.90 218.46 62.79
0 P (.+-.6.30) (.+-.5.78) (.+-.0.21) (.+-.5.15) E 1365 278 226
39.40 115.52 3.83 246.74 60.60 0 C (.+-.3.42) (.+-.30.84)
(.+-.1.06) (.+-.39.85) F 6849 4470 2905 14.35 130.93 2.1 117.08
85.65 0 P (.+-.1.23) (.+-.11.2) (.+-.1.79) (.+-.22.04) G 8688 2308
2760 21.93 99.68 2.58 149.60 78.07 0.32 C (.+-.1.94) (.+-.8.25)
(.+-.0.47) (.+-.18.75) H 3541 553 167 72.35 117.51 7.05 321.39
27.65 0 P (.+-.8.22) (.+-.9.59) (.+-.1.09) (.+-.24.81) I 1680 245
250 14.25 204.42 10.49 174.60 85.75 0 P (.+-.1.74) (.+-.29.76)
(.+-.0.75) (.+-.1.95) J 554 281 178 48.12 177.97 5.59 218.06 51.88
0 P (.+-.0.60) (.+-.3.19) (.+-.0.44) (.+-.11.31) K 2066 383 520
85.24 122.63 17.45 300.6 14.76 0 C (.+-.3.36) (.+-.28.2) (.+-.0.78)
(.+-.14.15) L 2333 185 667 63.17 176.42 3.00 354.94 36.83 0 P
(.+-.6.08) (.+-.29.9) (.+-.0.08) (.+-.19.19) M 955 1343 1940 75.56
173.73 7.49 392.53 24.44 0 P (.+-.1.23) (.+-.2.73) (.+-.0.80)
(.+-.68.16) N 2109 575 323 77.61 149.42 16.43 308.80 22.39 0 P
(.+-.12.31) (.+-.9.46) (.+-.9.36) (.+-.30.28) O 1881 148 216 66.91
195.00 9.10 310.92 33.09 0 P (.+-.14.36) (.+-.28.06) (.+-.2.92)
(.+-.6.27) P 459 80 57 65.30 110.80 4.36 355.53 34.70 0 C
(.+-.0.55) (.+-.8.02) (.+-.0.46) (.+-.33.92) Q 2469 1156 414 39.26
203.63 13.30 196.19 60.74 0 P (.+-.10.55) (.+-.17.23) (.+-.2.08)
(.+-.38.14) R 5934 1114 907 26.77 241.30 12.97 342.54 73.23 0 P
(.+-.0.04) (.+-.23.59) (.+-.0.16) (.+-.17.54) S 4070 225 300 66.06
113.39 10.89 132.24 33.94 0 C (.+-.8.19) (.+-.21.00) (.+-.5.89)
(.+-.18.5) T 1878 319 507 55.32 90.86 7.99 292.10 44.68 9.14 K
(.+-.0.72) (.+-.3.65) (.+-.2.94) (.+-.46.85) .sup.1Blood from human
volunteers obtained was anti coagulated with desirudin (10
.mu.g/ml), dispensed into 0.5 ml aliquots and inoculated with 5
.times. 10.sup.6 CFU USA300 LAC. The inoculum was enumerated by
lysing blood with 0.5 ml PBS (with 0.5% saponin, 100 U
streptokinase K, 50 .mu.g trypsin, 1 .mu.g DNAse and 5 .mu.g
RNAse), prior to plating on agar for CFU enumeration. .sup.2Serum
from coagulated blood of human volunteers was examined by ELISA for
the half-maximal IgG titer against purified recombinant proteins
derived from of S. aureus Newman genome sequence: .alpha.-hemolysin
(Hla), D1-D2 domain (D1-D2) or a tandem repeat of the R domain
carrying the N12D substitution. .sup.3Blood samples were lysed
after 60 min at 37.degree. C. with 0.5 ml PBS (0.5% saponin, 1
.mu.g DNAse, 5 .mu.g RNAse), followed by CFU enumeration. Data were
averaged from two independent determinations, SEM and percent
amount of total (60 min streptokinase treated sample) were
calculated. .sup.4Blood samples were lysed after 60 min at
37.degree. C. with 0.5 ml PBS (0.5% saponin, 100 U streptokinase,
50 .mu.g trypsin, 1 .mu.g DNAse, 5 .mu.g RNAse), followed by CFU
enumeration. Data were averaged from two independent
determinations, SEM and % of inoculum (0 min = 5 .times. 10.sup.6
CFU) calculated. .sup.5Blood was pretreated with 10 .mu.g
cytochalasin D/ml prior to infection with 5 .times. 10.sup.6 CFU
USA300 LAC. .sup.6Agglutination (%) was calculated from the percent
mock treated CFU after 60 min (without cytochalasin D) and the
Staphylococcal load enumerated with streptokinase treatment.
.sup.7Opsonophagocytic killing (OPK) (%) was calculated as the
.DELTA.0-60 min load in streptokinase treated blood without
cytochalasin D treatment. .sup.8Human blood samples were
categorized as killer (K), controllers (C) or prey (P) of MRSA
isolate USA300 LAC.
E. R Domain Antibody Promotes Phagocytosis of Fibrin-Coated
Staphylococci
[0352] When added to blood samples of volunteer B (prey), mAb 3B3
reduced the bacterial load to 63%, whereas USA300 LAC expanded to
128% in blood without antibody (3B3 vs. mock, P<0.05; FIG. 4C).
Pretreatment of blood with CD abolished phagocytosis and OPK of
USA300 LAC in the presence of mAb 3B3 (FIG. 4C). S. aureus Newman
expressing GFP was inoculated into mouse blood and neutrophils were
isolated by GR1-staining and flow cytometry (FIG. 6BC). Although
phagocytosis of Staphylococci occurred in the absence of antibody,
association of Staphylococci with neutrophils was increased in the
presence of mAb 3B3 (FIG. 6B). Further, GFP fluorescence did not
increase after 30 min, indicating that bacterial replication had
been arrested (Thammavongsa et al., 2013). Antibody-mediated uptake
of Staphylococci was not observed in neutrophils from S. aureus
coa.sub..DELTA.R samples (FIG. 6B). Neutrophil uptake of wild-type
S. aureus was accompanied by uptake of fibrin, detected by adding
Alexa488-conjugated human fibrinogen to blood samples and measuring
neutrophil fluorescence (FIG. 6C). Mouse blood infected with S.
aureus was Giemsa staining, which revealed large clumps of
fibrin-agglutinated Staphylococci outside of neutrophils (FIG. 4D).
When treated with mAb 3B3, Staphylococci appeared to be
internalized by mouse neutrophils (FIG. 4D). Mouse blood was
infected with USA300 LAC and analyzed for CFU after 30 and 60 min
incubation. Compared to mock control, mAb 3B3 promoted phagocytic
killing of USA300 LAC. As expected, OPK was blocked by
pre-treatment with CD (FIG. 4E). OPK of S. aureus was quantified in
vivo in mice with intravenous challenge of S. aureus followed by
CFU enumeration in cardiac blood 30 minutes post infection. mAb 3B3
reduced the bacterial load in mice infected with wild-type S.
aureus but not in mice infected with the coa.sub..DELTA.R variant
(FIG. 4F).
[0353] Inventors report that S. aureus evolved a unique mechanism
to escape phagocytic killing: coagulase-mediated assembly of a
fibrin shield protecting the pathogen against uptake by phagocytes.
The R domain drives the formation of the bacterial fibrin shield
that protects bacteria but also exposes trapped Coa for antibody
deposition. To avoid neutralizing antibody responses against its
key virulence determinant, coa, i.e. the coding sequence for the
D1-D2 domain, is subject to negative selection, generating variant
products that cannot be neutralized by antibodies against the D1-D2
domain of another coagulase serotype (McAdow et al., 2012a;
Watanabe et al., 2009). Inventors also show that monoclonal
antibody against the R domain target Staphylococci for OPK
destruction. If so, some R domain-specific antibodies, either
elicited through active vaccination or passively transferred
monoclonal, may protect against S. aureus bloodstream infection and
may be used to combat MRSA infections. Successful vaccines
generally rely on antibodies against bacterial surface structures
to implement pathogen destruction (Robbins et al., 1996). However,
S. aureus can escape antibody-mediated destruction by a number of
different immune evasion mechanisms, for example blocking
neutrophil chemotaxis, phagocytosis, complement activation and
antibody deposition (Spaan et al., 2013). Vaccine development
relies on standardized assays measuring OPK in cultured HL60
phagocytes supplemented with complement and antibody but not with
hemostasis factors (Nanra et al., 2013). This assay cannot assess
the immune evasive attributes of Staphylococcal coagulase and may
overestimate the role of antibodies against surface molecules to
promote OPK.
F. MATERIALS AND METHODS
[0354] Bacterial growth, strains and plasmids. S. aureus and
Escherichia coli were grown in tryptic soy and Luria broth or agar,
with ampicillin (100 .mu.g ml.sup.-1) or chloramphenicol (10 .mu.g
ml.sup.-1) when necessary. Earlier work reported S. aureus Newman
and its variants .DELTA.coa, .DELTA.vwb and .DELTA.coa/.DELTA.vwb
with or without plasmid expressing GFP or mCherry (Cheng et al.,
2010). pKOR1 was used to introduce the coa/i allele (deletions of
codons 470-605) into wild-type or .DELTA.vwb Newman (Bae and
Schneewind, 2005). Earlier work generated E. coli plasmids for
purification of full-length mature Coa (S. aureus Newman, USA300,
N315, MRSA252, 85/2082, or WIS)(McAdow et al., 2012a; Thomer et
al., 2013) or Coa Newman domains (D1, D1-D2, D1.sub..DELTA.1-18, D2
and L)(McAdow et al., 2012a). Plasmid pET15b-r.sub.ST harbors
coding sequence for the R domain (codons 470-605) and a C-terminal
Strep tag.
[0355] Identification of coagulases in cultures and clots. To
examine the secretion of coagulases, cultures of Staphylococci were
grown to an optical density A.sub.600 0.4 (.about.10.sup.8 colony
forming units (CFU) ml.sup.-1). Proteins in the supernatant, i.e. 1
ml of centrifuged culture, were precipitated with 75 .mu.l of
trichloroacetic acid 100% (w/v), washed with acetone, dried and
solubilized in 50 .mu.l sample buffer (62.5 mM Tris-HCl, pH 6.8, 2%
SDS, 10% glycerol, 5% 2-mercaptoethanol, 0.01% bromophenol blue).
To examine the fate of coagulase in fibrin clots, 950 .mu.l of
bacterial culture (.about.10.sup.8 CFU ml.sup.-1) or broth were
mixed with 50 .mu.l of PBS or human citrate-plasma for 10 min at
37.degree. C. and centrifuged at 13,000.times.g for 10 min to
separate soluble and clotted materials. 4 M urea was used to
solubilize fibrin clots prior to separation of extracts by
SDS-PAGE. Proteins were visualized with Coomassie staining or
transferred to polyvinylidene difluoride (PVDF) membranes for
immunoblotting using rabbit affinity-purified antibodies against
Coa (.alpha.-Coa) or vWbp (.alpha.-vWbp)(Thomer et al., 2013) and
mouse affinity-purified monoclonal antibodies 3B3 or 5D5.
[0356] Pull down experiments. Coa.sub.ST, Coa.sub..DELTA.R/ST and
R.sub.ST were purified over Strep-Tactin-Sepharose (IBA) following
methods described earlier for Coa subdomains and Coa strain
variants (McAdow et al., 2012a; Thomer et al., 2013). All purified
proteins were stored in PBS. For pull-down experiments,
citrate-plasma from healthy human volunteers (500 .mu.l) diluted
1:1 in PBS was applied by gravity flow over Strep-Tactin-Sepharose
beads pre-charged or not with 100 nmoles of purified Coa.sub.ST,
Coa.sub..DELTA.RST or R.sub.ST. Bound proteins were recovered by
boiling the resin in sample buffer and analyzed by SDS-PAGE
separation followed by Coomassie staining or immunoblot.
[0357] Coagulation assay. 10 .mu.l of bacterial suspension
(.about.10.sup.8 CFU ml.sup.-1) was added to 90 .mu.l of freshly
collected mouse blood anti-coagulated with sodium citrate (10 mM
final concentration) in a sterile plastic test tube (BD falcon).
Samples were incubated at room temperature and blood coagulation
was verified by tipping the tubes to 450 angles at timed intervals.
Where indicated, antibodies were added at a final concentration of
3 .mu.M. Statistical analysis was performed by two-tailed Student's
t-test using Prism (GraphPad Software).
[0358] Microscopy. For visualization of bacteria in clots, 5 .mu.l
of Staphylococci expressing mCherry (.about.10.sup.8 CFU ml.sup.-1)
were mixed for 5 min with 5 .mu.l of human citrate-plasma
supplemented with 5% Alexa488-conjugated human fibrinogen (Life
Technologies). Images of samples placed on glass slides were
captured on a SP5 tandem scanner spectral 2-photon confocal
microscope (Leica) using a 100.times. objective. For assessment of
agglutination, 1 ml of Staphylococci (.about.10.sup.8 CFU
ml.sup.-1) were incubated with 1:500 SYTO9 (Invitrogen) for 15 min,
washed twice and suspended in 1 ml of PBS. Bacteria were incubated
1:1 for 15 min with human citrate-plasma on glass microscope
slides. Where indicated, antibodies were added at a final
concentration of 3 .mu.M. Images were captured on an IX81 live cell
total internal reflection fluorescence microscope (Olympus) using a
20.times. objective. The threshold function in ImageJ software was
used to convert the image into a dichromatic format in which
Staphylococci are black and the background is white. Statistical
significance was determined by two-way analysis of variance using
Prism (GraphPad Software).
[0359] Production of monoclonal antibodies against coagulase. Three
8-week old BALB/c female mice (Jackson Laboratory) were immunized
by intraperitoneal injection with 100 .mu.g of purified recombinant
Coa.sub.NM emulsified 1:1 in Complete Freund's Adjuvant (DIFCO) for
the first immunization. On days 21 and 42, animals were boosted
with 100 .mu.g Coa.sub.NM emulsified 1:1 in Incomplete Freund's
Adjuvant (DIFCO). On days 31 and 52, animals were bled and screened
by ELISA on Nunc MaxiSorp 96-well flat bottom plates coated with
Coa. Seventy-nine days after the initial immunization, mice that
showed strong immunoreactivity to antigen were boosted with 25
.mu.g Coa in PBS. Three days later splenocytes were harvested and
fused with the mouse myeloma cell line SP2/mIL-6, an interleukin 6
secreting derivative of SP2/0 myeloma cell line. Hybridomas were
screened by ELISA and antigen-specific clones subcloned by limiting
dilution, to produce monoclonal antibody-secreting hybridomas
arising from single cells. Hybridoma cell lines were grown until a
density of 10.sup.6 cells ml.sup.-1 in DMEM-10 medium with 10% FBS
and left spending for 6 weeks. Antibodies were purified from
filtered culture supernatants by affinity chromatography as
described (McAdow et al., 2012a; Thomer et al., 2013).
[0360] ELISA. To determine the binding affinity and specificity of
mAbs, Nunc MaxiSorp 96-well plates were coated with the various Coa
variant serotypes and sub-domains prepared at a concentration of 20
nM in 0.1 M sodium bicarbonate and affinities were measured as
described earlier (McAdow et al., 2012a). ELISA plates coated with
vWbp and IsdA served as negative controls. The ability of mAbs to
interfere with the binding of prothrombin or fibrinogen was
measured as described earlier (McAdow et al., 2012a) and
statistical analyses were performed using one-way ANOVA with
Bonferroni post-test. Half-maximal IgG titers in serum from human
volunteers for binding to purified Hla, D1-D2.sub.ST or R.sub.N12D
were determined by ELISA as described previously (McAdow et al.,
2012a). R.sub.N12D is a translational hybrid between SpA.sub.KKAA,
a variant of SpA that does not bind immunoglobulin, and two 27
residue repeats of the R domain from Coa.sub.Newman, with
Asn.sup.12Asp at position 12 of each repeat, followed by a
C-terminal Strep tag; purified R.sub.N12D for is defective
fibrinogen binding.
[0361] Animal infection and immunization studies. Animals (cohorts
of 10), 6-week old, female BALB/c mice (Charles River Laboratories)
anesthetized with 100 mg ml.sup.-1 ketamine and 20 mg ml.sup.-1
xylazine per kilogram of body weight were inoculated into the
peri-orbital venous plexus with 100 .mu.l of bacterial suspension
in PBS at a concentration of 2.times.10.sup.8 CFU ml.sup.-1
(USA300), 8.times.10.sup.8 CFU ml.sup.-1 (Newman, N315, WIS) or
2.times.10.sup.9 CFU ml.sup.-1 (MRSA252). mAbs were injected at a
concentration of 5 mg kg.sup.-1 into the peritoneal cavity 10 hours
prior to challenges. Statistical analyses were performed by
two-tailed Log Rank test using Prism (GraphPad Software). To assess
the fate of Staphylococci in blood (in vivo blood survival assay),
animals were euthanized by CO.sub.2 inhalation 30 min post
infection and cardiac puncture was performed. Blood samples were
treated with 0.5% saponin to lyse eukaryotic cells, serially
diluted in PBS and plated on agar for enumeration of CFU.
Statistical analysis was performed using two-tailed Student's t
test. Animal experiments were performed in accordance with the
institutional guidelines following experimental protocol review and
approval by the Institutional Biosafety Committee (IBC) and the
Institutional Animal Care and Use Committee (IACUC).
[0362] Bacterial survival in blood, opsonophagocytosis assay and
flow cytometry analysis. To measure bacterial replication and
survival ex vivo, 0.5 ml of freshly drawn mouse or human blood
anticoagulated with 0.005 mg desirudin per ml was incubated with 50
.mu.l of a bacterial suspension containing 5.times.10.sup.5 CFU
(mouse) or 5.times.10.sup.6 CFU (human). Where indicated human
blood was processed to generate desirudin-plasma or serum. Where
indicated, 5% Alexa488-conjugated human fibrinogen (Life
Technologies), cytochalasin D (0.04 mM), or purified mouse
monoclonal antibodies (.about.10 .mu.g ml.sup.-1 final
concentration) were added to the samples. Following incubation at
37.degree. C. for 0, 30 or 60 min, 0.5 ml of PBS with 0.5% saponin
or 0.5 ml agglutination lysis buffer (0.5% saponin, 200 U
streptokinase K, 100 .mu.g trypsin, 2 .mu.g DNAse, 10 .mu.g RNAse
per ml PBS), were added to each sample for 10 min at 37.degree. C.,
prior to plating on agar for enumeration of CFU. Treatment with
agglutination lysis buffer is annotated as +SK in the figures.
Statistical analysis was performed by two-tailed Student's t-test.
For flow cytometry analysis, samples were incubated first with
lysostaphin (10 .mu.g ml.sup.-1) for 5 min to lyse extracellular
bacteria and next with erythrocyte lysis buffer (QIAGEN) for 30 min
on ice. Blood leukocytes were recovered following centrifugation at
400.times.g, washed three times and suspended in PBS containing 1%
FBS. Cells were stained with allophycocyanin-conjugated .alpha.-GR1
and analyzed using a FACSCanto (BD). The data were analyzed with
the two-tailed Student's t-test. Human volunteers were enrolled
under a protocol that was reviewed and approved by the University
of Chicago's Institutional Review Board.
Example 2
[0363] Selection of prototype Staphylocoagulase protein sequences
in dominant clinical Staphylococcus aureus lineages using molecular
epidemiology and whole-genome sequencing for inclusion into a
multicomponent Staphylococcal vaccine composition.
A. Purpose:
[0364] To collect and analyze currently available genomic
information of Staphylococcus aureus strain diversity for the
purpose of prevalence-based selection of prototype
Staphylocoagulase (Coa) sequences. These dominant full-length Coa
sequences will form the basis for selecting the most representative
R-domains from clinically relevant Staphylococcus aureus
strains.
B. Methods
[0365] 1. Molecular Epidemiology of Dominant Staphylococcal
Sequence Types (STs)
[0366] A Sequence Type (ST) is defined by the Multi Locus Sequence
Typing (MLST) technique, which characterizes the nucleotide
sequences of a number of housekeeping genes. For each housekeeping
gene in an isolate an allele number is assigned to the
corresponding sequence according to an existing nomenclature (i.e.
each unique allele sequence has its own unique allele number). The
resulting combination of allele numbers defines the allelic profile
or Sequence Type (ST), according to the defined nomenclature. In
the case of S. aureus, 7 housekeeping genes are used for defining
the ST. The S. aureus MLST nomenclature is found on the world wide
web at http://saureus.mlst.net.
[0367] USA: Dominant Methicillin-Resistant Staphylococcus aureus
(MRSA) sequence types (STs) in the USA were identified based on
prevalence data as reported by the Active Bacterial Core
Surveillance (ABCs) as part of the Emerging Infections Program
Network on Methicillin-Resistant Staphylococcus aureus infections
(Center for Disease Control (CDC), for the period 2005-2013,
described on the world wide web at
cdc.gov/abcs/reports-findings/survreports/mrsa13.pdf).
[0368] EU: Dominant Methicillin-Sensitive Staphylococcus aureus
(MSSA) & MRSA STs in the EU were identified based on prevalence
data as reported by Grundmann et al. (Grundmann et al. 2010 PLoS
Med. 7(1): e1000215, PMID20084094; Grundmann et al. 2014 Euro
Surveill. 19(49). pii: 20987, PMID25523972).
[0369] Asia: Dominant MSSA & MRSA STs in Asia were identified
based on multiple reviews and meta-analyses including Chen and
Huang, 2014, Clin Microbiol Infection PMID: 24888414; Chuang and
Huang, 2013, Lancet Infect Disease PMID:23827369; and Chung et al.,
2015 IJAA (PMID:25982914).
[0370] 2. Whole-Genome Sequence Data & Assembly.
[0371] Publicly available whole-genome sequence (WGS) assemblies
for S. aureus were extracted from GenBank on 16 Jul. 2015.
Additional S. aureus WGS data were collected from two publicly
available repositories of the Wellcome Trust Sanger Institute
(described on the world wide web at
sanger.ac.uk/resources/downloads/bacteria/staphylococcus-aureus.html).
The first repository contained data from the British Society for
Antimicrobial Chemotherapy (BSAC, described on the world wide web
at bsac.org.uk/) (#project_2036 on the Sanger website). BSAC
collects a broad selection of microorganisms from both community-
and hospital-acquired infections. Up to 6000 clinical isolates are
collected each year across the UK and Ireland. Paired-end Illumina
reads for 203 S. aureus isolates were downloaded from this
repository on 20 Nov. 2014. Assemblies were built with SPAdes 3.1.1
(Bankevitch et al. 2012 J Comput Biol. 19(5):455-77, PMID:
22506599) using default settings. All 203 isolates were MRSA from
human blood, isolated in the years 2009 and 2010. The second
repository contained data from a study describing the genetic
diversity of S. aureus in Europe (see, eg. world wide web at
sanger.ac.uk/resources/downloads/bacteria/Staphylococcus
aureus.html. on the Sanger website). Collection and typing of these
European isolates has been described in two studies by Grundmann
and colleagues (Grundmann et al. 2010 PLoS Med. 7(1): e1000215,
PMID20084094; Grundmann et al. 2014 Euro Surveill. 19(49). pii:
20987, PMID25523972). In the first study, MSSA and MRSA isolates
had been collected from 450 hospitals in 26 European countries in
2006 and 2007. Of these isolates, 90.1% were isolated from blood.
In the second study, MSSA and MRSA isolates had been collected from
453 hospitals in 25 European countries in 2011. These isolates came
from subjects with S. aureus bloodstream infections. The available
WGS data on the Sanger website corresponded to a representative
selection of 589 S. aureus isolates from the two studies described
above. Paired-end Illumina reads for these isolates were downloaded
on 26 Aug. 2015. Reads were quality-filtered using the Nesoni
toolset 0.131 (see, eg.
github.com/Victorian-Bioinformatics-Consortium/nesoni). Default
settings were used, including clipping of low-quality and ambiguous
bases and adapter sequences. Reads shorter than 51 bp as well as
their paired reads were discarded. Quality-filtered reads were
assembled with SPAdes 3.6.0, using the "careful" option and k-mer
values 27, 37 and 47.
[0372] 3. In Silico Multi-Locus Sequence Typing (MLST).
[0373] S. aureus WGS assemblies were typed using the available MLST
scheme for S. aureus. Alleles were typed on the basis of perfect
BLAST matches.
[0374] 4. Gene Prediction and Annotation.
[0375] Genes were predicted and annotated in WGS assemblies using
Prokka 1.11 (see, eg. github.com/tseemann/prokka). Coa (annotated
as "staphylocoagulase") protein sequences were extracted from the
Prokka annotations. Full-length Coa sequences were defined as those
Coa sequences that contained the N-terminal 3-amino-acid stretch
"MKK" and the C-terminal 3-amino-acid stretch "VTK". Assessment of
the Coa sequence variation within specific Coa collections was
determined using CD-HIT 4.6 (described on the world wide web at
bioinformatics.org/cd-hit/). CD-HIT was run using 100% identity
clustering (option: -c 1.0), allowing no redundancy (option: -t 0)
and using the most accurate clustering approach (option: -g 1).
C. Results:
[0376] 1. Molecular Epidemiology
[0377] A detailed analysis of molecular epidemiological data was
used to identify dominant S. aureus lineages in USA, Europe and
Asia:
[0378] a. USA
[0379] Prevalence data as reported by the Active Bacterial Core
Surveillance (ABCs) as part of the Emerging Infections Program
Network on Methicillin-Resistant Staphylococcus aureus infections
demonstrates that MRSA multilocus sequence type ST5 (USA100) and
ST8 (USA300) are predominantly associated with invasive MRSA
infections in the USA hospital (HA) and community (CA)
settings.
[0380] b. EU
[0381] Based on the large European surveillance studies performed
in 2006 and 2011 (Grundmann et al. 2010 PLoS Med. 7(1): e1000215,
PMID20084094; Grundmann et al. 2014 Euro Surveill. 19(49). pii:
20987, PMID25523972) we identified ST22 (i.e. EMRSA-15), first
detected in UK in early 1990s, as a dominant clone throughout
healthcare settings across Europe. Other important European clones
are ST8=CC8 (USA300), ST5, ST125, ST225=CC5 (USA100), ST30 and
ST45.
[0382] c. Asia
[0383] The epidemiology of S. aureus in both healthcare facilities
and communities in Asia has been extensively addressed, with an
emphasis on the prevalence, clonal structure and antibiotic
resistant profiles of the MRSA strains in several recent reviews
(Chen and Huang, 2014, Clin Microbiol Infection PMID: 24888414 and
Chuang and Huang, 2013, Lancet Infect Disease PMID:23827369). Two
dominant HA-MRSA clones, namely ST239 and ST5, are disseminated
throughout Asia.
[0384] In conclusion, we identified 6 dominant clinically-relevant
S. aureus lineages (or sequence types, ST) in USA, Europe and Asia,
corresponding to ST5, ST8, ST22, ST30, ST45 and ST239.
[0385] 2. S. aureus Whole-Genome Sequences
[0386] 4512 S. aureus WGS assembly projects were available in
GenBank. Based on available publications and meta-data, an initial
selection was made, thereby discarding all non-human isolates and
isolates without sufficient meta-data. Isolates with associated
publications were kept anyway, because these are often
well-characterized reference isolates. The initial screening
resulted in 2177 relevant isolates, including 166 with associated
publications. Further searches in GenBank and PubMed showed that
among the remaining 2011 isolates, 1951 could be manually linked to
sequencing projects/studies. Finally, the collection was split into
two collections: the first one being of primary interest and
containing 1043 recent (from year 1995 or later) clinical human
isolates, the other one being of secondary interest and containing
1134 older (from before 1995) and/or non-clinical isolates (e.g.
from eye, throat, nares, skin, stool, household surfaces, etc). The
primary collection was supplemented with (i) 203 WGS assemblies
from the BSAC collection, which comprised MRSA blood isolates from
the UK from the years 2009 and 2010 and (ii) 376 assembled genomes
from the Grundmann collection, which comprised MRSA and MSSA blood
isolates from Europe from the years 2006 and 2011. In summary, our
final primary WGS collection consisted of 1043 (GenBank)+203
(BSAC)+376 (Grundmann)=1622 WGS assemblies. Our final secondary
collection consisted of 1134 WGS assemblies (GenBank).
[0387] 3. MLST Profiling
[0388] In silico MLST profiling of the final primary WGS collection
(n=1622 genomes) showed that all six dominant lineages were present
in the following amounts: ST5 (n=540), ST8 (n=84), ST22 (n=205),
ST30 (n=38), ST45 (n=60), ST239 (n=17). In silico MLST profiling of
the final secondary WGS collection (n=1134 genomes) showed that all
six dominant lineages were present in the following amounts: ST5
(n=493), ST8 (n=252), ST22 (n=2), ST30 (n=5), ST45 (n=17), ST239
(n=7).
[0389] 4. Identification of Full-Length Coa Sequences
[0390] Identification of Coa sequences in the WGS assemblies
belonging to the 6 dominant S. aureus lineages indicated that the
majority of these isolates have a full-length Coa, containing the
N-terminal 3-amino-acid stretch "MKK" and the C-terminal
3-amino-acid stretch "VTK". Within the primary WGS collection, the
percentage of isolates with a full-length Coa ranged from 82%
(ST239) to 98% (ST8) (Table 1). Within the secondary collection,
the percentage of isolates with a full-length Coa ranged from 0%
(ST22) to 100% (ST8 and ST239) (Table 2).
TABLE-US-00010 TABLE 1 Identification of full-length Coa in six
dominant S. aureus lineages in the primary WGS collection. #
ISOLATES % ISOLATES LINEAGE # ISOLATES IN WITH FULL- WITH FULL-
(ST) COLLECTION LENGTH COA LENGTH COA ST5 540 457 85% ST8 84 82 98%
ST22 205 165 80% ST30 38 37 97% ST45 60 57 95% ST239 17 14 82%
TABLE-US-00011 TABLE 2 Identification of full-length Coa in six
dominant S. aureus lineages in the secondary WGS collection. #
ISOLATES % ISOLATES LINEAGE # ISOLATES IN WITH FULL- WITH FULL-
(ST) COLLECTION LENGTH COA LENGTH COA ST5 493 300 61% ST8 252 251
100% ST22 2 0 0% ST30 5 4 80% ST45 17 16 94% ST239 7 7 100%
[0391] 5. Coa Sequence Variation
[0392] To assess the Coa sequence variation within the dominant S.
aureus lineages, we collected all corresponding full-length Coa
sequences from the primary collection. Since the number of WGS
assemblies (and hence full-length Coa) in the primary collection
was limited for ST30 and ST239 (i.e. below n=50 for both), we also
used the full-length Coa sequences found in the secondary
collection for these STs.
[0393] a. ST5
[0394] Sequence analysis of the 457 full-length Coa sequences
identified in the ST5 isolates revealed a total of 42 unique
sequences, of which 24 were found once (i.e. each one in one single
isolate). Another 5 unique sequences were found twice (i.e. each
one found in two isolates). Of the remaining 13 unique sequences
the three most dominant ones were found in 191, 85 and 59 isolates.
Thus the 3 most dominant Coa sequences represented 73% of the
full-length Coa sequences in ST5 (i.e. 191+85+59=335 of the 457).
The reference isolates N315 and Mu50 both contain the second most
dominant Coa found within ST5. The 3 dominant ST5 Coa sequences are
listed below in fasta-format, in the order from most to least
dominant. R domains are underlined. Reference isolate(s) in which
the corresponding sequence is found is/are given in brackets in the
sequence header.
