U.S. patent application number 17/534774 was filed with the patent office on 2022-07-21 for therapeutic sirp-alpha antibodies.
The applicant listed for this patent is Arch Oncology, Inc.. Invention is credited to Juan C. ALMAGRO, Gabriela ANDREJEVA, Benjamin J. CAPOCCIA, Ronald R. HIEBSCH, Daniel S. PEREIRA, Robyn PURO.
Application Number | 20220226469 17/534774 |
Document ID | / |
Family ID | 1000006231183 |
Filed Date | 2022-07-21 |
United States Patent
Application |
20220226469 |
Kind Code |
A1 |
PURO; Robyn ; et
al. |
July 21, 2022 |
THERAPEUTIC SIRP-ALPHA ANTIBODIES
Abstract
Anti-SIRP.alpha. monoclonal antibodies (anti-SIRP.alpha. mAbs),
including multispecific SIRP.alpha. antibodies, are provided with
distinct functional profiles as are related compositions and
methods of using anti-SIRP.alpha. mAbs as therapeutics for the
prevention and treatment of solid and hematological cancers. Also
provided are amino acid sequences of exemplary anti-SIRP.alpha.
monoclonal antibodies.
Inventors: |
PURO; Robyn; (St. Louis,
MO) ; HIEBSCH; Ronald R.; (St. Louis, MO) ;
CAPOCCIA; Benjamin J.; (Webster Groves, MO) ;
ANDREJEVA; Gabriela; (St. Louis, MO) ; ALMAGRO; Juan
C.; (Cambridge, MA) ; PEREIRA; Daniel S.; (San
Diego, CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Arch Oncology, Inc. |
Brisbane |
CA |
US |
|
|
Family ID: |
1000006231183 |
Appl. No.: |
17/534774 |
Filed: |
November 24, 2021 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16682893 |
Nov 13, 2019 |
11202828 |
|
|
17534774 |
|
|
|
|
62931746 |
Nov 6, 2019 |
|
|
|
62886872 |
Aug 14, 2019 |
|
|
|
62820718 |
Mar 19, 2019 |
|
|
|
62767509 |
Nov 14, 2018 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
A61P 35/00 20180101;
A61K 45/06 20130101; C07K 2317/565 20130101; C07K 2317/24 20130101;
C07K 2317/76 20130101; A61K 9/0019 20130101; A61K 39/39558
20130101; C07K 16/2803 20130101; C07K 2317/31 20130101; A61K
39/3955 20130101 |
International
Class: |
A61K 39/395 20060101
A61K039/395; A61P 35/00 20060101 A61P035/00; A61K 9/00 20060101
A61K009/00; A61K 45/06 20060101 A61K045/06; C07K 16/28 20060101
C07K016/28 |
Claims
1. A bispecific antibody comprising: a first antigen-binding domain
that specifically binds human SIRP.alpha. and comprises a light
chain variable domain (VL) and a heavy chain variable domain (VH),
and a second antigen-binding domain which specifically binds to a
second antigen; wherein the VL comprises LCDR1, LCDR2, LCDR3
sequences selected from: i. SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3;
ii. SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6; iii. SEQ ID NO:7, SEQ ID
NO:8, SEQ ID NO:9; iv. SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12; v.
SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15; vi. SEQ ID NO:16, SEQ ID
NO:17, SEQ ID NO:18; vii. SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21;
viii. SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24; ix. SEQ ID NO:25,
SEQ ID NO:26, SEQ ID NO:27; x. SEQ ID NO:28, SEQ ID NO:29, SEQ ID
NO:30; xi. SEQ ID NO:10, SEQ ID NO:31, SEQ ID NO:12; xii. SEQ ID
NO:10, SEQ ID NO:31, SEQ ID NO:32; and xiii. SEQ ID NO:25, SEQ ID
NO:26, SEQ ID NO:27; and wherein the VH comprises HCDR1, HCDR2,
HCDR3 sequences selected from: i. SEQ ID NO:33, SEQ ID NO:34, and
SEQ ID NO:35; ii. SEQ ID NO:36, SEQ ID NO:37, and SEQ ID NO:38;
iii. SEQ ID NO:39, SEQ ID NO:40, and SEQ ID NO:41; iv. SEQ ID
NO:42, SEQ ID NO:43, and SEQ ID NO:44; v. SEQ ID NO:45, SEQ ID
NO:46, and SEQ ID NO:47; vi. SEQ ID NO:48, SEQ ID NO:49, and SEQ ID
NO:50; vii. SEQ ID NO:51, SEQ ID NO:52, and SEQ ID NO:53; viii. SEQ
ID NO:54, SEQ ID NO:55, and SEQ ID NO:56; ix. SEQ ID NO:57, SEQ ID
NO:58, and SEQ ID NO:59; x. SEQ ID NO:60, SEQ ID NO:61, and SEQ ID
NO:62; and xi. SEQ ID NO:57, SEQ ID NO:58, and SEQ ID NO:63.
2. The bispecific antibody of claim 1, wherein the VH comprises the
sequence of any one of SEQ ID NOs:81-97 and the VL comprises the
sequence of any one of SEQ ID NOs:64-80.
3. The bispecific antibody of claim 1, wherein the wherein the VL
comprises the LCDR1, LCDR2, LCDR3 sequences of SEQ ID NOs: 25, 26,
and 27, and the VH comprises the HCDR1, HCDR2, and HCDR3 sequences
of SEQ ID NOs: 57, 58, and 59.
4. The bispecific antibody of claim 1, wherein the VL comprises the
sequence of SEQ ID NO: 72 and the VH comprises the sequence of SEQ
ID NO: 89.
5. The bispecific antibody of claim 1, wherein the wherein the VL
comprises the LCDR1, LCDR2, LCDR3 sequences of SEQ ID NOs: 10, 11,
and 12, and the VH comprises the HCDR1, HCDR2, and HCDR3 sequences
of SEQ ID NOs: 42, 43, and 44.
6. The bispecific antibody of claim 1, wherein the VL comprises the
sequence of SEQ ID NO: 67 and the VH comprises the sequence of SEQ
ID NO: 84.
7. The bispecific antibody of claim 1, wherein the second antigen
is selected from CD47, CD19, CD20, CD22, CD24, CD25, CD30, CD33,
CD40, CD44, HER2, CD52, CD56, CD70, CD96, CD97, CD99, CD123, CD279
(PD-1), CD117, C-Met, PTHR2, EGFR, RANKL, SLAMF7, PD-L1, CD38,
CD19/CD3, HAVCR2 (TIM3), and GD2.
8. The bispecific antibody of claim 1, wherein the antibody is
chimeric or humanized.
9. The bispecific antibody of claim 1, wherein the antibody
comprises a constant region of the isotype IgG1, IgG1-N297Q, IgG2,
IgG4, IgG4-S228P, IgG4-PE or variants thereof.
10. The bispecific antibody of claim 9, wherein the constant region
is modified to increase or decrease an antibody effector function
selected from antibody-dependent cellular cytotoxicity (ADCC),
complement-dependent cytotoxicity (CDC), antibody-dependent
cellular phagocytosis (ADCP), C1q binding, and altered binding to
Fc receptors.
11. The bispecific antibody of claim 1, which exhibits anti-tumor
activity.
12. The bispecific antibody of claim 1, which increases
phagocytosis of human tumor cells.
13. A pharmaceutical composition comprising the bispecific antibody
of claim 1, and a pharmaceutically acceptable carrier, diluent, or
excipient.
14. A method of treating cancer in a subject in need thereof, the
method comprising administering to the subject the bispecific
antibody of claim 1, in an amount effective to treat cancer.
15. The method of claim 14, wherein the bispecific antibody is
administered in combination with a chemotherapeutic agent.
16. The method of claim 14, wherein the bispecific antibody is
administered in combination with an antibody that increases the
immune response to cancer.
17. The method of claim 16, wherein the antibody that increases the
immune response to cancer inhibits an immune checkpoint or
modulates one or more co-stimulatory molecules.
18. The method of claim 14, wherein the bispecific antibody is
administered in combination with an opsonizing antibody which
targets an antigen on a tumor cell.
19. The method of claim 18, wherein the opsonizing antibody is
selected from rituximab (anti-CD20), trastuzumab (anti-HER2),
alemtuzumab (anti-CD52), cetuximab (anti-EGFR), panitumumab
(anti-EGFR), ofatumumab (anti-CD20), denosumab (anti-RANKL),
pertuzumab (anti-HER2), elotuzumab (anti-SLAMF7), atezolizumab
(anti-PD-L1), avelumab (anti-PD-L1), durvalumab (anti-PD-L1),
necitumumab (anti-EGFR), daratumumab (anti-CD38), obinutuzumab
(anti-CD20), blinatumomab (anti-CD19/CD3), and dinutuximab
(anti-GD2).
20. The method of claim 14, wherein the cancer is selected from
leukemia, lymphoma, multiple myeloma, ovarian cancer, breast
cancer, endometrial cancer, colon cancer, rectal cancer, bladder
cancer, urothelial cancer, lung cancer, bronchial cancer, bone
cancer, prostate cancer, pancreatic cancer, gastric cancer,
hepatocellular carcinoma, gall bladder cancer, bile duct cancer,
esophageal cancer, renal cell carcinoma, thyroid cancer, head and
neck cancer, testicular cancer, cancer of the endocrine gland,
cancer of the adrenal gland, cancer of the pituitary gland, cancer
of the skin, cancer of soft tissues, cancer of blood vessels,
cancer of brain, cancer of nerves, cancer of eyes, cancer of
meninges, cancer of oropharynx, cancer of hypopharynx, cancer of
cervix, and cancer of uterus, glioblastoma, meduloblastoma,
astrocytoma, glioma, meningioma, gastrinoma, neuroblastoma,
melanoma, myelodysplastic syndrome, and a sarcoma.
21. The method of claim 14, wherein the cancer is non-small cell
lung cancer, adenocarcinoma of the lung, or squamous cell carcinoma
of the lung.
22. The method of claim 14, wherein the cancer is selected from
systemic mastocytosis, acute lymphocytic (lymphoblastic) leukemia
(ALL), T-cell ALL, acute myeloid leukemia (AML), chronic
lymphocytic leukemia (CLL), chronic myeloid leukemia (CML),
myeloproliferative disorder/neoplasm, myelodysplastic syndrome,
monocytic cell leukemia, and plasma cell leukemia.
23. The method of claim 14, wherein the cancer is a lymphoma
selected from histiocytic lymphoma, T-cell lymphoma and B-cell
lymphoma.
24. The method of claim 14, wherein the cancer is
low-grade/follicular non-Hodgkin's lymphoma (NHL), follicular
center cell lymphoma (FCC), mantle cell lymphoma (MCL), diffuse
large cell lymphoma (DLCL), small lymphocytic (SL) NHL,
intermediate grade/follicular NHL, intermediate grade diffuse NHL,
high grade immunoblastic NHL, high grade lymphoblastic NHL, high
grade small non-cleaved cell NHL, bulky disease NHL, and
Waldenstrom's Macroglobulinemia.
25. The method of claim 14, wherein the cancer is a sarcoma
selected from osteosarcoma, Ewing's sarcoma, leiomyosarcoma,
synovial sarcoma, alveolar soft part sarcoma, angiosarcoma,
liposarcoma, fibrosarcoma, rhabdomyosarcoma, and chrondrosarcoma.
Description
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. patent
application Ser. No. 16/682,893, filed Nov. 13, 2019, which claims
priority to U.S. Provisional Application No. 62/931,746, filed Nov.
6, 2019, U.S. Provisional Application No. 62/886,872, filed Aug.
14, 2019, U.S. Provisional Application No. 62/820,718, filed Mar.
19, 2019, and U.S. Provisional Application No. 62/767,509, filed
Nov. 14, 2018, each of which is herein incorporated by reference in
their entireties for all purposes.
SEQUENCE LISTING
[0002] The instant application contains a Sequence Listing which
has been submitted electronically in ASCII format and is hereby
incorporated by reference in its entirety. Said ASCII copy, created
on Nov. 13, 2021, is named ARCO_010_08US_SeqList.txt and is 146
kilobytes in size.
FIELD OF THE DISCLOSURE
[0003] This disclosure pertains to the field of immunotherapy. The
present disclosure provides anti-SIRP.alpha. antibodies
(anti-SIRP.alpha.) which disrupt the interaction between
SIRP.alpha. and CD47, enhance phagocytosis of tumor cells, cause
immunomodulation of immune responses, and methods to generate
anti-SIRP.alpha. antibodies and use anti-SIRP.alpha. antibodies as
therapeutic agents for the prevention and treatment of
hematological and solid and cancers.
BACKGROUND
[0004] Therapeutic antibodies targeting adaptive immunity including
the T-cell checkpoints, PD-1, PD-L1 and CTLA-4 to enhance the
cytotoxic activity of the T-cell immune response have raised the
prospect of long-term remission or even cure for patients with
metastatic diseases (Hodi 2010, McDermott 2015). Despite positive
results, there remains a significant patient population that either
fails to respond to these checkpoint inhibitors (primary
resistance) or those that respond, but eventually develop disease
progression (acquired resistance) (Pitt 2016, Restifo 2016, Sharma
2017). Recent studies suggest that resistance mechanisms can be
both tumor cell intrinsic, including a lack of unique tumor antigen
proteins or inhibition of tumor antigen presentation, and tumor
cell extrinsic, involving the absence of infiltrating T-cells,
redundant inhibitory checkpoints and/or the presence of
immunosuppressive cells in the tumor microenvironment (Sharma
2017). Even in tumors considered sensitive to checkpoint
inhibitors, or when combining anti-CTLA-4 and anti-PD-1/PDL-1
agents, approximately 50% of patients do not experience tumor
shrinkage and the median treatment duration or progression-free
survival for all treated patients remains relatively short around
2-5 months (Kazandjian, 2016). In addition, several of the most
prevalent solid tumors and the majority of hematological
malignancies have shown disappointing results with these checkpoint
inhibitors. In particular, hormone receptor-positive breast cancer,
colorectal cancer (non-microsatellite instability) and prostate
cancer do not appear to be sensitive to this type of immune
manipulation and could benefit from a different immunotherapy
approach (Le 2015, Dirix 2015, Topalian 2012, Graff 2016). These
findings highlight the need for alternative or synergistic
approaches that target additional checkpoints to activate the
innate immune response in addition to the adaptive immune response
to further improve clinical outcomes. Several checkpoints of the
innate immune response are present on tumor cells and on myeloid
cells (macrophages, dendritic cells, monocyte-derived suppressor
cells, granulocytes) which are important cellular components of the
tumor microenvironment that influence tumor progression, metastasis
and overall outcome (Barclay and van den Berg 2014, Yanagita
2017).
[0005] SIgnal Regulatory Protein (SIRP)-.alpha. or SIRP.alpha.,
also known as CD172a, BIT or SHPS-1, is a member of the SIRP paired
receptor family of closely related SIRP proteins. SIRP.alpha. is
expressed mainly by hematopoietic cells, including macrophages,
dendritic cells and granulocytes, and is also expressed on neurons,
especially in the brain, glia, smooth muscle cells and endothelial
and some tumor cells (Barclay and van den Berg 2014). SIPR.alpha.
is a transmembrane protein with an extracellular domain containing
three Ig-like domains and a cytoplasmic region that contains
immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The gene
encoding human SIRP.alpha. is polymorphic with two common variants
identified, SIRP.alpha.V1 and SIRP.alpha.V2, with changes in
surface amino acids, but that do not appear to affect binding to
its ligand, cluster of differentiation 47 (CD47) (Barclay and van
den Berg 2014). The interaction of SIRP.alpha., expressed by
myeloid cells, with CD47, expressed or overexpressed on many tumor
cells as well as on normal cells, is an important immune checkpoint
of the innate response that regulates myeloid functions that
include adhesion, migration, activation and inhibitory activities.
The CD47/SIRP.alpha. interaction regulates macrophage and dendritic
cell phagocytosis of target cells sending an inhibitory "don't eat
me signal" to the phagocyte. The binding of CD47 to SIRP.alpha.
initiates an inhibitory signaling cascade resulting in inhibition
of phagocytosis following phosphorylation of its cytoplasmic ITIMs
(Oldenborg 2000, Oldenborg 2001, Okazawa 2005), recruitment and
binding of SHP-1 and SHP-2, Src homology domain-containing protein
tyrosine phosphatases (Veillette 1998, Oldenborg 2001), inhibition
of non-muscle myosin IIA and ultimately phagocytic function (Tsai
and Discher 2008, Barclay and van den Berg 2014, Murata 2014,
Veillette and Chen 2018, Matazaki 2009). An important corollary of
the action of CD47 as a "don't eat me" signal is its role as a
"marker of self". This provides a significant hindrance to
phagocytosis of self and blocks a subsequent autoimmune response
(Oldenborg, 2002, Oldenborg 2004). Cancer cells use CD47 to mask
themselves in "selfness" consequently evading both the innate and
adaptive immune systems. Blocking the interaction SIRP.alpha. on
innate immune cells such as macrophages and dendritic cells with
CD47 on tumor cells has emerged as a viable target in cancer
therapy. Preclinical data has indicated that, similar to anti-CD47
antibodies, anti-SIRP.alpha. antibodies that block the
SIRP.alpha./CD47 interaction exhibit anti-tumor efficacy in mouse
tumor models, either as monotherapy or in combination with other
agents (Gauttier, 2017; Ring, 2017; Yanigita, 2017; Poirier, 2018;
and Guattier, 2018). Importantly, generation of an adaptive immune
response, in addition to the innate immune response following
interruption of the SIRP.alpha./CD47 interaction, appears to be
critical to obtaining a robust anti-tumor response (Tseng 2013, Li
2015, Xu 2017).
[0006] Expression of SIRP.alpha. on DC cells and its interaction
with CD47 on T-cells appears to be important in inducing the
adaptive immune response. Blockade of the SIRP.alpha./CD47
interaction was reported to affect the DCs ability to stimulate the
antigen-specific CD8+ T-cell response and this was correlated with
an enhanced DC-mediated response to tumor DNA (Liu 2015, Xu
2017).
[0007] Another member of the SIRP family of paired receptors,
SIRP-.gamma., is selectively expressed on the surface of human (but
not rodent) T-cells, has a short cytoplasmic region consisting of 4
amino acids. SIRP-.gamma. also binds to CD47 and appears to be
important for mediating adhesion between T-cell and APC and for
T-cell functions including proliferation and activation (Barclay
and van den Berg 2014; and Piccio, 2005). Thus, blocking the
interaction between SIRP.alpha. and CD47 but not between
SIRP-.gamma. and CD47 may provide an advantage to protecting T-cell
function.
[0008] The present disclosure describes anti-SIRP.alpha. mAbs with
distinct functional profiles. The antibodies of the disclosure are
useful in various therapeutic methods for treating diseases and
conditions associated with SIRP.alpha. in humans, including using
anti-SIRP.alpha. mAbs as therapeutics for the prevention and
treatment of solid and hematological cancers. The antibodies of the
disclosure are also useful as diagnostics to determine the level of
anti-SIRP.alpha. expression in tissue samples. Embodiments of the
disclosure include isolated antibodies and immunologically active
binding fragments thereof; pharmaceutical compositions comprising
one or more of the anti-SIRP.alpha. monoclonal antibodies,
preferably chimeric or humanized forms of said antibodies; and
methods of therapeutic use of such anti-SIRP.alpha. monoclonal
antibodies.
[0009] The embodiments of the disclosure include the mAbs, or
antigen-binding fragments thereof, which are defined by reference
to specific structural characteristics, i.e., specified amino acid
sequences of either the CDRs or entire heavy and light-chain
variable domains or entire heavy- and light-chains. All of these
antibodies disclosed herein bind to either SIRP.alpha.,
SIRP.gamma., or SIRP.alpha. and SIRP.gamma..
[0010] The monoclonal antibodies, or antigen binding fragments
thereof may comprise at least one, usually at least three, CDR
sequences as provided herein, usually in combination with framework
sequences from a human variable region or as an isolated CDR
peptide. In some embodiments, an antibody comprises at least one
light-chain comprising the three light-chain CDR sequences provided
herein situated in a variable region framework, which may be,
without limitation, a murine or human variable region framework,
and at least one heavy-chain comprising the three heavy-chain CDR
sequences provided herein situated in a variable region framework,
which may be, without limitation, a human or murine variable region
framework.
[0011] In some embodiments the combinations of 6 CDRs include, but
are not limited to, the combinations of variable heavy-chain CDR1
(HCDR1), variable heavy-chain CDR2 (HCDR2), variable heavy-chain
CDR3 (HCDR3), variable light-chain CDR1 (LCDR1), variable
light-chain CDR2 (LCDR2), and variable light-chain CDR3 (LCDR3)
selected from:
[0012] HCDR1 comprising SEQ ID NO:33, HCDR2 comprising SEQ ID
NO:34, HCDR3 comprising SEQ ID NO:35, LCDR1 comprising SEQ ID NO:1,
LCDR2 comprising SEQ ID NO:2, LCDR3 comprising SEQ ID NO:3;
[0013] HCDR1 comprising SEQ ID NO:36, HCDR2 comprising SEQ ID
NO:37, HCDR3 comprising SEQ ID NO:38, LCDR1 comprising SEQ ID NO:4,
LCDR2 comprising SEQ ID NO:5, LCDR3 comprising SEQ ID NO:6;
[0014] HCDR1 comprising SEQ ID NO:39, HCDR2 comprising SEQ ID
NO:40, HCDR3 comprising SEQ ID NO:41, LCDR1 comprising SEQ ID NO:7,
LCDR2 comprising SEQ ID NO:8, LCDR3 comprising SEQ ID NO:9;
[0015] HCDR1 comprising SEQ ID NO:42, HCDR2 comprising SEQ ID
NO:43, HCDR3 comprising SEQ ID NO:44, LCDR1 comprising SEQ ID
NO:10, LCDR2 comprising SEQ ID NO:11, LCDR3 comprising SEQ ID
NO:12;
[0016] HCDR1 comprising SEQ ID NO:45, HCDR2 comprising SEQ ID
NO:46, HCDR3 comprising SEQ ID NO:47, LCDR1 comprising SEQ ID
NO:13, LCDR2 comprising SEQ ID NO:14, LCDR3 comprising SEQ ID
NO:15;
[0017] HCDR1 comprising SEQ ID NO:48, HCDR2 comprising SEQ ID
NO:49, HCDR3 comprising SEQ ID NO:50, LCDR1 comprising SEQ ID
NO:16, LCDR2 comprising SEQ ID NO:17, LCDR3 comprising SEQ ID
NO:18;
[0018] HCDR1 comprising SEQ ID NO:51, HCDR2 comprising SEQ ID
NO:52, HCDR3 comprising SEQ ID NO:53, LCDR1 comprising SEQ ID
NO:19, LCDR2 comprising SEQ ID NO:20, LCDR3 comprising SEQ ID
NO:21.
[0019] HCDR1 comprising SEQ ID NO:54, HCDR2 comprising SEQ ID
NO:55, HCDR3 comprising SEQ ID NO:56, LCDR1 comprising SEQ ID
NO:22, LCDR2 comprising SEQ ID NO:23, LCDR3 comprising SEQ ID
NO:24.
[0020] HCDR1 comprising SEQ ID NO:57, HCDR2 comprising SEQ ID
NO:58, HCDR3 comprising SEQ ID NO:59, LCDR1 comprising SEQ ID
NO:25, LCDR2 comprising SEQ ID NO:26, LCDR3 comprising SEQ ID
NO:27.
[0021] HCDR1 comprising SEQ ID NO:60, HCDR2 comprising SEQ ID
NO:61, HCDR3 comprising SEQ ID NO:62, LCDR1 comprising SEQ ID
NO:28, LCDR2 comprising SEQ ID NO:29, LCDR3 comprising SEQ ID
NO:30.
[0022] HCDR1 comprising SEQ ID NO:42, HCDR2 comprising SEQ ID
NO:43, HCDR3 comprising SEQ ID NO:44, LCDR1 comprising SEQ ID
NO:10, LCDR2 comprising SEQ ID NO:31, LCDR3 comprising SEQ ID
NO:12.
[0023] HCDR1 comprising SEQ ID NO:42, HCDR2 comprising SEQ ID
NO:43, HCDR3 comprising SEQ ID NO:44, LCDR1 comprising SEQ ID
NO:10, LCDR2 comprising SEQ ID NO:31, LCDR3 comprising SEQ ID
NO:32.
[0024] HCDR1 comprising SEQ ID NO:57, HCDR2 comprising SEQ ID
NO:58, HCDR3 comprising SEQ ID NO:63, LCDR1 comprising SEQ ID
NO:25, LCDR2 comprising SEQ ID NO:26, LCDR3 comprising SEQ ID
NO:27.