TABLE-US-00012 >CoaST5_1_n191 (SEQ ID NO: 22)
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNEKSKKGATVSDY
YYWKIIDSLEAQFTGAIDLLEDYKYGDPIYKEAKDRLMTRVLGEDQYLLKK
KIDEYELYKKWYKSSNKNTNMLTFHKYNLYNLTMNEYNDIFNSLKDAVYQF
NKEVKEIEHKNVDLKQFDKDGEDKATKEVYDLVSEIDTLVVTYYADKDYGE
HAKELRAKLDLILGDTDNPHKITNERIKKEMIDDLNSIIDDFFMETKQNRP
NSITKYDPTKHNFKEKSENKPNFDKLVEETKKAVKEADESWKNKTVKKYEE
TVTKSPVVKEEKKVEEPQLPKVGNQQEVKTTAGKAEETTQPVAQPLVKIPQ
ETIYGETVKGPEYPTMENKTLQGEIVQGPDFLTMEQNRPSLSDNYTQPTTP
NPILEGLEGSSSKLEIKPQGTESTLKGIQGESSDIEVKPQATETTEASQYG
PRPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTN
QDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQKKPSKTNAYNV
TTHANGQVSYGARPTQKKPSKTNAYNVTTHANGQVSYGARPTYKKPSETNA
YNVTTHANGQVSYGARLTQKKPSETNAYNVTTHADGTATYGPRVTK R Domain: (SEQ ID
NO: 85) ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQV
SYGARPTQKKPSKTNAYNVTTHANGQVSYGARPTQKKPSKTNAYNVTTHAN
GQVSYGARPTYKKPSETNAYNVTTHANGQVSYGARLTQKKPSETNAYNVTT HADGTATYG
>CoaST5_2_n85 (Mu50, N315) (SEQ ID NO: 23)
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNEKSKKGATVSDY
YYWKIIDSLEAQFTGAIDLLEDYKYGDPIYKEAKDRLMTRVLGEDQYLLKK
KIDEYELYKKWYKSSNKNTNMLTFHKYNLYNLTMNEYNDIFNSLKDAVYQF
NKEVKEIEHKNVDLKQFDKDGEDKATKEVYDLVSEIDTLVVTYYADKDYGE
HAKELRAKLDLILGDTDNPHKITNERIKKEMIDDLNSIIDDFFMETKQNRP
NSITKYDPTKHNFKEKSENKPNFDKLVEETKKAVKEADESWKNKTVKKYEE
TVTKSPVVKEEKKVEEPQLPKVGNQQEVKTTAGKAEETTQPVAQPLVKIPQ
ETIYGETVKGPEYPTMENKTLQGEIVQGPDFLTMEQNRPSLSDNYTQPTTP
NPILEGLEGSSSKLEIKPQGTESTLKGIQGESSDIEVKPQATETTEASQYG
PRPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTN
QDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQKKPSKTNAYNV
TTHANGQVSYGARPTQKKPSKTNAYNVTTHANGQVSYGARPTYKKPSETNA
YNVTTHANGQVSYGARPTQKKPSETNAYNVTTHADGTATYGPRVTK R Domain: (SEQ ID
NO: 86) ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQV
SYGARPTQKKPSKTNAYNVTTHANGQVSYGARPTQKKPSKTNAYNVTTHAN
GQVSYGARPTYKKPSETNAYNVTTHANGQVSYGARPTQKKPSETNAYNVTT HADGTATYG
>CoaST5_3_n59 (SEQ ID NO: 24)
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNEKSKKGATVSDY
YYWKIIDSLEAQFTGAIDLLEDYKYGDPIYKEAKDRLMTRVLGEDQYLLKK
KIDEYELYKKWYKSSNKNTNMLTFHKYNLYNLTMNEYNDIFNSLKDAVYQF
NKEVKEIEHKNVDLKQFDKDGEDKATKEVYDLVSEIDTLVVTYYADKDYGE
HAKELRAKLDLILGDTDNPHKITNERIKKEMIDDLNSIIDDFFMETKQNRP
NSITKYDPTKHNFKEKSENKPNFDKLVEETKKAVKEADESWKNKTVKKYEE
TVTKSPVVKEEKKVEEPQLPKVGNQQEVKTTAGKAEETTQPVAQPLVKIPQ
ETIYGETVKGPEYPTMENKTLQGEIVQGPDFLTMEQNRPSLSDNYTQPTTP
NPILEGLEGSSSKLEIKPQGTESTLKGIQGESSDIEVKPQATETTEASQYG
PRPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTN
QDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTYKKPSETNAYNV
TTHANGQVSYGARPTQKKPSKTNAYNVTTHANGQVSYGARPTYKKPSETNA
YNVTTHANGQVSYGARPTQKKPSETNAYNVTTHADGTATYGPRVTK R Domain: (SEQ ID
NO: 87) ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQV
SYGARPTYKKPSETNAYNVTTHANGQVSYGARPTQKKPSKTNAYNVTTHAN
GQVSYGARPTYKKPSETNAYNVTTHANGQVSYGARPTQKKPSETNAYNVTT HADGTATYG
[0395] b. ST8
[0396] Sequence analysis of the 82 full-length Coa sequences
identified in the ST8 isolates revealed a total of 6 unique
sequences, of which 2 were found once (i.e. each one in one single
isolate). Another 2 unique sequences were found twice (i.e. each
one found in two isolates). The remaining 2 unique sequences were
the most dominant ones and were found in 57 and 19 isolates. Thus
the 2 most dominant Coa sequences represented 93% of the
full-length Coa sequences in ST8 (i.e. 57+19=76 of the 82). The
reference isolates Newman and USA300 contain the most dominant and
second most dominant Coa found within ST8, respectively. The 2
dominant ST8 Coa sequences are listed below in fasta-format, in the
order from most to least dominant. R domains are underlined.
Reference isolate(s) in which the corresponding sequence is found
is/are given in brackets in the sequence header.
TABLE-US-00013 >CoaST8_1_n57 (Newman) (SEQ ID NO: 25)
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKNGTLIDSR
YLNSALYYLEDYIIYAIGLTNKYEYGDNIYKEAKDRLLEKVLREDQYLLER
KKSQYEDYKQWYANYKKENPRTDLKMANFHKYNLEELSMKEYNELQDALKR
ALDDFHREVKDIKDKNSDLKTFNAAEEDKATKEVYDLVSEIDTLVVSYYGD
KDYGEHAKELRAKLDLILGDTDNPHKITNERIKKEMIDDLNSIIDDFFMET
KQNRPKSITKYNPTTHNYKTNSDNKPNFDKLVEETKKAVKEADDSWKKKTV
KKYGETETKSPVVKEEKKVEEPQAPKVDNQQEVKTTAGKAEETTQPVAQPL
VKIPQGTITGEIVKGPEYPTMENKTVQGEIVQGPDFLTMEQSGPSLSNNYT
NPPLTNPILEGLEGSSSKLEIKPQGTESTLKGTQGESSDIEVKPQATETTE
ASQYGPRPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAY
NVTTHANGQVSYGARPTYKKPSETNAYNVTTHANGQVSYGARPTQNKPSKT
NAYNVTTHGNGQVSYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYKKP
SKTNAYNVTTHADGTATYGPRVTK R Domain: (SEQ ID NO: 88)
ARPRFNKPSETNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTTHANGQV
SYGARPTQNKPSKTNAYNVTTHGNGQVSYGARPTQNKPSKTNAYNVTTHAN
GQVSYGARPTYKKPSKTNAYNVTTHADGTATYG >CoaST8_2_n19 (USA300) (SEQ ID
NO: 26) MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKNGTLIDSR
YLNSALYYLEDYIIYAIGLTNKYEYGDNIYKEAKDRLLEKVLREDQYLLER
KKSQYEDYKQWYANYKKENPRTDLKMANFHKYNLEELSMKEYNELQDALKR
ALDDFHREVKDIKDKNSDLKTFNAAEEDKATKEVYDLVSEIDTLVVSYYGD
KDYGEHAKELRAKLDLILGDTDNPHKITNERIKKEMIDDLNSIIDDFFMET
KQNRPKSITKYNPTTHNYKTNSDNKPNFDKLVEETKKAVKEADDSWKKKTV
KKYGETETKSPVVKEEKKVEEPQAPKVDNQQEVKTTAGKAEETTQPVAQPL
VKIPQGTITGEIVKGPEYPTMENKTVQGEIVQGPDFLTMEQSGPSLSNNYT
NPPLTNPILEGLEGSSSKLEIKPQGTESTLKGTQGESSDIEVKPQATETTE
ASQYGPRPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAY
NVTTHANGQVSYGARPTQNKPSKTNAYNVTTHGNGQVSYGARPTQNKPSKT
NAYNVTTHANGQVSYGARPTYKKPSKTNAYNVTTHADGTATYGPRVTK R Domain: (SEQ ID
NO: 89) ARPRFNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHGNGQV
SYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYKKPSKTNAYNVTTHAD GTATYG
[0397] C. ST22
[0398] Sequence analysis of the 165 full-length Coa sequences
identified in the ST22 isolates revealed a total of 25 unique
sequences, of which 17 were found once (i.e. each one in one single
isolate). Another 3 unique sequences were found three times (i.e.
each one found in three isolates). Of the remaining 5 unique
sequences, the three most dominant Coa sequences were found in 123,
8 and 5 isolates. Thus the 3 most dominant Coa sequences
represented 82% of the full-length Coa sequences in ST22 (i.e.
123+8+5=136 of the 165). The 3 dominant ST22 Coa sequences are
listed below in fasta-format, in the order from most to least
dominant. R domains are underlined.
TABLE-US-00014 >CoaST22_1_n123 (SEQ ID NO: 27)
MKKQIISLGALAVASSLFTWDNKADAIVTKDYNGKSQVKKESKNGTLIDSR
YYWEKIEALEKQFSSALALTDEYQYGGNEYKEAKDKLMERILGEDQYLLKK
KIDEYDYYKKWYKATYPNDNSKMYSFHKYNVYYLTMNEYNEITNSLKDAVE
KENNEVRDIQSKNEDLKPYDENTEKQETDKIYEFVSEIDTVFAAYYSHEKF
GIHAKELRAKLDIILGDVHNPNRITNERIKKEMMEDLNSIVDDFFMETNQN
RPTTIKKYDPNIHDYTKKKENKENFDKLVKETREAVEKADESWKNKTVKKY
EETVTKSPFVKEEKKVEEPQLPKVGNQQEVKTTAGKAEETTQPLVKIPQGT
ITGEIVKGPDYPTMENKTLQGEIVQGPDFPTMEQNRPSLSDNYTQPTTTNP
ILEGLEGSSSKLEIKPQGTESTLQGTQGESSDIEVKPQATETTEASQYGPR
PQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTNQD
GTVTYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTT
HANGQVSYGARPTQNKASETNAYNVTTHANGQVSYGARPTQNKPSKTNAYN
VTTHGNGQVSYGARPTYKKPSETNAYNVTTHADGTATYGPRVTK R Domain: (SEQ ID NO:
90) ARPRFNKPSETNAYNVTTNQDGTVTYGARPTQNKPSKTNAYNVTTHANGQV
SYGARPTYKKPSETNAYNVTTHANGQVSYGARPTQNKASETNAYNVTTHAN
GQVSYGARPTQNKPSKTNAYNVTTHGNGQVSYGARPTYKKPSETNAYNVTT HADGTATYG
>CoaST22_2_n8 (SEQ ID NO: 28)
MKKQIISLGALAVASSLFTWDNKADAIVTKDYNGKSQVKKESKNGTLIDSR
YYWEKIEALEKQFSSALALTDEYQYGGNEYKEAKDKLMERILGEDQYLLKK
KIDEYDYYKKWYKATYPNDNSKMYSFHKYNVYYLTMNEYNEISNSLKDAVE
KFNNEVRDIQSKNEDLKPYDENTEKQETDKIYEFVSEIDTVFAAYYSHEKF
GIHAKELRAKLDIILGDVHNPNRITNERIKKEMMEDLNSIVDDFFMETNQN
RPTTIKKYDPNIHDYTKKKENKENFDKLVKETREAVEKADESWKNKTVKKY
EETVTKSPFVKEEKKVEEPQLPKVGNQQEVKTTAGKAEETTQPLVKIPQGT
ITGEIVKGPDYPTMENKTLQGEIVQGPDFPTMEQNRPSLSDNYTQPTTTNP
ILEGLEGSSSKLEIKPQGTESTLQGTQGESSDIEVKPQATETTEASQYGPR
PQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTNQD
GTVTYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTT
HANGQVSYGARPTQNKASETNAYNVTTHANGQVSYGARPTQNKPSKTNAYN
VTTHGNGQVSYGARPTYKKPSETNAYNVTTHADGTATYGPRVTK R Domain: (SEQ ID NO:
91) ARPRFNKPSETNAYNVTTNQDGTVTYGARPTQNKPSKTNAYNVTTHANGQV
SYGARPTYKKPSETNAYNVTTHANGQVSYGARPTQNKASETNAYNVTTHAN
GQVSYGARPTQNKPSKTNAYNVTTHGNGQVSYGARPTYKKPSETNAYNVTT HADGTATYG
>CoaST22_3_n5 (SEQ ID NO: 29)
MKKQIISLGALAVASSLFTWDNKADAIVTKDYNGKSQVKKESKNGTLIDSR
YYWEKIEALEKQFSSALALTDEYQYGGNEYKEAKDKLMERILGEDQYLLKK
KIDEYDYYKKWYKATYPNDNSKMYSFHKYNVYYLTMNEYNEITNSLKDAVE
KFNNEVRDIQSKNEDLKPYDENTEKQETDKIYEFVSEIDTVFAAYYSHEKF
GIHAKELRAKLDIILGDVHNPNRITNERIKKEMMEDLNSIVDDFFMETNQN
RPTTIKKYDPNIHDYTKKKENKENFDKLVKETREAVEKADESWKNKTVKKY
EETVTKSPFVKEEKKVEEPQLPKVGNQQEVKTTAGKAEETTQPLVKIPQGT
ITGEIVKGPDYPTMENKTLQGEIVQGPDFPTMEQNRPSLSDNYTQPTTTNP
ILEGLEGSSSKLEIKPQGTESTLQGTQGESSDIEVKPQATETTEASQYGPR
PQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTNQD
GTVTYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTT HANGTATYGPRVTK
R Domain: (SEQ ID NO: 92)
ARPRFNKPSETNAYNVTTNQDGTVTYGARPTQNKPSKTNAYNVTTHANGQV
SYGARPTYKKPSETNAYNVTTHANGTATYG
[0399] d. ST30
[0400] Sequence analysis of the 41 full-length Coa sequences
identified in the ST30 isolates revealed a total of 9 unique
sequences, of which 6 were found once (i.e. each one in one single
isolate). The remaining 3 unique sequences were the most dominant
ones and were found in 27, 5 and 3 isolates. Thus the 3 most
dominant Coa sequences represented 85% of the full-length Coa
sequences in ST30 (i.e. 27+5+3=35 of the 41). The reference isolate
MRSA252, which is not an ST30 but an ST36 isolate (a single locus
variant of ST30), contains the most dominant Coa found within ST30.
The reference isolate 85/2082, which is not an ST30 but an ST239
isolate, contains the second most dominant Coa found within ST30
(this Coa was found to be identical to the most dominant Coa within
ST239: see below). The 3 dominant ST30 Coa sequences are listed
below in fasta-format, in the order from most to least dominant. R
domains are underlined. Reference isolate(s) in which the
corresponding sequence is found is/are given in brackets in the
sequence header.
TABLE-US-00015 >CoaST30_1_n27 (MRSA252) (SEQ ID NO: 30)
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNENSKYDTPIPDW
YLGSILNRLGDQIYYAKELTNKYEYGEKEYKQAIDKLMTRVLGEDHYLLEK
KKAQYEAYKKWFEKHKSENPHSSLKKIKFDDFDLYRLTKKEYNELHQSLKE
AVDEFNSEVKNIQSKQKDLLPYDEATENRVTNGIYDFVCEIDTLYAAYFNH
SQYGHNAKELRAKLDIILGDAKDPVRITNERIRKEMMDDLNSIIDDFFMDT
NMNRPLNITKFNPNIHDYTNKPENRDNFDKLVKETREAIANADESWKTRTV
KNYGESETKSPVVKEEKKVEEPQLPKVGNQQEDKITVGTTEEAPLPIAQPL
VKIPQGTIQGEIVKGPEYLTMENKTLQGEIVQGPDFPTMEQNRPSLSDNYT
QPTTPNPILKGIEGNSTKLEIKPQGTESTLKGTQGESSDIEVKPQATETTE
ASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAY
NVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKPSET
NAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHADGTATYGPRVTK R Domain: (SEQ ID
NO: 93) ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQV
SYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHAD GTATYG
>CoaST30_2_n5 (85/2082) (SEQ ID NO: 31)
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNENSKYDTPIPDW
YLGSILNRLGDQIYYAKELTNKYEYGEKEYKQAIDKLMTRVLGEDHYLLEK
KKAQYEAYKKWFEKHKSENPHSSLKKIKFDDFDLYRLTKKEYNELHQSLKE
AVDEFNSEVKNIQSKQKDLLPYDEATENRVTNGIYDFVCEIDTLYAAYFNH
SQYGHNAKELRAKLDIILGDAKDPVRITNERIRKEMMDDLNSIIDDFFMDT
NMNRPLNITKFNPNIHDYTNKPENRDNFDKLVKETREAVANADESWKTRTV
KNYGESETKSPVVKEEKKVEEPQLPKVGNQQEDKITVGTTEEAPLPIAQPL
VKIPQGTIQGEIVKGPEYLTMENKTLQGEIVQGPDFPTMEQNRPSLSDNYT
QPTTPNPILKGIEGNSTKLEIKPQGTESTLKGTQGESSDIEVKPQATETTE
ASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAY
NVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTYKKPSET
NAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKP
SETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHADGTATYGPRVTK R Domain: (SEQ
ID NO: 94) ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQV
SYGARPTYKKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHAN
GQVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTT HADGTATYG
>CoaST30_3_n3 (SEQ ID NO: 32)
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNENSKYDTPIPDW
YLGSILNRLGDQIYYAKELTNKYEYGEKEYKQAIDKLMTRVLGEDHYLLEK
KKAQYEAYKKWFEKHKSENPHSSLKKIKFDDFDLYRLTKKEYNELHQSLKE
AVDEFNSEVKNIQSKQKDLLPYDEATENRVTNGIYDFVCEIDTLYAAYFNH
SQYGHNAKELRAKLDIILGDAKDPVRITNERIRKEMMDDLNSIIDDFFMDT
NMNRPLNITKFNPNIHDYTNKPENRDNFDKLVKETREAIANADESWKTRTV
KNYGESETKSPVVKEEKKVEEPQLPKVGNQQEDKITVGTTEEAPLPIAQPL
VKIPQGTIQGEIVKGPEYLTMENKTLQGEIVQGPDFPTMEQNRPSLSDNYT
QPTTPNPILKGIEGNSTKLEIKPQGTESTLKGTQGESSDIEVKPQATETTE
ASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAY
NVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTYKKPSET
NAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKP
SETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHADGTATYGPRVTK R Domain: (SEQ
ID NO: 95) ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQV
SYGARPTYKKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHAN
GQVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTT HADGTATYG
[0401] e. ST45
[0402] Sequence analysis of the 57 full-length Coa sequences
identified in the ST45 isolates revealed a total of 19 unique
sequences, of which 12 were found once (i.e. each one in one single
isolate). Another 2 unique sequences were found twice (i.e. each
one found in two isolates). Of the remaining 5 unique sequences the
three most dominant ones were found in 16, 15 and 4 isolates. Thus
the 3 most dominant Coa sequences represented 61% of the
full-length Coa sequences in ST45 (i.e. 16+15+4=35 of the 57). The
reference isolates WIS contains the second most dominant Coa found
within ST45. The 3 dominant ST45 Coa sequences are listed below in
fasta-format, in the order from most to least dominant. R domains
are underlined. Reference isolate(s) in which the corresponding
sequence is found is/are given in brackets in the sequence
header.
TABLE-US-00016 >ST45_1_n16 (SEQ ID NO: 33)
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKNGKQIADG
YYWGIIENLENQFYNIFHLLDQHKYAEKEYKDALDKLKTRVLEEDQYLLER
KKEKYEIYKELYKKYKKENPNTQVKMKAFDKYDLGDLTMEEYNDLSKLLTK
ALDNFKLEVKKIESENPDLRPYSESEERTAYGKIDSLVDQAYSVYFAYVTD
AQHKTEALNLRAKIDLILGDEKDPIRVTNQRTEKEMIKDLESIIDDFFIET
KLNRPQHITRYDGTKHDYHKHKDGFDALVKETREAVSKADESWKTKTVKKY
GETETKYPVVKEEKKVEEPQSPKVSEKVDVQETVGTTEEAPLPIAQPLVKL
PQIGTQGEIVKGPDYPTMENKTLQGVIVQGPDFPTMEQNRPSLSDNYTQPS
VTLPSITGESTPTNPILKGIEGNSSKLEIKPQGTESTLKGIQGESSDIEVK
PQATETTEASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFN
KPSETNAYNVTTNQDGTVSYGARPTQNKPSKTNAYNVTTHANGQVSYGARP
TYNKPSKTNAYNVTTHADGTATYGPRVTK R Domain: (SEQ ID NO: 96)
ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSKTNAYNVTTHANGQV
SYGARPTYNKPSKTNAYNVTTHADGTATYG >ST45_2_n15 (WIS) (SEQ ID NO: 34)
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKNGKQIADG
YYWGIIENLENQFYNIFHLLDQHKYAEKEYKDALDKLKTRVLEEDQYLLER
KKEKYEIYKELYKKYKKENPNTQVKMKAFDKYDLGDLTMEEYNDLSKLLTK
ALDNFKLEVKKIESENPDLRPYSESEERTAYGKIDSLVDQAYSVYFAYVTD
AQHKTEALNLRAKIDLILGDEKDPIRVTNQRTEKEMIKDLESIIDDFFIET
KLNRPQHITRYDGTKHDYHKHKDGFDALVKETREAVSKADESWKTKTVKKY
GETETKYPVVKEEKKVEEPQSPKVSEKVDVQETVGTTEEAPLPIAQPLVKL
PQIGTQGEIVKGPDYPTMENKTLQGVIVQGPDFPTMEQNRPSLSDNYTQPS
VTLPSITGESTPTNPILKGIEGNSSKLEIKPQGTESTLKGIQGESSDIEVK
PQATETTEASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFN
KPSETNAYNVTTNQDGTVSYGARPTQNKPSKTNAYNVTTHANGQVSYGARP
TYNKPSETNAYNVTTNRDGTVSYGARPTQNKPSETNAYNVTTHGNGQVSYG
ARPTQKKPSKTNAYNVTTHANGQVSYGARPTYNKPSKTNAYNVTTHADGTA TYGPRVTK R
Domain: (SEQ ID NO: 97)
ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSKTNAYNVTTHANGQV
SYGARPTYNKPSETNAYNVTTNRDGTVSYGARPTQNKPSETNAYNVTTHGN
GQVSYGARPTQKKPSKTNAYNVTTHANGQVSYGARPTYNKPSKTNAYNVTT HADGTATYG
>ST45_3_n4 (SEQ ID NO: 35)
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSGKSQVNAGSKNGKQIADG
YYWGIIENLENQFYNIFHLLDQHKYAEKEYKDALDKLKTRVLEEDQYLLER
KKEKYEIYKELYKKYKKENPNTQVKMKAFDKYDLGDLTMEEYNDLSKLLTK
ALDNFKLEVKKIESENPDLRPYSESEERTAYGKIDSLVDQAYSVYFAYVTD
AQHKTEALNLRAKIDLILGDEKDPIRVTNQRTEKEMIKDLESIIDDFFIET
KLNRPQHITRYDGTKHDYHKHKDGFDALVKETREAVSKADESWKTKTVKKY
GETETKYPVVKEEKKVEEPQSPKVSEKVDVQETVGTTEEAPLPIAQPLVKL
PQIGTQGEIVKGPDYPTMENKTLQGVIVQGPDFPTMEQNRPSLSDNYTQPS
VTLPSITGESTSTNPILKGIEGNSSKLEIKPQGTESTLKGIQGESSDIEVK
PQATETTEASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFN
KPSETNAYNVTTNQDGTVSYGARPTQNKPSKTNAYNVTTHANGQVSYGARP
TYNKPSETNAYNVTTNRDGTVSYGARPTQNKPSETNAYNVTTHGNGQVSYG
ARPTQKKPSKTNAYNVTTHANGQVSYGARPTQKKPSKTNAYNVTTHADGTA TYGPRVTK R
Domain: (SEQ ID NO: 98)
ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSKTNAYNVTTHANGQV
SYGARPTYNKPSETNAYNVTTNRDGTVSYGARPTQNKPSETNAYNVTTHGN
GQVSYGARPTQKKPSKTNAYNVTTHANGQVSYGARPTQKKPSKTNAYNVTT HADGTATYG
[0403] f. ST239
[0404] Sequence analysis of the 21 full-length Coa sequences
identified in the ST239 isolates revealed a total of 7 unique
sequences, of which 4 were found once (i.e. each one in one single
isolate). The remaining 3 unique sequences were the most dominant
ones and were found in 10, 4 and 3 isolates. Thus the 3 most
dominant Coa sequences represented 81% of the full-length Coa
sequences in ST239 (i.e. 10+4+3=17 of the 21). The reference
isolate 85/2082 contains the most dominant Coa found within ST239,
which is identical to the second most dominant Coa within ST30. The
3 dominant ST239 Coa sequences are listed below in fasta-format, in
the order from most to least dominant. R domains are underlined.
Reference isolate(s) in which the corresponding sequence is found
is/are given in brackets in the sequence header.
TABLE-US-00017 >CoaST239_1_n10 (85/2082) (SEQ ID NO: 36)
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNENSKYDTPIPDW
YLGSILNRLGDQIYYAKELTNKYEYGEKEYKQAIDKLMTRVLGEDHYLLEK
KKAQYEAYKKWFEKHKSENPHSSLKKIKFDDFDLYRLTKKEYNELHQSLKE
AVDEFNSEVKNIQSKQKDLLPYDEATENRVTNGIYDFVCEIDTLYAAYFNH
SQYGHNAKELRAKLDIILGDAKDPVRITNERIRKEMMDDLNSIIDDFFMDT
NMNRPLNITKFNPNIHDYTNKPENRDNFDKLVKETREAVANADESWKTRTV
KNYGESETKSPVVKEEKKVEEPQLPKVGNQQEDKITVGTTEEAPLPIAQPL
VKIPQGTIQGEIVKGPEYLTMENKTLQGEIVQGPDFPTMEQNRPSLSDNYT
QPTTPNPILKGIEGNSTKLEIKPQGTESTLKGTQGESSDIEVKPQATETTE
ASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAY
NVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTYKKPSET
NAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKP
SETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHADGTATYGPRVTK R Domain: (SEQ
ID NO: 99) ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQV
SYGARPTYKKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHAN
GQVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTT HADGTATYG
>CoaST239_2_n4 (SEQ ID NO: 37)
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNENSKYDTPIPDW
YLGSILNRLGDQIYYAKELTNKYEYGEKEYKQAIDKLMTRVLGEDHYLLEK
KKAQYEAYKKWFEKHKSENPHSSLKKIKFDDFDLYRLTKKEYNELHQSLKE
AVDEFNSEVKNIQSKQKDLLPYDEATENRVTNGIYDFVCEIDTLYAAYFNH
SQYGHNAKELRAKLDIILGDAKDPVRITNERIRKEKMDDLNSIIDDFFMDT
NMNRPLNITKFNPNIHDYTNKPENRDNFDKLVKETREAVANADESWKTRTV
KNYGESETKSPVVKEEKKVEEPQLPKVGNQQEDKITVGTTEEAPLPIAQPL
VKIPQGTIQGEIVKGPEYLTMENKTLQGEIVQGPDFPTMEQNRPSLSDNYT
QPTTPNPILKGIEGNSTKLEIKPQGTESTLKGTQGESSDIEVKPQATETTE
ASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAY
NVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTYKKPSET
NAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKP
SETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHADGTATYGPRVTK R Domain: (SEQ
ID NO: 100) ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQV
SYGARPTYKKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHAN
GQVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTT HADGTATYG
>CoaST239_3_n3 (SEQ ID NO: 38)
MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNENSKYDTPIPDW
YLGSILNRLGDQIYYAKELTNKYEYGEKEYKQAIDKLMTRVLGEDHYLLEK
KKAQYEAYKKWFEKHKSENPHSSLKKIKFDDFDLYRLTKKEYNELHQSLKE
AVDEFNSEVKNIQSKQKDLLPYDEATENRVTNGIYDFVCEIDTLYAAYFNH
SQYGHNAKELRAKLDIILGDAKDPVRITNERIRKEKMDDLNSIIDDFFMDT
NMNRPLNITKFNPNIHDYTNKPENRDNFDKLVKETREAVANADESWKTRTV
KNYGESETKSPVVKEEKKVEEPQLPKVGNQQEDKITVGTTEEAPLPIAQPL
VKIPQGTIQGEIVKGPEYLTMENKTLQGEIVQGPDFPTMEQNRPSLSDNYT
QPTTPNPILKGIEGNSTKLEIKPQGTESTLKGTQGESSDIEVKPQATETTE
ASHYPARPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAY
NVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKPSET
NAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHADGTATYGPRVTK R Domain: (SEQ ID
NO: 101) ARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKPSETNAYNVTTHANGQV
SYGARPTQNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHAD GTATYG
[0405] 6. Identification of a Consensus R-Repeat Sequence
[0406] Coa R-domains consist of one to several 27 amino acid tandem
repeats (R-repeats). To identify the consensus R-repeat for
invasive S. aureus strains, all unique R-repeat sequences were
extracted from the R domain sequences listed above (i.e. SEQ ID NO:
39-55), resulting in a set of 20 sequences, which were aligned
manually. A 90% consensus R-repeat sequence was defined on the
basis of this alignment (Table 3).
TABLE-US-00018 TABLE 3 Identification of a 90% consensus R-repeat
in six dominant S. aureus lineages. SEQ ID NO. R-REPEAT SEQUENCE
102 ARPTYNKPSETNAYNVTTNRDGTVSYG 103 ARPTYKKPSETNAYNVTTNQDGTVSYG 104
ARPRFNKPSETNAYNVTTNQDGTVSYG 105 ARPRFNKPSETNAYNVTTNQDGTVTYG 106
ARPTYNKPSKTNAYNVTTHADGTATYG 107 ARPTYKKPSKTNAYNVTTHADGTATYG 108
ARPTYKKPSETNAYNVTTHANGTATYG 109 ARPTYKKPSETNAYNVTTHADGTATYG 110
ARPTQNKPSKTNAYNVTTHADGTATYG 111 ARPTQKKPSKTNAYNVTTHADGTATYG 112
ARPTQKKPSETNAYNVTTHADGTATYG 113 ARLTQKKPSETNAYNVTTHADGTATYG 114
ARPTYKKPSETNAYNVTTHANGQVSYG 115 ARPRFNKPSETNAYNVTTHANGQVSYG 116
ARPTQKKPSKTNAYNVTTHANGQVSYG 117 ARPTQNKPSKTNAYNVTTHANGQVSYG 118
ARPTQNKPSKTNAYNVTTHGNGQVSYG 119 ARPTQNKASETNAYNVTTHANGQVSYG 120
ARPTQNKPSETNAYNVTTHANGQVSYG 121 ARPTQNKPSETNAYNVTTHGNGQVSYG 90%
consensus ARP---KPS-TNAYNVTT---G---YG (SEQ ID NO: 127)
D. Conclusions:
[0407] It was identified that ST5 (USA100), ST8 (USA300), ST22, and
ST239 are dominant MRSA clones found in USA, Europe and Asia. Other
relevant MSSA S. aureus clones linked to invasive infections are
ST30 and ST45 that appear to be spread predominantly in several EU
member states. For each lineage we have identified the most
dominant two or three full-length Coa sequences, which can be used
for selecting representative R-domains from clinically relevant
Staphylococcus aureus strains to be used in a vaccine
composition.
Example 3
[0408] A polypeptide comprising the R-domain subunit of the
coagulase protein from Staphylococcus aureus USA300LAC (SEQ ID
NO:1) was produced recombinantly in Escherichia coli with an
N-terminal His-SUMO tag, which was removed after purification. The
R domain was defined as amino acid positions 470-583 of the full
length mature coagulase protein, and the R-domain subunit expressed
was, after tag removal, unchanged from that present in the
full-length protein. The sequence of the purified R-domain subunit
was:
TABLE-US-00019 (SEQ ID NO: 56)
EARPRFNKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHGNGQ
VSYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYKKPSKTNAYNVTTHA
DGTATYGPRVTK,
which comprises the R domain as defined in SEQ ID NO:43 and 89
[0409] Antibodies were produced by immunization of a New Zealand
White rabbit with 3 intramuscular doses of 100 .mu.g recombinant
R-domain adsorbed to aluminium hydroxide adjuvant. Doses were
administered 3 weeks apart, with a final bleed taken 3 weeks after
the last dose. Total IgG was obtained from sera using Protein G
purification and stored in PBS.
[0410] Mouse challenge studies were performed with S. aureus strain
USA300LAC as described previously (Thomer L. et al., J Exp Med.
2016 Mar. 7; 213(3):293-301).
[0411] The Whole Blood Killing Assay (WBKA) measures the ability of
fresh blood to kill bacteria. For S. aureus, killing requires
opsonization of the bacteria with antibodies and complement
proteins, followed by phagocytosis and subsequent killing.
Supplementing additional antibodies into the blood tests the
ability of those antibodies to improve killing either by increasing
the degree of opsonization or by inhibiting the activity of
Staphylococcal proteins that prevent phagocytosis. WBKAs were
performed with fresh (<1 hour old) heparinated blood from
healthy human donors. S. aureus strain USA300LAC was grown to
early-log phase and added to the healthy donor blood at
5.times.10.sup.5 CFU/mL in the presence of 5 .mu.g/mL purified IgG
or PBS. Cytochalasin D was added to control tubes to inhibit
killing by phagocytosis. After 60 minutes incubation, the colony
counts were determined as described previously (Thomer L. et al., J
Exp Med. 2016 Mar. 7; 213(3):293-301). The percentage of survival
of the bacteria at Time=60 minutes was calculated relative to the
number of bacteria measured at Time=0 minutes.
[0412] As shown in FIG. 9, anti-R domain IgG enhances
opsonophagocytic killing of S. aureus by human whole blood.
Purified rabbit anti-R domain IgG was tested for the capacity to
induce killing of S. aureus by phagocytosis in human whole blood.
Blood from two donors was tested independently. With both blood
donors the addition of the phagocytosis-inhibitor Cytochalasin D
increased survival of the bacteria, indicating that the donor blood
was already capable of some phagocytic killing of S. aureus. The
addition of anti-R domain IgG significantly decreased bacterial
survival in the blood of both donors compared to the PBS controls,
indicating that anti-R domain IgG enhances opsonophagocytic killing
of S. aureus by human cells.
[0413] As shown in FIG. 10, anti-R domain IgG improves survival of
mice in a S. aureus lethal challenge model. Mice were passively
immunized with anti-R domain IgG or a PBS control prior to lethal
infection with S. aureus. Mice given anti-R domain IgG showed
significantly improved survival compared to those given only PBS
(P<0.0005).
[0414] All of the methods disclosed and claimed herein can be made
and executed without undue experimentation in light of the present
disclosure. While the compositions and methods of this invention
have been described in terms of preferred embodiments, it will be
apparent to those of skill in the art that variations may be
applied to the methods and in the steps or in the sequence of steps
of the method described herein without departing from the concept,
spirit and scope of the invention. More specifically, it will be
apparent that certain agents which are both chemically and
physiologically related may be substituted for the agents described
herein while the same or similar results would be achieved. All
such similar substitutes and modifications apparent to those
skilled in the art are deemed to be within the spirit, scope and
concept of the invention as defined by the appended claims. All
references cited in this application are specifically incorporated
by reference for all purposes.
REFERENCES
[0415] The following references, to the extent that they provide
exemplary procedural or other details supplementary to those set
forth herein, are specifically incorporated herein by reference.
[0416] Bae, T., and O. Schneewind. 2005. Allelic replacement in
Staphylococcus aureus with inducible counter-selection. Plasmid
55:58-63. [0417] Bjerketorp, J., K. Jacobsson, and L. Frykberg.
2004. The von Willebrand factor-binding protein (vWbp) of
Staphylococcus aureus is a coagulase. FEMS Microbiol. Lett.
234:309-314. [0418] Cheng, A. G., M. McAdow, H. K. Kim, T. Bae, D.
M. Missiakas, and O. Schneewind. 2010. Contribution of coagulases
towards Staphylococcus aureus disease and protective immunity. PLoS
Pathog. 6:e1001036. [0419] David, M. Z., and R. S. Daum. 2010.
Community-associated methicillin-resistant Staphylococcus aureus:
epidemiology and clinical consequences of an emerging epidemic.
Clin. Microbiol. Rev. 23:616-687. [0420] Duthie, E. S. 1954.
Evidence for two forms of Staphylococcal coagulase. Journal of
general microbiology 10:427-436. [0421] Fowler, V. G., K. B. Allen,
E. D. Moreira, M. Moustafa, F. Isgro, H. W. Boucher, G. R. Corey,
Y. Carmeli, R. Betts, J. S. Hartzel, I. S. Chan, T. B. McNeely, N.
A. Kartsonis, D. Guris, M. T. Onorato, S. S. Smugar, M. J.
DiNubile, and A. Sobanjo-ter Meulen. 2013. Effect of an
investigational vaccine for preventing Staphylococcus aureus
infections after cardiothoracic surgery: a randomized trial. JAMA
309:1368-1378. [0422] Friedrich, R., P. Panizzi, P. Fuentes-Prior,
K. Richter, I. Verhamme, P. J. Anderson, S. Kawabata, R. Huber, W.
Bode, and P. E. Bock. 2003. Staphylocoagulase is a prototype for
the mechanism of cofactor-induced zymogen activation. Nature
425:535-539. [0423] Guggenberger, C., C. Wolz, J. A. Morrissey, and
J. Heesemann. 2012. Two distinct coagulase-dependent barriers
protect Staphylococcus aureus from neutrophils in a three
dimensional in vitro infection model. PLoS Pathog. 8:e1002434.
[0424] Kroh, H. K., P. Panizzi, and P. E. Bock. 2009. von
Willebrand factor-binding protein is a hysteretic conformational
activator of prothrombin. Proc. Natl. Acad. Sci. USA 106:7786-7791.
[0425] McAdow, M., A. C. DeDent, C. Emolo, A. G. Cheng, B. N.
Kreiswirth, D. M. Missiakas, and O. Schneewind. 2012a. Coagulases
as determinants of protective immune responses against
Staphylococcus aureus. Infect. Immun. 80:3389-3398. [0426] McAdow,
M., H. K. Kim, A. C. DeDenta, A. P. A. Hendrickx, O. Schneewind,
and D. M. Missiakas. 2011. Preventing Staphylococcus aureus sepsis
through the inhibition of its agglutination in blood. PLoS Pathog.
7:e1002307. [0427] McAdow, M., D. M. Missiakas, and O. Schneewind.
2012b. Staphylococcus aureus secretes coagulase and von Willebrand
factor binding protein to modify the coagulation cascade and
establish host infections. J. Innate Immun. 4:141-148. [0428]
McDevitt, D., P. Francois, P. Vaudaux, and T. J. Foster. 1994.
Molecular characterization of the clumping factor (fibrinogen
receptor) of Staphylococcus aureus. Mol. Microbiol. 11:237-248.
[0429] Mimura, N., and A. Asano. 1976. Synergistic effect of
colchicine and cytochalasin D on phagocytosis by peritoneal
macrophages. Nature 261:319-321. [0430] Nanra, J. S., S. M.
Buitrago, S. Crawford, J. Ng, P. S. Fink, J. Hawkins, I. L. Scully,
L. K. McNeil, J. M. Aste-Amezaga, D. Cooper, K. U. Jansen, and A.
S. Anderson. 2013. Capsular polysaccharides are an important immune
evasion mechanism for Staphylococcus aureus. Hum. Vaccin.
Immunother. 9:480-487. [0431] Panizzi, P., R. Friedrich, P.
Fuentes-Prior, W. Bode, and P. E. Bock. 2004. The staphylocoagulase
family of zymogen activator and adhesion proteins. Cell. Mol. Life
Sci. 61:2793-2798. [0432] Panizzi, P., M. Nahrendorf, J. L.
Figueiredo, J. Panizzi, B. Marinelli, Y. Iwamoto, E. Keliher, A. A.
Maddur, P. Waterman, H. Kroh, F. Leuschner, E. Aikawa, F. K.
Swirski, M. J. Pittet, T. M. Hackeng, P. Fuentes-Prior, O.
Schneewind, P. E. Bock, and R. Weissleder. 2011. In vivo detection
of Staphylococcus aureus endocarditis by targeting
pathogen-specific prothrombin activation. Nat. Med 17:1142-1146.
[0433] Rammelkamp, C. H., M. M. Hezebicks, and J. H. Dingle. 1950.
Specific coagulases of Staphylococcus aureus. J. Exp. Med
91:295-307. [0434] Robbins, J. B., R. Schneerson, and S. C. Szu.
1996. Hypothesis: how licensed vaccines confer protective immunity.
Adv. Exp. Med Biol. 397:169-182. [0435] Shinefield, H., S. Black,
A. Fattom, G. Horwith, S. Rasgon, J. Ordonez, H. Yeoh, D. Law, J.
B. Robbins, R. Schneerson, L. Muenz, S. Fuller, J. Johnson, B.
Fireman, H. Alcorn, and R. Naso. 2002. Use of a Staphylococcus
aureus conjugate vaccine in patients receiving hemodialysis. N.
Engl. J. Med 346:491-496. [0436] Smith, W., J. H. Hale, and M. M.
Smith. 1947. The role of coagulase in Staphylococcal infections.
Brit. J. Exp. Pathol. 28:57. [0437] Spaan, A. N., B. G. J.
Surewaard, R. Nijland, and J. A. G. van Strijp. 2013. Neutrophils
versus Staphylococcus aureus: a biological tug of war. Annu. Rev.
Microbiol. 67:629-650. [0438] Spellberg, B., and R. S. Daum. 2012.
Development of a vaccine against Staphylococcus aureus. Semin.
Immunopathol. 34:335-348. [0439] Tager, M. 1956. Studies on the
nature and the purification of coagulase-reacting factor and its
relation to prothrombin. J. Exp. Med. 104:675-686. [0440]
Thammavongsa, V., D. M. Missiakas, and O. Schneewind. 2013.
Staphylococcus aureus conversion of neutrophil extracellular traps
into deoxyadenosine promotes immune cell death Science 342:863-866.
[0441] Thomer, L., O. Schneewind, and D. Missiakas. 2013. Multiple
ligands of von Willebrand factor-binding protein (vWbp) promote
Staphylococcus aureus clot formation in human plasma. J. Biol.
Chem. 288:28283-28292. [0442] Watanabe, S., T. Ito, T. Sasaki, S.
Li, I. Uchiyama, K. Kishii, K. Kikuchi, R. L. Skov, and K.
Hiramatsu. 2009. Genetic diversity of staphylocoagulase genes
(coa): insight into the evolution of variable chromosomal virulence
factors in Staphylococcus aureus. PLoS One 4:e5714.
Sequence CWU 1
1
1271609PRTStaphylococcus aureus 1Met Lys Lys Gln Ile Ile Ser Leu
Gly Ala Leu Ala Val Ala Ser Ser1 5 10 15Leu Phe Thr Trp Asp Asn Lys
Ala Asp Ala Ile Val Thr Lys Asp Tyr 20 25 30Ser Gly Lys Ser Gln Val
Asn Ala Gly Ser Lys Asn Gly Thr Leu Ile 35 40 45Asp Ser Arg Tyr Leu
Asn Ser Ala Leu Tyr Tyr Leu Glu Asp Tyr Ile 50 55 60Ile Tyr Ala Ile
Gly Leu Thr Asn Lys Tyr Glu Tyr Gly Asp Asn Ile65 70 75 80Tyr Lys
Glu Ala Lys Asp Arg Leu Leu Glu Lys Val Leu Arg Glu Asp 85 90 95Gln
Tyr Leu Leu Glu Arg Lys Lys Ser Gln Tyr Glu Asp Tyr Lys Gln 100 105
110Trp Tyr Ala Asn Tyr Lys Lys Glu Asn Pro Arg Thr Asp Leu Lys Met
115 120 125Ala Asn Phe His Lys Tyr Asn Leu Glu Glu Leu Ser Met Lys
Glu Tyr 130 135 140Asn Glu Leu Gln Asp Ala Leu Lys Arg Ala Leu Asp
Asp Phe His Arg145 150 155 160Glu Val Lys Asp Ile Lys Asp Lys Asn
Ser Asp Leu Lys Thr Phe Asn 165 170 175Ala Ala Glu Glu Asp Lys Ala
Thr Lys Glu Val Tyr Asp Leu Val Ser 180 185 190Glu Ile Asp Thr Leu
Val Val Ser Tyr Tyr Gly Asp Lys Asp Tyr Gly 195 200 205Glu His Ala
Lys Glu Leu Arg Ala Lys Leu Asp Leu Ile Leu Gly Asp 210 215 220Thr
Asp Asn Pro His Lys Ile Thr Asn Glu Arg Ile Lys Lys Glu Met225 230
235 240Ile Asp Asp Leu Asn Ser Ile Ile Asp Asp Phe Phe Met Glu Thr
Lys 245 250 255Gln Asn Arg Pro Lys Ser Ile Thr Lys Tyr Asn Pro Thr
Thr His Asn 260 265 270Tyr Lys Thr Asn Ser Asp Asn Lys Pro Asn Phe
Asp Lys Leu Val Glu 275 280 285Glu Thr Lys Lys Ala Val Lys Glu Ala
Asp Asp Ser Trp Lys Lys Lys 290 295 300Thr Val Lys Lys Tyr Gly Glu
Thr Glu Thr Lys Ser Pro Val Val Lys305 310 315 320Glu Glu Lys Lys
Val Glu Glu Pro Gln Ala Pro Lys Val Asp Asn Gln 325 330 335Gln Glu
Val Lys Thr Thr Ala Gly Lys Ala Glu Glu Thr Thr Gln Pro 340 345
350Val Ala Gln Pro Leu Val Lys Ile Pro Gln Gly Thr Ile Thr Gly Glu
355 360 365Ile Val Lys Gly Pro Glu Tyr Pro Thr Met Glu Asn Lys Thr
Val Gln 370 375 380Gly Glu Ile Val Gln Gly Pro Asp Phe Leu Thr Met
Glu Gln Ser Gly385 390 395 400Pro Ser Leu Ser Asn Asn Tyr Thr Asn
Pro Pro Leu Thr Asn Pro Ile 405 410 415Leu Glu Gly Leu Glu Gly Ser
Ser Ser Lys Leu Glu Ile Lys Pro Gln 420 425 430Gly Thr Glu Ser Thr
Leu Lys Gly Thr Gln Gly Glu Ser Ser Asp Ile 435 440 445Glu Val Lys
Pro Gln Ala Thr Glu Thr Thr Glu Ala Ser Gln Tyr Gly 450 455 460Pro
Arg Pro Gln Phe Asn Lys Thr Pro Lys Tyr Val Lys Tyr Arg Asp465 470
475 480Ala Gly Thr Gly Ile Arg Glu Tyr Asn Asp Gly Thr Phe Gly Tyr
Glu 485 490 495Ala Arg Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala
Tyr Asn Val 500 505 510Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly
Ala Arg Pro Thr Gln 515 520 525Asn Lys Pro Ser Lys Thr Asn Ala Tyr
Asn Val Thr Thr His Gly Asn 530 535 540Gly Gln Val Ser Tyr Gly Ala
Arg Pro Thr Gln Asn Lys Pro Ser Lys545 550 555 560Thr Asn Ala Tyr
Asn Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr 565 570 575Gly Ala
Arg Pro Thr Tyr Lys Lys Pro Ser Lys Thr Asn Ala Tyr Asn 580 585
590Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr Gly Pro Arg Val Thr
595 600 605Lys2658PRTStaphylococcus aureus 2Met Lys Lys Gln Ile Ile
Ser Leu Gly Ala Leu Ala Val Ala Ser Ser1 5 10 15Leu Phe Thr Trp Asp
Asn Lys Ala Asp Ala Ile Val Thr Lys Asp Tyr 20 25 30Ser Lys Glu Ser
Arg Val Asn Glu Lys Ser Lys Lys Gly Ala Thr Val 35 40 45Ser Asp Tyr
Tyr Tyr Trp Lys Ile Ile Asp Ser Leu Glu Ala Gln Phe 50 55 60Thr Gly
Ala Ile Asp Leu Leu Glu Asp Tyr Lys Tyr Gly Asp Pro Ile65 70 75
80Tyr Lys Glu Ala Lys Asp Arg Leu Met Thr Arg Val Leu Gly Glu Asp
85 90 95Gln Tyr Leu Leu Lys Lys Lys Ile Asp Glu Tyr Glu Leu Tyr Lys
Lys 100 105 110Trp Tyr Lys Ser Ser Asn Lys Asn Thr Asn Met Leu Thr
Phe His Lys 115 120 125Tyr Asn Leu Tyr Asn Leu Thr Met Asn Glu Tyr
Asn Asp Ile Phe Asn 130 135 140Ser Leu Lys Asp Ala Val Tyr Gln Phe
Asn Lys Glu Val Lys Glu Ile145 150 155 160Glu His Lys Asn Val Asp
Leu Lys Gln Phe Asp Lys Asp Gly Glu Asp 165 170 175Lys Ala Thr Lys
Glu Val Tyr Asp Leu Val Ser Glu Ile Asp Thr Leu 180 185 190Val Val
Thr Tyr Tyr Ala Asp Lys Asp Tyr Gly Glu His Ala Lys Glu 195 200
205Leu Arg Ala Lys Leu Asp Leu Ile Leu Gly Asp Thr Asp Asn Pro His
210 215 220Lys Ile Thr Asn Glu Arg Ile Lys Lys Glu Met Ile Asp Asp
Leu Asn225 230 235 240Ser Ile Ile Asp Asp Phe Phe Met Glu Thr Lys
Gln Asn Arg Pro Asn 245 250 255Ser Ile Thr Lys Tyr Asp Pro Thr Lys
His Asn Phe Lys Glu Lys Ser 260 265 270Glu Asn Lys Pro Asn Phe Asp
Lys Leu Val Glu Glu Thr Lys Lys Ala 275 280 285Val Lys Glu Ala Asp
Glu Ser Trp Lys Asn Lys Thr Val Lys Lys Tyr 290 295 300Glu Glu Thr
Val Thr Lys Ser Pro Val Val Lys Glu Glu Lys Lys Val305 310 315
320Glu Glu Pro Gln Leu Pro Lys Val Gly Asn Gln Gln Glu Val Lys Thr
325 330 335Thr Ala Gly Lys Ala Glu Glu Thr Thr Gln Pro Val Ala Gln
Pro Leu 340 345 350Val Lys Ile Pro Gln Glu Thr Ile Tyr Gly Glu Thr
Val Lys Gly Pro 355 360 365Glu Tyr Pro Thr Met Glu Asn Lys Thr Leu
Gln Gly Glu Ile Val Gln 370 375 380Gly Pro Asp Phe Leu Thr Met Glu
Gln Asn Arg Pro Ser Leu Ser Asp385 390 395 400Asn Tyr Thr Gln Pro
Thr Thr Pro Asn Pro Ile Leu Glu Gly Leu Glu 405 410 415Gly Ser Ser
Ser Lys Leu Glu Ile Lys Pro Gln Gly Thr Glu Ser Thr 420 425 430Leu
Lys Gly Ile Gln Gly Glu Ser Ser Asp Ile Glu Val Lys Pro Gln 435 440
445Ala Thr Glu Thr Thr Glu Ala Ser Gln Tyr Gly Pro Arg Pro Gln Phe
450 455 460Asn Lys Thr Pro Lys Tyr Val Lys Tyr Arg Asp Ala Gly Thr
Gly Ile465 470 475 480Arg Glu Tyr Asn Asp Gly Thr Phe Gly Tyr Glu
Ala Arg Pro Arg Phe 485 490 495Asn Lys Pro Ser Glu Thr Asn Ala Tyr
Asn Val Thr Thr Asn Gln Asp 500 505 510Gly Thr Val Ser Tyr Gly Ala
Arg Pro Thr Gln Asn Lys Pro Ser Glu 515 520 525Thr Asn Ala Tyr Asn
Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr 530 535 540Gly Ala Arg
Pro Thr Gln Lys Lys Pro Ser Lys Thr Asn Ala Tyr Asn545 550 555
560Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr
565 570 575Gln Lys Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr
His Ala 580 585 590Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr
Lys Lys Pro Ser 595 600 605Glu Thr Asn Ala Tyr Asn Val Thr Thr His
Ala Asn Gly Gln Val Ser 610 615 620Tyr Gly Ala Arg Pro Thr Gln Lys
Lys Pro Ser Glu Thr Asn Ala Tyr625 630 635 640Asn Val Thr Thr His
Ala Asp Gly Thr Ala Thr Tyr Gly Pro Arg Val 645 650 655Thr
Lys3633PRTStaphylococcus aureus 3Met Lys Lys Gln Ile Ile Ser Leu
Gly Ala Leu Ala Val Ala Ser Ser1 5 10 15Leu Phe Thr Trp Asp Asn Lys
Ala Asp Ala Ile Val Thr Lys Asp Tyr 20 25 30Ser Gly Lys Ser Gln Val
Asn Ala Gly Ser Lys Asn Gly Lys Gln Ile 35 40 45Ala Asp Gly Tyr Tyr
Trp Gly Ile Ile Glu Asn Leu Glu Asn Gln Phe 50 55 60Tyr Asn Ile Phe
His Leu Leu Asp Gln His Lys Tyr Ala Glu Lys Glu65 70 75 80Tyr Lys
Asp Ala Val Asp Lys Leu Lys Thr Arg Val Leu Glu Glu Asp 85 90 95Gln
Tyr Leu Leu Glu Arg Lys Lys Glu Lys Tyr Glu Ile Tyr Lys Glu 100 105
110Leu Tyr Lys Lys Tyr Lys Lys Glu Asn Pro Asn Thr Gln Val Lys Met
115 120 125Lys Ala Phe Asp Lys Tyr Asp Leu Gly Asp Leu Thr Met Glu
Glu Tyr 130 135 140Asn Asp Leu Ser Lys Leu Leu Thr Lys Ala Leu Asp
Asn Phe Lys Leu145 150 155 160Glu Val Lys Lys Ile Glu Ser Glu Asn
Pro Asp Leu Lys Pro Tyr Ser 165 170 175Glu Ser Glu Glu Arg Thr Ala
Tyr Gly Lys Ile Asp Ser Leu Val Asp 180 185 190Gln Ala Tyr Ser Val
Tyr Phe Ala Tyr Val Thr Asp Ala Gln His Lys 195 200 205Thr Glu Ala
Leu Asn Leu Arg Ala Lys Ile Asp Leu Ile Leu Gly Asp 210 215 220Glu
Lys Asp Pro Ile Arg Val Thr Asn Gln Arg Thr Glu Lys Glu Met225 230
235 240Ile Lys Asp Leu Glu Ser Ile Ile Asp Asp Phe Phe Ile Glu Thr
Lys 245 250 255Leu Asn Arg Pro Lys His Ile Thr Arg Tyr Asp Gly Thr
Lys His Asp 260 265 270Tyr His Lys His Lys Asp Gly Phe Asp Ala Leu
Val Lys Glu Thr Arg 275 280 285Glu Ala Val Ala Lys Ala Asp Glu Ser
Trp Lys Asn Lys Thr Val Lys 290 295 300Lys Tyr Glu Glu Thr Val Thr
Lys Ser Pro Val Val Lys Glu Glu Lys305 310 315 320Lys Val Glu Glu
Pro Gln Ser Pro Lys Phe Asp Asn Gln Gln Glu Val 325 330 335Lys Ile
Thr Val Asp Lys Ala Glu Glu Thr Thr Gln Pro Val Ala Gln 340 345
350Pro Leu Val Lys Ile Pro Gln Gly Thr Ile Thr Gly Glu Ile Val Lys
355 360 365Gly Pro Glu Tyr Pro Thr Met Glu Asn Lys Thr Leu Gln Gly
Glu Ile 370 375 380Val Gln Gly Pro Asp Phe Pro Thr Met Glu Gln Asn
Arg Pro Ser Leu385 390 395 400Ser Asp Asn Tyr Thr Gln Pro Thr Thr
Pro Asn Pro Ile Leu Glu Gly 405 410 415Leu Glu Gly Ser Ser Ser Lys
Leu Glu Ile Lys Pro Gln Gly Thr Glu 420 425 430Ser Thr Leu Lys Gly
Thr Gln Gly Glu Ser Ser Asp Ile Glu Val Lys 435 440 445Pro Gln Ala
Ser Glu Thr Thr Glu Ala Ser His Tyr Pro Ala Arg Pro 450 455 460Gln
Phe Asn Lys Thr Pro Lys Tyr Val Lys Tyr Arg Asp Ala Gly Thr465 470
475 480Gly Ile Arg Glu Tyr Asn Asp Gly Thr Phe Gly Tyr Glu Ala Arg
Pro 485 490 495Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val
Thr Thr Asn 500 505 510Gln Asp Gly Thr Val Thr Tyr Gly Ala Arg Pro
Thr Gln Asn Lys Pro 515 520 525Ser Lys Thr Asn Ala Tyr Asn Val Thr
Thr His Ala Asn Gly Gln Val 530 535 540Ser Tyr Gly Ala Arg Pro Thr
Gln Asn Lys Pro Ser Lys Thr Asn Ala545 550 555 560Tyr Asn Val Thr
Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg 565 570 575Pro Thr
Gln Asn Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr 580 585
590His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys
595 600 605Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asp
Gly Thr 610 615 620Ala Thr Tyr Gly Pro Arg Val Thr Lys625
6304609PRTStaphylococcus aureus 4Met Lys Lys Gln Ile Ile Ser Leu
Gly Ala Leu Ala Val Ala Ser Ser1 5 10 15Leu Phe Thr Trp Asp Asn Lys
Ala Asp Ala Ile Val Thr Lys Asp Tyr 20 25 30Ser Lys Glu Ser Arg Val
Asn Glu Asn Ser Lys Tyr Asp Thr Pro Ile 35 40 45Pro Asp Trp Tyr Leu
Gly Ser Ile Leu Asn Arg Leu Gly Asp Gln Ile 50 55 60Tyr Tyr Ala Lys
Glu Leu Thr Asn Lys Tyr Glu Tyr Gly Glu Lys Glu65 70 75 80Tyr Lys
Gln Ala Ile Asp Lys Leu Met Thr Arg Val Leu Gly Glu Asp 85 90 95His
Tyr Leu Leu Glu Lys Lys Lys Ala Gln Tyr Glu Ala Tyr Lys Lys 100 105
110Trp Phe Glu Lys His Lys Ser Glu Asn Pro His Ser Ser Leu Lys Lys
115 120 125Ile Lys Phe Asp Asp Phe Asp Leu Tyr Arg Leu Thr Lys Lys
Glu Tyr 130 135 140Asn Glu Leu His Gln Ser Leu Lys Glu Ala Val Asp
Glu Phe Asn Ser145 150 155 160Glu Val Lys Asn Ile Gln Ser Lys Gln
Lys Asp Leu Leu Pro Tyr Asp 165 170 175Glu Ala Thr Glu Asn Arg Val
Thr Asn Gly Ile Tyr Asp Phe Val Cys 180 185 190Glu Ile Asp Thr Leu
Tyr Ala Ala Tyr Phe Asn His Ser Gln Tyr Gly 195 200 205His Asn Ala
Lys Glu Leu Arg Ala Lys Leu Asp Ile Ile Leu Gly Asp 210 215 220Ala
Lys Asp Pro Val Arg Ile Thr Asn Glu Arg Ile Arg Lys Glu Met225 230
235 240Met Asp Asp Leu Asn Ser Ile Ile Asp Asp Phe Phe Met Asp Thr
Asn 245 250 255Met Asn Arg Pro Leu Asn Ile Thr Lys Phe Asn Pro Asn
Ile His Asp 260 265 270Tyr Thr Asn Lys Pro Glu Asn Arg Asp Asn Phe
Asp Lys Leu Val Lys 275 280 285Glu Thr Arg Glu Ala Ile Ala Asn Ala
Asp Glu Ser Trp Lys Thr Arg 290 295 300Thr Val Lys Asn Tyr Gly Glu
Ser Glu Thr Lys Ser Pro Val Val Lys305 310 315 320Glu Glu Lys Lys
Val Glu Glu Pro Gln Leu Pro Lys Val Gly Asn Gln 325 330 335Gln Glu
Asp Lys Ile Thr Val Gly Thr Thr Glu Glu Ala Pro Leu Pro 340 345
350Ile Ala Gln Pro Leu Val Lys Ile Pro Gln Gly Thr Ile Gln Gly Glu
355 360 365Ile Val Lys Gly Pro Glu Tyr Leu Thr Met Glu Asn Lys Thr
Leu Gln 370 375 380Gly Glu Ile Val Gln Gly Pro Asp Phe Pro Thr Met
Glu Gln Asn Arg385 390 395 400Pro Ser Leu Ser Asp Asn Tyr Thr Gln
Pro Thr Thr Pro Asn Pro Ile 405 410 415Leu Lys Gly Ile Glu Gly Asn
Ser Thr Lys Leu Glu Ile Lys Pro Gln 420 425 430Gly Thr Glu Ser Thr
Leu Lys Gly Thr Gln Gly Glu Ser Ser Asp Ile 435 440 445Glu Val Lys
Pro Gln Ala Thr Glu Thr Thr Glu Ala Ser His Tyr Pro 450 455 460Ala
Arg Pro Gln Phe Asn Lys Thr Pro Lys Tyr Val Lys Tyr Arg Asp465 470
475 480Ala Gly Thr Gly Ile Arg Glu Tyr Asn Asp Gly Thr Phe Gly Tyr
Glu 485 490 495Ala Arg Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala
Tyr Asn Val 500 505 510Thr Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly
Ala Arg Pro Thr Gln 515 520 525Asn Lys Pro Ser Glu Thr Asn Ala Tyr
Asn Val Thr Thr His Ala Asn 530 535 540Gly Gln Val Ser Tyr Gly Ala
Arg Pro Thr Gln Asn Lys Pro Ser Glu545 550 555 560Thr Asn Ala Tyr
Asn Val Thr Thr His Ala
Asn Gly Gln Val Ser Tyr 565 570 575Gly Ala Arg Pro Thr Gln Asn Lys
Pro Ser Lys Thr Asn Ala Tyr Asn 580 585 590Val Thr Thr His Ala Asp
Gly Thr Ala Thr Tyr Gly Pro Arg Val Thr 595 600
605Lys5671PRTStaphylococcus aureus 5Met Lys Lys Gln Ile Ile Ser Leu
Gly Ala Leu Ala Val Ala Ser Ser1 5 10 15Leu Phe Thr Trp Asp Asn Lys
Ala Asp Ala Ile Val Thr Lys Asp Tyr 20 25 30Ser Gly Lys Ser Gln Val
Asn Ala Gly Ser Lys Asn Gly Lys Gln Ile 35 40 45Ala Asp Gly Tyr Tyr
Trp Gly Ile Ile Glu Asn Leu Glu Asn Gln Phe 50 55 60Tyr Asn Ile Phe
His Leu Leu Asp Gln His Lys Tyr Ala Glu Lys Glu65 70 75 80Tyr Lys
Asp Ala Leu Asp Lys Leu Lys Thr Arg Val Leu Glu Glu Asp 85 90 95Gln
Tyr Leu Leu Glu Arg Lys Lys Glu Lys Tyr Glu Ile Tyr Lys Glu 100 105
110Leu Tyr Lys Lys Tyr Lys Lys Glu Asn Pro Asn Thr Gln Val Lys Met
115 120 125Lys Ala Phe Asp Lys Tyr Asp Leu Gly Asp Leu Thr Met Glu
Glu Tyr 130 135 140Asn Asp Leu Ser Lys Leu Leu Thr Lys Ala Leu Asp
Asn Phe Lys Leu145 150 155 160Glu Val Lys Lys Ile Glu Ser Glu Asn
Pro Asp Leu Arg Pro Tyr Ser 165 170 175Glu Ser Glu Glu Arg Thr Ala
Tyr Gly Lys Ile Asp Ser Leu Val Asp 180 185 190Gln Ala Tyr Ser Val
Tyr Phe Ala Tyr Val Thr Asp Ala Gln His Lys 195 200 205Thr Glu Ala
Leu Asn Leu Arg Ala Lys Ile Asp Leu Ile Leu Gly Asp 210 215 220Glu
Lys Asp Pro Ile Arg Val Thr Asn Gln Arg Thr Glu Lys Glu Met225 230
235 240Ile Lys Asp Leu Glu Ser Ile Ile Asp Asp Phe Phe Ile Glu Thr
Lys 245 250 255Leu Asn Arg Pro Gln His Ile Thr Arg Tyr Asp Gly Thr
Lys His Asp 260 265 270Tyr His Lys His Lys Asp Gly Phe Asp Ala Leu
Val Lys Glu Thr Arg 275 280 285Glu Ala Val Ser Lys Ala Asp Glu Ser
Trp Lys Thr Lys Thr Val Lys 290 295 300Lys Tyr Gly Glu Thr Glu Thr
Lys Tyr Pro Val Val Lys Glu Glu Lys305 310 315 320Lys Val Glu Glu
Pro Gln Ser Pro Lys Val Ser Glu Lys Val Asp Val 325 330 335Gln Glu
Thr Val Gly Thr Thr Glu Glu Ala Pro Leu Pro Ile Ala Gln 340 345
350Pro Leu Val Lys Leu Pro Gln Ile Gly Thr Gln Gly Glu Ile Val Lys
355 360 365Gly Pro Asp Tyr Pro Thr Met Glu Asn Lys Thr Leu Gln Gly
Val Ile 370 375 380Val Gln Gly Pro Asp Phe Pro Thr Met Glu Gln Asn
Arg Pro Ser Leu385 390 395 400Ser Asp Asn Tyr Thr Gln Pro Ser Val
Thr Leu Pro Ser Ile Thr Gly 405 410 415Glu Ser Thr Pro Thr Asn Pro
Ile Leu Lys Gly Ile Glu Gly Asn Ser 420 425 430Ser Lys Leu Glu Ile
Lys Pro Gln Gly Thr Glu Ser Thr Leu Lys Gly 435 440 445Ile Gln Gly
Glu Ser Ser Asp Ile Glu Val Lys Pro Gln Ala Thr Glu 450 455 460Thr
Thr Glu Ala Ser His Tyr Pro Ala Arg Pro Gln Phe Asn Lys Thr465 470
475 480Pro Lys Tyr Val Lys Tyr Arg Asp Ala Gly Thr Gly Ile Arg Glu
Tyr 485 490 495Asn Asp Gly Thr Phe Gly Tyr Glu Ala Arg Pro Arg Phe
Asn Lys Pro 500 505 510Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr Asn
Gln Asp Gly Thr Val 515 520 525Ser Tyr Gly Ala Arg Pro Thr Gln Asn
Lys Pro Ser Lys Thr Asn Ala 530 535 540Tyr Asn Val Thr Thr His Ala
Asn Gly Gln Val Ser Tyr Gly Ala Arg545 550 555 560Pro Thr Tyr Asn
Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr 565 570 575Asn Arg
Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys 580 585
590Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Gly Asn Gly Gln
595 600 605Val Ser Tyr Gly Ala Arg Pro Thr Gln Lys Lys Pro Ser Lys
Thr Asn 610 615 620Ala Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val
Ser Tyr Gly Ala625 630 635 640Arg Pro Thr Tyr Asn Lys Pro Ser Lys
Thr Asn Ala Tyr Asn Val Thr 645 650 655Thr His Ala Asp Gly Thr Ala
Thr Tyr Gly Pro Arg Val Thr Lys 660 665 6706658PRTStaphylococcus
aureus 6Met Lys Lys Gln Ile Ile Ser Leu Gly Ala Leu Ala Val Ala Ser
Ser1 5 10 15Leu Phe Thr Trp Asp Asn Lys Ala Asp Ala Ile Val Thr Lys
Asp Tyr 20 25 30Ser Lys Glu Ser Arg Val Asn Glu Lys Ser Lys Lys Gly
Ala Thr Val 35 40 45Ser Asp Tyr Tyr Tyr Trp Lys Ile Ile Asp Ser Leu
Glu Ala Gln Phe 50 55 60Thr Gly Ala Ile Asp Leu Leu Glu Asp Tyr Lys
Tyr Gly Asp Pro Ile65 70 75 80Tyr Lys Glu Ala Lys Asp Arg Leu Met
Thr Arg Val Leu Gly Glu Asp 85 90 95Gln Tyr Leu Leu Lys Lys Lys Ile
Asp Glu Tyr Glu Leu Tyr Lys Lys 100 105 110Trp Tyr Lys Ser Ser Asn
Lys Asn Thr Asn Met Leu Thr Phe His Lys 115 120 125Tyr Asn Leu Tyr
Asn Leu Thr Met Asn Glu Tyr Asn Asp Ile Phe Asn 130 135 140Ser Leu
Lys Asp Ala Val Tyr Gln Phe Asn Lys Glu Val Lys Glu Ile145 150 155
160Glu His Lys Asn Val Asp Leu Lys Gln Phe Asp Lys Asp Gly Glu Asp
165 170 175Lys Ala Thr Lys Glu Val Tyr Asp Leu Val Ser Glu Ile Asp
Thr Leu 180 185 190Val Val Thr Tyr Tyr Ala Asp Lys Asp Tyr Gly Glu
His Ala Lys Glu 195 200 205Leu Arg Ala Lys Leu Asp Leu Ile Leu Gly
Asp Thr Asp Asn Pro His 210 215 220Lys Ile Thr Asn Glu Arg Ile Lys
Lys Glu Met Ile Asp Asp Leu Asn225 230 235 240Ser Ile Ile Asp Asp
Phe Phe Met Glu Thr Lys Gln Asn Arg Pro Asn 245 250 255Ser Ile Thr
Lys Tyr Asp Pro Thr Lys His Asn Phe Lys Glu Lys Ser 260 265 270Glu
Asn Lys Pro Asn Phe Asp Lys Leu Val Glu Glu Thr Lys Lys Ala 275 280
285Val Lys Glu Ala Asp Glu Ser Trp Lys Asn Lys Thr Val Lys Lys Tyr
290 295 300Glu Glu Thr Val Thr Lys Ser Pro Val Val Lys Glu Glu Lys
Lys Val305 310 315 320Glu Glu Pro Gln Leu Pro Lys Val Gly Asn Gln
Gln Glu Val Lys Thr 325 330 335Thr Ala Gly Lys Ala Glu Glu Thr Thr
Gln Pro Val Ala Gln Pro Leu 340 345 350Val Lys Ile Pro Gln Glu Thr
Ile Tyr Gly Glu Thr Val Lys Gly Pro 355 360 365Glu Tyr Pro Thr Met
Glu Asn Lys Thr Leu Gln Gly Glu Ile Val Gln 370 375 380Gly Pro Asp
Phe Leu Thr Met Glu Gln Asn Arg Pro Ser Leu Ser Asp385 390 395
400Asn Tyr Thr Gln Pro Thr Thr Pro Asn Pro Ile Leu Glu Gly Leu Glu
405 410 415Gly Ser Ser Ser Lys Leu Glu Ile Lys Pro Gln Gly Thr Glu
Ser Thr 420 425 430Leu Lys Gly Ile Gln Gly Glu Ser Ser Asp Ile Glu
Val Lys Pro Gln 435 440 445Ala Thr Glu Thr Thr Glu Ala Ser Gln Tyr
Gly Pro Arg Pro Gln Phe 450 455 460Asn Lys Thr Pro Lys Tyr Val Lys
Tyr Arg Asp Ala Gly Thr Gly Ile465 470 475 480Arg Glu Tyr Asn Asp
Gly Thr Phe Gly Tyr Glu Ala Arg Pro Arg Phe 485 490 495Asn Lys Pro
Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr Asn Gln Asp 500 505 510Gly
Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu 515 520
525Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr
530 535 540Gly Ala Arg Pro Thr Gln Lys Lys Pro Ser Lys Thr Asn Ala