[0025] In some embodiments, the anti-SIRP.alpha. antibodies include
antibodies or antigen binding fragments thereof, comprising a
heavy-chain variable domain (V.sub.H) having an amino acid sequence
selected from the amino acid sequences of: SEQ ID NO:81, SEQ ID
NO:82, SEQ ID NO:83, SEQ ID NO:84, SEQ ID NO:85, SEQ ID NO:86, SEQ
ID NO:87, SEQ ID NO:88, SEQ ID NO:89, SEQ ID NO:90, SEQ ID NO:91,
SEQ ID NO:92, SEQ ID NO:93, SEQ ID NO:94, SEQ ID NO:95, SEQ ID
NO:96, and SEQ ID NO:97, and amino acid sequences exhibiting at
least 85%, 90%, 95%, 97%, 98%, or 99% sequence identity to one of
the recited sequences. Alternatively or in addition,
anti-SIRP.alpha. antibodies, including antibodies or antigen
binding fragments thereof, may comprise a light-chain variable
domain (V.sub.L) having an amino acid sequence selected from the
amino acid sequences of SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:66,
SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:69, SEQ ID NO:70, SEQ ID
NO:71, SEQ ID NO:72, SEQ ID NO:73, SEQ ID NO:74, SEQ ID NO:75, SEQ
ID NO:76, SEQ ID NO:77, SEQ ID NO:78, SEQ ID NO:79, and SEQ ID
NO:80, and amino acid sequences exhibiting at least 85%, 90%, 95%,
97%, 98%, or 99% sequence identity to one of the recited
sequences.
[0026] Although all possible pairing of V.sub.H domains and V.sub.L
domains selected from the V.sub.H domain and V.sub.L domain
sequence groups listed above are permissible, certain combinations
of V.sub.H and V.sub.L domains are disclosed. Accordingly,
anti-SIRP.alpha. antibodies, or antigen binding fragments thereof,
are those comprising a combination of a heavy-chain variable domain
(V.sub.H) and a light-chain variable domain (V.sub.L), wherein the
combination is selected from: [0027] i. a heavy chain variable
domain comprising the amino acid sequence of SEQ ID NO:81 and a
light chain variable domain comprising the amino acid sequence SEQ
ID NO:64; [0028] ii. a heavy chain variable domain comprising the
amino acid sequence of SEQ ID NO:82 and a light chain variable
domain comprising the amino acid sequence SEQ ID NO:65; [0029] iii.
a heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:83 and a light chain variable domain comprising the amino
acid sequence SEQ ID NO:66; [0030] iv. a heavy chain variable
domain comprising the amino acid sequence of SEQ ID NO:84 and a
light chain variable domain comprising the amino acid sequence SEQ
ID NO:67; [0031] v. a heavy chain variable domain comprising the
amino acid sequence of SEQ ID NO:85 and a light chain variable
domain comprising the amino acid sequence SEQ ID NO:68; [0032] vi.
a heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:86 and a light chain variable domain comprising the amino
acid sequence SEQ ID NO:69; [0033] vii. a heavy chain variable
domain comprising the amino acid sequence of SEQ ID NO:87 and a
light chain variable domain comprising the amino acid sequence SEQ
ID NO:70; [0034] viii. a heavy chain variable domain comprising the
amino acid sequence of SEQ ID NO:88 and a light chain variable
domain comprising the amino acid sequence SEQ ID NO:71; [0035] ix.
a heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:89 and a light chain variable domain comprising the amino
acid sequence SEQ ID NO:72; [0036] x. a heavy chain variable domain
comprising the amino acid sequence of SEQ ID NO:90 and a light
chain variable domain comprising the amino acid sequence SEQ ID
NO:73; [0037] xi. a heavy chain variable domain comprising the
amino acid sequence of SEQ ID NO:91 and a light chain variable
domain comprising the amino acid sequence SEQ ID NO:74; [0038] xii.
a heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:91 and a light chain variable domain comprising the amino
acid sequence SEQ ID NO:75; [0039] xiii. a heavy chain variable
domain comprising the amino acid sequence of SEQ ID NO:91 and a
light chain variable domain comprising the amino acid sequence SEQ
ID NO:76; [0040] xiv. a heavy chain variable domain comprising the
amino acid sequence of SEQ ID NO:92 and a light chain variable
domain comprising the amino acid sequence SEQ ID NO:74; [0041] xv.
a heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:92 and a light chain variable domain comprising the amino
acid sequence SEQ ID NO:75; [0042] xvi. a heavy chain variable
domain comprising the amino acid sequence of SEQ ID NO:92 and a
light chain variable domain comprising the amino acid sequence SEQ
ID NO:76; [0043] xvii. a heavy chain variable domain comprising the
amino acid sequence of SEQ ID NO:93 and a light chain variable
domain comprising the amino acid sequence SEQ ID NO:74; [0044]
xviii. a heavy chain variable domain comprising the amino acid
sequence of SEQ ID NO:93 and a light chain variable domain
comprising the amino acid sequence SEQ ID NO:75; [0045] xix. a
heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:93 and a light chain variable domain comprising the amino
acid sequence SEQ ID NO:76; [0046] xx. a heavy chain variable
domain comprising the amino acid sequence of SEQ ID NO:94 and a
light chain variable domain comprising the amino acid sequence SEQ
ID NO:74; [0047] xxi. a heavy chain variable domain comprising the
amino acid sequence of SEQ ID NO:94 and a light chain variable
domain comprising the amino acid sequence SEQ ID NO:75; [0048]
xxii. a heavy chain variable domain comprising the amino acid
sequence of SEQ ID NO:94 and a light chain variable domain
comprising the amino acid sequence SEQ ID NO:76; [0049] xxiii. a
heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:84 and a light chain variable domain comprising the amino
acid sequence SEQ ID NO:77; [0050] xxiv. a heavy chain variable
domain comprising the amino acid sequence of SEQ ID NO:95 and a
light chain variable domain comprising the amino acid sequence SEQ
ID NO:78; [0051] xxv. a heavy chain variable domain comprising the
amino acid sequence of SEQ ID NO:95 and a light chain variable
domain comprising the amino acid sequence SEQ ID NO:79; [0052]
xxvi. a heavy chain variable domain comprising the amino acid
sequence of SEQ ID NO:95 and a light chain variable domain
comprising the amino acid sequence SEQ ID NO:80; [0053] xxvii. a
heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:96 and a light chain variable domain comprising the amino
acid sequence SEQ ID NO:78; [0054] xxviii. a heavy chain variable
domain comprising the amino acid sequence of SEQ ID NO:96 and a
light chain variable domain comprising the amino acid sequence SEQ
ID NO:79; [0055] xxix. a heavy chain variable domain comprising the
amino acid sequence of SEQ ID NO:96 and a light chain variable
domain comprising the amino acid sequence SEQ ID NO:80; [0056] xxx.
a heavy chain variable domain comprising the amino acid sequence of
SEQ ID NO:97 and a light chain variable domain comprising the amino
acid sequence SEQ ID NO:78; [0057] xxxi. a heavy chain variable
domain comprising the amino acid sequence of SEQ ID NO:97 and a
light chain variable domain comprising the amino acid sequence SEQ
ID NO:79; [0058] xxxii. a heavy chain variable domain comprising
the amino acid sequence of SEQ ID NO:97 and a light chain variable
domain comprising the amino acid sequence SEQ ID NO:80; and [0059]
xxxiii. a heavy chain variable domain comprising the amino acid
sequence of SEQ ID NO:89 and a light chain variable domain
comprising the amino acid sequence SEQ ID NO:72.
[0060] In some embodiments, the anti-SIRP.alpha. antibodies or
antigen binding fragments thereof may also comprise a combination
of a heavy-chain variable domain and a light-chain variable domain
wherein the heavy-chain variable domain comprises a V.sub.H
sequence with at least 85% sequence identity, or at least 90%
sequence identity, or at least 95% sequence identity, or at least
97%, 98% or 99% sequence identity, to the heavy chain amino acid
sequences shown above in (i) to (xxxiii) and/or the light chain
variable domain comprises a V.sub.L sequence with at least 85%
sequence identity, or at least 90% sequence identity, or at least
95% sequence identity, or at least 97%, 98% or 99% sequence
identity, to the light-chain amino acid sequences shown above in
(i) to (xxxiii). The specific V.sub.H and V.sub.L pairings or
combinations in parts (i) through (xxxiii) may be preserved for
anti-SIRP.alpha. antibodies having V.sub.H and V.sub.L domain
sequences with a particular percentage sequence identity to these
reference sequences.
[0061] For all embodiments the heavy-chain and/or light-chain
variable domains of the antibodies or antigen binding fragments are
defined by a particular percentage sequence identity to a reference
sequence, the V.sub.H and/or V.sub.L domains may retain identical
CDR sequences to those present in the reference sequence such that
the variation is present only within the framework regions.
[0062] In another embodiment, the anti-SIRP.alpha. antibodies, or
antigen binding fragments thereof, are those comprising a
combination of a heavy chain (HC) and a light chain (LC), wherein
the combination is selected from: [0063] i. a heavy chain
comprising the amino acid sequence of SEQ ID NO:109 and a light
chain comprising the amino acid sequence SEQ ID NO:98; [0064] ii. a
heavy chain comprising the amino acid sequence of SEQ ID NO:110 and
a light chain comprising the amino acid sequence SEQ ID NO:99;
[0065] iii. a heavy chain comprising the amino acid sequence of SEQ
ID NO:111 and a light chain comprising the amino acid sequence SEQ
ID NO:100. [0066] iv. a heavy chain comprising the amino acid
sequence of SEQ ID NO:112 and a light chain comprising the amino
acid sequence SEQ ID NO:101; [0067] v. a heavy chain comprising the
amino acid sequence of SEQ ID NO:112 and a light chain comprising
the amino acid sequence SEQ ID NO:102; [0068] vi. a heavy chain
comprising the amino acid sequence of SEQ ID NO:112 and a light
chain comprising the amino acid sequence SEQ ID NO:103; [0069] vii.
a heavy chain comprising the amino acid sequence of SEQ ID NO:113
and a light chain comprising the amino acid sequence SEQ ID NO:101;
[0070] viii. a heavy chain comprising the amino acid sequence of
SEQ ID NO:113 and a light chain comprising the amino acid sequence
SEQ ID NO:102; [0071] ix. a heavy chain comprising the amino acid
sequence of SEQ ID NO:113 and a light chain comprising the amino
acid sequence SEQ ID NO:103; [0072] x. a heavy chain comprising the
amino acid sequence of SEQ ID NO:114 and a light chain comprising
the amino acid sequence SEQ ID NO:101; [0073] xi. a heavy chain
comprising the amino acid sequence of SEQ ID NO:114 and a light
chain comprising the amino acid sequence SEQ ID NO:102; [0074] xii.
a heavy chain comprising the amino acid sequence of SEQ ID NO:114
and a light chain comprising the amino acid sequence SEQ ID NO:103;
[0075] xiii. a heavy chain comprising the amino acid sequence of
SEQ ID NO:115 and a light chain comprising the amino acid sequence
SEQ ID NO:101; [0076] xiv. a heavy chain comprising the amino acid
sequence of SEQ ID NO:115 and a light chain comprising the amino
acid sequence SEQ ID NO:102; [0077] xv. a heavy chain comprising
the amino acid sequence of SEQ ID NO:115 and a light chain
comprising the amino acid sequence SEQ ID NO:103; [0078] xvi. a
heavy chain comprising the amino acid sequence of SEQ ID NO:116 and
a light chain comprising the amino acid sequence SEQ ID NO:104;
[0079] xvii. a heavy chain comprising the amino acid sequence of
SEQ ID NO:117 and a light chain comprising the amino acid sequence
SEQ ID NO:105; [0080] xviii. a heavy chain comprising the amino
acid sequence of SEQ ID NO:117 and a light chain comprising the
amino acid sequence SEQ ID NO:106; [0081] xix. a heavy chain
comprising the amino acid sequence of SEQ ID NO:117 and a light
chain comprising the amino acid sequence SEQ ID NO:107; [0082] xx.
a heavy chain comprising the amino acid sequence of SEQ ID NO:118
and a light chain comprising the amino acid sequence SEQ ID NO:105;
[0083] xxi. a heavy chain comprising the amino acid sequence of SEQ
ID NO:118 and a light chain comprising the amino acid sequence SEQ
ID NO:106; [0084] xxii. a heavy chain comprising the amino acid
sequence of SEQ ID NO:118 and a light chain comprising the amino
acid sequence SEQ ID NO:107; [0085] xxiii. a heavy chain comprising
the amino acid sequence of SEQ ID NO:119 and a light chain
comprising the amino acid sequence SEQ ID NO:105; [0086] xxiv. a
heavy chain comprising the amino acid sequence of SEQ ID NO:119 and
a light chain comprising the amino acid sequence SEQ ID NO:106;
[0087] xxv. a heavy chain comprising the amino acid sequence of SEQ
ID NO:119 and a light chain comprising the amino acid sequence SEQ
ID NO:107; and [0088] xxvi. a heavy chain comprising the amino acid
sequence of SEQ ID NO:120 and a light chain comprising the amino
acid sequence SEQ ID NO:108.
[0089] Various forms of the anti-SIRP.alpha. mAbs are disclosed.
For example, the anti-SIRP.alpha. mAbs can be full length humanized
antibodies with human frameworks and constant regions of the
isotypes, IgA, IgD, IgE, IgG, and IgM, more particularly, IgG1,
IgG2, IgG3, IgG4, and in some cases with various mutations to alter
Fc receptor function or prevent Fab arm exchange or an antibody
fragment, e.g., a F(ab')2 fragment, a F(ab) fragment, a single
chain Fv fragment (scFv), etc., as disclosed herein.
[0090] In some embodiments, the anti-SIRP.alpha. mAbs or
antigen-binding fragment thereof comprises an IgG isotype selected
from IgG1, IgG1-N297Q, IgG2, IgG4, IgG4 S228P, IgG4 PE and variants
thereof.
[0091] In some embodiments, the anti-SIRP.alpha. mAbs or
antigen-binding fragment thereof binds human SIRP.gamma. in
addition to human SIRP.alpha..
[0092] In some embodiments, the anti-SIRP.alpha. mAbs or
antigen-binding fragment thereof selectively binds human
SIRP.alpha..
[0093] In some embodiments, the anti-SIRP.alpha. mAbs or
antigen-binding fragment thereof increases phagocytosis of human
tumor cells.
[0094] In some embodiments, the anti-SIRP.alpha. mAbs as disclosed
herein are multispecific antibodies that specifically bind to
SIRP.alpha. and at least a second antigen, where the second antigen
is a marker of a CD47-expressing cell.
[0095] In some embodiments, the second antigen of the multispecific
antibody is selected from CD19, CD20, CD22, CD24, CD25, CD30, CD33,
CD40, CD44, HER2, CD52, CD56, CD70, CD96, CD97, CD99, CD123, CD279
(PD-1), CD117, C-Met, PTHR2, EGFR, RANKL, SLAMF7, PD-L1, CD38,
CD19/CD3, HAVCR2 (TIM3), and GD2.
[0096] In some embodiments, the anti-SIRP.alpha. mAbs or
antigen-binding fragment thereof increases phagocytosis of human
tumor cells and are administered in combination with an opsonizing
monoclonal antibody that targets an antigen on a tumor cell.
[0097] In some embodiments, the anti-SIRP.alpha. mAbs or
antigen-binding fragment thereof increases phagocytosis of human
tumor cells and are administered in combination with an opsonizing
monoclonal antibody that targets an antigen on a tumor cell,
wherein the opsonizing monoclonal antibody is chosen from rituximab
(anti-CD20), trastuzumab (anti-HER2), alemtuzumab (anti-CD52),
cetuximab (anti-EGFR), panitumumab (anti-EGFR), ofatumumab
(anti-CD20), denosumab (anti-RANKL), pertuzumab (anti-HER2),
panitumumab (EGFR), pertuzumab (HER2), elotuzumab (SLAMF7),
atezolizumab (anti-PD-L1), avelumab (anti-PD-L1), durvalumab
(anti-PD-L1), necitumumab (anti-EGFR), daratumumab (anti-CD38),
obinutuzumab (anti-CD20), blinatumomab (anti-CD19/CD3), dinutuximab
(anti-GD2)
[0098] In some embodiments, the opsonizing monoclonal antibody
targets CD20, EGFR, and PD-L1.
[0099] In some embodiments, the anti-SIRP.alpha. mAbs or
antigen-binding fragment thereof exhibits anti-tumor activity.
[0100] In some embodiments, the anti-SIRP.alpha. mAbs or
antigen-binding fragment thereof is administered in combination
with an anti-CD47 antibody, wherein the anti-CD47 antibody is
described in U.S. Pat. No. 10,239,945, and hereby incorporated by
reference in its entirety.
[0101] In some embodiments, the anti-SIRP.alpha. mAbs or
antigen-binding fragment thereof is administered in combination
with an anti-EGFR antibody.
[0102] In some embodiments, the anti-SIRP.alpha. mAbs or
antigen-binding fragment thereof is administered in combination
with an anti-PD-1 antibody.
[0103] In some embodiments, the anti-SIRP.alpha. mAbs or
antigen-binding fragment thereof is administered in combination
with an anti-CTLA-4 antibody.
[0104] In some embodiments, the disclosure provides a
pharmaceutical composition comprising one or more of the
anti-SIRP.alpha. mAbs or antigen-binding fragments disclosed
herein, optionally in chimeric or humanized forms, and a
pharmaceutically or physiologically acceptable carrier, diluent, or
excipient.
[0105] In some embodiments, the anti-SIRP.alpha. mAbs or
antigen-binding fragment thereof are for use in human therapy.
[0106] In some embodiments, the anti-SIRP.alpha. mAbs or
antigen-binding fragment thereof are for use in preventing or
treating cancer in a human patient.
[0107] Prior to the present disclosure, there was a need to
identify anti-SIRP.alpha. mAbs that possess the functional profiles
as described herein. The anti-SIRP.alpha. mAbs of the present
disclosure exhibit a combination of properties that render the mAbs
particularly advantageous for use in human therapy, particularly in
the prevention and/or treatment of solid and hematological
cancers.
[0108] In some embodiments, the cancer is selected from leukemia, a
lymphoma, multiple myeloma, ovarian cancer, breast cancer,
endometrial cancer, colon cancer (colorectal cancer), rectal
cancer, bladder cancer, urothelial cancer, lung cancer (non-small
cell lung cancer, adenocarcinoma of the lung, squamous cell
carcinoma of the lung), bronchial cancer, bone cancer, prostate
cancer, pancreatic cancer, gastric cancer, hepatocellular
carcinoma, gall bladder cancer, bile duct cancer, esophageal
cancer, renal cell carcinoma, thyroid cancer, squamous cell
carcinoma of the head and neck (head and neck cancer), testicular
cancer, cancer of the endocrine gland, cancer of the adrenal gland,
cancer of the pituitary gland, cancer of the skin, cancer of soft
tissues, cancer of blood vessels, cancer of brain, cancer of
nerves, cancer of eyes, cancer of meninges, cancer of oropharynx,
cancer of hypopharynx, cancer of cervix, and cancer of uterus,
glioblastoma, meduloblastoma, astrocytoma, glioma, meningioma,
gastrinoma, neuroblastoma, melanoma, myelodysplastic syndrome, and
a sarcoma.
[0109] In some embodiments, the leukemia is selected from leukemia
is selected from the group consisting of systemic mastocytosis,
acute lymphocytic (lymphoblastic) leukemia (ALL), T-cell--ALL,
acute myeloid leukemia (AML), myelogenous leukemia, chronic
lymphocytic leukemia (CLL), chronic myeloid leukemia (CML),
myeloproliferative disorder/neoplasm, myelodysplastic syndrome,
monocytic cell leukemia, and plasma cell leukemia; wherein said
lymphoma is selected from the group consisting of histiocytic
lymphoma and T-cell lymphoma, B cell lymphomas, including Hodgkin's
lymphoma and non-Hodgkin's lymphoma, such as low grade/follicular
non-Hodgkin's lymphoma (NHL), cell lymphoma (FCC), mantle cell
lymphoma (MCL), diffuse large cell lymphoma (DLCL), small
lymphocytic (SL) NHL, intermediate grade/follicular NHL,
intermediate grade diffuse NHL, high grade immunoblastic NHL, high
grade lymphoblastic NHL, high grade small non-cleaved cell NHL,
bulky disease NHL, and Waldenstrom's Macroglobulinemia; and wherein
said sarcoma is selected from the group consisting of osteosarcoma,
Ewing's sarcoma, leiomyosarcoma, synovial sarcoma, alveolar soft
part sarcoma, angiosarcoma, liposarcoma, fibrosarcoma,
rhabdomyosarcoma, and chrondrosarcoma.
[0110] In some embodiments, a method is disclosed to assay
SIRP.alpha. expression in tumor and/or immune cells using an
anti-SIRP.alpha. monoclonal antibody or antigen-binding fragment
thereof, which specifically binds to an epitope within the sequence
of SEQ ID NO:121.
[0111] In some embodiments, the method comprises obtaining a
patient sample, contacting the patient sample with an
anti-SIRP.alpha. monoclonal antibody or antigen-binding fragment
thereof, which specifically binds to an epitope within the sequence
of SEQ ID NO:121, and assaying for binding of the antibody to the
patient sample, wherein binding of the antibody to the patient
sample is diagnostic of SIRP.alpha. expression in a patient
sample.
[0112] In some embodiments, a method is disclosed to assay
SIRP.gamma. expression in tumor and or immune cells using an
anti-SIRP.alpha. monoclonal antibody or antigen-binding fragment
thereof, which specifically binds to an epitope within the sequence
of SEQ ID NO:122.
[0113] In some embodiments, the method comprises obtaining a
patient sample, contacting the patient sample with an
anti-SIRP.gamma. monoclonal antibody or antigen-binding fragment
thereof, which specifically binds to an epitope within the sequence
of SEQ ID NO:122, and assaying for binding of the antibody to the
patient sample, wherein binding of the antibody to the patient
sample is diagnostic of SIRP.gamma. expression in a patient
sample.
[0114] In some embodiments, the tumor is primary a cancer tumor or
a metastatic cancer tumor.
[0115] In some embodiments, assaying for binding of the
anti-SIRP.alpha. monoclonal antibody or antigen-binding fragment
thereof to the patient sample utilizes immunohistochemistry
labeling of a tissue sample, enzyme linked immunosorbent assay
(ELISA), or flow cytometry.
[0116] In some embodiments, the method comprises tumor cells, and
the assay comprises assaying for the binding of the
anti-SIRP.alpha. monoclonal antibody or antigen-binding fragment
thereof to tumor cells in the patient sample.
[0117] Further scope of the applicability of the present disclosure
will become apparent from the detailed description provided below.
However, it should be understood that the detailed description and
specific examples, while indicating embodiments of the disclosure,
are given by way of illustration only since various changes and
modifications within the spirit and scope of the disclosure will
become apparent to those skilled in the art from this detailed
description.
BRIEF DESCRIPTION OF THE DRAWINGS
[0118] The above and other aspects, features, and advantages of the
present disclosure will be better understood from the following
detailed descriptions taken in conjunction with the accompanying
drawing(s), all of which are given by way of illustration only and
are not limited in the present disclosure.
[0119] FIG. 1A-FIG. 1V. Binding of anti-SIRP antibodies to human
SIRP.alpha.. Binding of anti-SIRP antibodies to recombinant human
SIRP.alpha. was determined by solid-phase ELISA. High-binding ELISA
plates were coated with recombinant human SIRP.alpha. and
increasing concentrations of anti-SIRP antibodies were added for 1
hour. Wells were washed and then incubated with HRP-labeled
secondary antibody for 1 hour followed by addition of peroxidase
substrate and the absorbance at 450 nm was measured.
[0120] FIG. 2. Binding of Hybridoma Derived mAbs (SIRP1, SIRP2, and
SIRP3) to THP1 cells Expressing SIRP.alpha.. Binding of SIRP1,
SIRP2, and SIRP3 to THP-1 monocytic cell line was determined. Cells
were incubated with increasing concentrations of antibody for 1 hr.
Cells were washed and then incubated with Alexaflour 647-labelled
secondary antibody for 1 hr. Cells were washed and antibody binding
measured using flow cytometry.
[0121] FIG. 3A-FIG. 3V. Binding of anti-SIRP antibodies to human
SIRP gamma. Binding of anti-SIRP antibodies to recombinant human
SIRP gamma (SIRP.gamma.) was determined by solid-phase ELISA.
High-binding ELISA plates were coated with recombinant human SIRP
gamma and increasing concentrations of anti-SIRP antibodies were
added for 1 hour. Wells were washed and then incubated with
HRP-labeled secondary antibody for 1 hour followed by addition of
peroxidase substrate and the absorbance at 450 nm was measured.
[0122] FIG. 4A-FIG. 4B. Binding of SIRP mAbs to Jurkat T cells
Expressing SIRP.gamma.. Binding of SIRP1, SIRP2, SIRP3, SIRP4 and
SIRP9 to Jurkat T-ALL cells was determined. Cells were incubated
with increasing concentrations of antibody FIG. 4A; or 10 .mu.g/ml
of the anti-SIRP antibodies for 1 hr; FIG. 4B. Cells were washed
and then incubated with Alexaflour 647-labelled secondary antibody
for 1 hr. Cells were washed and antibody binding measured using
flow cytometry.