Tyr Asn545 550 555 560Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr
Gly Ala Arg Pro Thr 565 570 575Gln Lys Lys Pro Ser Lys Thr Asn Ala
Tyr Asn Val Thr Thr His Ala 580 585 590Asn Gly Gln Val Ser Tyr Gly
Ala Arg Pro Thr Tyr Lys Lys Pro Ser 595 600 605Glu Thr Asn Ala Tyr
Asn Val Thr Thr His Ala Asn Gly Gln Val Ser 610 615 620Tyr Gly Ala
Arg Pro Thr Gln Lys Lys Pro Ser Glu Thr Asn Ala Tyr625 630 635
640Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr Gly Pro Arg Val
645 650 655Thr Lys7663PRTStaphylococcus aureus 7Met Lys Lys Gln Ile
Ile Ser Leu Gly Ala Leu Ala Val Ala Ser Ser1 5 10 15Leu Phe Thr Trp
Asp Asn Lys Ala Asp Ala Ile Val Thr Lys Asp Tyr 20 25 30Ser Lys Glu
Ser Arg Val Asn Glu Asn Ser Lys Tyr Asp Thr Pro Ile 35 40 45Pro Asp
Trp Tyr Leu Gly Ser Ile Leu Asn Arg Leu Gly Asp Gln Ile 50 55 60Tyr
Tyr Ala Lys Glu Leu Thr Asn Lys Tyr Glu Tyr Gly Glu Lys Glu65 70 75
80Tyr Lys Gln Ala Ile Asp Lys Leu Met Thr Arg Val Leu Gly Glu Asp
85 90 95His Tyr Leu Leu Glu Lys Lys Lys Ala Gln Tyr Glu Ala Tyr Lys
Lys 100 105 110Trp Phe Glu Lys His Lys Ser Glu Asn Pro His Ser Ser
Leu Lys Lys 115 120 125Ile Lys Phe Asp Asp Phe Asp Leu Tyr Arg Leu
Thr Lys Lys Glu Tyr 130 135 140Asn Glu Leu His Gln Ser Leu Lys Glu
Ala Val Asp Glu Phe Asn Ser145 150 155 160Glu Val Lys Asn Ile Gln
Ser Lys Gln Lys Asp Leu Leu Pro Tyr Asp 165 170 175Glu Ala Thr Glu
Asn Arg Val Thr Asn Gly Ile Tyr Asp Phe Val Cys 180 185 190Glu Ile
Asp Thr Leu Tyr Ala Ala Tyr Phe Asn His Ser Gln Tyr Gly 195 200
205His Asn Ala Lys Glu Leu Arg Ala Lys Leu Asp Ile Ile Leu Gly Asp
210 215 220Ala Lys Asp Pro Val Arg Ile Thr Asn Glu Arg Ile Arg Lys
Glu Met225 230 235 240Met Asp Asp Leu Asn Ser Ile Ile Asp Asp Phe
Phe Met Asp Thr Asn 245 250 255Met Asn Arg Pro Leu Asn Ile Thr Lys
Phe Asn Pro Asn Ile His Asp 260 265 270Tyr Thr Asn Lys Pro Glu Asn
Arg Asp Asn Phe Asp Lys Leu Val Lys 275 280 285Glu Thr Arg Glu Ala
Val Ala Asn Ala Asp Glu Ser Trp Lys Thr Arg 290 295 300Thr Val Lys
Asn Tyr Gly Glu Ser Glu Thr Lys Ser Pro Val Val Lys305 310 315
320Glu Glu Lys Lys Val Glu Glu Pro Gln Leu Pro Lys Val Gly Asn Gln
325 330 335Gln Glu Asp Lys Ile Thr Val Gly Thr Thr Glu Glu Ala Pro
Leu Pro 340 345 350Ile Ala Gln Pro Leu Val Lys Ile Pro Gln Gly Thr
Ile Gln Gly Glu 355 360 365Ile Val Lys Gly Pro Glu Tyr Leu Thr Met
Glu Asn Lys Thr Leu Gln 370 375 380Gly Glu Ile Val Gln Gly Pro Asp
Phe Pro Thr Met Glu Gln Asn Arg385 390 395 400Pro Ser Leu Ser Asp
Asn Tyr Thr Gln Pro Thr Thr Pro Asn Pro Ile 405 410 415Leu Lys Gly
Ile Glu Gly Asn Ser Thr Lys Leu Glu Ile Lys Pro Gln 420 425 430Gly
Thr Glu Ser Thr Leu Lys Gly Thr Gln Gly Glu Ser Ser Asp Ile 435 440
445Glu Val Lys Pro Gln Ala Thr Glu Thr Thr Glu Ala Ser His Tyr Pro
450 455 460Ala Arg Pro Gln Phe Asn Lys Thr Pro Lys Tyr Val Lys Tyr
Arg Asp465 470 475 480Ala Gly Thr Gly Ile Arg Glu Tyr Asn Asp Gly
Thr Phe Gly Tyr Glu 485 490 495Ala Arg Pro Arg Phe Asn Lys Pro Ser
Glu Thr Asn Ala Tyr Asn Val 500 505 510Thr Thr Asn Gln Asp Gly Thr
Val Ser Tyr Gly Ala Arg Pro Thr Gln 515 520 525Asn Lys Pro Ser Glu
Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn 530 535 540Gly Gln Val
Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu545 550 555
560Thr Asn Ala Tyr Asn Val Thr Thr Asn Gln Asp Gly Thr Val Ser Tyr
565 570 575Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu Thr Asn Ala
Tyr Asn 580 585 590Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly
Ala Arg Pro Thr 595 600 605Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr
Asn Val Thr Thr His Ala 610 615 620Asn Gly Gln Val Ser Tyr Gly Ala
Arg Pro Thr Gln Asn Lys Pro Ser625 630 635 640Lys Thr Asn Ala Tyr
Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr 645 650 655Tyr Gly Pro
Arg Val Thr Lys 6608636PRTStaphylococcus aureus 8Met Lys Lys Gln
Ile Ile Ser Leu Gly Ala Leu Ala Val Ala Ser Ser1 5 10 15Leu Phe Thr
Trp Asp Asn Lys Ala Asp Ala Ile Val Thr Lys Asp Tyr 20 25 30Ser Gly
Lys Ser Gln Val Asn Ala Gly Ser Lys Asn Gly Thr Leu Ile 35 40 45Asp
Ser Arg Tyr Leu Asn Ser Ala Leu Tyr Tyr Leu Glu Asp Tyr Ile 50 55
60Ile Tyr Ala Ile Gly Leu Thr Asn Lys Tyr Glu Tyr Gly Asp Asn Ile65
70 75 80Tyr Lys Glu Ala Lys Asp Arg Leu Leu Glu Lys Val Leu Arg Glu
Asp 85 90 95Gln Tyr Leu Leu Glu Arg Lys Lys Ser Gln Tyr Glu Asp Tyr
Lys Gln 100 105 110Trp Tyr Ala Asn Tyr Lys Lys Glu Asn Pro Arg Thr
Asp Leu Lys Met 115 120 125Ala Asn Phe His Lys Tyr Asn Leu Glu Glu
Leu Ser Met Lys Glu Tyr 130 135 140Asn Glu Leu Gln Asp Ala Leu Lys
Arg Ala Leu Asp Asp Phe His Arg145 150 155 160Glu Val Lys Asp Ile
Lys Asp Lys Asn Ser Asp Leu Lys Thr Phe Asn 165 170 175Ala Ala Glu
Glu Asp Lys Ala Thr Lys Glu Val Tyr Asp Leu Val Ser 180 185 190Glu
Ile Asp Thr Leu Val Val Ser Tyr Tyr Gly Asp Lys Asp Tyr Gly 195 200
205Glu His Ala Lys Glu Leu Arg Ala Lys Leu Asp Leu Ile Leu Gly Asp
210 215 220Thr Asp Asn Pro His Lys Ile Thr Asn Glu Arg Ile Lys Lys
Glu Met225 230 235 240Ile Asp Asp Leu Asn Ser Ile Ile Asp Asp Phe
Phe Met Glu Thr Lys 245 250 255Gln Asn Arg Pro Lys Ser Ile Thr Lys
Tyr Asn Pro Thr Thr His Asn 260 265 270Tyr Lys Thr Asn Ser Asp Asn
Lys Pro Asn Phe Asp Lys Leu Val Glu 275 280 285Glu Thr Lys Lys Ala
Val Lys Glu Ala Asp Asp Ser Trp Lys Lys Lys 290 295 300Thr Val Lys
Lys Tyr Gly Glu Thr Glu Thr Lys Ser Pro Val Val Lys305 310 315
320Glu Glu Lys Lys Val Glu Glu Pro Gln Ala Pro Lys Val Asp Asn Gln
325 330 335Gln Glu Val Lys Thr Thr Ala Gly Lys Ala Glu Glu Thr Thr
Gln Pro 340 345 350Val Ala Gln Pro Leu Val Lys Ile Pro Gln Gly Thr
Ile Thr Gly Glu 355 360 365Ile Val Lys Gly Pro Glu Tyr Pro Thr Met
Glu Asn Lys Thr Val Gln 370 375 380Gly Glu Ile Val Gln Gly Pro Asp
Phe Leu Thr Met Glu Gln Ser Gly385 390 395 400Pro Ser Leu Ser Asn
Asn Tyr Thr Asn Pro Pro Leu Thr Asn Pro Ile 405 410 415Leu Glu Gly
Leu Glu Gly Ser Ser Ser Lys Leu Glu Ile Lys Pro Gln
420 425 430Gly Thr Glu Ser Thr Leu Lys Gly Thr Gln Gly Glu Ser Ser
Asp Ile 435 440 445Glu Val Lys Pro Gln Ala Thr Glu Thr Thr Glu Ala
Ser Gln Tyr Gly 450 455 460Pro Arg Pro Gln Phe Asn Lys Thr Pro Lys
Tyr Val Lys Tyr Arg Asp465 470 475 480Ala Gly Thr Gly Ile Arg Glu
Tyr Asn Asp Gly Thr Phe Gly Tyr Glu 485 490 495Ala Arg Pro Arg Phe
Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val 500 505 510Thr Thr His
Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr 515 520 525Lys
Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn 530 535
540Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser
Lys545 550 555 560Thr Asn Ala Tyr Asn Val Thr Thr His Gly Asn Gly
Gln Val Ser Tyr 565 570 575Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser
Lys Thr Asn Ala Tyr Asn 580 585 590Val Thr Thr His Ala Asn Gly Gln
Val Ser Tyr Gly Ala Arg Pro Thr 595 600 605Tyr Lys Lys Pro Ser Lys
Thr Asn Ala Tyr Asn Val Thr Thr His Ala 610 615 620Asp Gly Thr Ala
Thr Tyr Gly Pro Arg Val Thr Lys625 630 63598PRTArtificial
SequenceSynthetic Peptide 9Gly Ala Ser Ile Thr Thr Ser Tyr1
5107PRTArtificial SequenceSynthetic Peptide 10Ile Ser Tyr Ser Gly
Asn Thr1 51114PRTArtificial SequenceSynthetic Peptide 11Ala Thr Tyr
Tyr Asp Phe Asn Tyr Asp Gly Tyr Leu Asp Val1 5 10127PRTArtificial
SequenceSynthetic Peptide 12Ser Ser Val Ser Ser Ser Tyr1
5133PRTArtificial SequenceSynthetic Peptide 13Ser Thr
Ser1149PRTArtificial SequenceSynthetic Peptide 14Gln Gln Tyr His
Arg Ser Pro Pro Thr1 5158PRTArtificial SequenceSynthetic Peptide
15Gly Tyr Thr Phe Thr Ser Phe Asp1 5168PRTArtificial
SequenceSynthetic Peptide 16Ile Phe Pro Gly Asp Gly Ser Ala1
51711PRTArtificial SequenceSynthetic Peptide 17Val Lys Asn His Gly
Gly Trp Tyr Phe Asp Val1 5 101811PRTArtificial SequenceSynthetic
Peptide 18Gln Ser Ile Val His Ser Asn Gly Asn Thr Tyr1 5
10193PRTArtificial SequenceSynthetic Peptide 19Lys Val
Ser1209PRTArtificial SequenceSynthetic Peptide 20Phe Gln Gly Ser
His Val Pro Leu Thr1 521609PRTArtificial SequenceSynthetic Peptide
21Met Lys Lys Gln Ile Ile Ser Leu Gly Ala Leu Ala Val Ala Ser Ser1
5 10 15Leu Phe Thr Trp Asp Asn Lys Ala Asp Ala Ile Val Thr Lys Asp
Tyr 20 25 30Ser Gly Lys Ser Gln Val Asn Ala Gly Ser Lys Asn Gly Thr
Leu Ile 35 40 45Asp Ser Arg Tyr Leu Asn Ser Ala Leu Tyr Tyr Leu Glu
Asp Tyr Ile 50 55 60Ile Tyr Ala Ile Gly Leu Thr Asn Lys Tyr Glu Tyr
Gly Asp Asn Ile65 70 75 80Tyr Lys Glu Ala Lys Asp Arg Leu Leu Glu
Lys Val Leu Arg Glu Asp 85 90 95Gln Tyr Leu Leu Glu Arg Lys Lys Ser
Gln Tyr Glu Asp Tyr Lys Gln 100 105 110Trp Tyr Ala Asn Tyr Lys Lys
Glu Asn Pro Arg Thr Asp Leu Lys Met 115 120 125Ala Asn Phe His Lys
Tyr Asn Leu Glu Glu Leu Ser Met Lys Glu Tyr 130 135 140Asn Glu Leu
Gln Asp Ala Leu Lys Arg Ala Leu Asp Asp Phe His Arg145 150 155
160Glu Val Lys Asp Ile Lys Asp Lys Asn Ser Asp Leu Lys Thr Phe Asn
165 170 175Ala Ala Glu Glu Asp Lys Ala Thr Lys Glu Val Tyr Asp Leu
Val Ser 180 185 190Glu Ile Asp Thr Leu Val Val Ser Tyr Tyr Gly Asp
Lys Asp Tyr Gly 195 200 205Glu His Ala Lys Glu Leu Arg Ala Lys Leu
Asp Leu Ile Leu Gly Asp 210 215 220Thr Asp Asn Pro His Lys Ile Thr
Asn Glu Arg Ile Lys Lys Glu Met225 230 235 240Ile Asp Asp Leu Asn
Ser Ile Ile Asp Asp Phe Phe Met Glu Thr Lys 245 250 255Gln Asn Arg
Pro Lys Ser Ile Thr Lys Tyr Asn Pro Thr Thr His Asn 260 265 270Tyr
Lys Thr Asn Ser Asp Asn Lys Pro Asn Phe Asp Lys Leu Val Glu 275 280
285Glu Thr Lys Lys Ala Val Lys Glu Ala Asp Asp Ser Trp Lys Lys Lys
290 295 300Thr Val Lys Lys Tyr Gly Glu Thr Glu Thr Lys Ser Pro Val
Val Lys305 310 315 320Glu Glu Lys Lys Val Glu Glu Pro Gln Ala Pro
Lys Val Asp Asn Gln 325 330 335Gln Glu Val Lys Thr Thr Ala Gly Lys
Ala Glu Glu Thr Thr Gln Pro 340 345 350Val Ala Gln Pro Leu Val Lys
Ile Pro Gln Gly Thr Ile Thr Gly Glu 355 360 365Ile Val Lys Gly Pro
Glu Tyr Pro Thr Met Glu Asn Lys Thr Val Gln 370 375 380Gly Glu Ile
Val Gln Gly Pro Asp Phe Leu Thr Met Glu Gln Ser Gly385 390 395
400Pro Ser Leu Ser Asn Asn Tyr Thr Asn Pro Pro Leu Thr Asn Pro Ile
405 410 415Leu Glu Gly Leu Glu Gly Ser Ser Ser Lys Leu Glu Ile Lys
Pro Gln 420 425 430Gly Thr Glu Ser Thr Leu Lys Gly Thr Gln Gly Glu
Ser Ser Asp Ile 435 440 445Glu Val Lys Pro Gln Ala Thr Glu Thr Thr
Glu Ala Ser Gln Tyr Gly 450 455 460Pro Arg Pro Gln Phe Asn Lys Thr
Pro Lys Tyr Val Lys Tyr Arg Asp465 470 475 480Ala Gly Thr Gly Ile
Arg Glu Tyr Asn Asp Gly Thr Phe Gly Tyr Glu 485 490 495Ala Arg Pro
Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val 500 505 510Thr
Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln 515 520
525Asn Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr His Gly Asn
530 535 540Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro
Ser Lys545 550 555 560Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn
Gly Gln Val Ser Tyr 565 570 575Gly Ala Arg Pro Thr Tyr Lys Lys Pro
Ser Lys Thr Asn Ala Tyr Asn 580 585 590Val Thr Thr His Ala Asp Gly
Thr Ala Thr Tyr Gly Pro Arg Val Thr 595 600
605Lys22658PRTArtificial SequenceSynthetic Peptide 22Met Lys Lys
Gln Ile Ile Ser Leu Gly Ala Leu Ala Val Ala Ser Ser1 5 10 15Leu Phe
Thr Trp Asp Asn Lys Ala Asp Ala Ile Val Thr Lys Asp Tyr 20 25 30Ser
Lys Glu Ser Arg Val Asn Glu Lys Ser Lys Lys Gly Ala Thr Val 35 40
45Ser Asp Tyr Tyr Tyr Trp Lys Ile Ile Asp Ser Leu Glu Ala Gln Phe
50 55 60Thr Gly Ala Ile Asp Leu Leu Glu Asp Tyr Lys Tyr Gly Asp Pro
Ile65 70 75 80Tyr Lys Glu Ala Lys Asp Arg Leu Met Thr Arg Val Leu
Gly Glu Asp 85 90 95Gln Tyr Leu Leu Lys Lys Lys Ile Asp Glu Tyr Glu
Leu Tyr Lys Lys 100 105 110Trp Tyr Lys Ser Ser Asn Lys Asn Thr Asn
Met Leu Thr Phe His Lys 115 120 125Tyr Asn Leu Tyr Asn Leu Thr Met
Asn Glu Tyr Asn Asp Ile Phe Asn 130 135 140Ser Leu Lys Asp Ala Val
Tyr Gln Phe Asn Lys Glu Val Lys Glu Ile145 150 155 160Glu His Lys
Asn Val Asp Leu Lys Gln Phe Asp Lys Asp Gly Glu Asp 165 170 175Lys
Ala Thr Lys Glu Val Tyr Asp Leu Val Ser Glu Ile Asp Thr Leu 180 185
190Val Val Thr Tyr Tyr Ala Asp Lys Asp Tyr Gly Glu His Ala Lys Glu
195 200 205Leu Arg Ala Lys Leu Asp Leu Ile Leu Gly Asp Thr Asp Asn
Pro His 210 215 220Lys Ile Thr Asn Glu Arg Ile Lys Lys Glu Met Ile
Asp Asp Leu Asn225 230 235 240Ser Ile Ile Asp Asp Phe Phe Met Glu
Thr Lys Gln Asn Arg Pro Asn 245 250 255Ser Ile Thr Lys Tyr Asp Pro
Thr Lys His Asn Phe Lys Glu Lys Ser 260 265 270Glu Asn Lys Pro Asn
Phe Asp Lys Leu Val Glu Glu Thr Lys Lys Ala 275 280 285Val Lys Glu
Ala Asp Glu Ser Trp Lys Asn Lys Thr Val Lys Lys Tyr 290 295 300Glu
Glu Thr Val Thr Lys Ser Pro Val Val Lys Glu Glu Lys Lys Val305 310
315 320Glu Glu Pro Gln Leu Pro Lys Val Gly Asn Gln Gln Glu Val Lys
Thr 325 330 335Thr Ala Gly Lys Ala Glu Glu Thr Thr Gln Pro Val Ala
Gln Pro Leu 340 345 350Val Lys Ile Pro Gln Glu Thr Ile Tyr Gly Glu
Thr Val Lys Gly Pro 355 360 365Glu Tyr Pro Thr Met Glu Asn Lys Thr
Leu Gln Gly Glu Ile Val Gln 370 375 380Gly Pro Asp Phe Leu Thr Met
Glu Gln Asn Arg Pro Ser Leu Ser Asp385 390 395 400Asn Tyr Thr Gln
Pro Thr Thr Pro Asn Pro Ile Leu Glu Gly Leu Glu 405 410 415Gly Ser
Ser Ser Lys Leu Glu Ile Lys Pro Gln Gly Thr Glu Ser Thr 420 425
430Leu Lys Gly Ile Gln Gly Glu Ser Ser Asp Ile Glu Val Lys Pro Gln
435 440 445Ala Thr Glu Thr Thr Glu Ala Ser Gln Tyr Gly Pro Arg Pro
Gln Phe 450 455 460Asn Lys Thr Pro Lys Tyr Val Lys Tyr Arg Asp Ala
Gly Thr Gly Ile465 470 475 480Arg Glu Tyr Asn Asp Gly Thr Phe Gly
Tyr Glu Ala Arg Pro Arg Phe 485 490 495Asn Lys Pro Ser Glu Thr Asn
Ala Tyr Asn Val Thr Thr Asn Gln Asp 500 505 510Gly Thr Val Ser Tyr
Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu 515 520 525Thr Asn Ala
Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr 530 535 540Gly
Ala Arg Pro Thr Gln Lys Lys Pro Ser Lys Thr Asn Ala Tyr Asn545 550
555 560Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro
Thr 565 570 575Gln Lys Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr
Thr His Ala 580 585 590Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr
Tyr Lys Lys Pro Ser 595 600 605Glu Thr Asn Ala Tyr Asn Val Thr Thr
His Ala Asn Gly Gln Val Ser 610 615 620Tyr Gly Ala Arg Leu Thr Gln
Lys Lys Pro Ser Glu Thr Asn Ala Tyr625 630 635 640Asn Val Thr Thr
His Ala Asp Gly Thr Ala Thr Tyr Gly Pro Arg Val 645 650 655Thr
Lys23658PRTArtificial SequenceSynthetic Peptide 23Met Lys Lys Gln
Ile Ile Ser Leu Gly Ala Leu Ala Val Ala Ser Ser1 5 10 15Leu Phe Thr
Trp Asp Asn Lys Ala Asp Ala Ile Val Thr Lys Asp Tyr 20 25 30Ser Lys
Glu Ser Arg Val Asn Glu Lys Ser Lys Lys Gly Ala Thr Val 35 40 45Ser
Asp Tyr Tyr Tyr Trp Lys Ile Ile Asp Ser Leu Glu Ala Gln Phe 50 55
60Thr Gly Ala Ile Asp Leu Leu Glu Asp Tyr Lys Tyr Gly Asp Pro Ile65
70 75 80Tyr Lys Glu Ala Lys Asp Arg Leu Met Thr Arg Val Leu Gly Glu
Asp 85 90 95Gln Tyr Leu Leu Lys Lys Lys Ile Asp Glu Tyr Glu Leu Tyr
Lys Lys 100 105 110Trp Tyr Lys Ser Ser Asn Lys Asn Thr Asn Met Leu
Thr Phe His Lys 115 120 125Tyr Asn Leu Tyr Asn Leu Thr Met Asn Glu
Tyr Asn Asp Ile Phe Asn 130 135 140Ser Leu Lys Asp Ala Val Tyr Gln
Phe Asn Lys Glu Val Lys Glu Ile145 150 155 160Glu His Lys Asn Val
Asp Leu Lys Gln Phe Asp Lys Asp Gly Glu Asp 165 170 175Lys Ala Thr
Lys Glu Val Tyr Asp Leu Val Ser Glu Ile Asp Thr Leu 180 185 190Val
Val Thr Tyr Tyr Ala Asp Lys Asp Tyr Gly Glu His Ala Lys Glu 195 200
205Leu Arg Ala Lys Leu Asp Leu Ile Leu Gly Asp Thr Asp Asn Pro His
210 215 220Lys Ile Thr Asn Glu Arg Ile Lys Lys Glu Met Ile Asp Asp
Leu Asn225 230 235 240Ser Ile Ile Asp Asp Phe Phe Met Glu Thr Lys
Gln Asn Arg Pro Asn 245 250 255Ser Ile Thr Lys Tyr Asp Pro Thr Lys
His Asn Phe Lys Glu Lys Ser 260 265 270Glu Asn Lys Pro Asn Phe Asp
Lys Leu Val Glu Glu Thr Lys Lys Ala 275 280 285Val Lys Glu Ala Asp
Glu Ser Trp Lys Asn Lys Thr Val Lys Lys Tyr 290 295 300Glu Glu Thr
Val Thr Lys Ser Pro Val Val Lys Glu Glu Lys Lys Val305 310 315
320Glu Glu Pro Gln Leu Pro Lys Val Gly Asn Gln Gln Glu Val Lys Thr
325 330 335Thr Ala Gly Lys Ala Glu Glu Thr Thr Gln Pro Val Ala Gln
Pro Leu 340 345 350Val Lys Ile Pro Gln Glu Thr Ile Tyr Gly Glu Thr
Val Lys Gly Pro 355 360 365Glu Tyr Pro Thr Met Glu Asn Lys Thr Leu
Gln Gly Glu Ile Val Gln 370 375 380Gly Pro Asp Phe Leu Thr Met Glu
Gln Asn Arg Pro Ser Leu Ser Asp385 390 395 400Asn Tyr Thr Gln Pro
Thr Thr Pro Asn Pro Ile Leu Glu Gly Leu Glu 405 410 415Gly Ser Ser
Ser Lys Leu Glu Ile Lys Pro Gln Gly Thr Glu Ser Thr 420 425 430Leu
Lys Gly Ile Gln Gly Glu Ser Ser Asp Ile Glu Val Lys Pro Gln 435 440
445Ala Thr Glu Thr Thr Glu Ala Ser Gln Tyr Gly Pro Arg Pro Gln Phe
450 455 460Asn Lys Thr Pro Lys Tyr Val Lys Tyr Arg Asp Ala Gly Thr
Gly Ile465 470 475 480Arg Glu Tyr Asn Asp Gly Thr Phe Gly Tyr Glu
Ala Arg Pro Arg Phe 485 490 495Asn Lys Pro Ser Glu Thr Asn Ala Tyr
Asn Val Thr Thr Asn Gln Asp 500 505 510Gly Thr Val Ser Tyr Gly Ala
Arg Pro Thr Gln Asn Lys Pro Ser Glu 515 520 525Thr Asn Ala Tyr Asn
Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr 530 535 540Gly Ala Arg
Pro Thr Gln Lys Lys Pro Ser Lys Thr Asn Ala Tyr Asn545 550 555
560Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr
565 570 575Gln Lys Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr
His Ala 580 585 590Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr
Lys Lys Pro Ser 595 600 605Glu Thr Asn Ala Tyr Asn Val Thr Thr His
Ala Asn Gly Gln Val Ser 610 615 620Tyr Gly Ala Arg Pro Thr Gln Lys
Lys Pro Ser Glu Thr Asn Ala Tyr625 630 635 640Asn Val Thr Thr His
Ala Asp Gly Thr Ala Thr Tyr Gly Pro Arg Val 645 650 655Thr
Lys24658PRTArtificial SequenceSynthetic Peptide 24Met Lys Lys Gln
Ile Ile Ser Leu Gly Ala Leu Ala Val Ala Ser Ser1 5 10 15Leu Phe Thr
Trp Asp Asn Lys Ala Asp Ala Ile Val Thr Lys Asp Tyr 20 25 30Ser Lys
Glu Ser Arg Val Asn Glu Lys Ser Lys Lys Gly Ala Thr Val 35 40 45Ser
Asp Tyr Tyr Tyr Trp Lys Ile Ile Asp Ser Leu Glu Ala Gln Phe 50 55
60Thr Gly Ala Ile Asp Leu Leu Glu Asp Tyr Lys Tyr Gly Asp Pro Ile65
70 75 80Tyr Lys Glu Ala Lys Asp Arg Leu Met Thr Arg Val Leu Gly Glu
Asp 85 90 95Gln Tyr Leu Leu Lys Lys Lys Ile Asp Glu Tyr Glu Leu Tyr
Lys Lys 100 105 110Trp Tyr Lys Ser Ser Asn Lys Asn Thr Asn Met Leu
Thr Phe His Lys 115 120 125Tyr Asn Leu Tyr Asn Leu Thr Met Asn Glu
Tyr Asn Asp Ile Phe Asn 130 135 140Ser Leu Lys Asp Ala Val Tyr Gln
Phe Asn Lys Glu Val Lys Glu
Ile145 150 155 160Glu His Lys Asn Val Asp Leu Lys Gln Phe Asp Lys
Asp Gly Glu Asp 165 170 175Lys Ala Thr Lys Glu Val Tyr Asp Leu Val
Ser Glu Ile Asp Thr Leu 180 185 190Val Val Thr Tyr Tyr Ala Asp Lys
Asp Tyr Gly Glu His Ala Lys Glu 195 200 205Leu Arg Ala Lys Leu Asp
Leu Ile Leu Gly Asp Thr Asp Asn Pro His 210 215 220Lys Ile Thr Asn
Glu Arg Ile Lys Lys Glu Met Ile Asp Asp Leu Asn225 230 235 240Ser
Ile Ile Asp Asp Phe Phe Met Glu Thr Lys Gln Asn Arg Pro Asn 245 250
255Ser Ile Thr Lys Tyr Asp Pro Thr Lys His Asn Phe Lys Glu Lys Ser
260 265 270Glu Asn Lys Pro Asn Phe Asp Lys Leu Val Glu Glu Thr Lys
Lys Ala 275 280 285Val Lys Glu Ala Asp Glu Ser Trp Lys Asn Lys Thr
Val Lys Lys Tyr 290 295 300Glu Glu Thr Val Thr Lys Ser Pro Val Val
Lys Glu Glu Lys Lys Val305 310 315 320Glu Glu Pro Gln Leu Pro Lys
Val Gly Asn Gln Gln Glu Val Lys Thr 325 330 335Thr Ala Gly Lys Ala
Glu Glu Thr Thr Gln Pro Val Ala Gln Pro Leu 340 345 350Val Lys Ile
Pro Gln Glu Thr Ile Tyr Gly Glu Thr Val Lys Gly Pro 355 360 365Glu
Tyr Pro Thr Met Glu Asn Lys Thr Leu Gln Gly Glu Ile Val Gln 370 375
380Gly Pro Asp Phe Leu Thr Met Glu Gln Asn Arg Pro Ser Leu Ser
Asp385 390 395 400Asn Tyr Thr Gln Pro Thr Thr Pro Asn Pro Ile Leu
Glu Gly Leu Glu 405 410 415Gly Ser Ser Ser Lys Leu Glu Ile Lys Pro
Gln Gly Thr Glu Ser Thr 420 425 430Leu Lys Gly Ile Gln Gly Glu Ser
Ser Asp Ile Glu Val Lys Pro Gln 435 440 445Ala Thr Glu Thr Thr Glu
Ala Ser Gln Tyr Gly Pro Arg Pro Gln Phe 450 455 460Asn Lys Thr Pro
Lys Tyr Val Lys Tyr Arg Asp Ala Gly Thr Gly Ile465 470 475 480Arg
Glu Tyr Asn Asp Gly Thr Phe Gly Tyr Glu Ala Arg Pro Arg Phe 485 490
495Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr Asn Gln Asp
500 505 510Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro
Ser Glu 515 520 525Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly
Gln Val Ser Tyr 530 535 540Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser
Glu Thr Asn Ala Tyr Asn545 550 555 560Val Thr Thr His Ala Asn Gly
Gln Val Ser Tyr Gly Ala Arg Pro Thr 565 570 575Gln Lys Lys Pro Ser
Lys Thr Asn Ala Tyr Asn Val Thr Thr His Ala 580 585 590Asn Gly Gln
Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser 595 600 605Glu
Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val Ser 610 615
620Tyr Gly Ala Arg Pro Thr Gln Lys Lys Pro Ser Glu Thr Asn Ala
Tyr625 630 635 640Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr
Gly Pro Arg Val 645 650 655Thr Lys25636PRTArtificial
SequenceSynthetic Peptide 25Met Lys Lys Gln Ile Ile Ser Leu Gly Ala
Leu Ala Val Ala Ser Ser1 5 10 15Leu Phe Thr Trp Asp Asn Lys Ala Asp
Ala Ile Val Thr Lys Asp Tyr 20 25 30Ser Gly Lys Ser Gln Val Asn Ala
Gly Ser Lys Asn Gly Thr Leu Ile 35 40 45Asp Ser Arg Tyr Leu Asn Ser
Ala Leu Tyr Tyr Leu Glu Asp Tyr Ile 50 55 60Ile Tyr Ala Ile Gly Leu
Thr Asn Lys Tyr Glu Tyr Gly Asp Asn Ile65 70 75 80Tyr Lys Glu Ala
Lys Asp Arg Leu Leu Glu Lys Val Leu Arg Glu Asp 85 90 95Gln Tyr Leu
Leu Glu Arg Lys Lys Ser Gln Tyr Glu Asp Tyr Lys Gln 100 105 110Trp
Tyr Ala Asn Tyr Lys Lys Glu Asn Pro Arg Thr Asp Leu Lys Met 115 120
125Ala Asn Phe His Lys Tyr Asn Leu Glu Glu Leu Ser Met Lys Glu Tyr
130 135 140Asn Glu Leu Gln Asp Ala Leu Lys Arg Ala Leu Asp Asp Phe
His Arg145 150 155 160Glu Val Lys Asp Ile Lys Asp Lys Asn Ser Asp
Leu Lys Thr Phe Asn 165 170 175Ala Ala Glu Glu Asp Lys Ala Thr Lys
Glu Val Tyr Asp Leu Val Ser 180 185 190Glu Ile Asp Thr Leu Val Val
Ser Tyr Tyr Gly Asp Lys Asp Tyr Gly 195 200 205Glu His Ala Lys Glu
Leu Arg Ala Lys Leu Asp Leu Ile Leu Gly Asp 210 215 220Thr Asp Asn
Pro His Lys Ile Thr Asn Glu Arg Ile Lys Lys Glu Met225 230 235
240Ile Asp Asp Leu Asn Ser Ile Ile Asp Asp Phe Phe Met Glu Thr Lys
245 250 255Gln Asn Arg Pro Lys Ser Ile Thr Lys Tyr Asn Pro Thr Thr
His Asn 260 265 270Tyr Lys Thr Asn Ser Asp Asn Lys Pro Asn Phe Asp
Lys Leu Val Glu 275 280 285Glu Thr Lys Lys Ala Val Lys Glu Ala Asp
Asp Ser Trp Lys Lys Lys 290 295 300Thr Val Lys Lys Tyr Gly Glu Thr
Glu Thr Lys Ser Pro Val Val Lys305 310 315 320Glu Glu Lys Lys Val
Glu Glu Pro Gln Ala Pro Lys Val Asp Asn Gln 325 330 335Gln Glu Val
Lys Thr Thr Ala Gly Lys Ala Glu Glu Thr Thr Gln Pro 340 345 350Val
Ala Gln Pro Leu Val Lys Ile Pro Gln Gly Thr Ile Thr Gly Glu 355 360
365Ile Val Lys Gly Pro Glu Tyr Pro Thr Met Glu Asn Lys Thr Val Gln
370 375 380Gly Glu Ile Val Gln Gly Pro Asp Phe Leu Thr Met Glu Gln
Ser Gly385 390 395 400Pro Ser Leu Ser Asn Asn Tyr Thr Asn Pro Pro
Leu Thr Asn Pro Ile 405 410 415Leu Glu Gly Leu Glu Gly Ser Ser Ser
Lys Leu Glu Ile Lys Pro Gln 420 425 430Gly Thr Glu Ser Thr Leu Lys
Gly Thr Gln Gly Glu Ser Ser Asp Ile 435 440 445Glu Val Lys Pro Gln
Ala Thr Glu Thr Thr Glu Ala Ser Gln Tyr Gly 450 455 460Pro Arg Pro
Gln Phe Asn Lys Thr Pro Lys Tyr Val Lys Tyr Arg Asp465 470 475
480Ala Gly Thr Gly Ile Arg Glu Tyr Asn Asp Gly Thr Phe Gly Tyr Glu
485 490 495Ala Arg Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr
Asn Val 500 505 510Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala
Arg Pro Thr Tyr 515 520 525Lys Lys Pro Ser Glu Thr Asn Ala Tyr Asn
Val Thr Thr His Ala Asn 530 535 540Gly Gln Val Ser Tyr Gly Ala Arg
Pro Thr Gln Asn Lys Pro Ser Lys545 550 555 560Thr Asn Ala Tyr Asn
Val Thr Thr His Gly Asn Gly Gln Val Ser Tyr 565 570 575Gly Ala Arg
Pro Thr Gln Asn Lys Pro Ser Lys Thr Asn Ala Tyr Asn 580 585 590Val
Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr 595 600
605Tyr Lys Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr His Ala
610 615 620Asp Gly Thr Ala Thr Tyr Gly Pro Arg Val Thr Lys625 630
63526609PRTArtificial SequenceSynthetic Peptide 26Met Lys Lys Gln
Ile Ile Ser Leu Gly Ala Leu Ala Val Ala Ser Ser1 5 10 15Leu Phe Thr
Trp Asp Asn Lys Ala Asp Ala Ile Val Thr Lys Asp Tyr 20 25 30Ser Gly
Lys Ser Gln Val Asn Ala Gly Ser Lys Asn Gly Thr Leu Ile 35 40 45Asp
Ser Arg Tyr Leu Asn Ser Ala Leu Tyr Tyr Leu Glu Asp Tyr Ile 50 55
60Ile Tyr Ala Ile Gly Leu Thr Asn Lys Tyr Glu Tyr Gly Asp Asn Ile65
70 75 80Tyr Lys Glu Ala Lys Asp Arg Leu Leu Glu Lys Val Leu Arg Glu
Asp 85 90 95Gln Tyr Leu Leu Glu Arg Lys Lys Ser Gln Tyr Glu Asp Tyr
Lys Gln 100 105 110Trp Tyr Ala Asn Tyr Lys Lys Glu Asn Pro Arg Thr
Asp Leu Lys Met 115 120 125Ala Asn Phe His Lys Tyr Asn Leu Glu Glu
Leu Ser Met Lys Glu Tyr 130 135 140Asn Glu Leu Gln Asp Ala Leu Lys
Arg Ala Leu Asp Asp Phe His Arg145 150 155 160Glu Val Lys Asp Ile
Lys Asp Lys Asn Ser Asp Leu Lys Thr Phe Asn 165 170 175Ala Ala Glu
Glu Asp Lys Ala Thr Lys Glu Val Tyr Asp Leu Val Ser 180 185 190Glu
Ile Asp Thr Leu Val Val Ser Tyr Tyr Gly Asp Lys Asp Tyr Gly 195 200
205Glu His Ala Lys Glu Leu Arg Ala Lys Leu Asp Leu Ile Leu Gly Asp
210 215 220Thr Asp Asn Pro His Lys Ile Thr Asn Glu Arg Ile Lys Lys
Glu Met225 230 235 240Ile Asp Asp Leu Asn Ser Ile Ile Asp Asp Phe
Phe Met Glu Thr Lys 245 250 255Gln Asn Arg Pro Lys Ser Ile Thr Lys
Tyr Asn Pro Thr Thr His Asn 260 265 270Tyr Lys Thr Asn Ser Asp Asn
Lys Pro Asn Phe Asp Lys Leu Val Glu 275 280 285Glu Thr Lys Lys Ala
Val Lys Glu Ala Asp Asp Ser Trp Lys Lys Lys 290 295 300Thr Val Lys
Lys Tyr Gly Glu Thr Glu Thr Lys Ser Pro Val Val Lys305 310 315
320Glu Glu Lys Lys Val Glu Glu Pro Gln Ala Pro Lys Val Asp Asn Gln
325 330 335Gln Glu Val Lys Thr Thr Ala Gly Lys Ala Glu Glu Thr Thr
Gln Pro 340 345 350Val Ala Gln Pro Leu Val Lys Ile Pro Gln Gly Thr
Ile Thr Gly Glu 355 360 365Ile Val Lys Gly Pro Glu Tyr Pro Thr Met
Glu Asn Lys Thr Val Gln 370 375 380Gly Glu Ile Val Gln Gly Pro Asp
Phe Leu Thr Met Glu Gln Ser Gly385 390 395 400Pro Ser Leu Ser Asn
Asn Tyr Thr Asn Pro Pro Leu Thr Asn Pro Ile 405 410 415Leu Glu Gly
Leu Glu Gly Ser Ser Ser Lys Leu Glu Ile Lys Pro Gln 420 425 430Gly
Thr Glu Ser Thr Leu Lys Gly Thr Gln Gly Glu Ser Ser Asp Ile 435 440
445Glu Val Lys Pro Gln Ala Thr Glu Thr Thr Glu Ala Ser Gln Tyr Gly
450 455 460Pro Arg Pro Gln Phe Asn Lys Thr Pro Lys Tyr Val Lys Tyr
Arg Asp465 470 475 480Ala Gly Thr Gly Ile Arg Glu Tyr Asn Asp Gly
Thr Phe Gly Tyr Glu 485 490 495Ala Arg Pro Arg Phe Asn Lys Pro Ser
Glu Thr Asn Ala Tyr Asn Val 500 505 510Thr Thr His Ala Asn Gly Gln
Val Ser Tyr Gly Ala Arg Pro Thr Gln 515 520 525Asn Lys Pro Ser Lys
Thr Asn Ala Tyr Asn Val Thr Thr His Gly Asn 530 535 540Gly Gln Val
Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys545 550 555
560Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr
565 570 575Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser Lys Thr Asn Ala
Tyr Asn 580 585 590Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr Gly
Pro Arg Val Thr 595 600 605Lys27656PRTArtificial SequenceSynthetic
Peptide 27Met Lys Lys Gln Ile Ile Ser Leu Gly Ala Leu Ala Val Ala
Ser Ser1 5 10 15Leu Phe Thr Trp Asp Asn Lys Ala Asp Ala Ile Val Thr
Lys Asp Tyr 20 25 30Asn Gly Lys Ser Gln Val Lys Lys Glu Ser Lys Asn
Gly Thr Leu Ile 35 40 45Asp Ser Arg Tyr Tyr Trp Glu Lys Ile Glu Ala
Leu Glu Lys Gln Phe 50 55 60Ser Ser Ala Leu Ala Leu Thr Asp Glu Tyr
Gln Tyr Gly Gly Asn Glu65 70 75 80Tyr Lys Glu Ala Lys Asp Lys Leu
Met Glu Arg Ile Leu Gly Glu Asp 85 90 95Gln Tyr Leu Leu Lys Lys Lys
Ile Asp Glu Tyr Asp Tyr Tyr Lys Lys 100 105 110Trp Tyr Lys Ala Thr
Tyr Pro Asn Asp Asn Ser Lys Met Tyr Ser Phe 115 120 125His Lys Tyr
Asn Val Tyr Tyr Leu Thr Met Asn Glu Tyr Asn Glu Ile 130 135 140Thr
Asn Ser Leu Lys Asp Ala Val Glu Lys Phe Asn Asn Glu Val Arg145 150
155 160Asp Ile Gln Ser Lys Asn Glu Asp Leu Lys Pro Tyr Asp Glu Asn
Thr 165 170 175Glu Lys Gln Glu Thr Asp Lys Ile Tyr Glu Phe Val Ser
Glu Ile Asp 180 185 190Thr Val Phe Ala Ala Tyr Tyr Ser His Glu Lys
Phe Gly Ile His Ala 195 200 205Lys Glu Leu Arg Ala Lys Leu Asp Ile
Ile Leu Gly Asp Val His Asn 210 215 220Pro Asn Arg Ile Thr Asn Glu
Arg Ile Lys Lys Glu Met Met Glu Asp225 230 235 240Leu Asn Ser Ile
Val Asp Asp Phe Phe Met Glu Thr Asn Gln Asn Arg 245 250 255Pro Thr
Thr Ile Lys Lys Tyr Asp Pro Asn Ile His Asp Tyr Thr Lys 260 265
270Lys Lys Glu Asn Lys Glu Asn Phe Asp Lys Leu Val Lys Glu Thr Arg
275 280 285Glu Ala Val Glu Lys Ala Asp Glu Ser Trp Lys Asn Lys Thr
Val Lys 290 295 300Lys Tyr Glu Glu Thr Val Thr Lys Ser Pro Phe Val
Lys Glu Glu Lys305 310 315 320Lys Val Glu Glu Pro Gln Leu Pro Lys
Val Gly Asn Gln Gln Glu Val 325 330 335Lys Thr Thr Ala Gly Lys Ala
Glu Glu Thr Thr Gln Pro Leu Val Lys 340 345 350Ile Pro Gln Gly Thr
Ile Thr Gly Glu Ile Val Lys Gly Pro Asp Tyr 355 360 365Pro Thr Met
Glu Asn Lys Thr Leu Gln Gly Glu Ile Val Gln Gly Pro 370 375 380Asp
Phe Pro Thr Met Glu Gln Asn Arg Pro Ser Leu Ser Asp Asn Tyr385 390
395 400Thr Gln Pro Thr Thr Thr Asn Pro Ile Leu Glu Gly Leu Glu Gly
Ser 405 410 415Ser Ser Lys Leu Glu Ile Lys Pro Gln Gly Thr Glu Ser
Thr Leu Gln 420 425 430Gly Thr Gln Gly Glu Ser Ser Asp Ile Glu Val
Lys Pro Gln Ala Thr 435 440 445Glu Thr Thr Glu Ala Ser Gln Tyr Gly
Pro Arg Pro Gln Phe Asn Lys 450 455 460Thr Pro Lys Tyr Val Lys Tyr
Arg Asp Ala Gly Thr Gly Ile Arg Glu465 470 475 480Tyr Asn Asp Gly
Thr Phe Gly Tyr Glu Ala Arg Pro Arg Phe Asn Lys 485 490 495Pro Ser
Glu Thr Asn Ala Tyr Asn Val Thr Thr Asn Gln Asp Gly Thr 500 505
510Val Thr Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys Thr Asn
515 520 525Ala Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr
Gly Ala 530 535 540Arg Pro Thr Tyr Lys Lys Pro Ser Glu Thr Asn Ala
Tyr Asn Val Thr545 550 555 560Thr His Ala Asn Gly Gln Val Ser Tyr
Gly Ala Arg Pro Thr Gln Asn 565 570 575Lys Ala Ser Glu Thr Asn Ala
Tyr Asn Val Thr Thr His Ala Asn Gly 580 585 590Gln Val Ser Tyr Gly
Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys Thr 595 600 605Asn Ala Tyr
Asn Val Thr Thr His Gly Asn Gly Gln Val Ser Tyr Gly 610 615 620Ala
Arg Pro Thr Tyr Lys Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val625 630
635 640Thr Thr His Ala Asp Gly Thr Ala Thr Tyr Gly Pro Arg Val Thr
Lys 645 650 65528656PRTArtificial SequenceSynthetic Peptide 28Met
Lys Lys Gln Ile Ile Ser Leu Gly Ala Leu Ala Val Ala Ser Ser1 5 10
15Leu Phe Thr Trp Asp Asn Lys Ala Asp Ala Ile Val Thr Lys Asp Tyr
20 25 30Asn Gly Lys Ser Gln Val Lys Lys Glu Ser Lys Asn Gly Thr
Leu Ile 35 40 45Asp Ser Arg Tyr Tyr Trp Glu Lys Ile Glu Ala Leu Glu
Lys Gln Phe 50 55 60Ser Ser Ala Leu Ala Leu Thr Asp Glu Tyr Gln Tyr
Gly Gly Asn Glu65 70 75 80Tyr Lys Glu Ala Lys Asp Lys Leu Met Glu
Arg Ile Leu Gly Glu Asp 85 90 95Gln Tyr Leu Leu Lys Lys Lys Ile Asp
Glu Tyr Asp Tyr Tyr Lys Lys 100 105 110Trp Tyr Lys Ala Thr Tyr Pro
Asn Asp Asn Ser Lys Met Tyr Ser Phe 115 120 125His Lys Tyr Asn Val
Tyr Tyr Leu Thr Met Asn Glu Tyr Asn Glu Ile 130 135 140Ser Asn Ser
Leu Lys Asp Ala Val Glu Lys Phe Asn Asn Glu Val Arg145 150 155
160Asp Ile Gln Ser Lys Asn Glu Asp Leu Lys Pro Tyr Asp Glu Asn Thr
165 170 175Glu Lys Gln Glu Thr Asp Lys Ile Tyr Glu Phe Val Ser Glu
Ile Asp 180 185 190Thr Val Phe Ala Ala Tyr Tyr Ser His Glu Lys Phe
Gly Ile His Ala 195 200 205Lys Glu Leu Arg Ala Lys Leu Asp Ile Ile
Leu Gly Asp Val His Asn 210 215 220Pro Asn Arg Ile Thr Asn Glu Arg
Ile Lys Lys Glu Met Met Glu Asp225 230 235 240Leu Asn Ser Ile Val
Asp Asp Phe Phe Met Glu Thr Asn Gln Asn Arg 245 250 255Pro Thr Thr
Ile Lys Lys Tyr Asp Pro Asn Ile His Asp Tyr Thr Lys 260 265 270Lys
Lys Glu Asn Lys Glu Asn Phe Asp Lys Leu Val Lys Glu Thr Arg 275 280
285Glu Ala Val Glu Lys Ala Asp Glu Ser Trp Lys Asn Lys Thr Val Lys
290 295 300Lys Tyr Glu Glu Thr Val Thr Lys Ser Pro Phe Val Lys Glu
Glu Lys305 310 315 320Lys Val Glu Glu Pro Gln Leu Pro Lys Val Gly
Asn Gln Gln Glu Val 325 330 335Lys Thr Thr Ala Gly Lys Ala Glu Glu
Thr Thr Gln Pro Leu Val Lys 340 345 350Ile Pro Gln Gly Thr Ile Thr
Gly Glu Ile Val Lys Gly Pro Asp Tyr 355 360 365Pro Thr Met Glu Asn
Lys Thr Leu Gln Gly Glu Ile Val Gln Gly Pro 370 375 380Asp Phe Pro
Thr Met Glu Gln Asn Arg Pro Ser Leu Ser Asp Asn Tyr385 390 395
400Thr Gln Pro Thr Thr Thr Asn Pro Ile Leu Glu Gly Leu Glu Gly Ser
405 410 415Ser Ser Lys Leu Glu Ile Lys Pro Gln Gly Thr Glu Ser Thr
Leu Gln 420 425 430Gly Thr Gln Gly Glu Ser Ser Asp Ile Glu Val Lys
Pro Gln Ala Thr 435 440 445Glu Thr Thr Glu Ala Ser Gln Tyr Gly Pro
Arg Pro Gln Phe Asn Lys 450 455 460Thr Pro Lys Tyr Val Lys Tyr Arg
Asp Ala Gly Thr Gly Ile Arg Glu465 470 475 480Tyr Asn Asp Gly Thr
Phe Gly Tyr Glu Ala Arg Pro Arg Phe Asn Lys 485 490 495Pro Ser Glu
Thr Asn Ala Tyr Asn Val Thr Thr Asn Gln Asp Gly Thr 500 505 510Val
Thr Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys Thr Asn 515 520
525Ala Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala
530 535 540Arg Pro Thr Tyr Lys Lys Pro Ser Glu Thr Asn Ala Tyr Asn
Val Thr545 550 555 560Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala
Arg Pro Thr Gln Asn 565 570 575Lys Ala Ser Glu Thr Asn Ala Tyr Asn
Val Thr Thr His Ala Asn Gly 580 585 590Gln Val Ser Tyr Gly Ala Arg
Pro Thr Gln Asn Lys Pro Ser Lys Thr 595 600 605Asn Ala Tyr Asn Val
Thr Thr His Gly Asn Gly Gln Val Ser Tyr Gly 610 615 620Ala Arg Pro
Thr Tyr Lys Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val625 630 635
640Thr Thr His Ala Asp Gly Thr Ala Thr Tyr Gly Pro Arg Val Thr Lys
645 650 65529575PRTArtificial SequenceSynthetic Peptide 29Met Lys
Lys Gln Ile Ile Ser Leu Gly Ala Leu Ala Val Ala Ser Ser1 5 10 15Leu
Phe Thr Trp Asp Asn Lys Ala Asp Ala Ile Val Thr Lys Asp Tyr 20 25
30Asn Gly Lys Ser Gln Val Lys Lys Glu Ser Lys Asn Gly Thr Leu Ile
35 40 45Asp Ser Arg Tyr Tyr Trp Glu Lys Ile Glu Ala Leu Glu Lys Gln
Phe 50 55 60Ser Ser Ala Leu Ala Leu Thr Asp Glu Tyr Gln Tyr Gly Gly
Asn Glu65 70 75 80Tyr Lys Glu Ala Lys Asp Lys Leu Met Glu Arg Ile
Leu Gly Glu Asp 85 90 95Gln Tyr Leu Leu Lys Lys Lys Ile Asp Glu Tyr
Asp Tyr Tyr Lys Lys 100 105 110Trp Tyr Lys Ala Thr Tyr Pro Asn Asp
Asn Ser Lys Met Tyr Ser Phe 115 120 125His Lys Tyr Asn Val Tyr Tyr
Leu Thr Met Asn Glu Tyr Asn Glu Ile 130 135 140Thr Asn Ser Leu Lys
Asp Ala Val Glu Lys Phe Asn Asn Glu Val Arg145 150 155 160Asp Ile
Gln Ser Lys Asn Glu Asp Leu Lys Pro Tyr Asp Glu Asn Thr 165 170
175Glu Lys Gln Glu Thr Asp Lys Ile Tyr Glu Phe Val Ser Glu Ile Asp
180 185 190Thr Val Phe Ala Ala Tyr Tyr Ser His Glu Lys Phe Gly Ile
His Ala 195 200 205Lys Glu Leu Arg Ala Lys Leu Asp Ile Ile Leu Gly
Asp Val His Asn 210 215 220Pro Asn Arg Ile Thr Asn Glu Arg Ile Lys
Lys Glu Met Met Glu Asp225 230 235 240Leu Asn Ser Ile Val Asp Asp
Phe Phe Met Glu Thr Asn Gln Asn Arg 245 250 255Pro Thr Thr Ile Lys
Lys Tyr Asp Pro Asn Ile His Asp Tyr Thr Lys 260 265 270Lys Lys Glu
Asn Lys Glu Asn Phe Asp Lys Leu Val Lys Glu Thr Arg 275 280 285Glu
Ala Val Glu Lys Ala Asp Glu Ser Trp Lys Asn Lys Thr Val Lys 290 295
300Lys Tyr Glu Glu Thr Val Thr Lys Ser Pro Phe Val Lys Glu Glu
Lys305 310 315 320Lys Val Glu Glu Pro Gln Leu Pro Lys Val Gly Asn
Gln Gln Glu Val 325 330 335Lys Thr Thr Ala Gly Lys Ala Glu Glu Thr
Thr Gln Pro Leu Val Lys 340 345 350Ile Pro Gln Gly Thr Ile Thr Gly
Glu Ile Val Lys Gly Pro Asp Tyr 355 360 365Pro Thr Met Glu Asn Lys
Thr Leu Gln Gly Glu Ile Val Gln Gly Pro 370 375 380Asp Phe Pro Thr
Met Glu Gln Asn Arg Pro Ser Leu Ser Asp Asn Tyr385 390 395 400Thr
Gln Pro Thr Thr Thr Asn Pro Ile Leu Glu Gly Leu Glu Gly Ser 405 410
415Ser Ser Lys Leu Glu Ile Lys Pro Gln Gly Thr Glu Ser Thr Leu Gln
420 425 430Gly Thr Gln Gly Glu Ser Ser Asp Ile Glu Val Lys Pro Gln
Ala Thr 435 440 445Glu Thr Thr Glu Ala Ser Gln Tyr Gly Pro Arg Pro
Gln Phe Asn Lys 450 455 460Thr Pro Lys Tyr Val Lys Tyr Arg Asp Ala
Gly Thr Gly Ile Arg Glu465 470 475 480Tyr Asn Asp Gly Thr Phe Gly
Tyr Glu Ala Arg Pro Arg Phe Asn Lys 485 490 495Pro Ser Glu Thr Asn
Ala Tyr Asn Val Thr Thr Asn Gln Asp Gly Thr 500 505 510Val Thr Tyr
Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys Thr Asn 515 520 525Ala
Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala 530 535
540Arg Pro Thr Tyr Lys Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val
Thr545 550 555 560Thr His Ala Asn Gly Thr Ala Thr Tyr Gly Pro Arg
Val Thr Lys 565 570 57530609PRTArtificial SequenceSynthetic Peptide
30Met Lys Lys Gln Ile Ile Ser Leu Gly Ala Leu Ala Val Ala Ser Ser1
5 10 15Leu Phe Thr Trp Asp Asn Lys Ala Asp Ala Ile Val Thr Lys Asp
Tyr 20 25 30Ser Lys Glu Ser Arg Val Asn Glu Asn Ser Lys Tyr Asp Thr
Pro Ile 35 40 45Pro Asp Trp Tyr Leu Gly Ser Ile Leu Asn Arg Leu Gly
Asp Gln Ile 50 55 60Tyr Tyr Ala Lys Glu Leu Thr Asn Lys Tyr Glu Tyr
Gly Glu Lys Glu65 70 75 80Tyr Lys Gln Ala Ile Asp Lys Leu Met Thr
Arg Val Leu Gly Glu Asp 85 90 95His Tyr Leu Leu Glu Lys Lys Lys Ala
Gln Tyr Glu Ala Tyr Lys Lys 100 105 110Trp Phe Glu Lys His Lys Ser
Glu Asn Pro His Ser Ser Leu Lys Lys 115 120 125Ile Lys Phe Asp Asp
Phe Asp Leu Tyr Arg Leu Thr Lys Lys Glu Tyr 130 135 140Asn Glu Leu
His Gln Ser Leu Lys Glu Ala Val Asp Glu Phe Asn Ser145 150 155
160Glu Val Lys Asn Ile Gln Ser Lys Gln Lys Asp Leu Leu Pro Tyr Asp
165 170 175Glu Ala Thr Glu Asn Arg Val Thr Asn Gly Ile Tyr Asp Phe
Val Cys 180 185 190Glu Ile Asp Thr Leu Tyr Ala Ala Tyr Phe Asn His
Ser Gln Tyr Gly 195 200 205His Asn Ala Lys Glu Leu Arg Ala Lys Leu
Asp Ile Ile Leu Gly Asp 210 215 220Ala Lys Asp Pro Val Arg Ile Thr
Asn Glu Arg Ile Arg Lys Glu Met225 230 235 240Met Asp Asp Leu Asn
Ser Ile Ile Asp Asp Phe Phe Met Asp Thr Asn 245 250 255Met Asn Arg
Pro Leu Asn Ile Thr Lys Phe Asn Pro Asn Ile His Asp 260 265 270Tyr
Thr Asn Lys Pro Glu Asn Arg Asp Asn Phe Asp Lys Leu Val Lys 275 280
285Glu Thr Arg Glu Ala Ile Ala Asn Ala Asp Glu Ser Trp Lys Thr Arg
290 295 300Thr Val Lys Asn Tyr Gly Glu Ser Glu Thr Lys Ser Pro Val
Val Lys305 310 315 320Glu Glu Lys Lys Val Glu Glu Pro Gln Leu Pro
Lys Val Gly Asn Gln 325 330 335Gln Glu Asp Lys Ile Thr Val Gly Thr
Thr Glu Glu Ala Pro Leu Pro 340 345 350Ile Ala Gln Pro Leu Val Lys
Ile Pro Gln Gly Thr Ile Gln Gly Glu 355 360 365Ile Val Lys Gly Pro
Glu Tyr Leu Thr Met Glu Asn Lys Thr Leu Gln 370 375 380Gly Glu Ile
Val Gln Gly Pro Asp Phe Pro Thr Met Glu Gln Asn Arg385 390 395
400Pro Ser Leu Ser Asp Asn Tyr Thr Gln Pro Thr Thr Pro Asn Pro Ile
405 410 415Leu Lys Gly Ile Glu Gly Asn Ser Thr Lys Leu Glu Ile Lys
Pro Gln 420 425 430Gly Thr Glu Ser Thr Leu Lys Gly Thr Gln Gly Glu
Ser Ser Asp Ile 435 440 445Glu Val Lys Pro Gln Ala Thr Glu Thr Thr
Glu Ala Ser His Tyr Pro 450 455 460Ala Arg Pro Gln Phe Asn Lys Thr
Pro Lys Tyr Val Lys Tyr Arg Asp465 470 475 480Ala Gly Thr Gly Ile
Arg Glu Tyr Asn Asp Gly Thr Phe Gly Tyr Glu 485 490 495Ala Arg Pro
Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val 500 505 510Thr
Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln 515 520
525Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn
530 535 540Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro
Ser Glu545 550 555 560Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn
Gly Gln Val Ser Tyr 565 570 575Gly Ala Arg Pro Thr Gln Asn Lys Pro
Ser Lys Thr Asn Ala Tyr Asn 580 585 590Val Thr Thr His Ala Asp Gly
Thr Ala Thr Tyr Gly Pro Arg Val Thr 595 600
605Lys31663PRTArtificial SequenceSynthetic Peptide 31Met Lys Lys
Gln Ile Ile Ser Leu Gly Ala Leu Ala Val Ala Ser Ser1 5 10 15Leu Phe
Thr Trp Asp Asn Lys Ala Asp Ala Ile Val Thr Lys Asp Tyr 20 25 30Ser
Lys Glu Ser Arg Val Asn Glu Asn Ser Lys Tyr Asp Thr Pro Ile 35 40
45Pro Asp Trp Tyr Leu Gly Ser Ile Leu Asn Arg Leu Gly Asp Gln Ile
50 55 60Tyr Tyr Ala Lys Glu Leu Thr Asn Lys Tyr Glu Tyr Gly Glu Lys
Glu65 70 75 80Tyr Lys Gln Ala Ile Asp Lys Leu Met Thr Arg Val Leu
Gly Glu Asp 85 90 95His Tyr Leu Leu Glu Lys Lys Lys Ala Gln Tyr Glu
Ala Tyr Lys Lys 100 105 110Trp Phe Glu Lys His Lys Ser Glu Asn Pro
His Ser Ser Leu Lys Lys 115 120 125Ile Lys Phe Asp Asp Phe Asp Leu
Tyr Arg Leu Thr Lys Lys Glu Tyr 130 135 140Asn Glu Leu His Gln Ser
Leu Lys Glu Ala Val Asp Glu Phe Asn Ser145 150 155 160Glu Val Lys
Asn Ile Gln Ser Lys Gln Lys Asp Leu Leu Pro Tyr Asp 165 170 175Glu
Ala Thr Glu Asn Arg Val Thr Asn Gly Ile Tyr Asp Phe Val Cys 180 185
190Glu Ile Asp Thr Leu Tyr Ala Ala Tyr Phe Asn His Ser Gln Tyr Gly
195 200 205His Asn Ala Lys Glu Leu Arg Ala Lys Leu Asp Ile Ile Leu
Gly Asp 210 215 220Ala Lys Asp Pro Val Arg Ile Thr Asn Glu Arg Ile
Arg Lys Glu Met225 230 235 240Met Asp Asp Leu Asn Ser Ile Ile Asp
Asp Phe Phe Met Asp Thr Asn 245 250 255Met Asn Arg Pro Leu Asn Ile
Thr Lys Phe Asn Pro Asn Ile His Asp 260 265 270Tyr Thr Asn Lys Pro
Glu Asn Arg Asp Asn Phe Asp Lys Leu Val Lys 275 280 285Glu Thr Arg
Glu Ala Val Ala Asn Ala Asp Glu Ser Trp Lys Thr Arg 290 295 300Thr
Val Lys Asn Tyr Gly Glu Ser Glu Thr Lys Ser Pro Val Val Lys305 310
315 320Glu Glu Lys Lys Val Glu Glu Pro Gln Leu Pro Lys Val Gly Asn
Gln 325 330 335Gln Glu Asp Lys Ile Thr Val Gly Thr Thr Glu Glu Ala
Pro Leu Pro 340 345 350Ile Ala Gln Pro Leu Val Lys Ile Pro Gln Gly
Thr Ile Gln Gly Glu 355 360 365Ile Val Lys Gly Pro Glu Tyr Leu Thr
Met Glu Asn Lys Thr Leu Gln 370 375 380Gly Glu Ile Val Gln Gly Pro
Asp Phe Pro Thr Met Glu Gln Asn Arg385 390 395 400Pro Ser Leu Ser
Asp Asn Tyr Thr Gln Pro Thr Thr Pro Asn Pro Ile 405 410 415Leu Lys
Gly Ile Glu Gly Asn Ser Thr Lys Leu Glu Ile Lys Pro Gln 420 425
430Gly Thr Glu Ser Thr Leu Lys Gly Thr Gln Gly Glu Ser Ser Asp Ile
435 440 445Glu Val Lys Pro Gln Ala Thr Glu Thr Thr Glu Ala Ser His
Tyr Pro 450 455 460Ala Arg Pro Gln Phe Asn Lys Thr Pro Lys Tyr Val
Lys Tyr Arg Asp465 470 475 480Ala Gly Thr Gly Ile Arg Glu Tyr Asn
Asp Gly Thr Phe Gly Tyr Glu 485 490 495Ala Arg Pro Arg Phe Asn Lys
Pro Ser Glu Thr Asn Ala Tyr Asn Val 500 505 510Thr Thr Asn Gln Asp
Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln 515 520 525Asn Lys Pro
Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn 530 535 540Gly
Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu545 550
555 560Thr Asn Ala Tyr Asn Val Thr Thr Asn Gln Asp Gly Thr Val Ser
Tyr 565 570 575Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu Thr Asn
Ala Tyr Asn 580 585 590Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr
Gly Ala Arg Pro Thr 595 600 605Gln Asn Lys Pro Ser Glu Thr Asn Ala
Tyr Asn Val Thr Thr His Ala 610 615 620Asn Gly Gln Val Ser Tyr Gly
Ala Arg Pro Thr Gln Asn Lys Pro Ser625 630 635 640Lys Thr Asn Ala
Tyr Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr 645
650 655Tyr Gly Pro Arg Val Thr Lys 66032663PRTArtificial
SequenceSynthetic Peptide 32Met Lys Lys Gln Ile Ile Ser Leu Gly Ala
Leu Ala Val Ala Ser Ser1 5 10 15Leu Phe Thr Trp Asp Asn Lys Ala Asp
Ala Ile Val Thr Lys Asp Tyr 20 25 30Ser Lys Glu Ser Arg Val Asn Glu
Asn Ser Lys Tyr Asp Thr Pro Ile 35 40 45Pro Asp Trp Tyr Leu Gly Ser
Ile Leu Asn Arg Leu Gly Asp Gln Ile 50 55 60Tyr Tyr Ala Lys Glu Leu
Thr Asn Lys Tyr Glu Tyr Gly Glu Lys Glu65 70 75 80Tyr Lys Gln Ala
Ile Asp Lys Leu Met Thr Arg Val Leu Gly Glu Asp 85 90 95His Tyr Leu
Leu Glu Lys Lys Lys Ala Gln Tyr Glu Ala Tyr Lys Lys 100 105 110Trp
Phe Glu Lys His Lys Ser Glu Asn Pro His Ser Ser Leu Lys Lys 115 120
125Ile Lys Phe Asp Asp Phe Asp Leu Tyr Arg Leu Thr Lys Lys Glu Tyr
130 135 140Asn Glu Leu His Gln Ser Leu Lys Glu Ala Val Asp Glu Phe
Asn Ser145 150 155 160Glu Val Lys Asn Ile Gln Ser Lys Gln Lys Asp
Leu Leu Pro Tyr Asp 165 170 175Glu Ala Thr Glu Asn Arg Val Thr Asn
Gly Ile Tyr Asp Phe Val Cys 180 185 190Glu Ile Asp Thr Leu Tyr Ala
Ala Tyr Phe Asn His Ser Gln Tyr Gly 195 200 205His Asn Ala Lys Glu
Leu Arg Ala Lys Leu Asp Ile Ile Leu Gly Asp 210 215 220Ala Lys Asp
Pro Val Arg Ile Thr Asn Glu Arg Ile Arg Lys Glu Met225 230 235
240Met Asp Asp Leu Asn Ser Ile Ile Asp Asp Phe Phe Met Asp Thr Asn
245 250 255Met Asn Arg Pro Leu Asn Ile Thr Lys Phe Asn Pro Asn Ile
His Asp 260 265 270Tyr Thr Asn Lys Pro Glu Asn Arg Asp Asn Phe Asp
Lys Leu Val Lys 275 280 285Glu Thr Arg Glu Ala Ile Ala Asn Ala Asp
Glu Ser Trp Lys Thr Arg 290 295 300Thr Val Lys Asn Tyr Gly Glu Ser
Glu Thr Lys Ser Pro Val Val Lys305 310 315 320Glu Glu Lys Lys Val
Glu Glu Pro Gln Leu Pro Lys Val Gly Asn Gln 325 330 335Gln Glu Asp
Lys Ile Thr Val Gly Thr Thr Glu Glu Ala Pro Leu Pro 340 345 350Ile
Ala Gln Pro Leu Val Lys Ile Pro Gln Gly Thr Ile Gln Gly Glu 355 360
365Ile Val Lys Gly Pro Glu Tyr Leu Thr Met Glu Asn Lys Thr Leu Gln
370 375 380Gly Glu Ile Val Gln Gly Pro Asp Phe Pro Thr Met Glu Gln
Asn Arg385 390 395 400Pro Ser Leu Ser Asp Asn Tyr Thr Gln Pro Thr
Thr Pro Asn Pro Ile 405 410 415Leu Lys Gly Ile Glu Gly Asn Ser Thr
Lys Leu Glu Ile Lys Pro Gln 420 425 430Gly Thr Glu Ser Thr Leu Lys
Gly Thr Gln Gly Glu Ser Ser Asp Ile 435 440 445Glu Val Lys Pro Gln
Ala Thr Glu Thr Thr Glu Ala Ser His Tyr Pro 450 455 460Ala Arg Pro
Gln Phe Asn Lys Thr Pro Lys Tyr Val Lys Tyr Arg Asp465 470 475
480Ala Gly Thr Gly Ile Arg Glu Tyr Asn Asp Gly Thr Phe Gly Tyr Glu
485 490 495Ala Arg Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr
Asn Val 500 505 510Thr Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly Ala
Arg Pro Thr Gln 515 520 525Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn
Val Thr Thr His Ala Asn 530 535 540Gly Gln Val Ser Tyr Gly Ala Arg
Pro Thr Tyr Lys Lys Pro Ser Glu545 550 555 560Thr Asn Ala Tyr Asn
Val Thr Thr Asn Gln Asp Gly Thr Val Ser Tyr 565 570 575Gly Ala Arg
Pro Thr Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn 580 585 590Val
Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr 595 600
605Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala
610 615 620Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys
Pro Ser625 630 635 640Lys Thr Asn Ala Tyr Asn Val Thr Thr His Ala
Asp Gly Thr Ala Thr 645 650 655Tyr Gly Pro Arg Val Thr Lys
66033590PRTArtificial SequenceSynthetic Peptide 33Met Lys Lys Gln
Ile Ile Ser Leu Gly Ala Leu Ala Val Ala Ser Ser1 5 10 15Leu Phe Thr
Trp Asp Asn Lys Ala Asp Ala Ile Val Thr Lys Asp Tyr 20 25 30Ser Gly
Lys Ser Gln Val Asn Ala Gly Ser Lys Asn Gly Lys Gln Ile 35 40 45Ala
Asp Gly Tyr Tyr Trp Gly Ile Ile Glu Asn Leu Glu Asn Gln Phe 50 55
60Tyr Asn Ile Phe His Leu Leu Asp Gln His Lys Tyr Ala Glu Lys Glu65
70 75 80Tyr Lys Asp Ala Leu Asp Lys Leu Lys Thr Arg Val Leu Glu Glu
Asp 85 90 95Gln Tyr Leu Leu Glu Arg Lys Lys Glu Lys Tyr Glu Ile Tyr
Lys Glu 100 105 110Leu Tyr Lys Lys Tyr Lys Lys Glu Asn Pro Asn Thr
Gln Val Lys Met 115 120 125Lys Ala Phe Asp Lys Tyr Asp Leu Gly Asp
Leu Thr Met Glu Glu Tyr 130 135 140Asn Asp Leu Ser Lys Leu Leu Thr
Lys Ala Leu Asp Asn Phe Lys Leu145 150 155 160Glu Val Lys Lys Ile
Glu Ser Glu Asn Pro Asp Leu Arg Pro Tyr Ser 165 170 175Glu Ser Glu
Glu Arg Thr Ala Tyr Gly Lys Ile Asp Ser Leu Val Asp 180 185 190Gln
Ala Tyr Ser Val Tyr Phe Ala Tyr Val Thr Asp Ala Gln His Lys 195 200
205Thr Glu Ala Leu Asn Leu Arg Ala Lys Ile Asp Leu Ile Leu Gly Asp
210 215 220Glu Lys Asp Pro Ile Arg Val Thr Asn Gln Arg Thr Glu Lys
Glu Met225 230 235 240Ile Lys Asp Leu Glu Ser Ile Ile Asp Asp Phe
Phe Ile Glu Thr Lys 245 250 255Leu Asn Arg Pro Gln His Ile Thr Arg
Tyr Asp Gly Thr Lys His Asp 260 265 270Tyr His Lys His Lys Asp Gly
Phe Asp Ala Leu Val Lys Glu Thr Arg 275 280 285Glu Ala Val Ser Lys
Ala Asp Glu Ser Trp Lys Thr Lys Thr Val Lys 290 295 300Lys Tyr Gly
Glu Thr Glu Thr Lys Tyr Pro Val Val Lys Glu Glu Lys305 310 315
320Lys Val Glu Glu Pro Gln Ser Pro Lys Val Ser Glu Lys Val Asp Val
325 330 335Gln Glu Thr Val Gly Thr Thr Glu Glu Ala Pro Leu Pro Ile
Ala Gln 340 345 350Pro Leu Val Lys Leu Pro Gln Ile Gly Thr Gln Gly
Glu Ile Val Lys 355 360 365Gly Pro Asp Tyr Pro Thr Met Glu Asn Lys
Thr Leu Gln Gly Val Ile 370 375 380Val Gln Gly Pro Asp Phe Pro Thr
Met Glu Gln Asn Arg Pro Ser Leu385 390 395 400Ser Asp Asn Tyr Thr
Gln Pro Ser Val Thr Leu Pro Ser Ile Thr Gly 405 410 415Glu Ser Thr
Pro Thr Asn Pro Ile Leu Lys Gly Ile Glu Gly Asn Ser 420 425 430Ser
Lys Leu Glu Ile Lys Pro Gln Gly Thr Glu Ser Thr Leu Lys Gly 435 440
445Ile Gln Gly Glu Ser Ser Asp Ile Glu Val Lys Pro Gln Ala Thr Glu
450 455 460Thr Thr Glu Ala Ser His Tyr Pro Ala Arg Pro Gln Phe Asn
Lys Thr465 470 475 480Pro Lys Tyr Val Lys Tyr Arg Asp Ala Gly Thr
Gly Ile Arg Glu Tyr 485 490 495Asn Asp Gly Thr Phe Gly Tyr Glu Ala
Arg Pro Arg Phe Asn Lys Pro 500 505 510Ser Glu Thr Asn Ala Tyr Asn
Val Thr Thr Asn Gln Asp Gly Thr Val 515 520 525Ser Tyr Gly Ala Arg
Pro Thr Gln Asn Lys Pro Ser Lys Thr Asn Ala 530 535 540Tyr Asn Val
Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg545 550 555
560Pro Thr Tyr Asn Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr
565 570 575His Ala Asp Gly Thr Ala Thr Tyr Gly Pro Arg Val Thr Lys
580 585 59034671PRTArtificial SequenceSynthetic Peptide 34Met Lys
Lys Gln Ile Ile Ser Leu Gly Ala Leu Ala Val Ala Ser Ser1 5 10 15Leu
Phe Thr Trp Asp Asn Lys Ala Asp Ala Ile Val Thr Lys Asp Tyr 20 25
30Ser Gly Lys Ser Gln Val Asn Ala Gly Ser Lys Asn Gly Lys Gln Ile
35 40 45Ala Asp Gly Tyr Tyr Trp Gly Ile Ile Glu Asn Leu Glu Asn Gln
Phe 50 55 60Tyr Asn Ile Phe His Leu Leu Asp Gln His Lys Tyr Ala Glu
Lys Glu65 70 75 80Tyr Lys Asp Ala Leu Asp Lys Leu Lys Thr Arg Val
Leu Glu Glu Asp 85 90 95Gln Tyr Leu Leu Glu Arg Lys Lys Glu Lys Tyr
Glu Ile Tyr Lys Glu 100 105 110Leu Tyr Lys Lys Tyr Lys Lys Glu Asn
Pro Asn Thr Gln Val Lys Met 115 120 125Lys Ala Phe Asp Lys Tyr Asp