[0123] FIG. 5A-FIG. 5G. Blocking of human CD47/SIRP.alpha. binding
by anti-SIRP antibodies. The ability of anti-SIRP antibodies to
block the interaction between CD47 and recombinant human SIR.alpha.
was determined by solid-phase ELISA. High-binding ELISA plates were
coated with recombinant human SIRP.alpha. and increasing
concentrations of anti-SIRP antibodies were added for 1 hour. Wells
were washed and then incubated with an Fc tagged human CD47 for 1
hours. Wells were washed and then incubated with an HRP-labeled
secondary antibody for 1 hour followed by addition of peroxidase
substrate and the absorbance at 450 nm was measured.
[0124] FIG. 6A-FIG. 6H. Blocking of human CD47/SIRP.gamma. binding
by anti-SIRP antibodies. The ability of anti-SIRP antibodies to
block the interaction between CD47 and recombinant human
SIRP.gamma. was determined by solid-phase ELISA. High-binding ELISA
plates were coated with recombinant human SIRPyand increasing
concentrations of anti-SIRP antibodies were added for 1 hour. Wells
were washed and then incubated with an Fc tagged human CD47 for 1
hours. Wells were washed and then incubated with an HRP-labeled
secondary antibody for 1 hour followed by addition of peroxidase
substrate and the absorbance at 450 nm was measured.
[0125] FIG. 7A-FIG. 7B. Anti-SIRP antibodies enhance phagocytosis.
Human macrophages were plated at a concentration of
3.times.10.sup.4 cells per well in a 96 well plate and allowed to
adhere for 24 hours. 8.times.10.sup.4 CFSE (1 .mu.M) labeled human
Jurkat T cells and increasing concentrations of anti-SIRP
antibodies; FIG. 7A or 10 .mu.g/ml of the anti-SIRP antibodies,
FIG. 7B, were added to the macrophage cultures and incubated at
37.degree. C. for 3 hours. Non-phagocytosed Jurkat cells were
removed and macrophage cultures were washed. Macrophages were
trypsinized and stained for CD14. Flow cytometry was used to
determine the percentage of CD14.sup.+/CFSE.sup.+ cells in the
total CD14.sup.+ population.
[0126] FIG. 8A-FIG. 8J. Anti-SIRP antibodies enhance phagocytosis
in combination with anti-CD47 antibodies. Human macrophages were
plated at a concentration of 3.times.10.sup.4 cells per well in a
96 well plate and allowed to adhere for 24 hours. 8.times.10.sup.4
CFSE (1 .mu.M) labeled human Jurkat T cells and increasing
concentrations of anti-SIRP antibodies alone, anti-CD47 antibody
alone, or a combination of anti-SIRP antibodies and anti-CD47
antibody were added to the macrophage cultures and incubated at
37.degree. C. for 3 hours. Non-phagocytosed Jurkat cells were
removed and macrophage cultures were washed. Macrophages were
trypsinized and stained for CD14. Flow cytometry was used to
determine the percentage of CD14.sup.+/CFSE.sup.+ cells in the
total CD14.sup.+ population.
[0127] FIG. 9A-FIG. 9D. Anti-SIRP antibodies enhance phagocytosis
in combination with anti-CD20 antibodies. Human macrophages were
plated at a concentration of 3.times.10.sup.4 cells per well in a
96 well plate and allowed to adhere for 24 hours. 8.times.10.sup.4
CFSE (1 .mu.M) labeled human RAJI lymphoma cells and increasing
concentrations of anti-SIRP antibodies alone, the anti-CD20
antibody Rituxan alone, or a combination of anti-SIRP antibodies
and Rituxan were added to the macrophage cultures and incubated at
37.degree. C. for 3 hours. Non-phagocytosed RAJI cells were removed
and macrophage cultures were washed. Macrophages were trypsinized
and stained for CD14. Flow cytometry was used to determine the
percentage of CD14.sup.+/CFSE.sup.+ cells in the total CD14.sup.+
population.
[0128] FIG. 10A-FIG. 10B. Anti-SIRP antibodies enhance phagocytosis
in combination with anti-EGFR and anti-PD-L1 antibodies. Human
macrophages were plated at a concentration of 3.times.10.sup.4
cells per well in a 96 well plate and allowed to adhere for 24
hours. 8.times.10.sup.4 CFSE (1 .mu.M) labeled human FaDu HNSCC and
increasing concentrations of anti-SIRP antibodies alone, the
anti-EGFR antibody Erbitux alone, or anti-SIRP antibodies in
combination with Erbitux or in combination with Avelumab were added
to the macrophage cultures and incubated at 37.degree. C. for 3
hours. Non-phagocytosed FaDu cells were removed and macrophage
cultures were washed. Macrophages were trypsinized and stained for
CD14. Flow cytometry was used to determine the percentage of
CD14.sup.+/CFSE.sup.+ cells in the total CD14.sup.+ population.
[0129] FIG. 11. Anti-SIRP antibodies bind to SIRP.alpha. on
macrophages and dendritic cells. Binding of anti-SIRP antibodies to
human macrophages or dendritic cells was determined. Human
monocyte-derived macrophages were incubated with increasing
concentrations of anti-SIRP antibodies for 1 hr. The cells were
washed and then incubated with AF647-labelled secondary antibody
for 45 min, washed and antibody binding measured using flow
cytometry.
[0130] FIG. 12A-FIG. 12C. Anti-SIRP antibodies bind to SIRP.gamma.
on naive and activated T cells. Binding of anti-SIRP antibodies to
naive T cells (FIG. 12A and FIG. 12B) or activated T cells (FIG.
12C) following 3-day activation on anti-CD3 coated plates was
determined by flow cytometry. T cells were incubated with
increasing concentrations of anti-SIRP antibodies for 1 h, cells
were washed and FITC-labelled anti-mouse secondary antibody was
added for 1 hr. Cells were washed and antibody binding measured
using flow cytometry.
[0131] FIG. 13. Blocking of human CD47/SIRP.alpha. binding by
anti-SIRP antibodies on macrophages. The ability of anti-SIRP
antibodies to block the interaction between recombinant human CD47
and macrophage expressed SIRP.alpha. was determined by flow
cytometry. The Fc receptors on macrophages were blocked prior to
incubation with 10 .mu.g/ml of the anti-SIRP antibodies. Binding of
soluble Fc tagged human CD47 (20 .mu.g/ml) was measured using
AF647-tagged anti-human secondary antibody.
[0132] FIG. 14A-FIG. 14B. Anti-SIRP antibodies do not inhibit T
cell proliferation upon allogeneic dendritic cell stimulation.
Effect of anti-SIRP antibodies on proliferation of T cells was
determined by activating CellTrace Violet labelled human CD3 T
cells with allogeneic human monocyte-derived dendritic cells at a
1:5 T cell:DC ratio in the presence of 10 .mu.g/ml anti-SIRP
antibodies. Flow cytometry was used to determine the percentage of
proliferated CD3 T cells following 6-7-day co-culture. The dotted
line represents proliferation of hIgG4P control.
[0133] FIG. 15. Anti-SIRP antibodies do not inhibit antigen recall
response. Effect of anti-SIRP antibodies on T cell antigen recall
responses was assessed using PBMC from human cytomegalovirus
seropositive donor. CellTrace Violet dye-labelled PBMC were
incubated with 10 .mu.g/ml of anti-SIRP antibodies in the presence
of increasing concentrations of CMV antigen for 5 days. T cell
proliferation was determined by the dilution of the CellTrace
Violet dye within the CD4+ T cell population using flow
cytometry.
DETAILED DESCRIPTION OF THE DISCLOSURE
Definitions
[0134] Unless otherwise defined, scientific and technical terms
used in connection with the present disclosure shall have the
meanings that are commonly understood by those of ordinary skill in
the art. Further, unless otherwise required by context, singular
terms shall include pluralities and plural terms shall include the
singular. Generally, nomenclatures utilized in connection with, and
techniques of, cell and tissue culture, molecular biology, and
protein and oligo or polynucleotide chemistry and hybridization
described herein are those well-known and commonly used in the
art.
[0135] As used herein, the term "SIRP.alpha." and "Src homology 2
(SH2) domain-containing protein tyrosine phosphatase substrate 1
(SHPS-1)" are synonymous and may be used interchangeably.
[0136] The term "anti-SIRP.alpha. antibody" refer to an antibody of
the disclosure which is intended for use as a therapeutic or
diagnostic agent, and specifically binds to SIRP.alpha., in
particular to a human SIRP.alpha..
[0137] The term "anti-SIRP" refer to an antibody of the disclosure
which is intended for use as a therapeutic or diagnostic agent, and
specifically binds to SIRP.alpha., in particular to a human
SIRP.alpha., to one or both of two common variants identified,
SIRP.alpha.V1 and SIRP.alpha.V2, and/or SIRP.gamma. and antibody
variants thereof.
[0138] As used herein, the term "antibody" refers to immunoglobulin
molecules and immunologically active portions of immunoglobulin
(Ig) molecules, i.e., molecules that contain an antigen binding
site that specifically binds (immunoreacts with) an antigen. By
"specifically bind" or "immunoreacts" with or directed against is
meant that the antibody reacts with one or more antigenic
determinants of the desired antigen and does not react with other
polypeptides or binds at a much lower affinity
(K.sub.d>10.sup.-6 M). Antibodies include but are not limited
to, polyclonal, monoclonal, chimeric, Fab fragments, Fab'
fragments, F(ab').sub.2 fragments, single chain Fv fragments, and
one-armed antibodies.
[0139] As used herein, the term "monoclonal antibody (mAb)" as
applied to the present anti-SIRP.alpha. compounds refer to an
antibody that is derived from a single copy or clone including, for
example, any eukaryotic, prokaryotic, or phage clone, and not the
method by which it is produced. Monoclonal antibodies of the
present disclosure preferably exist in a homogeneous or
substantially homogeneous population. Complete mAbs contain 2
heavy-chains and 2 light-chains.
[0140] An "antibody fragment" refers to a molecule other than an
intact antibody that comprises a portion of an intact antibody that
binds the antigen to which the intact antibody binds. Examples of
antibody fragments include but are not limited to Fv, Fab, Fab',
Fab'-SH, F(ab')2; diabodies; linear antibodies; single-chain
antibody molecules (e.g. scFv); and multi-specific antibodies
formed from antibody fragments.
[0141] As disclosed herein, "antibody compounds" refers to mAbs and
antigen-binding fragments thereof. Additional antibody compounds
exhibiting similar functional properties according to the present
disclosure can be generated by conventional methods. For example,
mice can be immunized with human SIRP.alpha. or fragments thereof,
the resulting antibodies can be recovered and purified, and
determination of whether they possess binding and functional
properties similar to or the same as the antibody compounds
disclosed herein can be assessed by the methods disclosed in the
Examples. Antigen-binding fragments can also be prepared by
conventional methods. Methods for producing and purifying
antibodies and antigen-binding fragments are well known in the art
and can be found, for example, in Harlow and Lane (1988)
Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory
Press, Cold Spring Harbor, N.Y., chapters 5-8 and 15.
[0142] As disclosed herein, "multispecific antibodies" are e.g.,
bispecific, trispecific or tetraspecific antibodies. In some
embodiments, the multispecific antibodies target SIRP.alpha. and/or
SIRP.gamma. and at least one other antigen binding specificity in
one molecule. In some embodiments, the multispecific antibodies may
simultaneously target SIRP.alpha. and/or SIRP.gamma. and at least a
second antigen (bispecific), or at least a second and third antigen
(trispecific), or at least a second, third, and fourth antigen
(tetraspecific), wherein the second antigen, third antigen, and
fourth antigen is on a tumor cell as disclosed herein.
[0143] Bispecific antibodies are antibodies which have two
different antigen binding specificities in one molecule.
Trispecific antibodies, accordingly, are antibodies which have
three different antigen-binding specificities in one molecule.
Tetraspecific antibodies are antibodies which have four different
antigen-binding specificities in one molecule. In one embodiment,
the anti-SIRP.alpha. antibodies as disclosed herein are bispecific
antibodies targeting SIRP.alpha. and/or SIRP.gamma., and a second
antigen on a tumor cell as disclosed herein.
[0144] The monoclonal antibodies encompass antibodies in which a
portion of the heavy and/or light-chain is identical with, or
homologous to, corresponding sequences in murine antibodies, in
particular the murine CDRs, while the remainder of the chain(s) is
(are) identical with, or homologous to, corresponding sequences in
human antibodies. Other embodiments of the disclosure include
antigen-binding fragments of these monoclonal antibodies that
exhibit binding and biological properties similar or identical to
the monoclonal antibodies. The antibodies of the present disclosure
can comprise kappa or lambda light-chain constant regions, and
heavy-chain IgA, IgD, IgE, IgG, or IgM constant regions, including
those of IgG subclasses IgG1, IgG2, IgG3, and IgG4 and in some
cases with various mutations to alter Fc receptor function.
[0145] The monoclonal antibodies containing the presently disclosed
murine CDRs can be prepared by any of the various methods known to
those skilled in the art, including recombinant DNA methods.
[0146] Reviews of current methods for antibody engineering and
improvement can be found, for example, in P. Chames, Ed., (2012)
Antibody Engineering: Methods and Protocols, Second Edition
(Methods in Molecular Biology, Book 907), Humana Press, ISBN-10:
1617799734; C. R. Wood, Ed., (2011) Antibody Drug Discovery
(Molecular Medicine and Medicinal Chemistry, Book 4), Imperial
College Press; R. Kontermann and S. Dubel, Eds., (2010) Antibody
Engineering Volumes 1 and 2 (Springer Protocols), Second Edition;
and W. Strohl and L. Strohl (2012) Therapeutic antibody
engineering: Current and future advances driving the strongest
growth area in the pharmaceutical industry, Woodhead
Publishing.
[0147] Methods for producing and purifying antibodies and
antigen-binding fragments are well known in the art and can be
found, for example, in Harlow and Lane (1988) Antibodies, A
Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring
Harbor, N.Y., chapters 5-8 and 15.
[0148] A full-length antibody as it exists naturally is a "Y"
shaped immunoglobulin (Ig) molecule comprising four polypeptide
chains: two identical heavy (H) chains and two identical light (L)
chains, interconnected by disulfide bonds. The amino terminal
portion of each chain, termed the fragment antigen binding region
(FAB), includes a variable region of about 100-110 or more amino
acids primarily responsible for antigen recognition via the
complementarity determining regions (CDRs) contained therein. The
carboxy-terminal portion of each chain defines a constant region
(the "Fc" region) primarily responsible for effector function.
[0149] The CDRs are interspersed with regions that are more
conserved, termed frameworks ("FRs"). Amino acid sequences of many
FRs are well known in the art. Each light-chain variable region
(LCVR) and heavy-chain variable region (HCVR) is composed of 3 CDRs
and 4 FRs, arranged from amino-terminus to carboxy-terminus in the
following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The 3 CDRs
of the light-chain are referred to as "LCDR1, LCDR2, and LCDR3" and
the 3 CDRs of the heavy-chain are referred to as "HCDR1, HCDR2, and
HCDR3." The CDRs contain most of the residues which form specific
interactions with the antigen. The numbering and positioning of CDR
amino acid residues within the LCVR and HCVR regions are in
accordance with the well-known Kabat numbering convention Kabat et
al. (1991) Sequences of Proteins of Immunological Interest, Fifth
Edition. NIH Publication No. 91-3242.
[0150] As described herein, the "antigen-binding site" can also be
defined as the "Hypervariable regions", "HVRs", or "HVs", and refer
to the structurally hypervariable regions of antibody variable
domains as defined by Chothia and Lesk (Chothia and Lesk, Mol.
Biol. 196:901-917, 1987). There are six HVRs, three in VH (H1, H2,
H3) and three in VL (L1, L2, L3). CDRs as defined by Kabat were
used herein except in H-CDR1, which is extended to include H1.
[0151] There are five types of mammalian immunoglobulin (Ig)
heavy-chains, denoted by the Greek letters .alpha. (alpha), .delta.
(delta), .epsilon. (epsilon), .gamma. (gamma), and .mu. (mu), which
define the class or isotype of an antibody as IgA, IgD, IgE, IgG,
or IgM, respectively. IgG antibodies can be further divided into
subclasses, for example, IgG1, IgG2, IgG3, and IgG4.
[0152] Each heavy-chain type is characterized by a particular
constant region with a sequence well known in the art. The constant
region is identical in all antibodies of the same isotype but
differs in antibodies of different isotypes. Heavy-chains .gamma.,
.alpha., and .delta. have a constant region composed of three
tandem immunoglobulin (Ig) domains, and a hinge region for added
flexibility. Heavy-chains .mu. and .epsilon. have a constant region
composed of four Ig domains.
[0153] The hinge region is a flexible amino acid stretch that links
the Fc and Fab portions of an antibody. This region contains
cysteine residues that can form disulfide bonds, connecting two
heavy-chains together.
[0154] The variable region of the heavy-chain differs in antibodies
produced by different B cells but is the same for all antibodies
produced by a single B cell or B cell clone. The variable region of
each heavy-chain is approximately 110 amino acids long and is
composed of a single Ig domain.
[0155] In mammals, light-chains are classified as kappa (.kappa.)
or lambda (.lamda.), and are characterized by a particular constant
region as known in the art. A light-chain has two successive
domains: one variable domain at the amino-terminal end, and one
constant domain at the carboxy-terminal end. Each antibody contains
two light-chains that are always identical; only one type of
light-chain, .kappa. or .lamda., is present per antibody in
mammals.
[0156] The Fc region, composed of two heavy-chains that contribute
three or four constant domains depending on the class of the
antibody, plays a role in modulating immune cell activity. By
binding to specific proteins, the Fc region ensures that each
antibody generates an appropriate immune response for a given
antigen. The Fc region also binds to various cell receptors, such
as Fc receptors, and other immune molecules, such as complement
proteins. By doing this, it mediates different physiological
effects, including opsonization, cell lysis, and degranulation of
mast cells, basophils and eosinophils.
[0157] As used herein, the term "epitope" refers to a specific
arrangement of amino acids located on a peptide or protein to which
an antibody or antibody fragment binds. Epitopes often consist of a
chemically active surface grouping of molecules such as amino acids
or sugar side chains and have specific three-dimensional structural
characteristics as well as specific charge characteristics.
Epitopes can be linear, i.e., involving binding to a single
sequence of amino acids, or conformational, i.e., involving binding
to two or more sequences of amino acids in various regions of the
antigen that may not necessarily be contiguous in the linear
sequence.
[0158] As used herein, the terms "specifically binds", "bind
specifically", "specific binding", and the like as applied to the
present antibody compounds refer to the ability of a specific
binding agent (such as an antibody) to bind to a target molecular
species in preference to binding to other molecular species with
which the specific binding agent and target molecular species are
admixed. A specific binding agent is said specifically to recognize
a target molecular species when it can bind specifically to that
target.
[0159] As used herein, the term "binding affinity" refers to the
strength of binding of one molecule to another at a site on the
molecule. If a particular molecule will bind to or specifically
associate with another particular molecule, these two molecules are
said to exhibit binding affinity for each other. Binding affinity
is related to the association constant and dissociation constant
for a pair of molecules, but it is not critical to the methods
herein that these constants be measured or determined. Rather,
affinities as used herein to describe interactions between
molecules of the described methods are generally apparent
affinities (unless otherwise specified) observed in empirical
studies, which can be used to compare the relative strength with
which one molecule (e.g., an antibody or other specific binding
partner) will bind two other molecules (e.g., two versions or
variants of a peptide). The concepts of binding affinity,
association constant, and dissociation constant are well known.
[0160] As used herein, the term "sequence identity" means the
percentage of identical nucleotide or amino acid residues at
corresponding positions in two or more sequences when the sequences
are aligned to maximize sequence matching, i.e., considering gaps
and insertions. Identity can be readily calculated by known
methods, including but not limited to those described in:
Computational Molecular Biology, Lesk, A. M., ed., Oxford
University Press, New York, 1988; Biocomputing: Informatics and
Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993;
Computer Analysis of Sequence Data, Part I, Griffin, A. M., and
Griffin, H. G., eds., Humana Press, New Jersey, 1994; Sequence
Analysis in Molecular Biology, von Heinje, G., Academic Press,
1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J.,
eds., M Stockton Press, New York, 1991; and Carillo, H., and
Lipman, D., SIAM J. Applied Math., 48: 1073 (1988). Methods to
determine identity are designed to give the largest match between
the sequences tested. Moreover, methods to determine identity are
codified in publicly available computer programs.
[0161] Optimal alignment of sequences for comparison can be
conducted, for example, by the local homology algorithm of Smith
& Waterman, by the homology alignment algorithms, by the search
for similarity method or, by computerized implementations of these
algorithms (GAP, BESTFIT, PASTA, and TFASTA in the GCG Wisconsin
Package, available from Accelrys, Inc., San Diego, Calif., United
States of America), or by visual inspection. See generally,
Altschul, S. F. et al., J. Mol. Biol. 215: 403-410 (1990) and
Altschul et al. Nucl. Acids Res. 25: 3389-3402 (1997).
[0162] One example of an algorithm that is suitable for determining
percent sequence identity and sequence similarity is the BLAST
algorithm, which is described in (Altschul, S., et al., NCBI NLM
NIH Bethesda, Md. 20894; and Altschul, S., et al., J. Mol. Biol.
215: 403-410 (1990). Software for performing BLAST analyses is
publicly available through the National Center for Biotechnology
Information. This algorithm involves first identifying high scoring
sequence pairs (HSPs) by identifying short words of length W in the
query sequence, which either match or satisfy some positive-valued
threshold score T when aligned with a word of the same length in a
database sequence. T is referred to as the neighborhood word score
threshold.
[0163] These initial neighborhood word hits act as seeds for
initiating searches to find longer HSPs containing them. The word
hits are then extended in both directions along each sequence for
as far as the cumulative alignment score can be increased.
Cumulative scores are calculated using, for nucleotide sequences,
the parameters M (reward score for a pair of matching residues;
always; 0) and N (penalty score for mismatching residues; always;
0). For amino acid sequences, a scoring matrix is used to calculate
the cumulative score. Extension of the word hits in each direction
are halted when: the cumulative alignment score falls off by the
quantity X from its maximum achieved value, the cumulative score
goes to zero or below due to the accumulation of one or more
negative-scoring residue alignments, or the end of either sequence
is reached. The BLAST algorithm parameters W, T, and X determine
the sensitivity and speed of the alignment. The BLASTN program (for
nucleotide sequences) uses as defaults a word length (W) of 11, an
expectation (E) of 10, a cutoff of 100, M=5, N=-4, and a comparison
of both strands. For amino acid sequences, the BLASTP program uses
as defaults a word length (W) of 3, an expectation (E) of 10, and
the BLOSUM62 scoring matrix.
[0164] In addition to calculating percent sequence identity, the
BLAST algorithm also performs a statistical analysis of the
similarity between two sequences. One measure of similarity
provided by the BLAST algorithm is the smallest sum probability
(P(N)), which provides an indication of the probability by which a
match between two nucleotide or amino acid sequences would occur by
chance. For example, a test nucleic acid sequence is considered
similar to a reference sequence if the smallest sum probability in
a comparison of the test nucleic acid sequence to the reference
nucleic acid sequence is in one embodiment less than about 0.1, in
another embodiment less than about 0.01, and in still another
embodiment less than about 0.001.
[0165] As used herein, the terms "humanized", "humanization", and
the like, refer to grafting of the murine monoclonal antibody CDRs
disclosed herein to human FRs and constant regions. Also
encompassed by these terms are possible further modifications to
the murine CDRs, and human FRs, by the methods disclosed in, for
example, Kashmiri et al. (2005) Methods 36(1):25-34 and Hou et al.
(2008) J. Biochem. 144(1):115-120, respectively, to improve various
antibody properties, as discussed below.
[0166] As used herein, the term "humanized antibodies" refers to
mAbs and antigen binding fragments thereof, including the antibody
compounds disclosed herein, that have binding and functional
properties according to the disclosure similar to those disclosed
herein, and that have FRs and constant regions that are
substantially human or fully human surrounding CDRs derived from a
non-human antibody.
[0167] As used herein, the term "FR" or "framework sequence" refers
to any one of FRs 1 to 4. Humanized antibodies and antigen binding
fragments encompassed by the present disclosure include molecules
wherein any one or more of FRs 1 to 4 is substantially or fully
human, i.e., wherein any of the possible combinations of individual
substantially or fully human FRs 1 to 4, is present. For example,
this includes molecules in which FR1 and FR2, FR1 and FR3, FR1,
FR2, and FR3, etc., are substantially or fully human. Substantially
human frameworks are those that have at least 80% sequence identity
to a known human germline framework sequence. Preferably, the
substantially human frameworks have at least 85%, at least 86%, at
least 87%, at least 88%, at least 89%, at least 90%, at least 91%,
at least 92%, at least 93%, at least 94%, at least 95%, at least
96%, at least 97%, at least 98%, or at least 99% sequence identity,
to a framework sequence disclosed herein, or to a known human
germline framework sequence.
[0168] Fully human frameworks are those that are identical to a
known human germline framework sequence. Human FR germline
sequences can be obtained from the international ImMunoGeneTics
(IMGT) database and from The Immunoglobulin FactsBook by
Marie-Paule Lefranc and Gerard Lefranc, Academic Press, 2001, the
contents of which are herein incorporated by reference in their
entirety.
[0169] The Immunoglobulin Facts Book is a compendium of the human
germline immunoglobulin genes that are used to create the human
antibody repertoire, and includes entries for 203 genes and 459
alleles, with a total of 837 displayed sequences. The individual
entries comprise all the human immunoglobulin constant genes, and
germline variable, diversity, and joining genes that have at least
one functional or open reading frame allele, and which are
localized in the three major loci. For example, germline
light-chain FRs can be selected from the group consisting of:
IGKV3D-20, IGKV2-30, IGKV2-29, IGKV2-28, IGKV1-27, IGKV3-20,
IGKV1-17, IGKV1-16, 1-6, IGKV1-5, IGKV1-12, IGKV1D-16, IGKV2D-28,
IGKV2D-29, IGKV3-11, IGKV1-9, IGKV1-39, IGKV1D-39 and IGKV1D-33 and
IGKJ1-5 and germline heavy-chain FRs can be selected from the group
consisting of: IGHV1-2, IGHV1-18, IGHV1-46, IGHV1-69, IGHV2-5,
IGHV2-26, IGHV2-70, IGHV1-3, IGHV1-8, IGHV3-9, IGHV3-11, IGHV3-15,
IGHV3-20, IGHV3-66, IGHV3-72, IGHV3-74, IGHV4-31, IGHV3-21,
IGHV3-23, IGHV3-30, IGHV3-48, IGHV4-39, IGHV4-59 and IGHV5-51 and
IGHJ1-6.
[0170] Substantially human FRs are those that have at least 80%
sequence identity to a known human germline FR sequence.
Preferably, the substantially human frameworks have at least 85%,
at least 90%, at least 95%, at least 96%, at least 97%, at least
98%, or at least 99% sequence identity, to a framework sequences
disclosed herein, or to a known human germline framework
sequence.
[0171] CDRs encompassed by the present disclosure include not only
those specifically disclosed herein, but also CDR sequences having
sequence identities of at least 80%, at least 85%, at least 90%, at
least 95%, at least 96%, at least 97%, at least 98%, or at least
99% sequence identity to a CDR sequence disclosed herein.
Alternatively, CDRs encompassed by the present disclosure include
not only those specifically disclosed herein, but also CDR
sequences having 1, 2, 3, 4, or 5 amino acid changes at
corresponding positions compared to CDR sequences disclosed herein.
Such sequence identical, or amino acid modified, CDRs preferably
bind to the antigen recognized by the intact antibody.
[0172] Humanized antibodies in addition to those disclosed herein
exhibiting similar functional properties according to the present
disclosure can be generated using several different methods Almagro
et al. Frontiers in Biosciences. Humanization of antibodies. (2008)
Jan. 1; 13:1619-33. In one approach, the parent antibody compound
CDRs are grafted into a human framework that has a high sequence
identity with the parent antibody compound framework. The sequence
identity of the new framework will generally be at least 80%, at
least 85%, at least 86%, at least 87%, at least 88%, at least 89%,
at least 90%, at least 91%, at least 92%, at least 93%, at least
94%, at least 95%, at least 96%, at least 97%, at least 98%, or at
least 99% sequence identical to the sequence of the corresponding
framework in the parent antibody compound. In the case of
frameworks having fewer than 100 amino acid residues, one, two,
three, four, five, six, seven, eight, nine, or ten amino acid
residues can be changed. This grafting may result in a reduction in
binding affinity compared to that of the parent antibody. If this
is the case, the framework can be back-mutated to the parent
framework at certain positions based on specific criteria disclosed
by Queen et al. (1991) Proc. Natl. Acad. Sci. USA 88:2869.
Additional references describing methods useful to generate
humanized variants based on homology and back mutations include as
described in Olimpieri et al. Bioinformatics. 2015 Feb. 1;
31(3):434-435 and U.S. Pat. Nos. 4,816,397, 5,225,539, and
5,693,761; and the method of Winter and co-workers (Jones et al.
(1986) Nature 321:522-525; Riechmann et al. (1988) Nature
332:323-327; and Verhoeyen et al. (1988) Science 239:1534-1536.
[0173] Humanization began with chimerization, a method developed
during the first half of the 1980's (Morrison, S. L., M. J.
Johnson, L. A. Herzenberg & V. T. Oi: Chimeric human antibody
molecules: mouse antigen-binding domains with human constant region
domains. Proc. Natl. Acad. Sci. USA., 81, 6851-5 (1984)),
consisting of combining the variable (V) domains of murine
antibodies with human constant (C) domains to generate molecules
with .about.70% of human content.
[0174] Several different methods can be used to generate humanized
antibodies, which are described herein. In one approach, the parent
antibody compound CDRs are grafted into a human FR that has a high
sequence identity with the parent antibody compound framework. The
sequence identity of the new FR will generally be at least 80%, at
least 85%, at least 90%, at least 95%, at least 96%, at least 97%,
at least 98%, or at least 99% identical to the sequence of the
corresponding FR in the parent antibody compound. In the case of
FRs having fewer than 100 amino acid residues, one, two, three,
four, five, or more amino acid residues can be changed. This
grafting may result in a reduction in binding affinity compared to
that of the parent antibody. If this is the case, the FR can be
back-mutated to the parent framework at certain positions based on
specific criteria disclosed by Queen et al. (1991) Proc. Natl.
Acad. Sci. USA 88:2869. Additional references describing methods
useful to generate humanized variants based on homology and back
mutations include as described in Olimpieri et al. Bioinformatics.
2015 Feb. 1; 31(3):434-435 and U.S. Pat. Nos. 4,816,397, 5,225,539,
and 5,693,761; and the method of Winter and co-workers (Jones et
al. (1986) Nature 321:522-525; Riechmann et al. (1988) Nature
332:323-327; and Verhoeyen et al. (1988) Science 239:1534-1536.
[0175] The identification of residues to consider for back-mutation
can be carried out as described below. When an amino acid falls
under the following category, the framework amino acid of the human
germ-line sequence that is being used (the "acceptor FR") is
replaced by a framework amino acid from a framework of the parent
antibody compound (the "donor FR"): [0176] (a) the amino acid in
the human FR of the acceptor framework is unusual for human
frameworks at that position, whereas the corresponding amino acid
in the donor immunoglobulin is typical for human frameworks at that
position; [0177] (b) the position of the amino acid is immediately
adjacent to one of the CDRs; or [0178] (c) any side chain atom of a
framework amino acid is within about 5-6 angstroms
(center-to-center) of any atom of a CDR amino acid in a
three-dimensional immunoglobulin model.
[0179] When each of the amino acids in the human FR of the acceptor
framework and a corresponding amino acid in the donor framework is
generally unusual for human frameworks at that position, such amino
acid can be replaced by an amino acid typical for human frameworks
at that position. This back-mutation criterion enables one to
recover the activity of the parent antibody compound.
[0180] Another approach to generating humanized antibodies
exhibiting similar functional properties to the antibody compounds
disclosed herein involves randomly mutating amino acids within the
grafted CDRs without changing the framework and screening the
resultant molecules for binding affinity and other functional
properties that are as good as, or better than, those of the parent
antibody compounds. Single mutations can also be introduced at each
amino acid position within each CDR, followed by assessing the
effects of such mutations on binding affinity and other functional
properties. Single mutations producing improved properties can be
combined to assess their effects in combination with one
another.
[0181] Further, a combination of both of the foregoing approaches
is possible. After CDR grafting, one can back-mutate specific FRs
in addition to introducing amino acid changes in the CDRs. This
methodology is described in Wu et al. (1999) J. Mol. Biol. 294:
151-162.
[0182] Applying the teachings of the present disclosure, a person
skilled in the art can use common techniques, e.g., site-directed
mutagenesis, to substitute amino acids within the presently
disclosed CDR and FR sequences and thereby generate further
variable region amino acid sequences derived from the present
sequences. Up to all naturally occurring amino acids can be
introduced at a specific substitution site. The methods disclosed
herein can then be used to screen these additional variable region
amino acid sequences to identify sequences having the indicated in
vivo functions. In this way, further sequences suitable for
preparing humanized antibodies and antigen-binding portions thereof
in accordance with the present disclosure can be identified.
Preferably, amino acid substitution within the frameworks is
restricted to one, two, three, four, or five positions within any
one or more of the four light-chain and/or heavy-chain FRs
disclosed herein. Preferably, amino acid substitution within the
CDRs is restricted to one, two, three, four, or five positions
within any one or more of the three light-chain and/or heavy-chain
CDRs. Combinations of the various changes within these FRs and CDRs
described above are also possible.
[0183] That the functional properties of the antibody compounds
generated by introducing the amino acid modifications discussed
above conform to those exhibited by the specific molecules
disclosed herein can be confirmed by the methods in Examples
disclosed herein.
[0184] As described above, to circumvent the problem of eliciting
human anti-murine antibody (HAMA) response in patients, murine
antibodies have been genetically manipulated to progressively
replace their murine content with the amino acid residues present
in their human counterparts by grafting their complementarity
determining regions (CDRs) onto the variable light (V.sub.L) and
variable heavy (V.sub.H) frameworks of human immunoglobulin
molecules, while retaining those murine framework residues deemed
essential for the integrity of the antigen-combining site. However,
the xenogeneic CDRs of the humanized antibodies may evoke
anti-idiotypic (anti-Id) response in patients.
[0185] To minimize the anti-Id response, a procedure to humanize
xenogeneic antibodies by grafting onto the human frameworks only
the CDR residues most crucial in the antibody-ligand interaction,
called "SDR grafting", has been developed, wherein only the crucial
specificity determining residues (SDRs) of CDRS are grafted onto
the human frameworks. This procedure, described in Kashmiri et al.
(2005) Methods 36(1):25-34, involves identification of SDRs through
the help of a database of the three-dimensional structures of the
antigen-antibody complexes of known structures, or by mutational
analysis of the antibody-combining site. An alternative approach to
humanization involving retention of more CDR residues is based on
grafting of the `abbreviated` CDRs, the stretches of CDR residues
that include all the SDRs. Kashmiri et al. also discloses a
procedure to assess the reactivity of humanized antibodies to sera
from patients who had been administered the murine antibody.
[0186] Another strategy for constructing human antibody variants
with improved immunogenic properties is disclosed in Hou et al.
(2008) J. Biochem. 144(1):115-120. These authors developed a
humanized antibody from 4C8, a murine anti-human CD34 monoclonal
antibody, by CDR grafting using a molecular model of 4C8 built by
computer-assisted homology modelling. Using this molecular model,
the authors identified FR residues of potential importance in
antigen binding. A humanized version of 4C8 was generated by
transferring these key murine FR residues onto a human antibody
framework that was selected based on homology to the murine
antibody FR, together with the murine CDR residues. The resulting
humanized antibody was shown to possess antigen-binding affinity
and specificity similar to that of the original murine antibody,
suggesting that it might be an alternative to murine anti-CD34
antibodies routinely used clinically.
[0187] Embodiments of the present disclosure encompass antibodies
created to avoid recognition by the human immune system containing
CDRs disclosed herein in any combinatorial form such that
contemplated mAbs can contain the set of CDRs from a single murine
mAb disclosed herein, or light and heavy-chains containing sets of
CDRs comprising individual CDRs derived from two or three of the
disclosed murine mAbs. Such mAbs can be created by standard
techniques of molecular biology and screened for desired activities
using assays described herein. In this way, the disclosure provides
a "mix and match" approach to create novel mAbs comprising a
mixture of CDRs from the disclosed murine mAbs to achieve new, or
improved, therapeutic activities.
[0188] Monoclonal antibodies or antigen-binding fragments thereof
encompassed by the present disclosure that "compete" with the
molecules disclosed herein are those that bind human SIRP.alpha. at
site(s) that are identical to, or overlapping with, the site(s) at
which the present molecules bind. Competing monoclonal antibodies
or antigen-binding fragments thereof can be identified, for
example, via an antibody competition assay. For example, a sample
of purified or partially purified human SIRP.alpha. extracellular
domain can be bound to a solid support. Then, an antibody compound,
or antigen binding fragment thereof, of the present disclosure and
a monoclonal antibody or antigen-binding fragment thereof suspected
of being able to compete with such disclosure antibody compound are
added. One of the two molecules is labeled. If the labeled compound
and the unlabeled compound bind to separate and discrete sites on
SIRP.alpha., the labeled compound will bind to the same level
whether or not the suspected competing compound is present.
However, if the sites of interaction are identical or overlapping,
the unlabeled compound will compete, and the amount of labeled
compound bound to the antigen will be lowered. If the unlabeled
compound is present in excess, very little, if any, labeled
compound will bind. For purposes of the present disclosure,
competing monoclonal antibodies or antigen-binding fragments
thereof are those that decrease the binding of the present antibody
compounds to SIRP.alpha. by about 50%, about 60%, about 70%, about
80%, about 85%, about 86%, about 87%, about 88%, about 89%, about
90%, about 91%, about 92%, about 93%, about 94%, about 95%, about
96%, about 97%, about 98%, or about 99%. Details of procedures for
carrying out such competition assays are well known in the art and
can be found, for example, in Harlow and Lane (1988) Antibodies, A
Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring
Harbor, N.Y. Such assays can be made quantitative by using purified
antibodies. A standard curve is established by titrating one
antibody against itself, i.e., the same antibody is used for both
the label and the competitor. The capacity of an unlabeled
competing monoclonal antibody or antigen-binding fragment thereof
to inhibit the binding of the labeled molecule to the plate is
titrated. The results are plotted, and the concentrations necessary
to achieve the desired degree of binding inhibition are
compared.
[0189] Whether mAbs or antigen-binding fragments thereof that
compete with antibody compounds of the present disclosure in such
competition assays possess the same or similar functional
properties of the present antibody compounds can be determined via
these methods in conjunction with the methods described in Examples
2-7, below. In various embodiments, competing antibodies for use in
the therapeutic methods encompassed herein possess biological
activities as described herein in the range of from about 50% to
about 100% or about 125%, or more, compared to that of the antibody
compounds disclosed herein. In some embodiments, competing
antibodies possess about 50%, about 60%, about 70%, about 80%,
about 85%, about 90%, about 91%, about 92%, about 93%, about 94%,
about 95%, about 96%, about 97%, about 98%, about 99%, or identical
biological activity compared to that of the antibody compounds
disclosed herein as determined by the methods disclosed in the
Examples presented below.
[0190] The mAbs or antigen-binding fragments thereof or competing
antibodies useful in the compositions and methods can be any of the
isotypes described herein. Furthermore, any of these isotypes can
comprise further amino acid modifications as follows.
[0191] The monoclonal antibody or antigen-binding fragment thereof,
or competing antibody described herein can be of the human IgG1
isotype.
[0192] The human IgG1 constant region of the monoclonal antibody,
antigen-binding fragment thereof, or competing antibody described
herein can be modified to alter antibody half-life. Antibody
half-life is regulated in large part by Fc-dependent interactions
with the neonatal Fc receptor (Roopenian and Alikesh, 2007). The
human IgG1 constant region of the monoclonal antibody,
antigen-binding fragment thereof, or competing antibody can be
modified to increase half-life include, but are not limited to
amino acid modifications N434A, T307A/E380A/N434A (Petkova et al.,
2006, Yeung et al., 2009); M252Y/S254T/T256E (Dall'Acqua et al.,
2006); T250Q/M428L (Hinton et al., 2006); and M428L/N434S (Zalevsky
et al., 2010).
[0193] As opposed to increasing half-life, there are some
circumstances where decreased half-life would be desired, such as
to reduce the possibility of adverse events associated with high
Antibody-Dependent Cellular Cytotoxicity (ADCC) and
Complement-Dependent Cytotoxicity (CDC) antibodies (Presta 2008).
The human IgG1 constant region of the monoclonal antibody,
antigen-binding fragment thereof, or competing antibody described
herein can be modified to decrease half-life and/or decrease
endogenous IgG include, but are not limited to, amino acid
modifications I253A (Petkova et al., 2006); P257I/N434H,
D376V/N434H (Datta-Mannan et al., 2007); and
M252Y/S254T/T256E/H433K/N434F (Vaccaro et al., 2005).
[0194] The human IgG1 constant region of the monoclonal antibody,
antigen-binding fragment thereof, or competing antibody described
herein can be modified to increase or decrease antibody effector
functions. These antibody effector functions include, but are not
limited to, Antibody-Dependent Cellular Cytotoxicity (ADCC),
Complement-Dependent Cytotoxicity (CDC), Antibody-Dependent
Cellular Phagocytosis (ADCP), C1q binding, and altered binding to
Fc receptors.
[0195] The human IgG1 constant region of the monoclonal antibody,
antigen-binding fragment thereof, or competing antibody described
herein can be modified to increase antibody effector function
include, but are not limited to amino acid modifications
S298A/E333A/K334 (Shields et al., 2001); S239D/I332E and
S239D/A330L/I332E (Lazar et al., 2006); F234L/R292P/Y300L,
F234L/R292P/Y300L/P393L, and F243L/R292P/Y300L/V305I/P396L
(Stevenhagen et al., 2007); G236A, G236A/S239D/I332E, and
G236A/S239D/A330L/I332E (Richards et al., 2008); K326A/E333A,
K326A/E333S and K326W/E333S (Idusogie et al., 2001); S267E and
S267E/L328F (Smith et al., 2012); H268F/S324T, S267E/H268F,
S267E/S234T, and S267E/H268F/S324T (Moore et al., 2010);
S298G/T299A (Sazinsky et al., 2008); E382V/M428I (Jung et al.,
2010).
[0196] The human IgG1 constant region of the monoclonal antibody,
antigen-binding fragment thereof, or competing antibody described
herein can be modified to decrease antibody effector function
include, but are not limited to amino acid modifications N297A and
N297Q (Bolt et al., 1993, Walker et al., 1989); L234A/L235A (Xu et
al., 2000);
K214T/E233P/L234V/L235A/G236-deleted/A327G/P331A/D356E/L358M
(Ghevaert et al., 2008); C226S/C229S/E233P/L234V/L235A (McEarchern
et al., 2007); S267E/L328F (Chu et al., 2008).
[0197] The human IgG1 constant region of the monoclonal antibody,
antigen-binding fragment thereof, or competing antibody described
herein can be modified to decrease antibody effector function
include, but are not limited to amino acid modifications
V234A/G237A (Cole et al., 1999); E233D, G237D, P238D, H268Q, H268D,
P271G, V309L, A330S, A330R, P331S, H268Q/A330S/V309L/P331S,
H268D/A330S/V309L/P331S, H268Q/A330R/V309L/P331S,
H268D/A330R/V309L/P331S, E233D/A330R, E233D/A330S,
E233D/P271G/A330R, E233D/P271G/A330S, G237D/H268D/P271G,
G237D/H268Q/P271G, G237D/P271G/A330R, G237D/P271G/A330S,
E233D/H268D/P271G/A330R, E233D/H268Q/P271G/A330R,
E233D/H268D/P271G/A330S, E233D/H268Q/P271G/A330S,
G237D/H268D/P271G/A330R, G237D/H268Q/P271G/A330R,
G237D/H268D/P271G/A330S, G237D/H268Q/P271G/A330S,
E233D/G237D/H268D/P271G/A330R, E233D/G237D/H268Q/P271G/A330R,
E233D/G237D/H268D/P271G/A330S, E233D/G237D/H268Q/P271G/A330S,
P238D/E233D/A330R, P238D/E233D/A330S, P238D/E233D/P271G/A330R,
P238D/E233D/P271G/A330S, P238D/G237D/H268D/P271G,
P238D/G237D/H268Q/P271G, P238D/G237D/P271G/A330R,
P238D/G237D/P271G/A330S, P238D/E233D/H268D/P271G/A330R,
P238D/E233D/H268Q/P271G/A330R, P238D/E233D/H268D/P271G/A330S,
P238D/E233D/H268Q/P271G/A330S, P238D/G237D/H268D/P271G/A330R,
P238D/G237D/H268Q/P271G/A330R, P238D/G237D/H268D/P271G/A330S,
P238D/G237D/H268Q/P271G/A330S, P238D/E233D/G237D/H268D/P271G/A330R,
P238D/E233D/G237D/H268Q/P271G/A330R,
P238D/E233D/G237D/H268D/P271G/A330S,
P238D/E233D/G237D/H268Q/P271G/A330S (An et al., 2009, Mimoto,
2013).
[0198] The monoclonal antibody or antigen-binding fragment thereof,
or competing antibody described herein can be of the human IgG2
isotype.
[0199] The human IgG2 constant region of the monoclonal antibody,
antigen-binding fragment thereof, or competing antibody described
herein can be modified to increase or decrease antibody effector
functions. These antibody effector functions include, but are not
limited to, Antibody-Dependent Cellular Cytotoxicity (ADCC),
Complement-Dependent Cytotoxicity (CDC), Antibody-Dependent
Cellular Phagocytosis (ADCP), and C1q binding, and altered binding
to Fc receptors.
[0200] The human IgG2 constant region of the monoclonal antibody,
antigen-binding fragment thereof, or a competing antibody described
herein, can be modified to increase antibody effector function
include, but are not limited to, the amino acid modification
K326A/E333S (Idusogie et al., 2001).
[0201] The human IgG2 constant region of the monoclonal antibody,
antigen-binding fragment thereof, or competing antibody described
herein can be modified to decrease antibody effector function
include, but are not limited to amino acid modifications
V234A/G237A (Cole et al., 1999); E233D, G237D, P238D, H268Q, H268D,
P271G, V309L, A330S, A330R, P331S, H268Q/A330S/V309L/P331S,
H268D/A330S/V309L/P331S, H268Q/A330R/V309L/P331S,
H268D/A330R/V309L/P331S, E233D/A330R, E233D/A330S,
E233D/P271G/A330R, E233D/P271G/A330S, G237D/H268D/P271G,
G237D/H268Q/P271G, G237D/P271G/A330R, G237D/P271G/A330S,
E233D/H268D/P271G/A330R, E233D/H268Q/P271G/A330R,
E233D/H268D/P271G/A330S, E233D/H268Q/P271G/A330S,
G237D/H268D/P271G/A330R, G237D/H268Q/P271G/A330R,
G237D/H268D/P271G/A330S, G237D/H268Q/P271G/A330S,
E233D/G237D/H268D/P271G/A330R, E233D/G237D/H268Q/P271G/A330R,
E233D/G237D/H268D/P271G/A330S, E233D/G237D/H268Q/P271G/A330S,
P238D/E233D/A330R, P238D/E233D/A330S, P238D/E233D/P271G/A330R,
P238D/E233D/P271G/A330S, P238D/G237D/H268D/P271G,
P238D/G237D/H268Q/P271G, P238D/G237D/P271G/A330R,
P238D/G237D/P271G/A330S, P238D/E233D/H268D/P271G/A330R,
P238D/E233D/H268Q/P271G/A330R, P238D/E233D/H268D/P271G/A330S,
P238D/E233D/H268Q/P271G/A330S, P238D/G237D/H268D/P271G/A330R,
P238D/G237D/H268Q/P271G/A330R, P238D/G237D/H268D/P271G/A330S,
P238D/G237D/H268Q/P271G/A330S, P238D/E233D/G237D/H268D/P271G/A330R,
P238D/E233D/G237D/H268Q/P271G/A330R,
P238D/E233D/G237D/H268D/P271G/A330S,
P238D/E233D/G237D/H268Q/P271G/A330S (An et al., 2009, Mimoto,
2013).
[0202] The Fc region of a human IgG2 of the monoclonal antibody,
antigen-binding fragment thereof, or competing antibody described
herein can be modified to alter isoform and/or agonistic activity,
include, but are not limited to amino acid modifications C127S
(C.sub.H1 domain), C232S, C233S, C232S/C233S, C236S, and C239S
(White et al., 2015, Lightle et al., 2010).
[0203] The Fc region of a human IgG2 of the monoclonal antibody,
antigen-binding fragment thereof, or competing antibody described
herein can be modified to exhibit diminished Fc.gamma.R binding
capacity but have conserved FcRn binding. These IgG Fc mutants
enable therapeutic targeting of soluble or cell surface antigens
while minimizing Fc-associated engagement of immune effector
function and complement mediated cytotoxicity. In one embodiment,
the IgG2 Fc mutant comprises V234A, G237A, P238S according to the
EU numbering system. In another embodiment, the IgG2 Fc mutant
comprises V234A, G237A, H268Q, or H268A, V309L, A330S, P331S,
according to the EU numbering system. In a particular aspect, the
IgG2 Fc mutant comprises V234A, G237A, P238S, H268A, V309L, A330S,
P331S, and, optionally, P233S according to the EU numbering
system.
[0204] The monoclonal antibody or antigen-binding fragment thereof,
or competing antibody described herein can be of the human IgG3
isotype.
[0205] The human IgG3 constant region of the monoclonal antibody,
or antigen binding fragment thereof, wherein said human IgG3
constant region of the monoclonal antibody, or antigen-binding
fragment thereof can be modified at one or more amino acid(s) to
increase antibody half-life, Antibody-Dependent Cellular
Cytotoxicity (ADCC), Complement-Dependent Cytotoxicity (CDC), or
apoptosis activity.