Leu Gly Asp Leu Thr Met Glu Glu Tyr 130 135 140Asn Asp Leu Ser Lys
Leu Leu Thr Lys Ala Leu Asp Asn Phe Lys Leu145 150 155 160Glu Val
Lys Lys Ile Glu Ser Glu Asn Pro Asp Leu Arg Pro Tyr Ser 165 170
175Glu Ser Glu Glu Arg Thr Ala Tyr Gly Lys Ile Asp Ser Leu Val Asp
180 185 190Gln Ala Tyr Ser Val Tyr Phe Ala Tyr Val Thr Asp Ala Gln
His Lys 195 200 205Thr Glu Ala Leu Asn Leu Arg Ala Lys Ile Asp Leu
Ile Leu Gly Asp 210 215 220Glu Lys Asp Pro Ile Arg Val Thr Asn Gln
Arg Thr Glu Lys Glu Met225 230 235 240Ile Lys Asp Leu Glu Ser Ile
Ile Asp Asp Phe Phe Ile Glu Thr Lys 245 250 255Leu Asn Arg Pro Gln
His Ile Thr Arg Tyr Asp Gly Thr Lys His Asp 260 265 270Tyr His Lys
His Lys Asp Gly Phe Asp Ala Leu Val Lys Glu Thr Arg 275 280 285Glu
Ala Val Ser Lys Ala Asp Glu Ser Trp Lys Thr Lys Thr Val Lys 290 295
300Lys Tyr Gly Glu Thr Glu Thr Lys Tyr Pro Val Val Lys Glu Glu
Lys305 310 315 320Lys Val Glu Glu Pro Gln Ser Pro Lys Val Ser Glu
Lys Val Asp Val 325 330 335Gln Glu Thr Val Gly Thr Thr Glu Glu Ala
Pro Leu Pro Ile Ala Gln 340 345 350Pro Leu Val Lys Leu Pro Gln Ile
Gly Thr Gln Gly Glu Ile Val Lys 355 360 365Gly Pro Asp Tyr Pro Thr
Met Glu Asn Lys Thr Leu Gln Gly Val Ile 370 375 380Val Gln Gly Pro
Asp Phe Pro Thr Met Glu Gln Asn Arg Pro Ser Leu385 390 395 400Ser
Asp Asn Tyr Thr Gln Pro Ser Val Thr Leu Pro Ser Ile Thr Gly 405 410
415Glu Ser Thr Pro Thr Asn Pro Ile Leu Lys Gly Ile Glu Gly Asn Ser
420 425 430Ser Lys Leu Glu Ile Lys Pro Gln Gly Thr Glu Ser Thr Leu
Lys Gly 435 440 445Ile Gln Gly Glu Ser Ser Asp Ile Glu Val Lys Pro
Gln Ala Thr Glu 450 455 460Thr Thr Glu Ala Ser His Tyr Pro Ala Arg
Pro Gln Phe Asn Lys Thr465 470 475 480Pro Lys Tyr Val Lys Tyr Arg
Asp Ala Gly Thr Gly Ile Arg Glu Tyr 485 490 495Asn Asp Gly Thr Phe
Gly Tyr Glu Ala Arg Pro Arg Phe Asn Lys Pro 500 505 510Ser Glu Thr
Asn Ala Tyr Asn Val Thr Thr Asn Gln Asp Gly Thr Val 515 520 525Ser
Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys Thr Asn Ala 530 535
540Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala
Arg545 550 555 560Pro Thr Tyr Asn Lys Pro Ser Glu Thr Asn Ala Tyr
Asn Val Thr Thr 565 570 575Asn Arg Asp Gly Thr Val Ser Tyr Gly Ala
Arg Pro Thr Gln Asn Lys 580 585 590Pro Ser Glu Thr Asn Ala Tyr Asn
Val Thr Thr His Gly Asn Gly Gln 595 600 605Val Ser Tyr Gly Ala Arg
Pro Thr Gln Lys Lys Pro Ser Lys Thr Asn 610 615 620Ala Tyr Asn Val
Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala625 630 635 640Arg
Pro Thr Tyr Asn Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr 645 650
655Thr His Ala Asp Gly Thr Ala Thr Tyr Gly Pro Arg Val Thr Lys 660
665 67035671PRTArtificial SequenceSynthetic Peptide 35Met Lys Lys
Gln Ile Ile Ser Leu Gly Ala Leu Ala Val Ala Ser Ser1 5 10 15Leu Phe
Thr Trp Asp Asn Lys Ala Asp Ala Ile Val Thr Lys Asp Tyr 20 25 30Ser
Gly Lys Ser Gln Val Asn Ala Gly Ser Lys Asn Gly Lys Gln Ile 35 40
45Ala Asp Gly Tyr Tyr Trp Gly Ile Ile Glu Asn Leu Glu Asn Gln Phe
50 55 60Tyr Asn Ile Phe His Leu Leu Asp Gln His Lys Tyr Ala Glu Lys
Glu65 70 75 80Tyr Lys Asp Ala Leu Asp Lys Leu Lys Thr Arg Val Leu
Glu Glu Asp 85 90 95Gln Tyr Leu Leu Glu Arg Lys Lys Glu Lys Tyr Glu
Ile Tyr Lys Glu 100 105 110Leu Tyr Lys Lys Tyr Lys Lys Glu Asn Pro
Asn Thr Gln Val Lys Met 115 120 125Lys Ala Phe Asp Lys Tyr Asp Leu
Gly Asp Leu Thr Met Glu Glu Tyr 130 135 140Asn Asp Leu Ser Lys Leu
Leu Thr Lys Ala Leu Asp Asn Phe Lys Leu145 150 155 160Glu Val Lys
Lys Ile Glu Ser Glu Asn Pro Asp Leu Arg Pro Tyr Ser 165 170 175Glu
Ser Glu Glu Arg Thr Ala Tyr Gly Lys Ile Asp Ser Leu Val Asp 180 185
190Gln Ala Tyr Ser Val Tyr Phe Ala Tyr Val Thr Asp Ala Gln His Lys
195 200 205Thr Glu Ala Leu Asn Leu Arg Ala Lys Ile Asp Leu Ile Leu
Gly Asp 210 215 220Glu Lys Asp Pro Ile Arg Val Thr Asn Gln Arg Thr
Glu Lys Glu Met225 230 235 240Ile Lys Asp Leu Glu Ser Ile Ile Asp
Asp Phe Phe Ile Glu Thr Lys 245 250 255Leu Asn Arg Pro Gln His Ile
Thr Arg Tyr Asp Gly Thr Lys His Asp 260 265 270Tyr His Lys His Lys
Asp Gly Phe Asp Ala Leu Val Lys Glu Thr Arg 275 280 285Glu Ala Val
Ser Lys Ala Asp Glu Ser Trp Lys Thr Lys Thr Val Lys 290 295 300Lys
Tyr Gly Glu Thr Glu Thr Lys Tyr Pro Val Val Lys Glu Glu Lys305 310
315 320Lys Val Glu Glu Pro Gln Ser Pro Lys Val Ser Glu Lys Val Asp
Val 325 330 335Gln Glu Thr Val Gly Thr Thr Glu Glu Ala Pro Leu Pro
Ile Ala Gln 340 345 350Pro Leu Val Lys Leu Pro Gln Ile Gly Thr Gln
Gly Glu Ile Val Lys 355 360 365Gly Pro Asp Tyr Pro Thr Met Glu Asn
Lys Thr Leu Gln Gly Val Ile 370 375 380Val Gln Gly Pro Asp Phe Pro
Thr Met Glu Gln Asn Arg Pro Ser Leu385 390 395 400Ser Asp Asn Tyr
Thr Gln Pro Ser Val Thr Leu Pro Ser Ile Thr Gly 405 410 415Glu Ser
Thr Ser Thr Asn Pro Ile Leu Lys Gly Ile Glu Gly Asn Ser 420 425
430Ser Lys Leu Glu Ile Lys Pro Gln Gly Thr Glu Ser Thr Leu Lys Gly
435 440 445Ile Gln Gly Glu Ser Ser Asp Ile Glu Val Lys Pro Gln Ala
Thr Glu 450 455 460Thr Thr Glu Ala Ser His Tyr Pro Ala Arg Pro Gln
Phe Asn Lys Thr465 470 475 480Pro Lys Tyr Val Lys Tyr Arg Asp Ala
Gly Thr Gly Ile Arg Glu Tyr 485 490 495Asn Asp Gly Thr Phe Gly Tyr
Glu Ala Arg Pro Arg Phe Asn Lys Pro 500 505 510Ser
Glu Thr Asn Ala Tyr Asn Val Thr Thr Asn Gln Asp Gly Thr Val 515 520
525Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys Thr Asn Ala
530 535 540Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly
Ala Arg545 550 555 560Pro Thr Tyr Asn Lys Pro Ser Glu Thr Asn Ala
Tyr Asn Val Thr Thr 565 570 575Asn Arg Asp Gly Thr Val Ser Tyr Gly
Ala Arg Pro Thr Gln Asn Lys 580 585 590Pro Ser Glu Thr Asn Ala Tyr
Asn Val Thr Thr His Gly Asn Gly Gln 595 600 605Val Ser Tyr Gly Ala
Arg Pro Thr Gln Lys Lys Pro Ser Lys Thr Asn 610 615 620Ala Tyr Asn
Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala625 630 635
640Arg Pro Thr Gln Lys Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr
645 650 655Thr His Ala Asp Gly Thr Ala Thr Tyr Gly Pro Arg Val Thr
Lys 660 665 67036663PRTArtificial SequenceSynthetic Peptide 36Met
Lys Lys Gln Ile Ile Ser Leu Gly Ala Leu Ala Val Ala Ser Ser1 5 10
15Leu Phe Thr Trp Asp Asn Lys Ala Asp Ala Ile Val Thr Lys Asp Tyr
20 25 30Ser Lys Glu Ser Arg Val Asn Glu Asn Ser Lys Tyr Asp Thr Pro
Ile 35 40 45Pro Asp Trp Tyr Leu Gly Ser Ile Leu Asn Arg Leu Gly Asp
Gln Ile 50 55 60Tyr Tyr Ala Lys Glu Leu Thr Asn Lys Tyr Glu Tyr Gly
Glu Lys Glu65 70 75 80Tyr Lys Gln Ala Ile Asp Lys Leu Met Thr Arg
Val Leu Gly Glu Asp 85 90 95His Tyr Leu Leu Glu Lys Lys Lys Ala Gln
Tyr Glu Ala Tyr Lys Lys 100 105 110Trp Phe Glu Lys His Lys Ser Glu
Asn Pro His Ser Ser Leu Lys Lys 115 120 125Ile Lys Phe Asp Asp Phe
Asp Leu Tyr Arg Leu Thr Lys Lys Glu Tyr 130 135 140Asn Glu Leu His
Gln Ser Leu Lys Glu Ala Val Asp Glu Phe Asn Ser145 150 155 160Glu
Val Lys Asn Ile Gln Ser Lys Gln Lys Asp Leu Leu Pro Tyr Asp 165 170
175Glu Ala Thr Glu Asn Arg Val Thr Asn Gly Ile Tyr Asp Phe Val Cys
180 185 190Glu Ile Asp Thr Leu Tyr Ala Ala Tyr Phe Asn His Ser Gln
Tyr Gly 195 200 205His Asn Ala Lys Glu Leu Arg Ala Lys Leu Asp Ile
Ile Leu Gly Asp 210 215 220Ala Lys Asp Pro Val Arg Ile Thr Asn Glu
Arg Ile Arg Lys Glu Met225 230 235 240Met Asp Asp Leu Asn Ser Ile
Ile Asp Asp Phe Phe Met Asp Thr Asn 245 250 255Met Asn Arg Pro Leu
Asn Ile Thr Lys Phe Asn Pro Asn Ile His Asp 260 265 270Tyr Thr Asn
Lys Pro Glu Asn Arg Asp Asn Phe Asp Lys Leu Val Lys 275 280 285Glu
Thr Arg Glu Ala Val Ala Asn Ala Asp Glu Ser Trp Lys Thr Arg 290 295
300Thr Val Lys Asn Tyr Gly Glu Ser Glu Thr Lys Ser Pro Val Val
Lys305 310 315 320Glu Glu Lys Lys Val Glu Glu Pro Gln Leu Pro Lys
Val Gly Asn Gln 325 330 335Gln Glu Asp Lys Ile Thr Val Gly Thr Thr
Glu Glu Ala Pro Leu Pro 340 345 350Ile Ala Gln Pro Leu Val Lys Ile
Pro Gln Gly Thr Ile Gln Gly Glu 355 360 365Ile Val Lys Gly Pro Glu
Tyr Leu Thr Met Glu Asn Lys Thr Leu Gln 370 375 380Gly Glu Ile Val
Gln Gly Pro Asp Phe Pro Thr Met Glu Gln Asn Arg385 390 395 400Pro
Ser Leu Ser Asp Asn Tyr Thr Gln Pro Thr Thr Pro Asn Pro Ile 405 410
415Leu Lys Gly Ile Glu Gly Asn Ser Thr Lys Leu Glu Ile Lys Pro Gln
420 425 430Gly Thr Glu Ser Thr Leu Lys Gly Thr Gln Gly Glu Ser Ser
Asp Ile 435 440 445Glu Val Lys Pro Gln Ala Thr Glu Thr Thr Glu Ala
Ser His Tyr Pro 450 455 460Ala Arg Pro Gln Phe Asn Lys Thr Pro Lys
Tyr Val Lys Tyr Arg Asp465 470 475 480Ala Gly Thr Gly Ile Arg Glu
Tyr Asn Asp Gly Thr Phe Gly Tyr Glu 485 490 495Ala Arg Pro Arg Phe
Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val 500 505 510Thr Thr Asn
Gln Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln 515 520 525Asn
Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn 530 535
540Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser
Glu545 550 555 560Thr Asn Ala Tyr Asn Val Thr Thr Asn Gln Asp Gly
Thr Val Ser Tyr 565 570 575Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser
Glu Thr Asn Ala Tyr Asn 580 585 590Val Thr Thr His Ala Asn Gly Gln
Val Ser Tyr Gly Ala Arg Pro Thr 595 600 605Gln Asn Lys Pro Ser Glu
Thr Asn Ala Tyr Asn Val Thr Thr His Ala 610 615 620Asn Gly Gln Val
Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser625 630 635 640Lys
Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr 645 650
655Tyr Gly Pro Arg Val Thr Lys 66037663PRTArtificial
SequenceSynthetic Peptide 37Met Lys Lys Gln Ile Ile Ser Leu Gly Ala
Leu Ala Val Ala Ser Ser1 5 10 15Leu Phe Thr Trp Asp Asn Lys Ala Asp
Ala Ile Val Thr Lys Asp Tyr 20 25 30Ser Lys Glu Ser Arg Val Asn Glu
Asn Ser Lys Tyr Asp Thr Pro Ile 35 40 45Pro Asp Trp Tyr Leu Gly Ser
Ile Leu Asn Arg Leu Gly Asp Gln Ile 50 55 60Tyr Tyr Ala Lys Glu Leu
Thr Asn Lys Tyr Glu Tyr Gly Glu Lys Glu65 70 75 80Tyr Lys Gln Ala
Ile Asp Lys Leu Met Thr Arg Val Leu Gly Glu Asp 85 90 95His Tyr Leu
Leu Glu Lys Lys Lys Ala Gln Tyr Glu Ala Tyr Lys Lys 100 105 110Trp
Phe Glu Lys His Lys Ser Glu Asn Pro His Ser Ser Leu Lys Lys 115 120
125Ile Lys Phe Asp Asp Phe Asp Leu Tyr Arg Leu Thr Lys Lys Glu Tyr
130 135 140Asn Glu Leu His Gln Ser Leu Lys Glu Ala Val Asp Glu Phe
Asn Ser145 150 155 160Glu Val Lys Asn Ile Gln Ser Lys Gln Lys Asp
Leu Leu Pro Tyr Asp 165 170 175Glu Ala Thr Glu Asn Arg Val Thr Asn
Gly Ile Tyr Asp Phe Val Cys 180 185 190Glu Ile Asp Thr Leu Tyr Ala
Ala Tyr Phe Asn His Ser Gln Tyr Gly 195 200 205His Asn Ala Lys Glu
Leu Arg Ala Lys Leu Asp Ile Ile Leu Gly Asp 210 215 220Ala Lys Asp
Pro Val Arg Ile Thr Asn Glu Arg Ile Arg Lys Glu Lys225 230 235
240Met Asp Asp Leu Asn Ser Ile Ile Asp Asp Phe Phe Met Asp Thr Asn
245 250 255Met Asn Arg Pro Leu Asn Ile Thr Lys Phe Asn Pro Asn Ile
His Asp 260 265 270Tyr Thr Asn Lys Pro Glu Asn Arg Asp Asn Phe Asp
Lys Leu Val Lys 275 280 285Glu Thr Arg Glu Ala Val Ala Asn Ala Asp
Glu Ser Trp Lys Thr Arg 290 295 300Thr Val Lys Asn Tyr Gly Glu Ser
Glu Thr Lys Ser Pro Val Val Lys305 310 315 320Glu Glu Lys Lys Val
Glu Glu Pro Gln Leu Pro Lys Val Gly Asn Gln 325 330 335Gln Glu Asp
Lys Ile Thr Val Gly Thr Thr Glu Glu Ala Pro Leu Pro 340 345 350Ile
Ala Gln Pro Leu Val Lys Ile Pro Gln Gly Thr Ile Gln Gly Glu 355 360
365Ile Val Lys Gly Pro Glu Tyr Leu Thr Met Glu Asn Lys Thr Leu Gln
370 375 380Gly Glu Ile Val Gln Gly Pro Asp Phe Pro Thr Met Glu Gln
Asn Arg385 390 395 400Pro Ser Leu Ser Asp Asn Tyr Thr Gln Pro Thr
Thr Pro Asn Pro Ile 405 410 415Leu Lys Gly Ile Glu Gly Asn Ser Thr
Lys Leu Glu Ile Lys Pro Gln 420 425 430Gly Thr Glu Ser Thr Leu Lys
Gly Thr Gln Gly Glu Ser Ser Asp Ile 435 440 445Glu Val Lys Pro Gln
Ala Thr Glu Thr Thr Glu Ala Ser His Tyr Pro 450 455 460Ala Arg Pro
Gln Phe Asn Lys Thr Pro Lys Tyr Val Lys Tyr Arg Asp465 470 475
480Ala Gly Thr Gly Ile Arg Glu Tyr Asn Asp Gly Thr Phe Gly Tyr Glu
485 490 495Ala Arg Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr
Asn Val 500 505 510Thr Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly Ala
Arg Pro Thr Gln 515 520 525Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn
Val Thr Thr His Ala Asn 530 535 540Gly Gln Val Ser Tyr Gly Ala Arg
Pro Thr Tyr Lys Lys Pro Ser Glu545 550 555 560Thr Asn Ala Tyr Asn
Val Thr Thr Asn Gln Asp Gly Thr Val Ser Tyr 565 570 575Gly Ala Arg
Pro Thr Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn 580 585 590Val
Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr 595 600
605Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala
610 615 620Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys
Pro Ser625 630 635 640Lys Thr Asn Ala Tyr Asn Val Thr Thr His Ala
Asp Gly Thr Ala Thr 645 650 655Tyr Gly Pro Arg Val Thr Lys
66038609PRTArtificial SequenceSynthetic Peptide 38Met Lys Lys Gln
Ile Ile Ser Leu Gly Ala Leu Ala Val Ala Ser Ser1 5 10 15Leu Phe Thr
Trp Asp Asn Lys Ala Asp Ala Ile Val Thr Lys Asp Tyr 20 25 30Ser Lys
Glu Ser Arg Val Asn Glu Asn Ser Lys Tyr Asp Thr Pro Ile 35 40 45Pro
Asp Trp Tyr Leu Gly Ser Ile Leu Asn Arg Leu Gly Asp Gln Ile 50 55
60Tyr Tyr Ala Lys Glu Leu Thr Asn Lys Tyr Glu Tyr Gly Glu Lys Glu65
70 75 80Tyr Lys Gln Ala Ile Asp Lys Leu Met Thr Arg Val Leu Gly Glu
Asp 85 90 95His Tyr Leu Leu Glu Lys Lys Lys Ala Gln Tyr Glu Ala Tyr
Lys Lys 100 105 110Trp Phe Glu Lys His Lys Ser Glu Asn Pro His Ser
Ser Leu Lys Lys 115 120 125Ile Lys Phe Asp Asp Phe Asp Leu Tyr Arg
Leu Thr Lys Lys Glu Tyr 130 135 140Asn Glu Leu His Gln Ser Leu Lys
Glu Ala Val Asp Glu Phe Asn Ser145 150 155 160Glu Val Lys Asn Ile
Gln Ser Lys Gln Lys Asp Leu Leu Pro Tyr Asp 165 170 175Glu Ala Thr
Glu Asn Arg Val Thr Asn Gly Ile Tyr Asp Phe Val Cys 180 185 190Glu
Ile Asp Thr Leu Tyr Ala Ala Tyr Phe Asn His Ser Gln Tyr Gly 195 200
205His Asn Ala Lys Glu Leu Arg Ala Lys Leu Asp Ile Ile Leu Gly Asp
210 215 220Ala Lys Asp Pro Val Arg Ile Thr Asn Glu Arg Ile Arg Lys
Glu Lys225 230 235 240Met Asp Asp Leu Asn Ser Ile Ile Asp Asp Phe
Phe Met Asp Thr Asn 245 250 255Met Asn Arg Pro Leu Asn Ile Thr Lys
Phe Asn Pro Asn Ile His Asp 260 265 270Tyr Thr Asn Lys Pro Glu Asn
Arg Asp Asn Phe Asp Lys Leu Val Lys 275 280 285Glu Thr Arg Glu Ala
Val Ala Asn Ala Asp Glu Ser Trp Lys Thr Arg 290 295 300Thr Val Lys
Asn Tyr Gly Glu Ser Glu Thr Lys Ser Pro Val Val Lys305 310 315
320Glu Glu Lys Lys Val Glu Glu Pro Gln Leu Pro Lys Val Gly Asn Gln
325 330 335Gln Glu Asp Lys Ile Thr Val Gly Thr Thr Glu Glu Ala Pro
Leu Pro 340 345 350Ile Ala Gln Pro Leu Val Lys Ile Pro Gln Gly Thr
Ile Gln Gly Glu 355 360 365Ile Val Lys Gly Pro Glu Tyr Leu Thr Met
Glu Asn Lys Thr Leu Gln 370 375 380Gly Glu Ile Val Gln Gly Pro Asp
Phe Pro Thr Met Glu Gln Asn Arg385 390 395 400Pro Ser Leu Ser Asp
Asn Tyr Thr Gln Pro Thr Thr Pro Asn Pro Ile 405 410 415Leu Lys Gly
Ile Glu Gly Asn Ser Thr Lys Leu Glu Ile Lys Pro Gln 420 425 430Gly
Thr Glu Ser Thr Leu Lys Gly Thr Gln Gly Glu Ser Ser Asp Ile 435 440
445Glu Val Lys Pro Gln Ala Thr Glu Thr Thr Glu Ala Ser His Tyr Pro
450 455 460Ala Arg Pro Gln Phe Asn Lys Thr Pro Lys Tyr Val Lys Tyr
Arg Asp465 470 475 480Ala Gly Thr Gly Ile Arg Glu Tyr Asn Asp Gly
Thr Phe Gly Tyr Glu 485 490 495Ala Arg Pro Arg Phe Asn Lys Pro Ser
Glu Thr Asn Ala Tyr Asn Val 500 505 510Thr Thr Asn Gln Asp Gly Thr
Val Ser Tyr Gly Ala Arg Pro Thr Gln 515 520 525Asn Lys Pro Ser Glu
Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn 530 535 540Gly Gln Val
Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu545 550 555
560Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr
565 570 575Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys Thr Asn Ala
Tyr Asn 580 585 590Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr Gly
Pro Arg Val Thr 595 600 605Lys39162PRTArtificial SequenceSynthetic
Peptide 39Arg Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn
Val Thr1 5 10 15Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro
Thr Gln Asn 20 25 30Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr
His Ala Asn Gly 35 40 45Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln Lys
Lys Pro Ser Lys Thr 50 55 60Asn Ala Tyr Asn Val Thr Thr His Ala Asn
Gly Gln Val Ser Tyr Gly65 70 75 80Ala Arg Pro Thr Gln Lys Lys Pro
Ser Lys Thr Asn Ala Tyr Asn Val 85 90 95Thr Thr His Ala Asn Gly Gln
Val Ser Tyr Gly Ala Arg Pro Thr Tyr 100 105 110Lys Lys Pro Ser Glu
Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn 115 120 125Gly Gln Val
Ser Tyr Gly Ala Arg Leu Thr Gln Lys Lys Pro Ser Glu 130 135 140Thr
Asn Ala Tyr Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr145 150
155 160Gly Pro40162PRTArtificial SequenceSynthetic Peptide 40Arg
Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10
15Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn
20 25 30Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn
Gly 35 40 45Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln Lys Lys Pro Ser
Lys Thr 50 55 60Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val
Ser Tyr Gly65 70 75 80Ala Arg Pro Thr Gln Lys Lys Pro Ser Lys Thr
Asn Ala Tyr Asn Val 85 90 95Thr Thr His Ala Asn Gly Gln Val Ser Tyr
Gly Ala Arg Pro Thr Tyr 100 105 110Lys Lys Pro Ser Glu Thr Asn Ala
Tyr Asn Val Thr Thr His Ala Asn 115 120 125Gly Gln Val Ser Tyr Gly
Ala Arg Pro Thr Gln Lys Lys Pro Ser Glu 130 135 140Thr Asn Ala Tyr
Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr145 150 155 160Gly
Pro41162PRTArtificial SequenceSynthetic Peptide 41Arg Pro Arg Phe
Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr Asn Gln
Asp Gly Thr Val Ser Tyr Gly Ala Arg
Pro Thr Gln Asn 20 25 30Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr
Thr His Ala Asn Gly 35 40 45Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr
Lys Lys Pro Ser Glu Thr 50 55 60Asn Ala Tyr Asn Val Thr Thr His Ala
Asn Gly Gln Val Ser Tyr Gly65 70 75 80Ala Arg Pro Thr Gln Lys Lys
Pro Ser Lys Thr Asn Ala Tyr Asn Val 85 90 95Thr Thr His Ala Asn Gly
Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr 100 105 110Lys Lys Pro Ser
Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn 115 120 125Gly Gln
Val Ser Tyr Gly Ala Arg Pro Thr Gln Lys Lys Pro Ser Glu 130 135
140Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr
Tyr145 150 155 160Gly Pro42135PRTArtificial SequenceSynthetic
Peptide 42Arg Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn
Val Thr1 5 10 15Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro
Thr Tyr Lys 20 25 30Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr
His Ala Asn Gly 35 40 45Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn
Lys Pro Ser Lys Thr 50 55 60Asn Ala Tyr Asn Val Thr Thr His Gly Asn
Gly Gln Val Ser Tyr Gly65 70 75 80Ala Arg Pro Thr Gln Asn Lys Pro
Ser Lys Thr Asn Ala Tyr Asn Val 85 90 95Thr Thr His Ala Asn Gly Gln
Val Ser Tyr Gly Ala Arg Pro Thr Tyr 100 105 110Lys Lys Pro Ser Lys
Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asp 115 120 125Gly Thr Ala
Thr Tyr Gly Pro 130 13543108PRTArtificial SequenceSynthetic Peptide
43Arg Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1
5 10 15Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln
Asn 20 25 30Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr His Gly
Asn Gly 35 40 45Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro
Ser Lys Thr 50 55 60Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly Gln
Val Ser Tyr Gly65 70 75 80Ala Arg Pro Thr Tyr Lys Lys Pro Ser Lys
Thr Asn Ala Tyr Asn Val 85 90 95Thr Thr His Ala Asp Gly Thr Ala Thr
Tyr Gly Pro 100 10544162PRTArtificial SequenceSynthetic Peptide
44Arg Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1
5 10 15Thr Asn Gln Asp Gly Thr Val Thr Tyr Gly Ala Arg Pro Thr Gln
Asn 20 25 30Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr His Ala
Asn Gly 35 40 45Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro
Ser Glu Thr 50 55 60Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly Gln
Val Ser Tyr Gly65 70 75 80Ala Arg Pro Thr Gln Asn Lys Ala Ser Glu
Thr Asn Ala Tyr Asn Val 85 90 95Thr Thr His Ala Asn Gly Gln Val Ser
Tyr Gly Ala Arg Pro Thr Gln 100 105 110Asn Lys Pro Ser Lys Thr Asn
Ala Tyr Asn Val Thr Thr His Gly Asn 115 120 125Gly Gln Val Ser Tyr
Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu 130 135 140Thr Asn Ala
Tyr Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr145 150 155
160Gly Pro45162PRTArtificial SequenceSynthetic Peptide 45Arg Pro
Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr
Asn Gln Asp Gly Thr Val Thr Tyr Gly Ala Arg Pro Thr Gln Asn 20 25
30Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly
35 40 45Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu
Thr 50 55 60Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val Ser
Tyr Gly65 70 75 80Ala Arg Pro Thr Gln Asn Lys Ala Ser Glu Thr Asn
Ala Tyr Asn Val 85 90 95Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly
Ala Arg Pro Thr Gln 100 105 110Asn Lys Pro Ser Lys Thr Asn Ala Tyr
Asn Val Thr Thr His Gly Asn 115 120 125Gly Gln Val Ser Tyr Gly Ala
Arg Pro Thr Tyr Lys Lys Pro Ser Glu 130 135 140Thr Asn Ala Tyr Asn
Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr145 150 155 160Gly
Pro4681PRTArtificial SequenceSynthetic Peptide 46Arg Pro Arg Phe
Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr Asn Gln
Asp Gly Thr Val Thr Tyr Gly Ala Arg Pro Thr Gln Asn 20 25 30Lys Pro
Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly 35 40 45Gln
Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu Thr 50 55
60Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly Thr Ala Thr Tyr Gly65
70 75 80Pro47108PRTArtificial SequenceSynthetic Peptide 47Arg Pro
Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr
Asn Gln Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn 20 25
30Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly
35 40 45Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu
Thr 50 55 60Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val Ser
Tyr Gly65 70 75 80Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys Thr Asn
Ala Tyr Asn Val 85 90 95Thr Thr His Ala Asp Gly Thr Ala Thr Tyr Gly
Pro 100 10548162PRTArtificial SequenceSynthetic Peptide 48Arg Pro
Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr
Asn Gln Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn 20 25
30Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly
35 40 45Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu
Thr 50 55 60Asn Ala Tyr Asn Val Thr Thr Asn Gln Asp Gly Thr Val Ser
Tyr Gly65 70 75 80Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu Thr Asn
Ala Tyr Asn Val 85 90 95Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly
Ala Arg Pro Thr Gln 100 105 110Asn Lys Pro Ser Glu Thr Asn Ala Tyr
Asn Val Thr Thr His Ala Asn 115 120 125Gly Gln Val Ser Tyr Gly Ala
Arg Pro Thr Gln Asn Lys Pro Ser Lys 130 135 140Thr Asn Ala Tyr Asn
Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr145 150 155 160Gly
Pro49162PRTArtificial SequenceSynthetic Peptide 49Arg Pro Arg Phe
Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr Asn Gln
Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn 20 25 30Lys Pro
Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly 35 40 45Gln
Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu Thr 50 55
60Asn Ala Tyr Asn Val Thr Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly65
70 75 80Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn
Val 85 90 95Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro
Thr Gln 100 105 110Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr
Thr His Ala Asn 115 120 125Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr
Gln Asn Lys Pro Ser Lys 130 135 140Thr Asn Ala Tyr Asn Val Thr Thr
His Ala Asp Gly Thr Ala Thr Tyr145 150 155 160Gly
Pro5081PRTArtificial SequenceSynthetic Peptide 50Arg Pro Arg Phe
Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr Asn Gln
Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn 20 25 30Lys Pro
Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly 35 40 45Gln
Val Ser Tyr Gly Ala Arg Pro Thr Tyr Asn Lys Pro Ser Lys Thr 50 55
60Asn Ala Tyr Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr Gly65
70 75 80Pro51162PRTArtificial SequenceSynthetic Peptide 51Arg Pro
Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr
Asn Gln Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn 20 25
30Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly
35 40 45Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr Asn Lys Pro Ser Glu
Thr 50 55 60Asn Ala Tyr Asn Val Thr Thr Asn Arg Asp Gly Thr Val Ser
Tyr Gly65 70 75 80Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu Thr Asn
Ala Tyr Asn Val 85 90 95Thr Thr His Gly Asn Gly Gln Val Ser Tyr Gly