[0206] The human IgG3 constant region of the monoclonal antibody,
or antigen-binding fragment thereof, wherein said human IgG3
constant region of the monoclonal antibody, or antigen-binding
fragment thereof can be modified at amino acid R435H to increase
antibody half-life.
[0207] The monoclonal antibody or antigen-binding fragment thereof,
or competing antibody described herein can be of the human IgG4
isotype.
[0208] The human IgG4 constant region of the monoclonal antibody,
antigen-binding fragment thereof, or competing antibody described
herein can be modified to decrease antibody effector functions.
These antibody effector functions include, but are not limited to,
Antibody-Dependent Cellular Cytotoxicity (ADCC) and
Antibody-Dependent Cellular Phagocytosis (ADCP).
[0209] The human IgG4 constant region of the monoclonal antibody,
antigen-binding fragment thereof, or competing antibody described
herein can be modified to prevent Fab arm exchange and/or decrease
antibody effector function include, but are not limited to, amino
acid modifications F234A/L235A (Alegre et al., 1994); S228P, L235E
and S228P/L235E (Reddy et al., 2000).
[0210] As used herein, the term "tumor" refers to all neoplastic
cell growth and proliferation, whether malignant or benign, and all
pre-cancerous and cancerous cells and tissues.
[0211] The terms "cancer", "cancerous", and "tumor" are not
mutually exclusive as used herein. The terms "cancer" and
"cancerous" refer to or describe the physiological condition in
mammals that is typically characterized by aberrant cell
growth/proliferation. Examples of cancers include, but are not
limited to, carcinoma, lymphoma (i.e., Hodgkin's and non-Hodgkin's
lymphoma), multiple myeloma, blastoma, sarcoma, and leukemia. More
particular examples of such cancers include squamous cell cancer,
small-cell lung cancer, non-small cell lung cancer, adenocarcinoma
of the lung, squamous carcinoma of the lung, cancer of the
peritoneum, hepatocellular cancer, gastrointestinal cancer,
pancreatic cancer, glioma, cervical cancer, ovarian cancer, liver
cancer, bladder cancer, hepatoma, breast cancer, colon cancer,
colorectal cancer, endometrial or uterine carcinoma, salivary gland
carcinoma, kidney cancer, liver cancer, prostate cancer, vulvar
cancer, thyroid cancer, hepatic carcinoma, leukemia and other
lymphoproliferative disorders, and various types of head and neck
cancer.
[0212] The term "susceptible cancer" as used herein refers to a
cancer, cells of which express CD47, IRP.alpha., or CD47 and
SIRP.alpha. and are responsive to treatment with an antibody or
antigen binding fragment thereof, or competing antibody or antigen
binding fragment thereof, from the present disclosure that prevent
interaction between CD47 and SIRP.alpha..
[0213] The term "autoimmune disease" as used herein refers to when
the body's immune system turns against itself and mistakenly
attacks healthy cells.
[0214] The term "inflammatory disease" as used herein refers to a
disease characterized by inflammation which is a fundamental
pathologic process consisting of a dynamic complex of
histologically apparent cytologic changes, cellular infiltration,
and mediator release that occurs in the affected blood vessels and
adjacent tissues in response to an injury or abnormal stimulation
caused by a physical, chemical, or biologic agent, including the
local reactions and resulting morphologic changes; the destruction
or removal of the injurious material; and the responses that lead
to repair and healing.
[0215] The term "autoinflammatory disease" as used herein refers to
a disease that results when the innate immune system causes
inflammation for unknown reasons.
[0216] As used herein, term "treating" or "treat" or "treatment"
means slowing, interrupting, arresting, controlling, stopping,
reducing, or reversing the progression or severity of a sign,
symptom, disorder, condition, or disease, but does not necessarily
involve a total elimination of all disease-related signs, symptoms,
conditions, or disorders. The term "treating" and the like refer to
a therapeutic intervention that ameliorates a sign or symptom of a
disease or pathological condition after it has begun to
develop.
[0217] As used herein, term "effective amount" refers to the amount
or dose of an antibody compound of the present disclosure which,
upon single or multiple dose administration to a patient or organ,
provides the desired treatment or prevention.
[0218] The precise effective amount for any particular subject will
depend upon their size and health, the nature and extent of their
condition, and the therapeutics or combination of therapeutics
selected for administration. The effective amount for a given
patient is determined by routine experimentation and is within the
judgment of a clinician. Therapeutically effective amounts of the
present antibody compounds can also comprise an amount in the range
of from about 0.1 mg/kg to about 150 mg/kg, from about 0.1 mg/kg to
about 100 mg/kg, from about 0.1 mg/kg to about 50 mg/kg, or from
about 0.05 mg/kg to about 10 mg/kg per single dose administered to
a harvested organ or to a patient. Known antibody-based
pharmaceuticals provide guidance in this respect. For example,
Herceptin.TM. is administered by intravenous infusion of a 21 mg/ml
solution, with an initial loading dose of 4 mg/kg body weight and a
weekly maintenance dose of 2 mg/kg body weight; Rituxan.TM. is
administered weekly at 375 mg/m.sup.2; for example.
[0219] A therapeutically effective amount for any individual
patient can be determined by the health care provider by monitoring
the effect of the antibody compounds on tumor regression,
circulating tumor cells, tumor stem cells or anti-tumor responses.
Analysis of the data obtained by these methods permits modification
of the treatment regimen during therapy so that optimal amounts of
antibody compounds of the present disclosure, whether employed
alone or in combination with one another, or in combination with
another therapeutic agent, or both, are administered, and so that
the duration of treatment can be determined as well. In this way,
the dosing/treatment regimen can be modified over the course of
therapy so that the lowest amounts of antibody compounds used alone
or in combination that exhibit satisfactory efficacy are
administered, and so that administration of such compounds is
continued only so long as is necessary to successfully treat the
patient. Known antibody-based pharmaceuticals provide guidance
relating to frequency of administration e.g., whether a
pharmaceutical should be delivered daily, weekly, monthly, etc.
Frequency and dosage may also depend on the severity of
symptoms.
[0220] In some embodiments, antibody compounds of the present
disclosure can be used as medicaments in human and veterinary
medicine, administered by a variety of routes including, but not
limited to, oral, intravenous, intramuscular, intra-arterial,
intramedullary, intraperitoneal, intrathecal, intraventricular,
transdermal, transcutaneous, topical, subcutaneous, intratumoral,
intranasal, enteral, sublingual, intravaginal, intravesicular or
rectal routes. The compositions can also be administered directly
into a lesion such as a tumor. Dosage treatment may be a single
dose schedule or a multiple dose schedule. Hypo sprays may also be
used to administer the pharmaceutical compositions. Typically, the
therapeutic compositions can be prepared as injectables, either as
liquid solutions or suspensions. Solid forms suitable for solution
in, or suspension in, liquid vehicles prior to injection can also
be prepared. Veterinary applications include the treatment of
companion/pet animals, such as cats and dogs; working animals, such
as guide or service dogs, and horses; sport animals, such as horses
and dogs; zoo animals, such as primates, cats such as lions and
tigers, bears, etc.; and other valuable animals kept in
captivity.
[0221] Such pharmaceutical compositions can be prepared by methods
well known in the art. See, e.g., Remington: The Science and
Practice of Pharmacy, 2.sup.st Edition (2005), Lippincott Williams
& Wilkins, Philadelphia, Pa., and comprise one or more antibody
compounds disclosed herein, and a pharmaceutically acceptable, for
example, physiologically acceptable, carrier, diluent, or
excipient.
Cancer Indications
[0222] Presently disclosed are anti-SIRP.alpha. mAbs and antigen
binding fragments thereof effective as cancer therapeutics which
can be administered to patients, preferably parenterally, with
susceptible hematologic cancers and solid tumors including, but not
limited to, leukemias, including systemic mastocytosis, acute
lymphocytic (lymphoblastic) leukemia (ALL), T-cell--ALL, acute
myeloid leukemia (AML), myelogenous leukemia, chronic lymphocytic
leukemia (CLL), chronic myeloid leukemia (CIVIL),
myeloproliferative disorder/neoplasm, monocytic cell leukemia, and
plasma cell leukemia; multiple myeloma (MM); Waldenstrom's
Macroglobulinemia; lymphomas, including histiocytic lymphoma and
T-cell lymphoma, B cell lymphomas, including Hodgkin's lymphoma and
non-Hodgkin's lymphoma, such as low grade/follicular non-Hodgkin's
lymphoma (NHL), cell lymphoma (FCC), mantle cell lymphoma (MCL),
diffuse large cell lymphoma (DLCL), small lymphocytic (SL) NHL,
intermediate grade/follicular NHL, intermediate grade diffuse NHL,
high grade immunoblastic NHL, high grade lymphoblastic NHL, high
grade small non-cleaved cell NHL, bulky disease NHL; solid tumors,
including ovarian cancer, breast cancer, endometrial cancer, colon
cancer (colorectal cancer), rectal cancer, bladder cancer,
urothelial cancer, lung cancer (non-small cell lung cancer,
adenocarcinoma of the lung, squamous cell carcinoma of the lung),
bronchial cancer, bone cancer, prostate cancer, pancreatic cancer,
gastric cancer, hepatocellular carcinoma (liver cancer, hepatoma),
gall bladder cancer, bile duct cancer, esophageal cancer, renal
cell carcinoma, thyroid cancer, squamous cell carcinoma of the head
and neck (head and neck cancer), testicular cancer, cancer of the
endocrine gland, cancer of the adrenal gland, cancer of the
pituitary gland, cancer of the skin, cancer of soft tissues, cancer
of blood vessels, cancer of brain, cancer of nerves, cancer of
eyes, cancer of meninges, cancer of oropharynx, cancer of
hypopharynx, cancer of cervix, and cancer of uterus, glioblastoma,
meduloblastoma, astrocytoma, glioma, meningioma, gastrinoma,
neuroblastoma, myelodysplastic syndrome, and sarcomas including,
but not limited to, osteosarcoma, Ewing's sarcoma, leiomyosarcoma,
synovial sarcoma, alveolar soft part sarcoma, angiosarcoma,
liposarcoma, fibrosarcoma, rhabdomyosarcoma, and chrondrosarcoma;
and melanoma.
Treatment of Cancer
[0223] As is well known to those of ordinary skill in the art,
combination therapies are often employed in cancer treatment as
single-agent therapies or procedures may not be sufficient to treat
or cure the disease or condition. Conventional cancer treatments
often involve surgery, radiation treatment, a combination of
cytotoxic drugs to achieve additive or synergistic effects, or
combinations of any or all of these approaches. Especially useful
chemotherapeutic and biologic therapy combinations employ drugs
that work via different mechanisms of action, increasing cancer
cell control or killing, increasing the ability of the immune
system to control cancer cell growth, reducing the likelihood of
drug resistance during therapy, and minimizing possible overlapping
toxicities by permitting the use of reduced doses of individual
drugs.
[0224] Classes of conventional anti-tumor and anti-neoplastic
agents useful in the combination therapies encompassed by the
present methods are disclosed in Goodman & Gilman's The
Pharmacological Basis of Therapeutics, Twelfth Edition (2010) L. L.
Brunton, B. A. Chabner, and B. C. Knollmann Eds., Section VIII,
"Chemotherapy of Neoplastic Diseases", Chapters 60-63, pp.
1665-1770, McGraw-Hill, NY, include but are not limited to
anthracyclines, platinums, taxols, topisomerase inhibitors,
anti-metabolites, anti-tumor antibiotics, mitotic inhibitors, and
alkylating agents.
[0225] In addition to the foregoing, the methods of the present
disclosure are related to treatment of cancer indications and
further comprises treating the patient via surgery, radiation,
and/or administering to a patient in need thereof an effective
amount of a chemical small molecule or biologic drug including, but
not limited to, a peptide, polypeptide, protein, nucleic acid
therapeutic, conventionally used or currently being developed, to
treat tumorous conditions. This includes antibodies and
antigen-binding fragments, other than those disclosed herein,
cytokines, antisense oligonucleotides, siRNAs, and miRNAs.
[0226] The therapeutic methods disclosed and claimed herein include
the use of the antibodies disclosed herein alone, and/or in
combinations with one another, and/or with antigen-binding
fragments thereof of the present disclosure that bind to
SIRP.alpha., and/or with competing antibodies exhibiting
appropriate biological/therapeutic activity, as well, for example,
all possible combinations of these antibody compounds to achieve
the greatest treatment efficacy.
[0227] In addition, the present therapeutic methods also encompass
the use of these antibodies, antigen-binding fragments thereof,
competing antibodies, and combinations thereof in further in
combination with: (1) one or more anti-tumor therapeutic treatments
selected from surgery, radiation, anti-tumor, and anti-neoplastic
agents or combinations of any of these, or (2) one or more of
anti-tumor biological agents or (3) equivalents of any of the
foregoing of (1) or (2) as would be apparent to one of ordinary
skill in the art, in appropriate combination(s) to achieve the
desired therapeutic treatment effect for the particular
indication.
[0228] Antibodies and small molecule drugs that increase the immune
response to cancer by modulating co-stimulatory or inhibitory
interactions that influence the T-cell response to tumor antigens,
including inhibitors of immune checkpoints and modulators of
co-stimulatory molecules, are also of particular interest in the
context of the combination therapeutic methods encompassed herein
and include, but are not limited to, other anti-SIRP.alpha.
antibodies. Administration of therapeutic agents that bind to the
SIRP.alpha. protein, for example, antibodies or small molecules
that bind to SIRP.alpha. and prevent interaction between CD47 and
SIRP.alpha., are administered to a patient, causing the clearance
of cancer cells via phagocytosis. The therapeutic agent that binds
to the SIRP.alpha. protein is combined with a therapeutic agent
such as an antibody, a chemical small molecule or biologic drug
which is directed against one or more additional cellular targets
selected from CD47 (Cluster of Differentiation 47), CD70 (Cluster
of Differentiation 70), CD200 (OX-2 membrane glycoprotein, Cluster
of Differentiation 200), CD154 (Cluster of Differentiation 154,
CD40L, CD40 ligand, Cluster of Differentiation 40 ligand), CD223
(Lymphocyte-activation gene 3, LAG3, Cluster of Differentiation
223), KIR (Killer-cell immunoglobulin-like receptors), GITR
(TNFRSF18, glucocorticoid-induced TNFR-related protein,
activation-inducible TNFR family receptor, AITR, Tumor necrosis
factor receptor superfamily member 18), CD20 (Cluster of
Differentiation 20), CD28 (Cluster of Differentiation 28), CD40
(Cluster of Differentiation 40, Bp50, CDW40, TNFRSF5, Tumor
necrosis factor receptor superfamily member 5, p50), CD86 (B7-2,
Cluster of Differentiation 86), CD160 (Cluster of Differentiation
160, BY55, NK1, NK28), CD258 (LIGHT, Cluster of Differentiation
258, Tumor necrosis factor ligand superfamily member 14, TNFSF14,
herpesvirus entry mediator ligand (HVEM-L), CD270 (HVEM, Tumor
necrosis factor receptor superfamily member 14, herpesvirus entry
mediator, Cluster of Differentiation 270, LIGHTR, HVEA), CD275
(ICOSL, ICOS ligand, Inducible T-cell co-stimulator ligand, Cluster
of Differentiation 275), CD276 (B7-H3, B7 homolog 3, Cluster of
Differentiation 276), OX40L (0X40 Ligand), B7-H4 (B7 homolog 4,
VTCN1, V-set domain-containing T-cell activation inhibitor 1),
GITRL (Glucocorticoid-induced tumor necrosis factor
receptor-ligand, glucocorticoid-induced TNFR-ligand), 4-1BBL (4-1BB
ligand), CD3 (Cluster of Differentiation 3, T3D), CD25 (IL2Ra,
Cluster of Differentiation 25, Interleukin-2 Receptor a chain, IL-2
Receptor a chain), CD48 (Cluster of Differentiation 48,
B-lymphocyte activation marker, BLAST-1, signaling lymphocytic
activation molecule 2, SLAMF2), CD66a (Ceacam-1, Carcinoembryonic
antigen-related cell adhesion molecule 1, biliary glycoprotein,
BGP, BGP1, BGPI, Cluster of Differentiation 66a), CD80 (B7-1,
Cluster of Differentiation 80), CD94 (Cluster of Differentiation
94), NKG2A (Natural killer group 2A, killer cell lectin-like
receptor subfamily D member 1, KLRD1), CD96 (Cluster of
Differentiation 96, TActILE, T-cell activation increased late
expression), CD112 (PVRL2, nectin, Poliovirus receptor-related 2,
herpesvirus entry mediator B, HVEB, nectin-2, Cluster of
Differentiation 112), CD115 (CSF1R, Colony stimulating factor 1
receptor, macrophage colony-stimulating factor receptor, M-CSFR,
Cluster of Differentiation 115), CD205 (DEC-205, LY75, Lymphocyte
antigen 75, Cluster of Differentiation 205), CD226 (DNAM1, Cluster
of Differentiation 226, DNAX Accessory Molecule-1, PTA1, platelet
and T-cell activation antigen 1), CD244 (Cluster of Differentiation
244, Natural killer cell receptor 2B4), CD262 (DRS, TrailR2,
TRAIL-R2, Tumor necrosis factor receptor superfamily member 10b,
TNFRSF10B, Cluster of Differentiation 262, KILLER, TRICK2, TRICKB,
ZTNFR9, TRICK2A, TRICK2B), CD284 (Toll-like Receptor-4, TLR4,
Cluster of Differentiation 284), CD288 (Toll-like Receptor-8, TLR8,
Cluster of Differentiation 288), Leukemia Inhibitor Factor (LIF),
TNFSF15 (Tumor necrosis factor superfamily member 15, Vascular
endothelial growth inhibitor, VEGI, TL1A), TDO2 (Tryptophan
2,3-dioxygenase, TPH2, TRPO), IGF-1R (Type 1 Insulin-like Growth
Factor), GD2 (Disialoganglioside 2), TMIGD2 (Transmembrane and
immunoglobulin domain-containing protein 2), RGMB (RGM domain
family, member B), VISTA (V-domain immunoglobulin-containing
suppressor of T-cell activation, B7-H5, B7 homolog 5), BTNL2
(Butyrophilin-like protein 2), Btn (Butyrophilin family), TIGIT
(T-cell Immunoreceptor with Ig and ITIM domains, Vstm3, WUCAM),
Siglecs (Sialic acid binding Ig-like lectins), i.e., SIGLEC-15,
Neurophilin, VEGFR (Vascular endothelial growth factor receptor),
ILT family (LIRs, immunoglobulin-like transcript family, leukocyte
immunoglobulin-like receptors), NKG families (Natural killer group
families, C-type lectin transmembrane receptors), MICA (MHC class I
polypeptide-related sequence A), TGF.beta. (Transforming growth
factor (3), STING pathway (Stimulator of interferon gene pathway),
Arginase (Arginine amidinase, canavanase, L-arginase, arginine
transamidinase), EGFRvIII (Epidermal growth factor receptor variant
III), and HHLA2 (B7-H7, B7y, HERV-H LTR-associating protein 2, B7
homolog 7), inhibitors of PD-1 (Programmed cell death protein 1,
PD-1, CD279, Cluster of Differentiation 279), PD-L1 (B7-H1, B7
homolog 1, Programmed death-ligand 1, CD274, cluster of
Differentiation 274), PD-L2 (B7-DC, Programmed cell death 1 ligand
2, PDCD1LG2, CD273, Cluster of Differentiation 273), CTLA-4
(Cytotoxic T-lymphocyte-associated protein 4, CD152, Cluster of
Differentiation 152), BTLA (B- and T-lymphocyte attenuator, CD272,
Cluster of Differentiation 272), Indoleamine 2,3-dioxygenase (IDO,
IDO1), TIM3 (HAVCR2, Hepatitis A virus cellular receptor 2, T-cell
immunoglobulin mucin-3, KIM-3, Kidney injury molecule 3, TIMD-3,
T-cell immunoglobulin mucin-domain 3), A2A adenosine receptor (ADO
receptor), CD39 (ectonucleoside triphosphate diphosphohydrolase-1,
Cluster of Differentiation 39, ENTPD1), and CD73
(Ecto-5'-nucleotidase, 5'-nucleotidase, 5'-NT, Cluster of
Differentiation 73), CD27 (Cluster of Differentiation 27), ICOS
(CD278, Cluster of Differentiation 278, Inducible T-cell
Co-stimulator), CD137 (4-1BB, Cluster of Differentiation 137, tumor
necrosis factor receptor superfamily member 9, TNFRSF9), OX40
(CD134, Cluster of Differentiation 134), TNF SF25 (Tumor necrosis
factor receptor superfamily member 25), IL-10 (Interleukin-10,
human cytokine synthesis inhibitory factor, CSIF), and
Galectins.
[0229] ERBITUX.RTM. (cetuximab, Bristol-Meyers Squibb) is an
example of an approved recombinant, human/mouse chimeric monoclonal
antibody that binds specifically to the extracellular domain of the
human epidermal growth factor receptor (EGFR).
[0230] RITUXAN.RTM. (rituximab, Biogen IDEC/Genentech) is an
example of an approved anti-CD20 antibody.
[0231] YERVOY.RTM. (ipilimumab; Bristol-Meyers Squibb) is an
example of an approved anti-CTLA-4 antibody.
[0232] KEYTRUDA.RTM. (pembrolizumab; Merck) and OPDIVO.RTM.
(nivolumab; Bristol-Meyers Squibb Company) are examples of approved
anti-PD-1 antibodies.
[0233] TECENTRIQ.TM. (atezolizumab; Roche) is an example of an
approved anti-PD-L1 antibody.
[0234] BAVENCIO.TM. (avelumab; Merck KGaA and Pfizer and Eli Lilly
and Company) is an example of an approved anti-PD-L1 antibody.
[0235] IMFINZI.TM. (Durvalumab; Medimmune/AstraZeneca) is an
example of an approved anti-PD-L1 antibody.
[0236] The Examples illustrate various embodiments of the present
disclosure, but they should not be considered as limiting the
disclosure to only these particularly disclosed embodiments.
EXAMPLES
Example 1
TABLE-US-00001 [0237] Amino Acid Sequences Light Chain CDRs LCDR1
LCDR2 LCDR3 SEQ ID NO: 1 RASSGVNYMY SEQ ID NO: 2 YTS1LAP SEQ ID NO:
3 QQFTSSPYT SEQ ID NO: 4 RASQSIGTSIH SEQ ID NO: 5 YGSESIS SEQ ID
NO: 6 QQSNTWPLT SEQ ID NO: 7 SASSIIGSDFLH SEQ ID NO: 8 RTSILAS SEQ
ID NO: 9 QQGSGLPLT SEQ ID NO: 10 KASQDINSHLS SEQ ID NO: 11 RANRLAD
SEQ ID NO: 12 LQYDEFPYT SEQ ID NO: 13 SASSSVSYMY SEQ ID NO: 14
LTSNLAS SEQ ID NO: 15 QQWSGNPFT SEQ ID NO: 16 RASENIYSYLT SEQ ID
NO: 17 NAKTLAE SEQ ID NO: 18 QHHYGSPRT SEQ ID NO: 19 SASSSISSNFLH
SEQ ID NO: 20 RTSILAS SEQ ID NO: 21 QQGSGLPLT SEQ ID NO: 22 SSVSY
SEQ ID NO: 23 DTS SEQ ID NO: 24 QQWSSFPWT SEQ ID NO: 25 EDIYDR SEQ
ID NO: 26 GTA SEQ ID NO: 27 QQYWTTPWT SEQ ID NO: 28 SSVNY SEQ ID
NO: 29 YTS SEQ ID NO: 30 QQFTSSPFT SEQ ID NO: 31 RANRLAT SEQ ID NO:
32 QQYDEFPYT Heavy Chain CDRs HCDR1 HCDR2 HCDR3 SEQ ID NO: 33 KYWIE
SEQ ID NO: 34 ELPGSVITNYNEKFKG SEQ ID NO: 35 WGLYDSDDGVDY SEQ ID
NO: 36 GCTMS SEQ ID NO: 37 YISNGGDITYYPDTVKG SEQ ID NO: 38
LDGYYYAMDF SEQ ID NO: 39 SYVMH SEQ ID NO: 40 YINPYNDGPKYNEKFKG SEQ
ID NO: 41 WDYFNSASGFAF SEQ ID NO: 42 DYFLN SEQ ID NO: 43
RINPYNGDSFINQNFRD SEQ ID NO: 44 GGYDGYFIAYFDY SEQ ID NO: 45 SYTMH
SEQ ID NO: 46 YINPTIGYTEYNQKFKD SEQ ID NO: 47 LVITSVLGRAMDY SEQ ID
NO: 48 DYGVN SEQ ID NO: 49 WVNTNTRESTYVEDFKG SEQ ID NO: 50
GAYDAYYYYYGMDY SEQ ID NO: 51 TYVMH SEQ ID NO: 52 YINPNNDGPNYNEKFKG
SEQ ID NO: 53 WDSYNSAAGFAY SEQ ID NO: 54 GFTLSTYT SEQ ID NO: 55
ITSGDTYT SEQ ID NO: 56 TRDRPLFH SEQ ID NO: 57 GYTFTDYE SEQ ID NO:
58 IHPGSGGT SEQ ID NO: 59 TRAVSGYYAMDY SEQ ID NO: 60 GYTFSNYL SEQ
ID NO: 61 IYPGDNNT SEQ ID NO: 62 AGGTDYDGFAN SEQ ID NO: 63
ARAVSGYYAMDY Murine Light Chain (V.sub.L) Variable Domain Sequences
and Human Light Chain (V.sub.L) Variable Domain Sequences SEQ ID
NO: 64
ENVLTQSPAIMSASLGEKVTMSCRASSGVNYMYWYQQKSDASPKLLIYYTSILAPGVPARFSGSGSG
NSYSLTISSMEGEDAATYYCQQFTSSPYTFGGGTKLEIK SEQ ID NO: 65
DILLTQSPAILSVSPGERVSFSCRASQSIGTSIHWYQQRTNGSPRLLIKYGSESISGIPSRFSGSGSGTDFT
LSINSVESEDIADYYCQQSNTWPLTFGDGTKLELK SEQ ID NO: 66
EIVLTQSPTTMAASPGEKITIICSASSIIGSDFLHWYQQRPGFSPKFLIYRTS1LASGVPTRFTGSGSGTSY
SLTIGTMEAEDVATYYCQQGSGLPLTFGSGTKLEMK SEQ ID NO: 67
DIKLTQSQSSMYSSLGQRVTITCKASQDINSHLSWFQEKPGKSPKTLIYRANRLADGVPSRFSGSGSGQ
DYFLTISSLEYEDVGIYYCLQYDEFPYTFGGGTKLEIK SEQ ID NO: 68
QIVLTQSPALMSASPGEKVTMTCSASSSVSYMYWFQQKPRSSPKPWIYLTSNLASGVPARFSGSGSGT
SYSLTISSMEAEDAATYYCQQWSGNPFTFGSGTKLEIK SEQ ID NO: 69
DIQMTQSPASLSASVGETVTITCRASENIYSYLTWYKQKQGKSPQLLVYNAKTLAEGVPSRFSGSGSG
TQFSLKINSLQPEDFGSYYCQHHYGSPRTFGGGTKLEIK SEQ ID NO: 70
EIVLTQSPTTMAASPGEKITIICSASSSISSNFLHWYQQKPGFSPRFLIYRTSILASGVPTRFSGSGSGTSY
SLTIDTMEAEDVATYYCQQGSGLPLTFGSGTKLEIK SEQ ID NO: 71
QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDTSNLASGVPVRFSGSGSGTS
YSLTISRMEAEDAATYYCQQWSSFPWTFGGGTKLEIK SEQ ID NO: 72
DIQMTQSSSSFSGSLGDRLTINCKASEDIYDRVAWYQQKPGNAPRLLISGTASLETGVLSRFSGSGSGK
DYTLSINGLQAEDVATYYCQQYWTTPWTFGGGTKLEIK SEQ ID NO: 73
ENVLTQSPAIMSASLGEKVTMSCRASSSVNYMYWYQQKSDASPKLWIYYTSKLAPGVPARFSGSGSG
NSYSLTISSMEGEDAATYYCQQFTSSPFTFGSGTKLEIK SEQ ID NO: 74
DIQMTQSPSSLSASVGDRVTITCKASQDINSHLSWYQQKPGKAPKLLIYRANRLATGVPSRFSGSGSGT
DFTFTISSLQPEDIATYYCLQYDEFPYTFGGGTKLEIK SEQ ID NO: 75
DIQMTQSPSSLSASVGDRVTITCKASQDINSHLSWYQQKPGKAPKLLIYRANRLATGVPSRFSGSGSGT
DFTFTISSLEYEDIATYYCLQYDEFPYTFGGGTKLEIK SEQ ID NO: 76
DIQMTQSPSSLSASVGDRVTITCKASQDINSHLSWYQQKPGKAPKLLIYRANRLATGVPSRFSGSGSGT
DFTFTISSLQPEDIATYYCQQYDEFPYTFGGGTKLEIK SEQ ID NO: 77
DIKMTQSPSSMYASLGQRVTITCKASQDINSHLSWFQEKPGKSPKTLIYRANRLADGVPSRFSGSGSG
QDYFLTISSLEYEDVGIYYCLQYDEFPYTFGGGTKLEIK SEQ ID NO: 78
DIQMTQSPSSLSASVGDRVTITCKASEDIYDRVAWYQQKPGKAPKLLIYGTASLETGVPSRFSGSGSGT
DFTFTISSLQPEDIATYYCQQYWTTPWTFGGGTKVEIK SEQ ID NO: 79
DIQMTQSPSSLSASVGDRVTITCKASEDIYDRVAWYQQKPGKAPKLLIYGTASLETGVPSRFSGSGSGT
DFTLTISSLQPEDFATYYCQQYWTTPWTFGGGTKVEIK SEQ ID NO: 80
DIQMTQSPSSLSASVGDRVTITCKASEDIYDRVAWYQQKPGKAPKLLIYGTASLETGVLSRFSGSGSG
TDFTLTISSLQAEDFATYYCQQYWTTPWTFGGGTKVEIK Murine Heavy Chain
(V.sub.H) Variable Domain Sequences and Human Heavy Chain (V.sub.H)
Variable Domain Sequences SEQ ID NO: 81
QVQLQQSGAELMKPGASVKISCKATGYSFTKYWIEWVKQRPGHGLEWIGHLPGSVITNYNEKFKGK
ATFTADTSSNTVYMQLSSLTSEDSAVYYCTKWGLYDSDDGVDYWGQGTTLTVSS SEQ ID NO:
82
EVKLVESGGGLVQPGGSLKLSCAASGFSFSGCTMSWIRQTPERRLEWVAYISNGGDITYYPDTVKGRF
TISRDNAKNSLYLQMSSLKSEDTAMYYCARLDGYYYAMDFWGQGTSVTVSS SEQ ID NO: 83
EVQLQQSGPEVVKPGASVKMSCKASGYTFTSYVMHWVKQKPGQGLEWIGYINPYNDGPKYNEKFKG
KATLTSDKSSSTAYMELSSLTSEDSAVYFCARWDYFNSASGFAFWGQGTLVTVSA SEQ ID NO:
84
EVQLQQSGPDLVKPGASVKISCKASGYSFTDYFLNWVKQSHGKSLEWIGRINPYNGDSFINQNFRDKA
TLTVDKSSTTAHMDLLSLTSEDSAIYYCGRGGYDGYFIAYFDYWGQGSLVTVSA SEQ ID NO:
85
QVQLQQSAAELARPGASVKMSCKASGYTFTSYTMHWVKQRPGQGLEWIGYINPTIGYTEYNQKFKD
KTTLTADKSSSTAYMQLSSLTSEDSAVYYCVRLVITSVLGRAMDYWGQGTSVTVSS SEQ ID NO:
86
QIQLVQSGPELKKPGETVKISCKASGYTFTDYGVNWVKQGPGKDLQWMGWVNTNTRESTYVEDFKG
RFAFSLETSASTAYLQINNLKNEDSSTYFCARGAYDAYYYYYGMDYWGQGTSVTVSS SEQ ID
NO: 87
EVQLQQSGPELVKPGASVKMSCRASGYTFSTYVMHWIKHRPGQGLEWIGYINPNNDGPNYNEKFKG
KATLTSDISSSTAYMELSSLTSEDSAVYFCSRWDSYNSAAGFAYWGHGTLVTVSA SEQ ID NO:
88
EVQLQESGGGLVKPGGSLKLSCAASGFTLSTYTMSWVRQTPEKRLEWVAIITSGDTYTYYPDSVKGRF
TISRDNAKNTLYLQMSSLKSEDTGMYYCTRDRPLFHWGQGTTLTVST SEQ ID NO: 89
EVQLQESGAELVRPGASVKLSCKALGYTFTDYEIHWVKETPVYGLEWIGDIHPGSGGTANNQKFKGK
ATLTADKSSNTAYMELSSLTSEDSAVYYCTRAVSGYYAMDYWGQGTSVTVSS SEQ ID NO: 90
EVQLQESGAELVRPGTSVKMSCKAAGYTFSNYLIGWIKQRPGHGLEWIGDIYPGDNNTNYNEKFRVK
ATLTADTSSNTAYMHLTSLTSEDSAIYYCAGGTDYDGFANWGQGTLVTVSA SEQ ID NO: 91
QVQLVQSGAEVKKPGASVKVSCKASGYSFTDYFLNWVRQAPGQGLEWMGRINPYNGDSFINQNFRD
RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGGYDGYFIAYFDYWGAGTTVTVSS SEQ ID NO:
92
QVQLVQSGAEVKKPGSSVKVSCKASGYSFTDYFLNWVRQAPGQGLEWMGRINPYNGDSFINQNFRD
RVTITADKSTSTAYMELSSLRSEDTAVYYCARGGYDGYFIAYFDYWGAGTTVTVSS SEQ ID NO:
93
EVQLVQSGAEVKKPGESLKISCKGSGYSFTDYFLNWVRQNfPGKGLEWMGRINPYNGDSFINQNFRDQ
VTISADKSISTAYLQWSSLKASDTAMYYCARGGYDGYFIAYFDYWGAGTTVTVSS SEQ ID NO:
94
QVQLVQSGAEVKKPGASVKVSCKASGYSFTDYFLNWVRQAPGQGLEWMGRINPYNGDSFINQNFRD
RVTMTVDTSTSTVYMELSSLRSEDTAVYYCARGGYDGYFIAYFDYWGAGTTVTVSS SEQ ID NO:
95
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYEIHWVRQAPGQGLEWMGDIHPGSGGTANNQKFK
GRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARAVSGYYAMDYWGQGTLVTVSS SEQ ID NO:
96
QVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYEIHWVRQAPGQGLEWMGDIHPGSGGTANNQKFKG
RVTITADESTSTAYMELSSLRSEDTAVYYCARAVSGYYAMDYWGQGTLVTVSS SEQ ID NO: 97
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYEIHWVRQAPGQGLEWMGDIHPGSGGTANNQKFK
GRVTMTADTSTSTVYMELSSLRSEDTAVYYCTRAVSGYYAMDYWGQGTLVTVSS Murine Light
Chain (LC) Sequences and Human Light Chain (LC) Sequences SEQ ID
NO: 98
ENVLTQSPAIIVISASLGEKVTMSCRASSGVNYMYWYQQKSDASPKWYYTSILAPGVPARFSGSGSG
NSYSLTISSMEGEDAATYYCQQFTSSPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLN
NFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTS
PIVKSFNRNEC SEQ ID NO: 99
DILLTQSPAILSVSPGERVSFSCRASQSIGTSIHWYQQRTNGSPRLLIKYGSESISGIPSRFSGSGSGTDFT
LSINSVESEDIADYYCQQSNTWPLTFGDGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYP
KDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKS
FNRNEC SEQ ID NO: 100
EIVLTQSPTTMAASPGEKITIICSASSIIGSDFLHWYQQRPGFSPKFLIYRTSILASGVPTRFTGSGSGTSY
SLTIGTMEAEDVATYYCQQGSGLPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNF
YPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIV
KSFNRNEC SEQ ID NO: 101
DIQMTQSPSSLSASVGDRVTITCKASQDINSHLSWYQQKPGKAPKLLIYRANRLATGVPSRFSGSGSG
TDFTFTISSLQPEDIATYYCLQYDEFPYTFGGGTKLEKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNN
FYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
VTKSFNRGEC SEQ ID NO: 102
DIQMTQSPSSLSASVGDRVTITCKASQDINSHLSWYQQKPGKAPKLLIYRANRLATGVPSRFSGSGSG
TDFTFTISSLEYEDIATYYCLQYDEFPYTFGGGTKLEKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNN
FYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP
VTKSFNRGEC SEQ ID NO: 103
DIQMTQSPSSLSASVGDRVTITCKASQDINSHLSWYQQKPGKAPKLLIYRANRLATGVPSRFSGSGSG
TDFTFTISSLQPEDIATYYCQQYDEFPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLN
NFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSS
PVTKSFNRGEC SEQ ID NO: 104
DIKMTQSPSSMYASLGQRVTITCKASQDINSHLSWFQEKPGKSPKTLIYRANRLADGVPSRFSGSGSG
QDYFLTISSLEYEDVGIYYCLQYDEFPYTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLN
NFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSS
PVTKSFNRGEC SEQ ID NO: 105
DIQMTQSPSSLSASVGDRVTITCKASEDIYDRVAWYQQKPGKAPKLLIYGTASLETGVPSRFSGSGSG
TDFTFTISSLQPEDIATYYCQQYWTTPWTFGGGTKVEKRTVAAPSVFIFPPSDEQLKSGTASVVCLLN
NFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSS
PVTKSFNRGEC SEQ ID NO: 106
DIQMTQSPSSLSASVGDRVTITCKASEDIYDRVAWYQQKPGKAPKLLIYGTASLETGVPSRFSGSGSG
TDFTLTISSLQPEDFATYYCQQYWTTPWTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLL
NNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL
SSPVTKSFNRGEC SEQ ID NO: 107
DIQMTQSPSSLSASVGDRVTITCKASEDIYDRVAWYQQKPGKAPKLLIYGTASLETGVLSRFSGSGSG
TDFTLTISSLQAEDFATYYCQQYWTTPWTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLL
NNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL
SSPVTKSFNRGEC SEQ ID NO: 108
DIQMTQSSSSFSGSLGDRLTINCKASEDIYDRVAWYQQKPGNAPRLLISGTASLETGVLSRFSGSGSG
KDYTLSINGLQAEDVATYYCQQYWTTPWTFGGGTKLEKRTVAAPSVFIFPPSDEQLKSGTASVVCL
LNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQG
LSSPVTKSFNRGEC Murine Heavy Chain (HC) Sequences and Human Heavy
Chain (HC) Sequences SEQ ID
QVQLQQSGAELMKPGASVKISCKATGYSFTKYWIEWVKQRPGHGLEWIGEILPGSVITNYNEKFKGK
NO: 109
ATFTADTSSNTVYMQLSSLTSEDSAVYYCTKWGLYDSDDGVDYWGQGTTLTVSSAKTTPPSVYPLA
PGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETV
TCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEV
QFSWFVDDVEVHTAQTQPREEQFNSTERSVSELPIMHQDWLNGKEEKCRVNSAAFPAPIEKTISKTKG
RPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYS
KLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK SEQ ID
EVKLVESGGGLVQPGGSLKLSCAASGFSFSGCTMSWIRQTPERRLEWVAYISNGGDITYYPDTVKGR-
F NO: 110
TISRDNAKNSLYLQMSSLKSEDTAMYYCARLDGYYYAMDFWGQGTSVTVSSAKTTPPSVYPLAPGS
AAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCN
VAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFS
WFVDDVEVHTAQTQPREEQFNSTERSVSELPIMHQDWLNGKEEKCRVNSAAFPAPIEKTISKTKGRPK
APQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLN
VQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK SEQ ID
EVQLQQSGPEVVKPGASVKMSCKASGYTFTSYVMHWVKQKPGQGLEWIGYINPYNDGPKYNEKEK
NO: 111
GKATLTSDKSSSTAYMELSSLTSEDSAVYFCARWDYFNSASGFAFWGQGTLVTVSAAKTTPPSVYP-
L
APGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSET
VTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPE
VQFSWFVDDVEVHTAQTQPREEQFNSTERSVSELPIMHQDWLNGKEEKCRVNSAAFPAPIEKTISKTK
GRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVY
SKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK SEQ ID
QVQLVQSGAEVKKPGASVKVSCKASGYSFTDYFLNWVRQAPGQGLEWMGRINPYNGDSFINQNFRD
NO: 112
RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGGYDGYFIAYFDYWGAGTTVTVSSASTKGPSVFP-
L
APCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKT
YTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLEPPKPKDTLMISRTPEVTCVVVDVSQ
EDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEK
TISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG
SFELYSRLTVDKSRWQEGNVESCSVMHEALHNHYTQKSLSLSLGK SEQ ID
QVQLVQSGAEVKKPGSSVKVSCKASGYSFTDYFLNWVRQAPGQGLEWMGRINPYNGDSFINQNFRD
NO: 113
RVTITADKSTSTAYMELSSLRSEDTAVYYCARGGYDGYFIAYFDYWGAGTTVTVSSASTKGPSVFP-
L
APCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKT
YTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQ
EDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEK
TISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG
SFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
EVQLVQSGAEVKKPGESLKISCKGSGYSFTDYFLNWVRQ1VfPGKGLEWMGRINPYNGDSFINQNFRD
SEQ ID
QVTISADKSISTAYLQWSSLKASDTAMYYCARGGYDGYFIAYFDYWGAGTTVTVSSASTKGPSVFPL
NO: 114
APCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLG-
TKT
YTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQ
EDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEK
TISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG
SFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK SEQ ID
QVQLVQSGAEVKKPGASVKVSCKASGYSFTDYFLNWVRQAPGQGLEWMGRINPYNGDSFINQNFRD
NO: 115
RVTMTVDTSTSTVYMELSSLRSEDTAVYYCARGGYDGYFIAYFDYWGAGTTVTVSSASTKGPSVFP-
L
APCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKT
YTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLEPPKPKDTLMISRTPEVTCVVVDVSQ
EDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEK
TISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG
SFELYSRLTVDKSRWQEGNVESCSVMHEALHNHYTQKSLSLSLGK SEQ ID
EVQLQQSGPDLVKPGASVKISCKASGYSFTDYFLNWVKQSHGKSLEWIGRINPYNGDSFINQNFRDK
NO: 116
ATLTVDKSSTTAHMDLLSLTSEDSAIYYCGRGGYDGYFIAYFDYWGQGSLVTVSAASTKGPSVFPL-
A
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTY
TCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLEPPKPKDTLMISRTPEVTCVVVDVSQE
DPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKT
ISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS
FFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK SEQ ID
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYEIHWVRQAPGQGLEWMGDIHPGSGGTANNQKFK
NO: 117
GRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARAVSGYYAMDYWGQGTLVTVSSASTKGPSVFPLA
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTY
TCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLEPPKPKDTLMISRTPEVTCVVVDVSQE
DPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKT
ISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS
FFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK SEQ ID
QVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYEIHWVRQAPGQGLEWMGDIHPGSGGTANNQKFK
NO: 118
GRVTITADESTSTAYMELSSLRSEDTAVYYCARAVSGYYAMDYWGQGTLVTVSSASTKGPSVFPLA-
P
CSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYT
CNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLEPPKPKDTLMISRTPEVTCVVVDVSQED
PEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTI
SKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS
FFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYEIHWVRQAPGQGLEWMGDIHPGSGGTANNQKFK
GRVTMTADTSTSTVYMELSSLRSEDTAVYYCTRAVSGYYAMDYWGQGTLVTVSSASTKGPSVFPLA
PCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTY
SEQ ID
TCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQ-
E NO: 119
DPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKT
ISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS
FFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
EVQLQESGAELVRPGASVKLSCKALGYTFTDYEIHWVKETPVYGLEWIGDIHPGSGGTANNQKFKGK
ATLTADKSSNTAYMELSSLTSEDSAVYYCTRAVSGYYAMDYWGQGTSVTVSSASTKGPSVFPLAPCS
RSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTC
SEQ ID
NVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQED-
P NO: 120
EVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTIS
KAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF
FLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK SIRP.alpha. and
SIRP.gamma. Sequences SEQ ID SIRP.alpha.
EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPRVTTVS
NO: 121
ESTKRENMDFSISISNITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPSAPVVSGPAAR
ATPQHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDV
HSQVICEVAHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYPQRLQ
LTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKS
HDLKVSAHPKEQGSNTAAENTGSNERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTS
STRLHEPEKNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQPASEDTLT
YADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK SEQ ID
EEELQMIQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTT NO:
122 SIRP.gamma.
VSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSAPVVLG
PAARTTPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPTGQSVAYSIRSTARVVLD
PWDVRSQVICEVAHVTLQGDPLRGTANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRKFY
PQSLQLTWSENGNVCQRETASTLTENKDGTYNWTSWFLVNISDQRDDVVLTCQVKHDGQL
AVSKRLALEVTVHQKDQSSDATPGPASSLTALLLIAVLLGPIYVPWKQKT Human IgG Fc
Sequences Human Fc IgG1
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SEQ
ID NO: 123
SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFP
PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV
LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM
HEALHNHYTQKSLSLSPGK Human Fe IgG1-
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
N297Q
SLSSVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFP SEQ
ID NO: 124
PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYQSTYRVVSV
LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTC
LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM
HEALHNHYTQKSLSLSPGK Human Fc-IgG2
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SEQ
ID NO: 125
SLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPPKP
KDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTV
VHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVK
GFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEA
LHNHYTQKSLSLSPGK Human Fc-IgG3
ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SEQ
ID NO: 126
SLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCP
RCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCV
VVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKC
KVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESS
GQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPG K
Human Fc-IgG4
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SEQ
ID NO: 127
SLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSVFLFPPKP
KDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTV
LHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVK
GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVESCSVMHEAL
HNHYTQKSLSLSLG Human Fc-IgG4
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
S228P
SLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKP
SEQ ID NO: 128
KDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTV
LHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVK
GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVESCSVMHEAL
HNHYTQKSLSLSLG Human Fc-IgG4 PE
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SEQ
ID NO: 129
SLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFEGGPSVFLFPPKP
KDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTV
LHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVK
GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVESCSVMHEAL
HNHYTQKSLSLSLGK Human Fc-IgG4 PE'
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SEQ
ID NO: 130
SLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFEGGPSVFLFPPKP
KDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTV
LHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVK
GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVESCSVMHEAL
HNHYTQKSLSLSLG Human kappa LC
RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSK SEQ
ID NO: 131 DSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Example 2
Binding of SIRP Monoclonal Antibodies to SIRP.alpha.
[0238] The binding of anti-SIRP monoclonal antibodies (mAbs) of the
present disclosure to SIRP alpha (SIRP.alpha.) was determined by
solid phase ELISA using an Fc tagged human SIRP alpha. Binding by
soluble anti-SIRP antibodies was measured in vitro.
[0239] Fc tagged human SIRP.alpha. (ACRO #SIG-H5251, genotype
variant 1) is adsorbed to high-binding microtiter plates at a
concentration of 1 .mu.g/ml diluted in phosphate buffered saline
(PBS) overnight at 4.degree. C. The coating solution is removed,
the wells are washed and then blocked with 75% casein in PBS
containing 0.5% Tween 20 (PBST) for 60 minutes at room temperature
while shaking. Blocking solution is removed, the wells are washed
and incubated for 60 minutes at room temperature while shaking with
either murine or human anti-SIRP mAbs diluted in PBST at a starting
concentration of 30 .mu.g/ml and reducing the concentration in
3-fold serial dilutions. Wells are washed three times with PBST and
incubated for 60 minutes at room temperature while shaking with an
HRP-labeled donkey anti-mouse or anti-human secondary antibody
(Jackson ImmunoResearch Laboratories) diluted 1:10,000 in PBST. The
wells are washed and then incubated with peroxidase substrate and
the absorbance at 450 nm measured. The apparent affinities were
calculated using a non-linear fit model (GraphPad Prism).
[0240] As shown in Table 1, all soluble anti-SIRP mAbs bound to
human SIRP.alpha. with apparent affinities in the picomolar to
nanomolar range. FIG. 1A-FIG. 1V demonstrate representative binding
curves for antibodies of the present disclosure.
TABLE-US-00002 TABLE 1 Binding of anti-SIRP Antibodies to human
SIRP.alpha.. Human SIRP.alpha. binding K.sub.d (pM) SIRP1 39 SIRP2
182 SIRP3 289 SIRP4 161 SIRP5 65 SIRP6 131 SIRP7 197 SIRP8 57 SIRP9
583 SIRP10 >10,000 SIRP11 194 SIRP12 165 SIRP13 1,565 SIRP14 565
SIRP15 608 SIRP16 >40,000 SIRP17 326 SIRP18 364 SIRP19
>19,000 SIRP20 157 SIRP21 274 SIRP22 >11,000 SIRP23 164
Example 3
Binding of Mouse Anti-SIRP mAbs to THP-1 Cells Expressing
SIRP.alpha.
[0241] Binding activity of hybridoma-derived mouse SIRP antibodies
SIRP1, SIRP2, and SIRP3 to THP-1 cells which express SIRP.alpha.,
but not SIRP.gamma., was determined by flow cytometry.
[0242] THP-1 cells were incubated for 60 min at 37.degree. C. with
increasing concentrations of the mAbs diluted in PBS, pH 7.2. Cells
were then washed with PBS and incubated for an additional hour with
Alexa Fluor-647 labeled donkey anti-mouse antibody (Jackson
ImmunoResearch Laboratories) in PBS. Cells were washed and binding
analyzed using a C6 Accuri Flow Cytometer (Becton Dickinson).
[0243] As shown in FIG. 2, all the antibodies bound to SIRP.alpha.
expressing THP-1 cells in a concentration-dependent manner.