Ala Arg Pro Thr Gln 100 105 110Lys Lys Pro Ser Lys Thr Asn Ala Tyr
Asn Val Thr Thr His Ala Asn 115 120 125Gly Gln Val Ser Tyr Gly Ala
Arg Pro Thr Tyr Asn Lys Pro Ser Lys 130 135 140Thr Asn Ala Tyr Asn
Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr145 150 155 160Gly
Pro52162PRTArtificial SequenceSynthetic Peptide 52Arg Pro Arg Phe
Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr Asn Gln
Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn 20 25 30Lys Pro
Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly 35 40 45Gln
Val Ser Tyr Gly Ala Arg Pro Thr Tyr Asn Lys Pro Ser Glu Thr 50 55
60Asn Ala Tyr Asn Val Thr Thr Asn Arg Asp Gly Thr Val Ser Tyr Gly65
70 75 80Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn
Val 85 90 95Thr Thr His Gly Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro
Thr Gln 100 105 110Lys Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr
Thr His Ala Asn 115 120 125Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr
Gln Lys Lys Pro Ser Lys 130 135 140Thr Asn Ala Tyr Asn Val Thr Thr
His Ala Asp Gly Thr Ala Thr Tyr145 150 155 160Gly
Pro53162PRTArtificial SequenceSynthetic Peptide 53Arg Pro Arg Phe
Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr Asn Gln
Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn 20 25 30Lys Pro
Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly 35 40 45Gln
Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu Thr 50 55
60Asn Ala Tyr Asn Val Thr Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly65
70 75 80Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn
Val 85 90 95Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro
Thr Gln 100 105 110Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr
Thr His Ala Asn 115 120 125Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr
Gln Asn Lys Pro Ser Lys 130 135 140Thr Asn Ala Tyr Asn Val Thr Thr
His Ala Asp Gly Thr Ala Thr Tyr145 150 155 160Gly
Pro54162PRTArtificial SequenceSynthetic Peptide 54Arg Pro Arg Phe
Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr Asn Gln
Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn 20 25 30Lys Pro
Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly 35 40 45Gln
Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu Thr 50 55
60Asn Ala Tyr Asn Val Thr Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly65
70 75 80Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn
Val 85 90 95Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro
Thr Gln 100 105 110Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr
Thr His Ala Asn 115 120 125Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr
Gln Asn Lys Pro Ser Lys 130 135 140Thr Asn Ala Tyr Asn Val Thr Thr
His Ala Asp Gly Thr Ala Thr Tyr145 150 155 160Gly
Pro55108PRTArtificial SequenceSynthetic Peptide 55Arg Pro Arg Phe
Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr Asn Gln
Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn 20 25 30Lys Pro
Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly 35 40 45Gln
Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu Thr 50 55
60Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly65
70 75 80Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys Thr Asn Ala Tyr Asn
Val 85 90 95Thr Thr His Ala Asp Gly Thr Ala Thr Tyr Gly Pro 100
10556114PRTArtificial SequenceSynthetic Peptide 56Glu Ala Arg Pro
Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn1 5 10 15Val Thr Thr
His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr 20 25 30Gln Asn
Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr His Gly 35 40 45Asn
Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser 50 55
60Lys Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val Ser65
70 75 80Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser Lys Thr Asn Ala
Tyr 85 90 95Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr Gly Pro
Arg Val 100 105 110Thr Lys5781PRTArtificial SequenceSynthetic
PeptideMISC_FEATURE(3)..(3)X is T or RMISC_FEATURE(4)..(4)X is F or
QMISC_FEATURE(5)..(5)X is N or KMISC_FEATURE(7)..(7)X is P or
AMISC_FEATURE(9)..(9)X is E or KMISC_FEATURE(18)..(18)X is H or
NMISC_FEATURE(19)..(19)X is A, G or QMISC_FEATURE(20)..(20)X is N
or DMISC_FEATURE(22)..(22)X is Q or TMISC_FEATURE(24)..(24)X is S
or TMISC_FEATURE(31)..(31)X is Y or QMISC_FEATURE(32)..(32)X is K
or NMISC_FEATURE(36)..(36)X is E or KMISC_FEATURE(46)..(46)X is A
or GMISC_FEATURE(56)..(56)X is L or PMISC_FEATURE(58)..(58)X is Q
or YMISC_FEATURE(59)..(59)X is N or KMISC_FEATURE(63)..(63)X is K
or EMISC_FEATURE(74)..(74)X is D or N 57Arg Pro Xaa Xaa Xaa Lys Xaa
Ser Xaa Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr Xaa Xaa Xaa Gly Xaa
Val Xaa Tyr Gly Ala Arg Pro Thr Xaa Xaa 20 25 30Lys Pro Ser Xaa Thr
Asn Ala Tyr Asn Val Thr Thr His Xaa Asn Gly 35 40 45Gln Val Ser Tyr
Gly Ala Arg Xaa Thr Xaa Xaa Lys Pro Ser Xaa Thr 50 55 60Asn Ala Tyr
Asn Val Thr Thr His Ala Xaa Gly Thr Ala Thr Tyr Gly65 70 75
80Pro5827PRTArtificial SequenceSynthetic
PeptideMISC_FEATURE(24)..(24)X is S or T 58Arg Pro Arg Phe Asn Lys
Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr Asn Gln Asp Gly
Thr Val Xaa Tyr
Gly Ala 20 255927PRTArtificial SequenceSynthetic
PeptideMISC_FEATURE(3)..(3)X is T or RMISC_FEATURE(4)..(4)X is Q or
FMISC_FEATURE(9)..(9)X is K or E 59Arg Pro Xaa Xaa Asn Lys Pro Ser
Xaa Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr His Ala Asn Gly Gln Val
Ser Tyr Gly Ala 20 256027PRTArtificial SequenceSynthetic
PeptideMISC_FEATURE(3)..(3)X is T or RMISC_FEATURE(4)..(4)X is F, Y
or QMISC_FEATURE(5)..(5)X is N or KMISC_FEATURE(9)..(9)X is E or
KMISC_FEATURE(18)..(18)X is H or NMISC_FEATURE(19)..(19)X is Q, A
or RMISC_FEATURE(20)..(20)X is N or DMISC_FEATURE(22)..(22)X is Q
or T 60Arg Pro Xaa Xaa Xaa Lys Pro Ser Xaa Thr Asn Ala Tyr Asn Val
Thr1 5 10 15Thr Xaa Xaa Xaa Gly Xaa Val Ser Tyr Gly Ala 20
256127PRTArtificial SequenceSynthetic
Peptidemisc_feature(3)..(6)Xaa can be any naturally occurring amino
acidmisc_feature(8)..(8)Xaa can be any naturally occurring amino
acidmisc_feature(10)..(10)Xaa can be any naturally occurring amino
acidmisc_feature(19)..(21)Xaa can be any naturally occurring amino
acidmisc_feature(23)..(25)Xaa can be any naturally occurring amino
acid 61Ala Arg Xaa Xaa Xaa Xaa Lys Xaa Ser Xaa Thr Asn Ala Tyr Asn
Val1 5 10 15Thr Thr Xaa Xaa Xaa Gly Xaa Xaa Xaa Tyr Gly 20
256227PRTArtificial SequenceSynthetic
Peptidemisc_feature(5)..(6)Xaa can be any naturally occurring amino
acidmisc_feature(10)..(10)Xaa can be any naturally occurring amino
acidmisc_feature(20)..(21)Xaa can be any naturally occurring amino
acidmisc_feature(23)..(25)Xaa can be any naturally occurring amino
acid 62Ala Arg Pro Thr Xaa Xaa Lys Pro Ser Xaa Thr Asn Ala Tyr Asn
Val1 5 10 15Thr Thr His Xaa Xaa Gly Xaa Xaa Xaa Tyr Gly 20
25631830DNAStaphylococcus aureus 63atgaaaaagc aaataatttc gctaggcgca
ttagcagttg catctagctt atttacatgg 60gataacaaag cagatgcgat agtaacaaag
gattatagtg ggaaatcaca agttaatgct 120gggagtaaaa atgggacatt
aatagatagc agatatttaa attcagctct atattatttg 180gaagactata
taatttatgc tataggatta actaataaat atgaatatgg agataatatt
240tataaagaag ctaaagatag gttgttggaa aaggtattaa gggaagatca
atatcttttg 300gagagaaaga aatctcaata tgaagattat aaacaatggt
atgcaaatta taaaaaagaa 360aatcctcgta cagatttaaa aatggctaat
tttcataaat ataatttaga agaactttcg 420atgaaagaat acaatgaact
acaggatgca ttaaagagag cactggatga ttttcacaga 480gaagttaaag
atattaagga taagaattca gacttgaaaa cttttaatgc agcagaagaa
540gataaagcaa ctaaggaagt atacgatctc gtatctgaaa ttgatacatt
agttgtatca 600tattatggtg ataaggatta tggggagcac gcgaaagagt
tacgagcaaa actggactta 660atccttggag atacagacaa tccacataaa
attacaaatg aacgtattaa aaaagaaatg 720attgatgact taaattcaat
tattgatgat ttctttatgg aaactaaaca aaatagaccg 780aaatctataa
cgaaatataa tcctacaaca cataactata aaacaaatag tgataataaa
840cctaattttg ataaattagt tgaagaaacg aaaaaagcag ttaaagaagc
agatgattct 900tggaaaaaga aaactgtcaa aaaatacgga gaaactgaaa
caaaatcgcc agtagtaaaa 960gaagagaaga aagttgaaga acctcaagca
cctaaagttg ataaccaaca agaggttaaa 1020actacggctg gtaaagctga
agaaacaaca caaccagttg cacaaccatt agttaaaatt 1080ccacagggca
caattacagg tgaaattgta aaaggtccgg aatatccaac gatggaaaat
1140aaaacggtac aaggtgaaat cgttcaaggt cccgattttc taacaatgga
acaaagcggc 1200ccatcattaa gcaataatta tacaaaccca ccgttaacga
accctatttt agaaggtctt 1260gaaggtagct catctaaact tgaaataaaa
ccacaaggta ctgaatcaac gttaaaaggt 1320actcaaggag aatcaagtga
tattgaagtt aaacctcaag caactgaaac aacagaagct 1380tctcaatatg
gtccgagacc gcaatttaac aaaacaccta aatatgttaa atatagagat
1440gctggtacag gtatccgtga atacaacgat ggaacatttg gatatgaagc
gagaccaaga 1500ttcaataagc catcagaaac aaatgcatat aacgtaacaa
cacatgcaaa tggtcaagta 1560tcatacggag ctcgtccgac acaaaacaag
ccaagcaaaa caaacgcata taacgtaaca 1620acacatggaa acggccaagt
atcatatggc gctcgcccaa cacaaaacaa gccaagcaaa 1680acaaatgcat
acaacgtaac aacacatgca aacggtcaag tgtcatacgg agctcgcccg
1740acatacaaga agccaagtaa aacaaatgca tacaatgtaa caacacatgc
agatggtact 1800gcgacatatg ggcctagagt aacaaaataa
1830641977DNAStaphylococcus aureus 64atgaaaaagc aaataatttc
gctaggcgca ttagcagttg catctagctt atttacatgg 60gataacaaag cagatgcgat
agtaacaaag gattatagta aagaatcaag agtgaatgag 120aaaagtaaaa
agggagctac tgtttcagat tattactatt ggaaaataat tgatagttta
180gaggcacaat ttactggagc aatagactta ttggaagatt ataaatatgg
agatcctatc 240tataaagaag cgaaagatag attgatgaca agagtattag
gagaagacca gtatttatta 300aagaaaaaga ttgatgaata tgagctttat
aaaaagtggt ataaaagttc aaataagaac 360actaatatgc ttactttcca
taaatataat ctttacaatt taacaatgaa tgaatataac 420gatattttta
actctttgaa agatgcagtt tatcaattta ataaagaagt taaagaaata
480gagcataaaa atgttgactt gaagcagttt gataaagatg gagaagacaa
ggcaactaaa 540gaagtttatg accttgtttc tgaaattgat acattagttg
taacttatta tgctgataag 600gattatgggg agcatgcgaa agagttacga
gcaaaactgg acttaatcct tggagataca 660gacaatccac ataaaattac
aaatgagcgt ataaaaaaag aaatgatcga tgacttaaat 720tcaattatag
atgatttctt tatggagact aaacaaaata gaccgaattc tataacaaaa
780tatgatccaa caaaacacaa ttttaaagag aagagtgaaa ataaacctaa
ttttgataaa 840ttagttgaag aaacaaaaaa agcagttaaa gaagcagacg
aatcttggaa aaataaaact 900gtcaaaaaat acgaggaaac tgtaacaaaa
tctcctgttg taaaagaaga gaagaaagtt 960gaagaacctc aattacctaa
agttggaaac cagcaagagg ttaaaactac ggctggtaaa 1020gctgaagaaa
caacacaacc agtggcacag ccattagtaa aaattccaca agaaacaatc
1080tatggtgaaa ctgtaaaagg tccagaatat ccaacgatgg aaaataaaac
gttacaaggt 1140gaaatcgttc aaggtcccga ttttctaaca atggaacaaa
acagaccatc tttaagcgat 1200aattatactc aaccgacgac accgaaccct
attttagaag gtcttgaagg tagctcatct 1260aaacttgaaa taaaaccaca
aggtactgaa tcaacgttga aaggtattca aggagaatca 1320agtgatattg
aagttaaacc tcaagcaact gaaacaacag aagcttctca atatggtccg
1380agaccgcaat ttaacaaaac acctaagtat gtgaaatata gagatgctgg
tacaggtatc 1440cgtgaataca acgatggaac atttggatat gaagcgagac
caagattcaa caagccaagt 1500gaaacaaatg catacaacgt aacgacaaat
caagatggca cagtatcata cggagctcgc 1560ccaacacaaa acaagccaag
tgaaacaaac gcatataacg taacaacaca tgcaaatggt 1620caagtatcat
acggtgctcg cccaacacaa aaaaagccaa gcaaaacaaa tgcatacaac
1680gtaacaacac atgcaaatgg tcaagtatca tatggcgctc gcccgacaca
aaaaaagcca 1740agcaaaacaa atgcatataa cgtaacaaca catgcaaatg
gtcaagtatc atacggagct 1800cgcccgacat acaagaagcc aagcgaaaca
aatgcataca acgtaacaac acatgcaaat 1860ggtcaagtat catatggcgc
tcgcccgaca caaaaaaagc caagcgaaac aaacgcatat 1920aacgtaacaa
cacatgcaga tggtactgcg acatatgggc ctagagtaac aaaataa
1977651830DNAStaphylococcus aureus 65atgaaaaagc aaataatttc
gctaggcgca ttagcagttg catctagctt atttacatgg 60gataacaaag cagatgcgat
agtaactaaa gattatagta aagaatcaag agtgaatgag 120aacagtaaat
acgatacacc aattccagat tggtatctag gtagtatttt aaacagatta
180ggggatcaaa tatactacgc taaggaatta actaataaat acgaatatgg
tgagaaagag 240tataagcaag cgatagataa attgatgact agagttttgg
gagaagatca ttatctatta 300gaaaaaaaga aagcacaata tgaagcatac
aaaaaatggt ttgaaaaaca taaaagtgaa 360aatccacatt ctagtttaaa
aaagattaaa tttgacgatt ttgatttata tagattaacg 420aagaaagaat
acaatgagtt acatcaatca ttaaaagaag ctgttgatga gtttaatagt
480gaagtgaaaa atattcaatc taaacaaaag gatttattac cttatgatga
agcaactgaa 540aatcgagtaa caaatggaat atatgatttt gtttgcgaga
ttgacacatt atacgcagca 600tattttaatc atagccaata tggtcataat
gctaaagaat taagagcaaa gctagatata 660attcttggtg atgctaaaga
tcctgttaga attacgaatg aaagaataag aaaagaaatg 720atggatgatt
taaattctat tattgatgat ttctttatgg atacaaacat gaatagacca
780ttaaacataa ctaaatttaa tccgaatatt catgactata ctaataagcc
tgaaaataga 840gataacttcg ataaattagt caaagaaaca agagaagcaa
tcgcaaacgc tgacgaatct 900tggaaaacaa gaaccgtcaa aaattacggt
gaatctgaaa caaaatctcc tgttgtaaaa 960gaagagaaga aagttgaaga
acctcaatta cctaaagttg gaaaccagca agaggataaa 1020attacagttg
gtacaactga agaagcacca ttaccaattg cgcaaccact agttaaaatt
1080ccacagggca caattcaagg tgaaattgta aaaggtccgg aatatctaac
gatggaaaat 1140aaaacgttac aaggtgaaat cgttcaaggt ccagatttcc
caacaatgga acaaaacaga 1200ccatctttaa gcgataatta tactcaaccg
acgacaccga accctatttt aaaaggtatt 1260gaaggaaact caactaaact
tgaaataaaa ccacaaggta ctgaatcaac gttaaaaggt 1320actcaaggag
aatcaagtga tattgaagtt aaacctcaag caactgaaac aacagaagca
1380tcacattatc cagcgagacc tcaatttaac aaaacaccta agtatgtgaa
atatagagat 1440gctggtacag gtatccgtga atacaacgat ggaacatttg
gatatgaagc gagaccaaga 1500ttcaacaagc caagcgaaac aaatgcatac
aacgtaacga caaatcaaga tggcacagta 1560tcatatggcg ctcgcccgac
acaaaacaag ccaagcgaaa caaacgcata taacgtaaca 1620acacatgcaa
acggccaagt atcatacgga gctcgtccga cacaaaacaa gccaagcgaa
1680acgaacgcat ataacgtaac aacacatgca aacggtcaag tgtcatacgg
agctcgccca 1740acacaaaaca agccaagtaa aacaaatgca tacaatgtaa
caacacatgc agatggtact 1800gcgacatatg gtcctagagt aacaaaataa
1830661902DNAStaphylococcus aureus 66atgaaaaagc aaataatttc
gctaggcgca ttagcagttg catctagctt atttacatgg 60gataacaaag cagatgcgat
agtaacaaag gattatagtg ggaaatcaca agttaatgct 120gggagtaaaa
atgggaaaca aattgcagat ggatattatt ggggaataat tgaaaatcta
180gaaaaccagt tttacaatat ttttcattta ctggatcagc ataaatatgc
agaaaaagaa 240tataaagatg cagtagataa attaaaaact agagttttag
aggaagacca atacctgcta 300gaaagaaaaa aagaaaaata cgaaatttat
aaagaactat ataaaaaata caaaaaagag 360aatcctaata ctcaagttaa
aatgaaagca tttgataaat acgatcttgg cgatttaact 420atggaagaat
acaatgactt atcaaaatta ttaacaaaag cattggataa ctttaagtta
480gaagtaaaga aaattgaatc agagaatcca gatttaaaac catattctga
aagcgaagaa 540agaacagcat atggtaaaat agattcactt gttgatcaag
catatagtgt atattttgcc 600tacgttacag atgcacaaca taaaacagaa
gcattaaatc ttagggcgaa aattgatttg 660attttaggtg atgaaaaaga
tccaattaga gttacgaatc aacgtactga aaaagaaatg 720attaaagatt
tagaatctat tattgatgat ttcttcattg aaaccaagtt gaatagacct
780aaacacatta ctaggtatga tggaactaaa catgattacc ataaacataa
agatggattt 840gatgctctag ttaaagaaac aagagaagcg gttgcaaagg
ctgacgaatc ttggaaaaat 900aaaactgtca aaaaatacga ggaaactgta
acaaaatctc cagttgtaaa agaagagaag 960aaagttgaag aacctcaatc
acctaaattt gataaccaac aagaggttaa aattacagtt 1020gataaagctg
aagaaacaac acaaccagtg gcacagccat tagttaaaat tccacagggc
1080acaattacag gtgaaattgt aaaaggtccg gaatatccaa cgatggaaaa
taaaacgtta 1140caaggtgaaa tcgttcaagg tccagatttc ccaacaatgg
aacaaaacag accatcttta 1200agcgataatt atactcaacc gacgacaccg
aaccctattt tagaaggtct tgaaggtagc 1260tcatctaaac ttgaaataaa
accacaaggt actgaatcaa cgttaaaagg tactcaagga 1320gaatcaagtg
atattgaagt taaacctcaa gcatctgaaa caacagaagc atcacattat
1380ccagcaagac ctcaatttaa caaaacacct aaatatgtta aatatagaga
tgctggtaca 1440ggtatccgtg aatacaacga tggaacattt ggatatgaag
cgagaccaag attcaataag 1500ccatcagaaa caaacgcata caacgtaacg
acaaatcaag atggcacagt aacatatggc 1560gctcgcccaa cacaaaacaa
accaagcaaa acaaatgcat acaacgtaac aacacatgca 1620aatggtcaag
tatcatatgg cgctcgcccg acacaaaaca agccaagcaa aacaaatgca
1680tataacgtaa caacacatgc aaatggtcaa gtatcatacg gagctcgccc
gacacaaaac 1740aagccaagca aaacaaatgc atataacgta acaacacacg
caaacggtca agtgtcatac 1800ggagctcgcc cgacatacaa gaagccaagt
aaaacaaatg catacaatgt aacaacacat 1860gcagatggta ctgcgacata
tgggcctaga gtaacaaaat aa 1902671938DNAStaphylococcus aureus
67atagtaacaa aggattatag tgggaaatca caagttaatg ctgggagtaa aaatgggaaa
60caaattgcag atggatatta ttggggaata attgaaaatc tagagaacca gttttacaat
120atttttcatt tattggatca gcataaatat gcagaaaaag aatataaaga
tgcattagat 180aaattaaaaa ctagagtttt agaggaagac caatacctgc
tagaaagaaa aaaagaaaaa 240tacgaaattt ataaagaact atataaaaaa
tacaaaaaag agaatcctaa tactcaggtt 300aaaatgaaag catttgataa
atacgatctt ggcgatttaa ctatggaaga atacaatgac 360ttatcaaaat
tattaacaaa agcattggat aactttaagt tagaagtaaa gaaaattgaa
420tcagagaatc cagatttaag accatattct gaaagtgaag agagaacagc
atatggtaaa 480atagattcac ttgttgatca agcatatagt gtatattttg
cctacgttac agatgctcaa 540cataaaacag aagcattaaa tcttagggca
aaaatagatt tgattttagg tgatgaaaaa 600gatccaatta gagtgacgaa
tcaacgtact gaaaaagaaa tgattaaaga tttagaatct 660attattgatg
atttcttcat tgaaacaaag ttgaatagac ctcaacacat tactagatat
720gatggaacta aacatgatta ccataaacat aaagatggat ttgatgcttt
agttaaagaa 780acaagagaag cggtttctaa ggctgacgaa tcttggaaaa
ctaaaactgt caaaaaatac 840ggggaaactg aaacaaaata tcctgttgta
aaagaagaga agaaagttga agaacctcaa 900tcacctaaag tttctgaaaa
agtggatgtt caggaaacgg ttggtacaac tgaagaagca 960ccattaccaa
ttgcgcaacc actagttaaa ttaccacaaa ttgggactca aggcgaaatt
1020gtaaaaggtc ccgactatcc aactatggaa aataaaacgt tacaaggtgt
aattgttcaa 1080ggtccagatt tcccaacaat ggaacaaaac agaccatctt
taagtgacaa ttatacacaa 1140ccatctgtga ctttaccgtc aattacaggt
gaaagtacac caacgaaccc tattttaaaa 1200ggtattgaag gaaactcatc
taaacttgaa ataaaaccac aaggtactga atcaacgttg 1260aaaggtattc
aaggagaatc aagtgatatt gaagttaaac ctcaagcaac tgaaacaaca
1320gaagcatcac attatccagc gagaccgcaa tttaacaaaa cacctaaata
tgtgaaatat 1380agagatgctg gtacaggtat tcgtgaatac aacgatggaa
cttttggata tgaagcgaga 1440ccaagattca acaagccatc agaaacaaac
gcatacaacg taacgacaaa tcaagatggc 1500acagtatcat atggggctcg
cccaacacaa aacaagccaa gcaaaacaaa tgcatataac 1560gtaacaacac
atgcaaacgg ccaagtatca tatggcgctc gcccgacata caacaagcca
1620agtgaaacaa atgcatacaa cgtaacgaca aatcgagatg gcacagtatc
atatggcgct 1680cgcccgacac aaaacaagcc aagcgaaacg aatgcatata
acgtaacaac acacggaaat 1740ggccaagtat catatggcgc tcgtccgaca
caaaagaagc caagcaaaac aaatgcatat 1800aacgtaacaa cacatgcaaa
cggccaagta tcatatggcg ctcgtccgac atacaacaag 1860ccaagtaaaa
caaatgcata caatgtaaca acacatgcag atggtactgc gacatatggt
1920cctagagtaa caaaataa 193868162PRTStaphylococcus aureus 68Arg Pro
Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr
Asn Gln Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn 20 25
30Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly
35 40 45Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln Lys Lys Pro Ser Lys
Thr 50 55 60Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val Ser
Tyr Gly65 70 75 80Ala Arg Pro Thr Gln Lys Lys Pro Ser Lys Thr Asn
Ala Tyr Asn Val 85 90 95Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly
Ala Arg Pro Thr Tyr 100 105 110Lys Lys Pro Ser Glu Thr Asn Ala Tyr
Asn Val Thr Thr His Ala Asn 115 120 125Gly Gln Val Ser Tyr Gly Ala
Arg Leu Thr Gln Lys Lys Pro Ser Glu 130 135 140Thr Asn Ala Tyr Asn
Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr145 150 155 160Gly
Pro69162PRTStaphylococcus aureus 69Arg Pro Arg Phe Asn Lys Pro Ser
Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr Asn Gln Asp Gly Thr Val
Ser Tyr Gly Ala Arg Pro Thr Gln Asn 20 25 30Lys Pro Ser Glu Thr Asn
Ala Tyr Asn Val Thr Thr His Ala Asn Gly 35 40 45Gln Val Ser Tyr Gly
Ala Arg Pro Thr Gln Lys Lys Pro Ser Lys Thr 50 55 60Asn Ala Tyr Asn
Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly65 70 75 80Ala Arg
Pro Thr Gln Lys Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val 85 90 95Thr
Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr 100 105
110Lys Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn
115 120 125Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln Lys Lys Pro
Ser Glu 130 135 140Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asp Gly
Thr Ala Thr Tyr145 150 155 160Gly Pro70162PRTStaphylococcus aureus
70Arg Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1
5 10 15Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln
Asn 20 25 30Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala
Asn Gly 35 40 45Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro
Ser Glu Thr 50 55 60Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly Gln
Val Ser Tyr Gly65 70 75 80Ala Arg Pro Thr Gln Lys Lys Pro Ser Lys
Thr Asn Ala Tyr Asn Val 85 90 95Thr Thr His Ala Asn Gly Gln Val Ser
Tyr Gly Ala Arg Pro Thr Tyr 100 105 110Lys Lys Pro Ser Glu Thr Asn
Ala Tyr Asn Val Thr Thr His Ala Asn 115 120 125Gly Gln Val Ser Tyr
Gly Ala Arg Pro Thr Gln Lys Lys Pro Ser Glu 130 135 140Thr Asn Ala
Tyr Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr145 150 155
160Gly Pro71135PRTStaphylococcus aureus 71Arg Pro Arg Phe Asn Lys
Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr His Ala Asn Gly
Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys 20 25 30Lys Pro Ser Glu
Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly 35 40 45Gln Val Ser
Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys Thr 50 55 60Asn Ala
Tyr Asn Val Thr Thr His Gly Asn Gly Gln Val Ser Tyr Gly65 70 75
80Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys Thr Asn Ala Tyr Asn
Val 85 90 95Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro
Thr Tyr 100 105 110Lys Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr
Thr His Ala Asp 115 120 125Gly Thr Ala Thr Tyr Gly Pro 130
13572108PRTStaphylococcus aureus 72Arg Pro Arg Phe Asn Lys Pro Ser
Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr His Ala Asn Gly Gln Val
Ser Tyr Gly Ala Arg Pro Thr Gln Asn 20 25 30Lys Pro Ser Lys Thr Asn
Ala Tyr Asn Val Thr Thr His Ala Asn Gly 35 40 45Gln Val Ser Tyr Gly
Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys Thr 50 55 60Asn Ala Tyr Asn
Val Thr Thr His Gly Asn Gly Gln Val Ser Tyr Gly65 70 75 80Ala Arg
Pro Thr Tyr Lys Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val 85 90 95Thr
Thr His Ala Asp Gly Thr Ala Thr Tyr Gly Pro 100
10573162PRTStaphylococcus aureus 73Arg Pro Arg Phe Asn Lys Pro Ser
Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr Asn Gln Asp Gly Thr Val
Thr Tyr Gly Ala Arg Pro Thr Gln Asn 20 25 30Lys Pro Ser Lys Thr Asn
Ala Tyr Asn Val Thr Thr His Ala Asn Gly 35 40 45Gln Val Ser Tyr Gly
Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu Thr 50 55 60Asn Ala Tyr Asn
Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly65 70 75 80Ala Arg
Pro Thr Gln Asn Lys Ala Ser Glu Thr Asn Ala Tyr Asn Val 85 90 95Thr
Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln 100 105
110Asn Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr His Gly Asn
115 120 125Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro
Ser Glu 130 135 140Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asp Gly
Thr Ala Thr Tyr145 150 155 160Gly Pro74162PRTStaphylococcus aureus
74Arg Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1
5 10 15Thr Asn Gln Asp Gly Thr Val Thr Tyr Gly Ala Arg Pro Thr Gln
Asn 20 25 30Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr His Ala
Asn Gly 35 40 45Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro
Ser Glu Thr 50 55 60Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly Gln
Val Ser Tyr Gly65 70 75 80Ala Arg Pro Thr Gln Asn Lys Ala Ser Glu
Thr Asn Ala Tyr Asn Val 85 90 95Thr Thr His Ala Asn Gly Gln Val Ser
Tyr Gly Ala Arg Pro Thr Gln 100 105 110Asn Lys Pro Ser Lys Thr Asn
Ala Tyr Asn Val Thr Thr His Gly Asn 115 120 125Gly Gln Val Ser Tyr
Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu 130 135 140Thr Asn Ala
Tyr Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr145 150 155
160Gly Pro7581PRTStaphylococcus aureus 75Arg Pro Arg Phe Asn Lys
Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr Asn Gln Asp Gly
Thr Val Thr Tyr Gly Ala Arg Pro Thr Gln Asn 20 25 30Lys Pro Ser Lys
Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly 35 40 45Gln Val Ser
Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu Thr 50 55 60Asn Ala
Tyr Asn Val Thr Thr His Ala Asn Gly Thr Ala Thr Tyr Gly65 70 75
80Pro76108PRTStaphylococcus aureus 76Arg Pro Arg Phe Asn Lys Pro
Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr Asn Gln Asp Gly Thr
Val Ser Tyr Gly Ala Arg Pro Thr Gln Lys 20 25 30Lys Pro Ser Glu Thr
Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly 35 40 45Gln Val Ser Tyr
Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu Thr 50 55 60Asn Ala Tyr
Asn Val Thr Thr His Gly Asn Gly Gln Val Ser Tyr Gly65 70 75 80Ala
Arg Pro Thr Gln Asn Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val 85 90
95Thr Thr His Ala Asp Gly Thr Ala Thr Tyr Gly Pro 100
10577162PRTStaphylococcus aureus 77Arg Pro Arg Phe Asn Lys Pro Ser
Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr Asn Gln Asp Gly Thr Val
Ser Tyr Gly Ala Arg Pro Thr Gln Asn 20 25 30Lys Pro Ser Glu Thr Asn
Ala Tyr Asn Val Thr Thr His Ala Asn Gly 35 40 45Gln Val Ser Tyr Gly
Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu Thr 50 55 60Asn Ala Tyr Asn
Val Thr Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly65 70 75 80Ala Arg
Pro Thr Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val 85 90 95Thr
Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln 100 105
110Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn
115 120 125Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro
Ser Lys 130 135 140Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asp Gly
Thr Ala Thr Tyr145 150 155 160Gly Pro78162PRTStaphylococcus aureus
78Arg Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1
5 10 15Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln
Asn 20 25 30Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala
Asn Gly 35 40 45Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro
Ser Glu Thr 50 55 60Asn Ala Tyr Asn Val Thr Thr Asn Gln Asp Gly Thr
Val Ser Tyr Gly65 70 75 80Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu
Thr Asn Ala Tyr Asn Val 85 90 95Thr Thr His Ala Asn Gly Gln Val Ser
Tyr Gly Ala Arg Pro Thr Gln 100 105 110Asn Lys Pro Ser Glu Thr Asn
Ala Tyr Asn Val Thr Thr His Ala Asn 115 120 125Gly Gln Val Ser Tyr
Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys 130 135 140Thr Asn Ala
Tyr Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr145 150 155
160Gly Pro7981PRTStaphylococcus aureus 79Arg Pro Arg Phe Asn Lys
Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr Asn Gln Asp Gly
Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn 20 25 30Lys Pro Ser Lys
Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly 35 40 45Gln Val Ser
Tyr Gly Ala Arg Pro Thr Tyr Asn Lys Pro Ser Lys Thr 50 55 60Asn Ala
Tyr Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr Gly65 70 75
80Pro80162PRTStaphylococcus aureus 80Arg Pro Arg Phe Asn Lys Pro
Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr Asn Gln Asp Gly Thr
Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn 20 25 30Lys Pro Ser Lys Thr
Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly 35 40 45Gln Val Ser Tyr
Gly Ala Arg Pro Thr Tyr Asn Lys Pro Ser Glu Thr 50 55 60Asn Ala Tyr
Asn Val Thr Thr Asn Arg Asp Gly Thr Val Ser Tyr Gly65 70 75 80Ala
Arg Pro Thr Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val 85 90
95Thr Thr His Gly Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln
100 105 110Lys Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr His
Ala Asn 115 120 125Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr Asn
Lys Pro Ser Lys 130 135 140Thr Asn Ala Tyr Asn Val Thr Thr His Ala
Asp Gly Thr Ala Thr Tyr145 150 155 160Gly Pro81162PRTStaphylococcus
aureus 81Arg Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn
Val Thr1 5 10 15Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro
Thr Gln Asn 20 25 30Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr
His Ala Asn Gly 35 40 45Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr Asn
Lys Pro Ser Glu Thr 50 55 60Asn Ala Tyr Asn Val Thr Thr Asn Arg Asp
Gly Thr Val Ser Tyr Gly65 70 75 80Ala Arg Pro Thr Gln Asn Lys Pro
Ser Glu Thr Asn Ala Tyr Asn Val 85 90 95Thr Thr His Gly Asn Gly Gln
Val Ser Tyr Gly Ala Arg Pro Thr Gln 100 105 110Lys Lys Pro Ser Lys
Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn 115 120 125Gly Gln Val
Ser Tyr Gly Ala Arg Pro Thr Gln Lys Lys Pro Ser Lys 130 135 140Thr
Asn Ala Tyr Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr145 150
155 160Gly Pro82162PRTStaphylococcus aureus 82Arg Pro Arg Phe Asn
Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr Asn Gln Asp
Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn 20 25 30Lys Pro Ser
Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly 35 40 45Gln Val
Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu Thr 50 55 60Asn
Ala Tyr Asn Val Thr Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly65 70 75
80Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val
85 90 95Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr
Gln 100 105 110Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr
His Ala Asn 115 120 125Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln
Asn Lys Pro Ser Lys 130 135 140Thr Asn Ala Tyr Asn Val Thr Thr His
Ala Asp Gly Thr Ala Thr Tyr145 150 155 160Gly
Pro83162PRTStaphylococcus aureus 83Arg Pro Arg Phe Asn Lys Pro Ser
Glu Thr Asn Ala Tyr Asn Val Thr1 5 10 15Thr Asn Gln Asp Gly Thr Val
Ser Tyr Gly Ala Arg Pro Thr Gln Asn 20 25 30Lys Pro Ser Glu Thr Asn
Ala Tyr Asn Val Thr Thr His Ala Asn Gly 35 40 45Gln Val Ser Tyr Gly
Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu Thr 50 55 60Asn Ala Tyr Asn
Val Thr Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly65 70 75 80Ala Arg
Pro Thr Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val 85 90 95Thr
Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln 100 105
110Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn
115 120 125Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro
Ser Lys 130 135 140Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asp Gly
Thr Ala Thr Tyr145 150 155 160Gly Pro84108PRTStaphylococcus aureus
84Arg Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr1
5 10 15Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln
Asn 20 25 30Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala
Asn Gly 35 40 45Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro
Ser Glu Thr 50 55 60Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly Gln
Val Ser Tyr Gly65 70 75 80Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys
Thr Asn Ala Tyr Asn Val 85 90 95Thr Thr His Ala Asp Gly Thr Ala Thr
Tyr Gly Pro 100 10585162PRTStaphylococcus aureus 85Ala Arg Pro Arg
Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr Asn
Gln Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln 20 25 30Asn Lys
Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn 35 40 45Gly
Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln Lys Lys Pro Ser Lys 50 55
60Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr65
70 75 80Gly Ala Arg Pro Thr Gln Lys Lys Pro Ser Lys Thr Asn Ala Tyr
Asn 85 90 95Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg
Pro Thr 100 105 110Tyr Lys Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val
Thr Thr His Ala 115 120 125Asn Gly Gln Val Ser Tyr Gly Ala Arg Leu
Thr Gln Lys Lys Pro Ser 130 135 140Glu Thr Asn Ala Tyr Asn Val Thr
Thr His Ala Asp Gly Thr Ala Thr145 150 155 160Tyr
Gly86162PRTStaphylococcus aureus 86Ala Arg Pro Arg Phe Asn Lys Pro
Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr Asn Gln Asp Gly Thr
Val Ser Tyr Gly Ala Arg Pro Thr Gln 20 25 30Asn Lys Pro Ser Glu Thr
Asn Ala Tyr Asn Val Thr Thr His Ala Asn 35 40 45Gly Gln Val Ser Tyr
Gly Ala Arg Pro Thr Gln Lys Lys Pro Ser Lys 50 55 60Thr Asn Ala Tyr
Asn Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr65 70 75 80Gly Ala
Arg Pro Thr Gln Lys Lys Pro Ser Lys Thr Asn Ala Tyr Asn 85 90 95Val
Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr 100 105
110Tyr Lys Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala
115 120 125Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln Lys Lys
Pro Ser 130 135 140Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asp
Gly Thr Ala Thr145 150 155 160Tyr Gly87162PRTStaphylococcus aureus
87Ala Arg Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val1
5 10 15Thr Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr
Gln 20 25 30Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His
Ala Asn 35 40 45Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys
Pro Ser Glu 50 55 60Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly
Gln Val Ser Tyr65 70 75 80Gly Ala Arg Pro Thr Gln Lys Lys Pro Ser
Lys Thr Asn Ala Tyr Asn 85 90 95Val Thr Thr His Ala Asn Gly Gln Val
Ser Tyr Gly Ala Arg Pro Thr 100 105 110Tyr Lys Lys Pro Ser Glu Thr
Asn Ala Tyr Asn Val Thr Thr His Ala 115 120 125Asn Gly Gln Val Ser
Tyr Gly Ala Arg Pro Thr Gln Lys Lys Pro Ser 130 135 140Glu Thr Asn
Ala Tyr Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr145 150 155
160Tyr Gly88135PRTStaphylococcus aureus 88Ala Arg Pro Arg Phe Asn
Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr His Ala Asn
Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr 20 25 30Lys Lys Pro Ser
Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn 35 40 45Gly Gln Val
Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys 50 55 60Thr Asn
Ala Tyr Asn Val Thr Thr His Gly Asn Gly Gln Val Ser Tyr65 70 75
80Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys Thr Asn Ala Tyr Asn
85 90 95Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro
Thr 100
105 110Tyr Lys Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr His
Ala 115 120 125Asp Gly Thr Ala Thr Tyr Gly 130
13589108PRTStaphylococcus aureus 89Ala Arg Pro Arg Phe Asn Lys Pro
Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr His Ala Asn Gly Gln
Val Ser Tyr Gly Ala Arg Pro Thr Gln 20 25 30Asn Lys Pro Ser Lys Thr
Asn Ala Tyr Asn Val Thr Thr His Gly Asn 35 40 45Gly Gln Val Ser Tyr
Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys 50 55 60Thr Asn Ala Tyr
Asn Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr65 70 75 80Gly Ala
Arg Pro Thr Tyr Lys Lys Pro Ser Lys Thr Asn Ala Tyr Asn 85 90 95Val
Thr Thr His Ala Asp Gly Thr Ala Thr Tyr Gly 100
10590162PRTStaphylococcus aureus 90Ala Arg Pro Arg Phe Asn Lys Pro
Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr Asn Gln Asp Gly Thr
Val Thr Tyr Gly Ala Arg Pro Thr Gln 20 25 30Asn Lys Pro Ser Lys Thr
Asn Ala Tyr Asn Val Thr Thr His Ala Asn 35 40 45Gly Gln Val Ser Tyr
Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu 50 55 60Thr Asn Ala Tyr
Asn Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr65 70 75 80Gly Ala
Arg Pro Thr Gln Asn Lys Ala Ser Glu Thr Asn Ala Tyr Asn 85 90 95Val
Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr 100 105
110Gln Asn Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr His Gly
115 120 125Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys
Pro Ser 130 135 140Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asp
Gly Thr Ala Thr145 150 155 160Tyr Gly91162PRTStaphylococcus aureus
91Ala Arg Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val1
5 10 15Thr Thr Asn Gln Asp Gly Thr Val Thr Tyr Gly Ala Arg Pro Thr
Gln 20 25 30Asn Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr His
Ala Asn 35 40 45Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys
Pro Ser Glu 50 55 60Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn Gly
Gln Val Ser Tyr65 70 75 80Gly Ala Arg Pro Thr Gln Asn Lys Ala Ser
Glu Thr Asn Ala Tyr Asn 85 90 95Val Thr Thr His Ala Asn Gly Gln Val
Ser Tyr Gly Ala Arg Pro Thr 100 105 110Gln Asn Lys Pro Ser Lys Thr
Asn Ala Tyr Asn Val Thr Thr His Gly 115 120 125Asn Gly Gln Val Ser
Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser 130 135 140Glu Thr Asn
Ala Tyr Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr145 150 155
160Tyr Gly9281PRTStaphylococcus aureus 92Ala Arg Pro Arg Phe Asn
Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr Asn Gln Asp
Gly Thr Val Thr Tyr Gly Ala Arg Pro Thr Gln 20 25 30Asn Lys Pro Ser
Lys Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn 35 40 45Gly Gln Val
Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu 50 55 60Thr Asn
Ala Tyr Asn Val Thr Thr His Ala Asn Gly Thr Ala Thr Tyr65 70 75
80Gly93108PRTStaphylococcus aureus 93Ala Arg Pro Arg Phe Asn Lys
Pro Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr Asn Gln Asp Gly
Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln 20 25 30Asn Lys Pro Ser Glu
Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn 35 40 45Gly Gln Val Ser
Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu 50 55 60Thr Asn Ala
Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr65 70 75 80Gly
Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys Thr Asn Ala Tyr Asn 85 90
95Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr Gly 100
10594162PRTStaphylococcus aureus 94Ala Arg Pro Arg Phe Asn Lys Pro
Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr Asn Gln Asp Gly Thr
Val Ser Tyr Gly Ala Arg Pro Thr Gln 20 25 30Asn Lys Pro Ser Glu Thr
Asn Ala Tyr Asn Val Thr Thr His Ala Asn 35 40 45Gly Gln Val Ser Tyr
Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu 50 55 60Thr Asn Ala Tyr
Asn Val Thr Thr Asn Gln Asp Gly Thr Val Ser Tyr65 70 75 80Gly Ala
Arg Pro Thr Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn 85 90 95Val
Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr 100 105
110Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala
115 120 125Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln Asn Lys
Pro Ser 130 135 140Lys Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asp
Gly Thr Ala Thr145 150 155 160Tyr Gly95162PRTStaphylococcus aureus
95Ala Arg Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val1
5 10 15Thr Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr
Gln 20 25 30Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His
Ala Asn 35 40 45Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys
Pro Ser Glu 50 55 60Thr Asn Ala Tyr Asn Val Thr Thr Asn Gln Asp Gly
Thr Val Ser Tyr65 70 75 80Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser
Glu Thr Asn Ala Tyr Asn 85 90 95Val Thr Thr His Ala Asn Gly Gln Val
Ser Tyr Gly Ala Arg Pro Thr 100 105 110Gln Asn Lys Pro Ser Glu Thr
Asn Ala Tyr Asn Val Thr Thr His Ala 115 120 125Asn Gly Gln Val Ser
Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser 130 135 140Lys Thr Asn
Ala Tyr Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr145 150 155
160Tyr Gly9681PRTStaphylococcus aureus 96Ala Arg Pro Arg Phe Asn
Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr Asn Gln Asp
Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln 20 25 30Asn Lys Pro Ser
Lys Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn 35 40 45Gly Gln Val
Ser Tyr Gly Ala Arg Pro Thr Tyr Asn Lys Pro Ser Lys 50 55 60Thr Asn
Ala Tyr Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr65 70 75
80Gly97162PRTStaphylococcus aureus 97Ala Arg Pro Arg Phe Asn Lys
Pro Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr Asn Gln Asp Gly
Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln 20 25 30Asn Lys Pro Ser Lys
Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn 35 40 45Gly Gln Val Ser
Tyr Gly Ala Arg Pro Thr Tyr Asn Lys Pro Ser Glu 50 55 60Thr Asn Ala
Tyr Asn Val Thr Thr Asn Arg Asp Gly Thr Val Ser Tyr65 70 75 80Gly
Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn 85 90
95Val Thr Thr His Gly Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr
100 105 110Gln Lys Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr Thr
His Ala 115 120 125Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr
Asn Lys Pro Ser 130 135 140Lys Thr Asn Ala Tyr Asn Val Thr Thr His
Ala Asp Gly Thr Ala Thr145 150 155 160Tyr Gly98162PRTStaphylococcus
aureus 98Ala Arg Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr
Asn Val1 5 10 15Thr Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly Ala Arg
Pro Thr Gln 20 25 30Asn Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val Thr
Thr His Ala Asn 35 40 45Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Tyr
Asn Lys Pro Ser Glu 50 55 60Thr Asn Ala Tyr Asn Val Thr Thr Asn Arg
Asp Gly Thr Val Ser Tyr65 70 75 80Gly Ala Arg Pro Thr Gln Asn Lys
Pro Ser Glu Thr Asn Ala Tyr Asn 85 90 95Val Thr Thr His Gly Asn Gly
Gln Val Ser Tyr Gly Ala Arg Pro Thr 100 105 110Gln Lys Lys Pro Ser
Lys Thr Asn Ala Tyr Asn Val Thr Thr His Ala 115 120 125Asn Gly Gln
Val Ser Tyr Gly Ala Arg Pro Thr Gln Lys Lys Pro Ser 130 135 140Lys
Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asp Gly Thr Ala Thr145 150
155 160Tyr Gly99162PRTStaphylococcus aureus 99Ala Arg Pro Arg Phe
Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr Asn Gln
Asp Gly Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln 20 25 30Asn Lys Pro
Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn 35 40 45Gly Gln
Val Ser Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu 50 55 60Thr
Asn Ala Tyr Asn Val Thr Thr Asn Gln Asp Gly Thr Val Ser Tyr65 70 75
80Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn
85 90 95Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro
Thr 100 105 110Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr
Thr His Ala 115 120 125Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr
Gln Asn Lys Pro Ser 130 135 140Lys Thr Asn Ala Tyr Asn Val Thr Thr
His Ala Asp Gly Thr Ala Thr145 150 155 160Tyr
Gly100162PRTStaphylococcus aureus 100Ala Arg Pro Arg Phe Asn Lys
Pro Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr Asn Gln Asp Gly
Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln 20 25 30Asn Lys Pro Ser Glu
Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn 35 40 45Gly Gln Val Ser
Tyr Gly Ala Arg Pro Thr Tyr Lys Lys Pro Ser Glu 50 55 60Thr Asn Ala
Tyr Asn Val Thr Thr Asn Gln Asp Gly Thr Val Ser Tyr65 70 75 80Gly
Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn 85 90
95Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr
100 105 110Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr
His Ala 115 120 125Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr Gln
Asn Lys Pro Ser 130 135 140Lys Thr Asn Ala Tyr Asn Val Thr Thr His
Ala Asp Gly Thr Ala Thr145 150 155 160Tyr
Gly101108PRTStaphylococcus aureus 101Ala Arg Pro Arg Phe Asn Lys
Pro Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr Asn Gln Asp Gly
Thr Val Ser Tyr Gly Ala Arg Pro Thr Gln 20 25 30Asn Lys Pro Ser Glu
Thr Asn Ala Tyr Asn Val Thr Thr His Ala Asn 35 40 45Gly Gln Val Ser
Tyr Gly Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu 50 55 60Thr Asn Ala
Tyr Asn Val Thr Thr His Ala Asn Gly Gln Val Ser Tyr65 70 75 80Gly
Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys Thr Asn Ala Tyr Asn 85 90
95Val Thr Thr His Ala Asp Gly Thr Ala Thr Tyr Gly 100
10510227PRTStaphylococcus aureus 102Ala Arg Pro Thr Tyr Asn Lys Pro
Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr Asn Arg Asp Gly Thr
Val Ser Tyr Gly 20 2510327PRTStaphylococcus aureus 103Ala Arg Pro
Thr Tyr Lys Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr
Asn Gln Asp Gly Thr Val Ser Tyr Gly 20 2510427PRTStaphylococcus
aureus 104Ala Arg Pro Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr
Asn Val1 5 10 15Thr Thr Asn Gln Asp Gly Thr Val Ser Tyr Gly 20
2510527PRTStaphylococcus aureus 105Ala Arg Pro Arg Phe Asn Lys Pro
Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr Asn Gln Asp Gly Thr
Val Thr Tyr Gly 20 2510627PRTStaphylococcus aureus 106Ala Arg Pro
Thr Tyr Asn Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr
His Ala Asp Gly Thr Ala Thr Tyr Gly 20 2510727PRTStaphylococcus
aureus 107Ala Arg Pro Thr Tyr Lys Lys Pro Ser Lys Thr Asn Ala Tyr
Asn Val1 5 10 15Thr Thr His Ala Asp Gly Thr Ala Thr Tyr Gly 20
2510827PRTStaphylococcus aureus 108Ala Arg Pro Thr Tyr Lys Lys Pro
Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr His Ala Asn Gly Thr
Ala Thr Tyr Gly 20 2510927PRTStaphylococcus aureus 109Ala Arg Pro
Thr Tyr Lys Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr
His Ala Asp Gly Thr Ala Thr Tyr Gly 20 2511027PRTStaphylococcus
aureus 110Ala Arg Pro Thr Gln Asn Lys Pro Ser Lys Thr Asn Ala Tyr
Asn Val1 5 10 15Thr Thr His Ala Asp Gly Thr Ala Thr Tyr Gly 20
2511127PRTStaphylococcus aureus 111Ala Arg Pro Thr Gln Lys Lys Pro
Ser Lys Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr His Ala Asp Gly Thr
Ala Thr Tyr Gly 20 2511227PRTStaphylococcus aureus 112Ala Arg Pro
Thr Gln Lys Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr
His Ala Asp Gly Thr Ala Thr Tyr Gly 20 2511327PRTStaphylococcus
aureus 113Ala Arg Leu Thr Gln Lys Lys Pro Ser Glu Thr Asn Ala Tyr
Asn Val1 5 10 15Thr Thr His Ala Asp Gly Thr Ala Thr Tyr Gly 20
2511427PRTStaphylococcus aureus 114Ala Arg Pro Thr Tyr Lys Lys Pro
Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr His Ala Asn Gly Gln
Val Ser Tyr Gly 20 2511527PRTStaphylococcus aureus 115Ala Arg Pro
Arg Phe Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr
His Ala Asn Gly Gln Val Ser Tyr Gly 20 2511627PRTStaphylococcus
aureus 116Ala Arg Pro Thr Gln Lys Lys Pro Ser Lys Thr Asn Ala Tyr
Asn Val1 5 10 15Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly 20
2511727PRTStaphylococcus aureus 117Ala Arg Pro Thr Gln Asn Lys Pro
Ser Lys Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr His Ala Asn Gly Gln
Val Ser Tyr Gly 20 2511827PRTStaphylococcus aureus 118Ala Arg Pro
Thr Gln Asn Lys Pro Ser Lys Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr
His Gly Asn Gly Gln Val Ser Tyr Gly 20 2511927PRTStaphylococcus
aureus 119Ala Arg Pro Thr Gln Asn Lys Ala Ser Glu Thr Asn Ala Tyr
Asn Val1 5 10 15Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly 20
2512027PRTStaphylococcus aureus 120Ala Arg Pro Thr Gln Asn Lys Pro
Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr His Ala Asn Gly Gln
Val Ser Tyr Gly 20 2512127PRTStaphylococcus aureus 121Ala Arg Pro
Thr Gln Asn Lys Pro Ser
Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr His Gly Asn Gly Gln Val
Ser Tyr Gly 20 2512254PRTArtificial SequenceSynthetic Peptide
122Ala Arg Pro Thr Gln Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val1
5 10 15Thr Thr His Ala Asn Gly Gln Val Ser Tyr Gly Ala Arg Pro Thr
Gln 20 25 30Asn Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val Thr Thr His
Ala Asn 35 40 45Gly Gln Val Ser Tyr Gly 5012380PRTArtificial
SequenceSynthetic PeptideMISC_FEATURE(4)..(4)X is T or
RMISC_FEATURE(5)..(5)X is F or QMISC_FEATURE(6)..(6)X is N or
KMISC_FEATURE(8)..(8)X is P or AMISC_FEATURE(10)..(10)X is E or
KMISC_FEATURE(19)..(19)X is H or NMISC_FEATURE(20)..(20)X is A, G
or QMISC_FEATURE(21)..(21)X is N or DMISC_FEATURE(23)..(23)X is Q
or TMISC_FEATURE(25)..(25)X is S or TMISC_FEATURE(32)..(32)X is Y
or QMISC_FEATURE(33)..(33)X is K or Nmisc_feature(36)..(36)Xaa can
be any naturally occurring amino acidMISC_FEATURE(37)..(37)X is E
or KMISC_FEATURE(46)..(46)X is A or GMISC_FEATURE(56)..(56)X is L
or PMISC_FEATURE(58)..(58)X is Q or YMISC_FEATURE(59)..(59)X is N
or KMISC_FEATURE(63)..(63)X is K or EMISC_FEATURE(74)..(74)X is D
or N 123Ala Arg Pro Xaa Xaa Xaa Lys Xaa Ser Xaa Thr Asn Ala Tyr Asn
Val1 5 10 15Thr Thr Xaa Xaa Xaa Gly Xaa Val Xaa Tyr Gly Ala Arg Pro
Thr Xaa 20 25 30Lys Pro Ser Xaa Thr Asn Ala Tyr Asn Val Thr Thr His
Xaa Asn Gly 35 40 45Gln Val Ser Tyr Gly Ala Arg Xaa Thr Xaa Xaa Lys
Pro Ser Xaa Thr 50 55 60Asn Ala Tyr Asn Val Thr Thr His Ala Xaa Gly
Thr Ala Thr Tyr Gly65 70 75 8012427PRTArtificial SequenceSynthetic
PeptideMISC_FEATURE(25)..(25)X is S or T 124Ala Arg Pro Arg Phe Asn
Lys Pro Ser Glu Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr Asn Gln Asp
Gly Thr Val Xaa Tyr Gly 20 2512527PRTArtificial SequenceSynthetic
PeptideMISC_FEATURE(4)..(4)X is T or RMISC_FEATURE(5)..(5)X is Q or
FMISC_FEATURE(10)..(10)X is K or E 125Ala Arg Pro Xaa Xaa Asn Lys
Pro Ser Xaa Thr Asn Ala Tyr Asn Val1 5 10 15Thr Thr His Ala Asn Gly
Gln Val Ser Tyr Gly 20 2512627PRTArtificial SequenceSynthetic
PeptideMISC_FEATURE(4)..(4)X is R or TMISC_FEATURE(5)..(5)X is F, Y
or QMISC_FEATURE(6)..(6)X is N or KMISC_FEATURE(10)..(10)X is E or
KMISC_FEATURE(19)..(19)X is H or NMISC_FEATURE(20)..(20)X is Q, A,
or RMISC_FEATURE(21)..(21)X is N or DMISC_FEATURE(23)..(23)X is Q
or T 126Ala Arg Pro Xaa Xaa Xaa Lys Pro Ser Xaa Thr Asn Ala Tyr Asn
Val1 5 10 15Thr Thr Xaa Xaa Xaa Gly Xaa Val Ser Tyr Gly 20
2512717PRTArtificial SequenceSynthetic Peptide 127Ala Arg Pro Lys
Pro Ser Thr Asn Ala Tyr Asn Val Thr Thr Gly Tyr1 5 10 15Gly
* * * * *
References