Example 4
Binding of SIRP mAbs to SIRP.gamma.
[0244] The binding of anti-SIRP antibodies of the present
disclosure to SIRP gamma (SIRP.gamma.) was determined by ELISA
using an Fc tagged human SIRP.gamma.. Binding by soluble anti-SIRP
antibodies was measured in vitro.
[0245] Fc tagged human SIRP.gamma. (ACRO #SIG-H5253) is adsorbed to
high-binding microtiter plates at a concentration of 1 .mu.g/ml in
phosphate buffered saline (PBS) overnight at 4.degree. C. The
coating solution is removed, the wells are washed and then blocked
with 75% casein in PBS containing 0.5% Tween 20 (PBST) for 60
minutes at room temperature while shaking. Blocking solution is
removed, the wells are washed and incubated for 60 minutes at room
temperature while shaking with anti-SIRP mAbs diluted in PBST at a
starting concentration of 30 .mu.g/ml and reducing the
concentration in 3-fold serial dilutions. Wells are washed three
times with PBST and incubated for 60 minutes at room temperature
while shaking with an HRP labeled donkey anti-mouse or anti-human
secondary antibody (Jackson ImmonResearch Laboratories) diluted
1:10,000 in PBST. The wells are washed and then incubated with
peroxidase substrate and the absorbance at 450 nm determined. The
apparent affinities were calculated using a non-linear fit model
(GraphPad Prism).
[0246] As shown in Table 2, the soluble anti-SIRP mAbs SIRP2,
SIRP3, SIRP4, SIRP5, SIRP6, SIRP7, SIRP9, SIRP10, SIRP11, SIRP12,
SIRP16, SIRP17, SIRP18, SIRP20, SIRP21 and SIRP23 bound to human
SIRP gamma with apparent affinities in the picomolar or nanomolar
range. Additionally, the anti-SIRP mAb SIRP1, SIRP8, SIRP13,
SIRP14, SIRP15, SIRP19, and SIRP22 did not appreciably bind human
SIRP gamma at mAb concentrations up to 30 .mu.g/ml. FIG. 3A-FIG. 3V
demonstrate representative binding curves derived from antibodies
of the present disclosure.
TABLE-US-00003 TABLE 2 Binding of anti-SIRP Antibodies to Human
SIRP.gamma.. Human SIRP.gamma. binding K.sub.d (pM) SIRP1 *NB SIRP2
734 SIRP3 170 SIRP4 274 SIRP5 126 SIRP6 183 SIRP7 99 SIRP8 *NB
SIRP9 510 SIRP10 >10,000 SIRP11 7,223 SIRP12 >12,000 SIRP13
*NB SIRP14 *NB SIRP15 >14,000 SIRP16 *NB SIRP17 >15,000
SIRP18 >34,000 SIRP19 *NB SIRP20 >29,000 SIRP21 >21,000
SIRP22 *NB SIRP23 225 *NB--no binding detected at mAb concentration
up to 30 .mu.g/ml
Example 5
Binding of Mouse mAbs to Jurkat T Cells Expressing SIRP.gamma.
[0247] Binding activity of mouse hybridoma-derived SIRP mAbs to
Jurkat cells which express SIRP.gamma., but not SIRP.alpha., was
determined by flow cytometry.
[0248] Jurkat cells were incubated for 60 min at 37.degree. C., 5%
CO.sub.2 with increasing concentrations of the anti-SIRP mAbs
diluted in phosphate buffered saline (PBS), pH 7.2. Cells were then
washed with PBS and incubated for an additional hour with Alexa
Fluor-647 labeled donkey anti-mouse antibody (Jackson
ImmunoResearch Laboratories) in PBS. Cells were washed and binding
analyzed using a C6 Accuri Flow Cytometer (Becton Dickinson).
Alternatively, the cells were incubated for 1 h at 37.degree. C.
with the saturating concentration of 10 .mu.g/ml of SIRP mAbs in
binding buffer containing 1 mM EDTA (Sigma Aldrich), 1% FBS
(Biowest) in PBS (Corning). The cells were then washed and stained
for 45 min under the same conditions with donkey anti-mouse IgG
fluorescein isothiocyanate (FITC)-linked secondary antibody
(Jackson ImmunoResearch Laboratories). The cells were then washed
and analyzed by flow cytometry (Attune, Life Technologies).
[0249] As shown in FIG. 4A, SIRP3 bound to SIRP.gamma. expressing
Jurkat cells whereas SIRP2 or SIRP1 exhibited no binding. In
addition, as shown in FIG. 4B, SIRP9 bound to Jurkat cells at a
concentration of 10 .mu.g/ml, comparable to KWAR-23 which has
previously been shown to bind to SIRP.gamma. whereas SIRP4
exhibited no binding to SIRP.gamma. on the Jurkat cells.
Example 6
Anti-SIRP mAbs Block CD47/SIRP.alpha. Binding
[0250] To assess the ability of anti-SIRP antibodies of the present
disclosure to block the binding of CD47 to SIRP.alpha. in vitro the
following method was employed using ELISA plates coated with
Histidine (HIS) tagged human SIRP.alpha..
[0251] HIS tagged human SIRP.alpha. (ACRO #SIG-H5225) is adsorbed
to high-binding microtiter plates at a concentration of 1 .mu.g/ml
diluted in PBS overnight at 4.degree. C. The coating solution is
removed, the wells are washed and then blocked with 75% casein in
PBS containing 0.5% Tween 20 (PBST) for 60 minutes at room
temperature while shaking. Blocking solution is removed, the wells
are washed and incubated for 60 minutes at room temperature while
shaking with anti-SIRP mAbs diluted in PBST at a starting
concentration of 30 .mu.g/ml and reducing the concentration by
3-fold serial dilutions. Wells are washed three times with PBST and
incubated for 60 minutes at room temperature while shaking with an
FC tagged human CD47 (ACRO #CD7-H5256) at a concentration of 250
ng/ml in PBST. Wells are washed three times with PBST and incubated
for 60 minutes at room temperature while shaking with an HRP
labeled donkey anti-mouse or anti-human secondary antibody (Jackson
ImmunoResearch Laboratories) diluted 1:20,000 in PBST. The wells
are washed and then incubated with peroxidase substrate and the
absorbance at 450 nm determined. The IC.sub.50 was calculated using
a non-linear fit model (GraphPad Prism).
[0252] As shown in Table 3, the soluble anti-SIRP mAbs SIRP2,
SIRP3, SIRP4, and SIRP7 block the binding of human SIRP.alpha. to
human CD47 with IC.sub.50 values in the nanomolar range. In
addition, the soluble anti-SIRP mAbs SIRP1, SIRP5, SIRP6, SIRP8,
and SIRP10 were unable to block the binding of human SIRP.alpha. to
human CD47 at mAb concentrations of up to 30 FIG. 5A-FIG. 5G
demonstrates representative inhibition curves derived from
antibodies of the present disclosure.
TABLE-US-00004 TABLE 3 Blocking of CD47/SIRP.alpha. Binding by
anti-SIRP Antibodies. SIRP.alpha. Blocking (IC.sub.50 nM) SIRP1 *NB
SIRP2 3 SIRP3 2.7 SIRP4 0.71 SIRP5 *NB SIRP6 *NB SIRP7 1.1 SIRP8
*NB SIRP10 *NB *NB--no blocking detected at mAb concentration of up
to 30 .mu.g/ml
Example 7
Anti-SIRP Monoclonal Antibodies Block CD47/SIRP.gamma. Binding
[0253] To assess the effect of anti-SIRP mAbs of the present
disclosure on binding of CD47 to SIRP.gamma. in vitro the following
method was employed using ELISA plates coated with HIS tagged human
CD47.
[0254] HIS tagged human CD47 (ACRO #CD7-H5227) is adsorbed to
high-binding microtiter plates at a concentration of 2 .mu.g/ml
diluted in PBS overnight at 4.degree. C. The coating solution is
removed, the wells are washed and then blocked with 75% casein in
PBS containing 0.5% Tween 20 (PBST) for 60 minutes at room
temperature while shaking. Blocking solution is removed, the wells
are washed and incubated for 60 minutes at room temperature while
shaking with anti-SIRP mAbs diluted in PBST at a starting
concentration of 30 .mu.g/ml and reducing the concentration in 3
fold serial dilutions and 0.5 .mu.g/ml of human SIRP.gamma. (ACRO
#SIG-H5253). Wells are washed three times with PBST and incubated
for 60 minutes at room temperature while shaking with an HRP
labeled donkey anti-mouse or anti-human secondary antibody (Jackson
ImmunoResearch Laboratories) diluted 1:20,000 in PBST. The wells
are washed and then incubated with peroxidase substrate and the
absorbance at 450 nm determined. The IC.sub.50 was calculated using
a non-linear fit model (GraphPad Prism).
[0255] As shown in Table 4, the soluble anti-SIRP mAbs SIRP2,
SIRP3, SIRP4, SIRP5, SIRP6, and SIRP7 block the binding of human
SIRP.gamma. to human CD47 with IC.sub.50 values in the nanomolar
range. In addition, the soluble anti-SIRP mAbs SIRP1, SIRP8, SIRP9,
and SIRP10 were unable to block the binding of human SIRP.gamma. to
human CD47 at mAb concentrations up to 30 .mu.g/ml. FIG. 6A-FIG. 6H
demonstrates representative inhibition curves derived from
antibodies of the present disclosure.
TABLE-US-00005 TABLE 4 Blocking of CD47/SIRP.gamma. Binding by
anti-SIRP Antibodies. SIRP.gamma. Blocking (IC.sub.50 nM) SIRP1 *NB
SIRP2 3.5 SIRP3 0.96 SIRP4 0.44 SIRP5 0.163 SIRP6 0.86 SIRP7 0.63
SIRP8 *NB SIRP9 *NB SIRP10 *NB *NB--no blocking detected at mAb
concentration up to 30 .mu.g/ml
Example 8
Anti-SIRP mAbs Induce Phagocytosis
[0256] To assess the effect of anti-SIRP mAbs on phagocytosis of
tumor cells by macrophages in vitro the following method was
employed using flow cytometry.
[0257] Human monocyte-derived macrophages were derived from
leukapheresis of healthy human peripheral blood and incubated in
AIM-V media (Life Technologies) supplemented with 50 ng/ml M-CSF
(Biolegend) for seven days. For the in vitro phagocytosis assay,
macrophages were re-plated at a concentration of 3.times.10.sup.4
cells per well in 100 .mu.l of AIM-V media supplemented with 50
ng/ml M-CSF in a 96-well plate and allowed to adhere for 24 hours.
Once the effector macrophages adhered to the culture dish, the
targeted human cancer cells (Jurkat) were labeled with 1 .mu.M
5(6)-Carboxyfluorescein diacetate N-succinimidyl ester (CFSE; Sigma
Aldrich) and added to the macrophage cultures at a concentration of
8.times.10.sup.4 cells in 100 .mu.l of AIM-V media without
supplements. Anti-SIRP mAbs were added at various concentrations,
FIG. 7A, or 10 .mu.g/ml of the antibodies, FIG. 7B, immediately
upon mixture of target and effector cells and allowed to incubate
at 37.degree. C. for 3 hours. After 3 hours, all non-phagocytosed
cells were removed, and the remaining cells washed three times with
PBS. Cells were then incubated in Accutase (Stemcell Technologies)
to detach macrophages, collected into microcentrifuge tubes, and
incubated in 100 ng of allophycocyanin (APC) labeled CD14
antibodies (BD biosciences) for 30 minutes, washed once, and
analyzed by flow cytometry (Attune, Life Technologies) for the
percentage of CD14.sup.+ cells that were also CFSE.sup.+,
indicating complete phagocytosis.
[0258] As shown in FIG. 7A and FIG. 7B, the soluble anti-SIRP mAbs
SIRP4, SIRP9, SIRP11, SIRP12, SIRP13, SIRP14, SIRP15, SIRP16,
SIRP17, SIRP18, SIRP19, SIRP20, SIRP21, SIRP22 and SIRP23 induced
phagocytosis of Jurkat cells by human macrophages as compared to a
murine IgG1 control antibody (Biolegend). In contrast, soluble
anti-SIRP mAbs SIRP1, SIRP2, SIRP3, SIRP7, SIRP8 and SIRP10 did not
induce the phagocytosis of Jurkat cells by human macrophages.
Example 9
Anti-SIRP mAbs Induce Phagocytosis when Combined with an Anti-CD47
Antibody
[0259] To assess the effect of anti-SIRP mAbs and anti-CD47 mAbs in
combination on inducing phagocytosis of tumor cells by macrophages
in vitro the following method was employed using flow
cytometry.
[0260] Human monocyte-derived macrophages were derived from
leukapheresis of healthy human peripheral blood and incubated in
AIM-V media (Life Technologies) supplemented with 50 ng/ml M-CSF
(Biolegend) for seven days. For the in vitro phagocytosis assay,
macrophages were re-plated at a concentration of 3.times.10.sup.4
cells per well in 100 .mu.l of AIM-V media supplemented with 50
ng/ml M-CSF in a 96-well plate and allowed to adhere for 24 hours.
Once the effector macrophages adhered to the culture dish, the
targeted human cancer cells (Jurkat) were labeled with 1 .mu.M
5(6)-Carboxyfluorescein diacetate N-succinimidyl ester (CFSE; Sigma
Aldrich) and added to the macrophage cultures at a concentration of
8.times.10.sup.4 cells in 100 .mu.l of AIM-V media without
supplements. Anti-SIRP mAbs alone, an anti-CD47 mAb (known to
induce phagocytosis) alone, or anti-SIRP and anti-CD47 mAbs
together were added at various concentrations immediately upon
mixture of target and effector cells and allowed to incubate at
37.degree. C. for 3 hours. After 3 hours, all non-phagocytosed
cells were removed, and the remaining cells washed three times with
PBS. Cells were then incubated in Accutase (Stemcell Technologies)
to detach macrophages, collected into microcentrifuge tubes, and
incubated in 100 ng of allophycocyanin (APC) labeled CD14
antibodies (BD biosciences) for 30 minutes, washed once, and
analyzed by flow cytometry (Attune, Life Technologies) for the
percentage of CD14.sup.+ cells that were also CFSE.sup.+ indicating
complete phagocytosis.
[0261] As shown in FIG. 8A-FIG. 8J, all soluble anti-SIRP mAbs
SIRP1, SIRP2, SIRP3, SIRP4, SIRP5, SIRP7, SIRP12, SIRP20, SIRP21
and SIRP22 increase phagocytosis of Jurkat cells by human
macrophages to a greater degree when combined with anti-CD47 mAbs
compared to either agent alone.
Example 10
Anti-SIRP mAbs Induce Phagocytosis in Combination with Rituxan
[0262] To assess the effect of anti-SIRP mAbs and anti-CD20 mAbs in
combination on inducing phagocytosis of tumor cells by macrophages
in vitro the following method was employed using flow
cytometry.
[0263] Human monocyte-derived macrophages were derived from
leukapheresis of healthy human peripheral blood and incubated in
AIM-V media (Life Technologies) supplemented with 50 ng/ml M-CSF
(Biolegend) for seven days. For the in vitro phagocytosis assay,
macrophages were re-plated at a concentration of 3.times.10.sup.4
cells per well in 100 .mu.l of AIM-V media supplemented with 50
ng/ml M-CSF in a 96-well plate and allowed to adhere for 24 hours.
Once the effector macrophages adhered to the culture dish, the
targeted human cancer cells (RAJI) were labeled with 1 .mu.M
5(6)-Carboxyfluorescein diacetate N-succinimidyl ester (CFSE; Sigma
Aldrich) and added to the macrophage cultures at a concentration of
8.times.10.sup.4 cells in 100 .mu.l of AIM-V media without
supplements. Anti-SIRP mAbs alone, an anti-CD20 mAb (Rituxan,
Roche) alone, or anti-SIRP and anti-CD20 mAbs together were added
at various concentrations immediately upon mixture of target and
effector cells and allowed to incubate at 37.degree. C. for 3
hours. After 3 hours, all non-phagocytosed cells were removed, and
the remaining cells washed three times with PBS. Cells were then
incubated in Accutase (Stemcell Technologies) to detach
macrophages, collected into microcentrifuge tubes, and incubated in
100 ng of allophycocyanin (APC) labeled CD14 antibodies (BD
biosciences) for 30 minutes, washed once, and analyzed by flow
cytometry (Attune, Life Technologies) for the percentage of
CD14.sup.+ cells that were also CFSE.sup.+ indicating complete
phagocytosis.
[0264] As shown in FIG. 9A-FIG. 9D, all soluble anti-SIRP mAbs
SIRP1, SIRP2, SIRP3, and SIRP7 increased phagocytosis of RAJI cells
by human macrophages to a greater degree when combined with
anti-CD20 mAbs compared to either agent alone.
Example 11
Anti-SIRP mAbs Induce Phagocytosis in Combination with Erbitux and
Avelumab
[0265] To assess the effect of anti-SIRP mAbs and anti-EGFR mAbs or
anti-PD-L1 mAbs in combination on inducing phagocytosis of tumor
cells by macrophages in vitro the following method was employed
using flow cytometry.
[0266] Human monocyte-derived macrophages were derived from
leukapheresis of healthy human peripheral blood and incubated in
AIM-V media (Life Technologies) supplemented with 50 ng/ml M-CSF
(Biolegend) for seven days. For the in vitro phagocytosis assay,
macrophages were re-plated at a concentration of 3.times.10.sup.4
cells per well in 100 .mu.l of AIM-V media supplemented with 50
ng/ml M-CSF in a 96-well plate and allowed to adhere for 24 hours.
Once the effector macrophages adhered to the culture dish, the
targeted human cancer cells (FaDu or ES-2) were labeled with 1
.mu.M 5(6)-Carboxyfluorescein diacetate N-succinimidyl ester (CF
SE; Sigma Aldrich) and added to the macrophage cultures at a
concentration of 8.times.10.sup.4 cells in 100 .mu.l of AIM-V media
without supplements. Anti-SIRP mAbs alone, an anti-EGFR mAb
(Erbitux, Bristol-Myers Squibb) alone, an anti-PD-L1 mAb (Avelumab,
Pfizer), or anti-SIRP and anti-EGFR mAbs together were added at
various concentrations immediately upon mixture of target and
effector cells and allowed to incubate at 37.degree. C. for 3
hours. After 3 hours, all non-phagocytosed cells were removed, and
the remaining cells washed three times with PBS. Cells were then
incubated in Accutase (Stemcell Technologies) to detach
macrophages, collected into microcentrifuge tubes, and incubated in
100 ng of allophycocyanin (APC) labeled CD14 antibodies (BD
biosciences) for 30 minutes, washed once, and analyzed by flow
cytometry (Attune, Life Technologies) for the percentage of
CD14.sup.+ cells that were also CFSE.sup.+ indicating complete
phagocytosis.
[0267] As shown in FIG. 10A, soluble anti-SIRP mAb SIRP4 increased
phagocytosis of FaDu cells by human macrophages to a greater degree
when combined with anti-EGFR mAbs compared to either agent alone.
As shown in FIG. 10B, soluble anti-SIRP mAb SIRP4 increased
phagocytosis of ES-2 cells by human macrophages to a greater degree
when combined with anti-PD-L1 mAbs compared to either agent
alone.
Example 12
Anti-SIRP mAbs Bind to Human Macrophages and Dendritic Cells
[0268] To assess the binding of anti-SIRP mAbs to cells expressing
SIRP.alpha. such as human macrophages and dendritic cells the
following method was employed using flow cytometry.
[0269] Human CD14.sup.+ monocytes, isolated from peripheral blood
mononuclear cells (Astarte Biologics) were differentiated in vitro
for seven days into macrophages or dendritic cells. For macrophage
differentiation, monocytes were incubated in AIM-V media (Life
Technologies) supplemented with 50 ng/ml M-CSF (Biolegend) for
seven days. For dendritic cell differentiation, monocytes were
incubated in AIM-V media (Life Technologies) in the presence of 10%
human AB serum (Valley Biomedical), 200 ng/ml GM-CSF (Biolegend)
and 50 ng/ml IL-4 (Biolegend). The cells were incubated for 1 h at
37.degree. C., 5% CO.sub.2 with serial dilutions of SIRP mAbs in
binding buffer containing 1 mM EDTA (Sigma Aldrich) and 1% FBS
(Biowest) in PBS (Corning). The cells were then washed and stained
for 45 min under the same conditions with donkey anti-mouse IgG
fluorescein isothiocyanate (FITC)-linked secondary antibody
(Jackson ImmunoResearch Laboratories). The cells were subsequently
stained with anti-CD14 or anti-CD11c conjugated to Alexa Fluor 647
fluorophore (Life Technologies and Biolegend, respectively) for 30
min on ice, washed and analyzed by flow cytometry (Attune, Life
Technologies). Binding was assessed as the median FITC fluorescence
intensity of CD14.sup.+ or CD11c.sup.+ cells, subtracted from cells
stained with the secondary antibody only.
[0270] As shown in Table 5, the soluble anti-SIRP mAbs SIRP3,
SIRP4, SIRP5 and SIRP9, as well as OSE-18D5 and KWAR-23, bound to
cell-expressed SIRP.alpha. on dendritic cells and/or macrophages
with apparent affinities in the picomolar range. FIG. 11
demonstrates representative binding curves derived from the
antibodies of the present disclosure.
TABLE-US-00006 TABLE 5 Binding of anti-SIRP mAbs to Human Cells
Expressing SIRP.alpha.. Human Human dendritic macrophage cell
binding K.sub.d binding K.sub.d (pM) (pM) SIRP3 ND* 3.47 SIRP4 20.7
50 SIRP5 ND* 770 SIRP9 93.7 ND* 18D5 37.3 41.2 KWAR-23 ND* 23.4
*Not Determined
Example 13
Anti-SIRP mAbs Exhibit Variable Binding to Human CD3.sup.+ T
Cells
[0271] To assess the binding of anti-SIRP mAbs on human CD3 T cells
the following method was employed using flow cytometry.
[0272] Human CD3 T cells, isolated from peripheral blood
mononuclear cells (Astarte Biologics) were incubated in 96-well
V-bottom plates at 2.5.times.10.sup.5 cells/well for 1 h at
37.degree. C., 5% CO.sub.2 with serial dilutions of SIRP mAbs in
binding buffer containing 1 mM EDTA (Sigma Aldrich), 1% FBS
(Biowest) in PBS (Corning). The cells were then washed and stained
for 45 min under the same conditions with donkey anti-mouse IgG
fluorescein isothiocyanate (FITC)-linked secondary antibody
(Jackson ImmunoResearch Laboratories). The cells were subsequently
stained with anti-CD3 conjugated to
3-carboxy-6,8-difluoro-7-hydroxycoumarin (Pacific Blue) fluorophore
(BioLegend) for 30 min on ice, washed and analyzed by flow
cytometry (Attune, Life Technologies). Binding was assessed as the
median FITC fluorescence intensity of CD3.sup.+ cells, subtracted
from CD3.sup.+ cells stained with the secondary antibody only. All
SIRP antibodies were generated in-house except for LSB2.20
(BioLegend). For activated T cells, prior to the binding assay CD3
T cells were activated for 72 h in a 96-well flat-bottom plate
coated with 10 .mu.g/ml anti-CD3 (clone UCHT1; BioLegend), at
1.times.10.sup.5 cells/well in the presence of 0.5 .mu.g/ml
anti-CD28 (clone CD28.2; BioLegend).
[0273] As shown in Table 6, the soluble SIRP3, SIRP7, SIRP9,
KWAR-23, and the SIRP.gamma.-specific antibody LSB2.20 bind T cells
with affinities in the picomolar range. The affinities of anti-SIRP
mAbs SIRP4, SIRP5 and OSE-18D5 are much lower and are in the
nanomolar range. FIG. 12A, FIG. 12B, and FIG. 12C demonstrate
representative binding curves derived from antibodies of the
present disclosure.
TABLE-US-00007 TABLE 6 Binding of anti-SIRP Antibodies to Human T
Cells Expressing SIRP.gamma.. Human T cell Human T cell Human T
cell binding K.sub.d (pM) binding K.sub.d (pM) binding K.sub.d (pM)
Naive Naive Activated SIRP3 80.7 ND ND SIRP4 NC* NC* NC* SIRP5 NC*
NC* NC* SIRP7 83.9 ND ND SIRP9 ND 1410 263 18D5 8410 NC* NC*
KWAR-23 4.04 1.59 6.22 LSB2.20 750 1260 950 *NC Not calculated;
mean fluorescence intensities were comparable to the mIgG1
background level **Not determined.
Example 14
Anti-SIRP mAbs do not Block Soluble CD47/Cellular SIRP.gamma.
Binding
[0274] To assess the effect of anti-SIRP antibodies of the present
disclosure on blocking the binding of soluble CD47 to cells
expressing SIRP.gamma., the following method was employed using
soluble human IgG1 Fc tagged human CD47.
[0275] Human T-ALL cells (Jurkat) were incubated at
2.5.times.10.sup.5 cells/well for 1 h at 37.degree. C., CO.sub.2
with 10 .mu.g/ml of anti-SIRP mAbs in binding buffer containing 1
mM EDTA (Sigma Aldrich), 1% FBS (Biowest) in PBS (Corning).
Following this, soluble human IgG1 Fc tagged human CD47 (ACRO
#CD7-H5256) was added for a final concentration of 50 .mu.g/ml and
the cells incubated as previously for another 1 h. The cells were
then washed extensively and stained for 45 min under the same
conditions with donkey anti-human antibody conjugated to Alexa
Fluor 647 (Jackson ImmunoResearch). The samples were analyzed by
flow cytometry (Attune, Life Technologies). For analysis,
background human IgG1 Fc staining in the absence of soluble Fc
tagged CD47 was subtracted from median Alexa Fluor 647 fluorescence
intensity. Blocking was assessed as the reduction in
background-corrected median fluorescence intensity of Alexa Fluor
647 in the presence of SIRP mAbs compared to murine IgG1
(Biolegend, MOPC-21) control.
[0276] As shown in Table 7, the soluble anti-SIRP mAbs SIRP4,
SIRP9, and OSE 18D5 do not block the binding of cell expressed
SIRP.gamma. to soluble human CD47. KWAR-23 does block the binding
of Jurkat cell expressed SIRP.gamma. to soluble human CD47.
TABLE-US-00008 TABLE 7 Blocking of CD47/SIRP.gamma. Binding by
anti-SIRP Antibodies. Blocking of soluble CD47 binding to
SIRP.gamma. on Jurkat SIRP4 Non-blocking SIRP9 Non-blocking OSE
18D5 Non-blocking KWAR-23 Blocking
Example 15
Anti-SIRP mAbs Block Soluble CD47/Cellular SIRP.gamma. Binding
[0277] To assess the effect of anti-SIRP antibodies of the present
disclosure on binding of soluble CD47 to cells expressing
SIRP.gamma., the following method was employed using human
macrophages and soluble human IgG1 Fc tagged human CD47.
[0278] Human CD14.sup.+ monocytes, isolated from peripheral blood
mononuclear cells (Astarte Biologics) were differentiated in vitro
for seven days in AIM-V media (Life Technologies) supplemented with
50 ng/ml M-CSF (Biolegend). Macrophage Fc receptors were then
blocked with human Fc receptor blocking solution (Biolegend) for 20
min at room temperature. The cells were then washed and incubated
for 1 h at 37T, 5% CO.sub.2 with 10 .mu.g/ml of anti-SIRP mAbs in
binding buffer containing 1 mM EDTA (Sigma Aldrich), 1% FBS
(Biowest) in PBS (Corning). Following this, soluble human IgG1 Fc
tagged human CD47 (ACRO #CD7-H5256) was added for a final
concentration of 20 .mu.g/ml and the cells incubated as previously
for another 1 h. The cells were then washed extensively and stained
for 45 min under the same conditions with donkey anti-human
antibody conjugated to Alexa Fluor 647 (Jackson ImmunoResearch).
The samples were analyzed by flow cytometry (Attune, Life
Technologies). For analysis, background human IgG1 Fc staining in
the absence of soluble Fc tagged CD47 was subtracted from median
Alexa Fluor 647 fluorescence intensity. Blocking was assessed as
the reduction in background-corrected median fluorescence intensity
of Alexa Fluor 647 in the presence of SIRP mAbs compared to murine
IgG1 (Biolegend, MOPC-21) control. Four different monocyte donors
were used in these assays with a minimum of three donors per
antibody tested.
[0279] As shown in FIG. 13, the soluble anti-SIRP mAbs SIRP4 and
SIRP9 block the binding of cell expressed SIRP.alpha. on
macrophages to soluble human CD47. The OSE 18D5 mAb does not block
the binding of cell expressed SIRP.alpha. to soluble human
CD47.
Example 16
Anti-SIRP mAbs do not Inhibit T Cell Proliferation
[0280] To assess the effect of anti-SIRP mAbs on allogeneic
dendritic cell-induced T cell proliferation in vitro the following
method was employed using flow cytometry.
[0281] Human monocyte-derived dendritic cells were generated by
incubating CD14.sup.+ monocytes (Astarte Biologics) in AIM-V medium
(Life Technologies) supplemented with 10% human AB serum (Valley
Biomedical), 200 ng/ml GM-CSF (Biolegend) and 50 ng/ml IL-4
(Biolegend) for six days, with addition of fresh, cytokine replete
medium on Day 2. For the allogeneic dendritic cell and T cell
co-culture assay, immature dendritic cells were re-plated onto a
96-well plate at a concentration of 1.times.10.sup.5 cells per
well. CellTrace.TM. Violet (Life Technologies) fluorescent cell
proliferation dye-labelled allogeneic healthy donor derived
CD3.sup.+ T cells from four different donors (Astarte Biologics)
were added to the culture at a 1:5 DC:T cell ratio. Anti-SIRP mAbs
were added immediately at the saturating concentration of 10
.mu.g/ml immediately and the cells incubated at 37.degree. C., 5%
CO.sub.2 for 6-7 days in a total volume of 200 .mu.l. Cells were
then detached by scraping the wells with pipette tips and washed in
fluorescence-activated cell sorting buffer (1% FBS, Biowest, in
PBS). Cells were then incubated with PerCP-Cy5.5 fluorescent dye
labelled CD3 antibody (Biolegend) for 30 minutes on ice, washed
once, and analyzed by flow cytometry (Attune, Life Technologies). T
cell proliferation was measured by the dilution of the
CellTrace.TM. Violet dye within the CD3.sup.+ cell population.
[0282] As shown in FIG. 14A and FIG. 14B, the anti-SIRP mAbs SIRP3,
SIRP4, SIRP5, SIRP9, SIRP11, SIRP12, SIRP13, SIRP14, SIRP15,
SIRP17, SIRP18, SIRP20, SIRP21, SIRP23 and OSE-18D5 had no
significant effect on T cell proliferation compared to control
antibody (Biolegend). In contrast, KWAR-23, which blocks both
SIRP.alpha. and SIRP.gamma. binding to CD47, inhibited T cell
proliferation.
Example 17
Anti-SIRP mAbs do not Inhibit Antigen-Specific T Cell Recall
Response
[0283] To assess the effect of anti-SIRP mAbs on antigen recall
response in T cells in vitro the following method was employed
using flow cytometry.
[0284] Human peripheral blood mononuclear cells from a
cytomegalovirus seropositive donor (Astarte Biologics) were
labelled with CellTrace.TM. Violet (Life Technologies) fluorescent
cell proliferation dye and seeded at 200,000 cells/well in a
96-well plate. The cells were then incubated with different
concentrations of cytomegalovirus antigen (Astarte Biologics) in
AIM-V medium (Life Technologies) supplemented with 10% human AB
serum (Valley Biomedical), which induces an antigen dependent
stimulation of T cell proliferation. Anti-SIRP mAbs as well as an
anti-CD47 mAb, clone B6H12, (Biolegend) were added immediately at
the saturating concentration of 10 .mu.g/ml immediately and the
cells incubated at 37.degree. C., 5% CO.sub.2 for five days. T cell
proliferation was measured by the dilution of the CellTrace.TM.
Violet dye within the CD4.sup.+ cell population.
[0285] As shown in FIG. 15, the soluble anti-SIRP mAbs SIRP4, SIRP5
and SIRP9 did not inhibit the ability of T cells to elicit a CMV
antigen recall response. In contrast, the anti-CD47 antibody clone
B6H12, which is known to inhibit T cell responses, reduced T cell
proliferation compared to murine IgG1 control antibody
(Biolegend).
Example 18
TABLE-US-00009 [0286] SIRP.alpha. Antibody Sequences LCDR1 LCDR2
LCDR3 HCDR1 HCDR2 HCDR3 (SEQ ID (SEQ ID (SEQ ID (SEQ ID (SEQ ID
(SEQ ID Antibody NO:) NO:) NO:) NO:) NO:) NO:) SIRP1 1 2 3 33 34 35
SIRP2 4 5 6 36 37 38 SIRP3 7 8 9 39 40 41 SIRP4 10 11 12 42 43 44
SIRP5 13 14 15 45 46 47 SIRP6 16 17 18 48 49 50 SIRP7 19 20 21 51
52 53 SIRP8 22 23 24 54 55 56 SIRP9 25 26 27 57 58 59 SIRP10 28 29
30 60 61 62 SIRP11 10 31 12 42 43 44 SIRP12 10 31 12 42 43 44
SIRP13 10 31 32 42 43 44 SIRP14 10 31 12 42 43 44 SIRP15 10 31 12
42 43 44 SIRP16 10 31 32 42 43 44 SIRP17 10 31 12 42 43 44 SIRP18
10 31 12 42 43 44 SIRP19 10 31 32 42 43 44 SIRP20 10 31 12 42 43 44
SIRP21 10 31 12 42 43 44 SIRP22 10 31 32 42 43 44 SIRP23 10 11 12
42 43 44 SIRP24 25 26 27 57 58 63 SIRP25 25 26 27 57 58 63 SIRP26
25 26 27 57 58 63 SIRP27 25 26 27 57 58 63 SIRP28 25 26 27 57 58 63
SIRP29 25 26 27 57 58 63 SIRP30 25 26 27 57 58 59 SIRP31 25 26 27
57 58 59 SIRP32 25 26 27 57 58 59 SIRP33 25 26 27 57 58 63 V.sub.L
(SEQ V.sub.H (SEQ LC (SEQ HC (SEQ ID NO:) ID NO:) ID NO:) ID NO:)
SIRP1 64 81 98 109 SIRP2 65 82 99 110 SIRP3 66 83 100 111 SIRP4 67
84 SIRP5 68 85 SIRP6 69 86 SIRP7 70 87 SIRP8 71 88 SIRP9 72 89
SIRP10 73 90 SIRP11 74 91 101 112 SIRP12 75 91 102 112 SIRP13 76 91
103 112 SIRP14 74 92 101 113 SIRP15 75 92 102 113 SIRP16 76 92 103
113 SIRP17 74 93 101 114 SIRP18 75 93 102 114 SIRP19 76 93 103 114
SIRP20 74 94 101 115 SIRP21 75 94 102 115 SIRP22 76 94 103 115
SIRP23 77 84 104 116 SIRP24 78 95 105 117 SIRP25 79 95 106 117
SIRP26 80 95 107 117 SIRP27 78 96 105 118 SIRP28 79 96 106 118
SIRP29 80 96 107 118 SIRP30 78 97 105 119 SIRP31 79 97 106 119
SIRP32 80 97 107 119 SIRP33 72 89 108 120
Sequence CWU 1
1
131110PRTArtificial SequenceLCDR1 1Arg Ala Ser Ser Gly Val Asn Tyr
Met Tyr1 5 1027PRTArtificial SequenceLCDR2 2Tyr Thr Ser Ile Leu Ala
Pro1 539PRTArtificial SequenceLCDR3 3Gln Gln Phe Thr Ser Ser Pro
Tyr Thr1 5411PRTArtificial SequenceLCDR1 4Arg Ala Ser Gln Ser Ile
Gly Thr Ser Ile His1 5 1057PRTArtificial SequenceLCDR2 5Tyr Gly Ser
Glu Ser Ile Ser1 569PRTArtificial SequenceLCDR3 6Gln Gln Ser Asn
Thr Trp Pro Leu Thr1 5712PRTArtificial SequenceLCDR1 7Ser Ala Ser
Ser Ile Ile Gly Ser Asp Phe Leu His1 5 1087PRTArtificial
SequenceLCDR2 8Arg Thr Ser Ile Leu Ala Ser1 599PRTArtificial
SequenceLCDR3 9Gln Gln Gly Ser Gly Leu Pro Leu Thr1
51011PRTArtificial SequenceLCDR1 10Lys Ala Ser Gln Asp Ile Asn Ser
His Leu Ser1 5 10117PRTArtificial SequenceLCDR2 11Arg Ala Asn Arg
Leu Ala Asp1 5129PRTArtificial SequenceLCDR3 12Leu Gln Tyr Asp Glu
Phe Pro Tyr Thr1 51310PRTArtificial SequenceLCDR1 13Ser Ala Ser Ser
Ser Val Ser Tyr Met Tyr1 5 10147PRTArtificial SequenceLCDR2 14Leu
Thr Ser Asn Leu Ala Ser1 5159PRTArtificial SequenceLCDR3 15Gln Gln
Trp Ser Gly Asn Pro Phe Thr1 51611PRTArtificial SequenceLCDR1 16Arg
Ala Ser Glu Asn Ile Tyr Ser Tyr Leu Thr1 5 10177PRTArtificial
SequenceLCDR2 17Asn Ala Lys Thr Leu Ala Glu1 5189PRTArtificial
SequenceLCDR3 18Gln His His Tyr Gly Ser Pro Arg Thr1
51912PRTArtificial SequenceLCDR1 19Ser Ala Ser Ser Ser Ile Ser Ser
Asn Phe Leu His1 5 10207PRTArtificial SequenceLCDR2 20Arg Thr Ser
Ile Leu Ala Ser1 5219PRTArtificial SequenceLCDR3 21Gln Gln Gly Ser
Gly Leu Pro Leu Thr1 5225PRTArtificial SequenceLCDR1 22Ser Ser Val
Ser Tyr1 5233PRTArtificial SequenceLCDR2 23Asp Thr
Ser1249PRTArtificial SequenceLCDR3 24Gln Gln Trp Ser Ser Phe Pro
Trp Thr1 5256PRTArtificial SequenceLCDR1 25Glu Asp Ile Tyr Asp Arg1
5263PRTArtificial SequenceLCDR2 26Gly Thr Ala1279PRTArtificial
SequenceLCDR3 27Gln Gln Tyr Trp Thr Thr Pro Trp Thr1
5285PRTArtificial SequenceLCDR1 28Ser Ser Val Asn Tyr1
5293PRTArtificial SequenceLCDR2 29Tyr Thr Ser1309PRTArtificial
SequenceLCDR3 30Gln Gln Phe Thr Ser Ser Pro Phe Thr1
5317PRTArtificial SequenceLCDR2 31Arg Ala Asn Arg Leu Ala Thr1
5329PRTArtificial SequenceLCDR3 32Gln Gln Tyr Asp Glu Phe Pro Tyr
Thr1 5335PRTArtificial SequenceHCDR1 33Lys Tyr Trp Ile Glu1
53417PRTArtificial SequenceHCDR2 34Glu Ile Leu Pro Gly Ser Val Ile
Thr Asn Tyr Asn Glu Lys Phe Lys1 5 10 15Gly3512PRTArtificial
SequenceHCDR3 35Trp Gly Leu Tyr Asp Ser Asp Asp Gly Val Asp Tyr1 5
10365PRTArtificial SequenceHCDR1 36Gly Cys Thr Met Ser1
53717PRTArtificial SequenceHCDR2 37Tyr Ile Ser Asn Gly Gly Asp Ile
Thr Tyr Tyr Pro Asp Thr Val Lys1 5 10 15Gly3810PRTArtificial
SequenceHCDR3 38Leu Asp Gly Tyr Tyr Tyr Ala Met Asp Phe1 5
10395PRTArtificial SequenceHCDR1 39Ser Tyr Val Met His1
54017PRTArtificial SequenceHCDR2 40Tyr Ile Asn Pro Tyr Asn Asp Gly
Pro Lys Tyr Asn Glu Lys Phe Lys1 5 10 15Gly4112PRTArtificial
SequenceHCDR3 41Trp Asp Tyr Phe Asn Ser Ala Ser Gly Phe Ala Phe1 5
10425PRTArtificial SequenceHCDR1 42Asp Tyr Phe Leu Asn1
54317PRTArtificial SequenceHCDR2 43Arg Ile Asn Pro Tyr Asn Gly Asp
Ser Phe Ile Asn Gln Asn Phe Arg1 5 10 15Asp4413PRTArtificial
SequenceHCDR3 44Gly Gly Tyr Asp Gly Tyr Phe Ile Ala Tyr Phe Asp
Tyr1 5 10455PRTArtificial SequenceHCDR1 45Ser Tyr Thr Met His1
54617PRTArtificial SequenceHCDR2 46Tyr Ile Asn Pro Thr Ile Gly Tyr
Thr Glu Tyr Asn Gln Lys Phe Lys1 5 10 15Asp4713PRTArtificial
SequenceHCDR3 47Leu Val Ile Thr Ser Val Leu Gly Arg Ala Met Asp
Tyr1 5 10485PRTArtificial SequenceHCDR1 48Asp Tyr Gly Val Asn1
54917PRTArtificial SequenceHCDR2 49Trp Val Asn Thr Asn Thr Arg Glu
Ser Thr Tyr Val Glu Asp Phe Lys1 5 10 15Gly5014PRTArtificial
SequenceHCDR3 50Gly Ala Tyr Asp Ala Tyr Tyr Tyr Tyr Tyr Gly Met Asp
Tyr1 5 10515PRTArtificial SequenceHCDR1 51Thr Tyr Val Met His1
55217PRTArtificial SequenceHCDR2 52Tyr Ile Asn Pro Asn Asn Asp Gly
Pro Asn Tyr Asn Glu Lys Phe Lys1 5 10 15Gly5312PRTArtificial
SequenceHCDR3 53Trp Asp Ser Tyr Asn Ser Ala Ala Gly Phe Ala Tyr1 5
10548PRTArtificial SequenceHCDR1 54Gly Phe Thr Leu Ser Thr Tyr Thr1
5558PRTArtificial SequenceHCDR2 55Ile Thr Ser Gly Asp Thr Tyr Thr1
5568PRTArtificial SequenceHCDR3 56Thr Arg Asp Arg Pro Leu Phe His1
5578PRTArtificial SequenceHCDR1 57Gly Tyr Thr Phe Thr Asp Tyr Glu1
5588PRTArtificial SequenceHCDR2 58Ile His Pro Gly Ser Gly Gly Thr1
55912PRTArtificial SequenceHCDR3 59Thr Arg Ala Val Ser Gly Tyr Tyr
Ala Met Asp Tyr1 5 10608PRTArtificial SequenceHCDR1 60Gly Tyr Thr
Phe Ser Asn Tyr Leu1 5618PRTArtificial SequenceHCDR2 61Ile Tyr Pro
Gly Asp Asn Asn Thr1 56211PRTArtificial SequenceHCDR3 62Ala Gly Gly
Thr Asp Tyr Asp Gly Phe Ala Asn1 5 106312PRTArtificial
SequenceHCDR3 63Ala Arg Ala Val Ser Gly Tyr Tyr Ala Met Asp Tyr1 5
1064106PRTArtificial SequenceLight Chain (VL) Variable Domain
Sequence 64Glu Asn Val Leu Thr Gln Ser Pro Ala Ile Met Ser Ala Ser
Leu Gly1 5 10 15Glu Lys Val Thr Met Ser Cys Arg Ala Ser Ser Gly Val
Asn Tyr Met 20 25 30Tyr Trp Tyr Gln Gln Lys Ser Asp Ala Ser Pro Lys
Leu Leu Ile Tyr 35 40 45Tyr Thr Ser Ile Leu Ala Pro Gly Val Pro Ala
Arg Phe Ser Gly Ser 50 55 60Gly Ser Gly Asn Ser Tyr Ser Leu Thr Ile
Ser Ser Met Glu Gly Glu65 70 75 80Asp Ala Ala Thr Tyr Tyr Cys Gln
Gln Phe Thr Ser Ser Pro Tyr Thr 85 90 95Phe Gly Gly Gly Thr Lys Leu
Glu Ile Lys 100 10565107PRTArtificial SequenceLight Chain (VL)
Variable Domain Sequence 65Asp Ile Leu Leu Thr Gln Ser Pro Ala Ile
Leu Ser Val Ser Pro Gly1 5 10 15Glu Arg Val Ser Phe Ser Cys Arg Ala
Ser Gln Ser Ile Gly Thr Ser 20 25 30Ile His Trp Tyr Gln Gln Arg Thr
Asn Gly Ser Pro Arg Leu Leu Ile 35 40 45Lys Tyr Gly Ser Glu Ser Ile
Ser Gly Ile Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp
Phe Thr Leu Ser Ile Asn Ser Val Glu Ser65 70 75 80Glu Asp Ile Ala
Asp Tyr Tyr Cys Gln Gln Ser Asn Thr Trp Pro Leu 85 90 95Thr Phe Gly
Asp Gly Thr Lys Leu Glu Leu Lys 100 10566108PRTArtificial
SequenceLight Chain (VL) Variable Domain Sequence 66Glu Ile Val Leu
Thr Gln Ser Pro Thr Thr Met Ala Ala Ser Pro Gly1 5 10 15Glu Lys Ile
Thr Ile Ile Cys Ser Ala Ser Ser Ile Ile Gly Ser Asp 20 25 30Phe Leu
His Trp Tyr Gln Gln Arg Pro Gly Phe Ser Pro Lys Phe Leu 35 40 45Ile
Tyr Arg Thr Ser Ile Leu Ala Ser Gly Val Pro Thr Arg Phe Thr 50 55
60Gly Ser Gly Ser Gly Thr Ser Tyr Ser Leu Thr Ile Gly Thr Met Glu65
70 75 80Ala Glu Asp Val Ala Thr Tyr Tyr Cys Gln Gln Gly Ser Gly Leu
Pro 85 90 95Leu Thr Phe Gly Ser Gly Thr Lys Leu Glu Met Lys 100
10567107PRTArtificial SequenceLight Chain (VL) Variable Domain
Sequence 67Asp Ile Lys Leu Thr Gln Ser Gln Ser Ser Met Tyr Ser Ser
Leu Gly1 5 10 15Gln Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile
Asn Ser His 20 25 30Leu Ser Trp Phe Gln Glu Lys Pro Gly Lys Ser Pro
Lys Thr Leu Ile 35 40 45Tyr Arg Ala Asn Arg Leu Ala Asp Gly Val Pro
Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Gln Asp Tyr Phe Leu Thr
Ile Ser Ser Leu Glu Tyr65 70 75 80Glu Asp Val Gly Ile Tyr Tyr Cys
Leu Gln Tyr Asp Glu Phe Pro Tyr 85 90 95Thr Phe Gly Gly Gly Thr Lys
Leu Glu Ile Lys 100 10568106PRTArtificial SequenceLight Chain (VL)
Variable Domain Sequence 68Gln Ile Val Leu Thr Gln Ser Pro Ala Leu
Met Ser Ala Ser Pro Gly1 5 10 15Glu Lys Val Thr Met Thr Cys Ser Ala
Ser Ser Ser Val Ser Tyr Met 20 25 30Tyr Trp Phe Gln Gln Lys Pro Arg
Ser Ser Pro Lys Pro Trp Ile Tyr 35 40 45Leu Thr Ser Asn Leu Ala Ser
Gly Val Pro Ala Arg Phe Ser Gly Ser 50 55 60Gly Ser Gly Thr Ser Tyr
Ser Leu Thr Ile Ser Ser Met Glu Ala Glu65 70 75 80Asp Ala Ala Thr
Tyr Tyr Cys Gln Gln Trp Ser Gly Asn Pro Phe Thr 85 90 95Phe Gly Ser
Gly Thr Lys Leu Glu Ile Lys 100 10569107PRTArtificial SequenceLight
Chain (VL) Variable Domain Sequence 69Asp Ile Gln Met Thr Gln Ser
Pro Ala Ser Leu Ser Ala Ser Val Gly1 5 10 15Glu Thr Val Thr Ile Thr
Cys Arg Ala Ser Glu Asn Ile Tyr Ser Tyr 20 25 30Leu Thr Trp Tyr Lys
Gln Lys Gln Gly Lys Ser Pro Gln Leu Leu Val 35 40 45Tyr Asn Ala Lys
Thr Leu Ala Glu Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser
Gly Thr Gln Phe Ser Leu Lys Ile Asn Ser Leu Gln Pro65 70 75 80Glu
Asp Phe Gly Ser Tyr Tyr Cys Gln His His Tyr Gly Ser Pro Arg 85 90
95Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 100
10570108PRTArtificial SequenceLight Chain (VL) Variable Domain
Sequence 70Glu Ile Val Leu Thr Gln Ser Pro Thr Thr Met Ala Ala Ser
Pro Gly1 5 10 15Glu Lys Ile Thr Ile Ile Cys Ser Ala Ser Ser Ser Ile
Ser Ser Asn 20 25 30Phe Leu His Trp Tyr Gln Gln Lys Pro Gly Phe Ser
Pro Arg Phe Leu 35 40 45Ile Tyr Arg Thr Ser Ile Leu Ala Ser Gly Val
Pro Thr Arg Phe Ser 50 55 60Gly Ser Gly Ser Gly Thr Ser Tyr Ser Leu
Thr Ile Asp Thr Met Glu65 70 75 80Ala Glu Asp Val Ala Thr Tyr Tyr
Cys Gln Gln Gly Ser Gly Leu Pro 85 90 95Leu Thr Phe Gly Ser Gly Thr
Lys Leu Glu Ile Lys 100 10571106PRTArtificial SequenceLight Chain
(VL) Variable Domain Sequence 71Gln Ile Val Leu Thr Gln Ser Pro Ala
Ile Met Ser Ala Ser Pro Gly1 5 10 15Glu Lys Val Thr Met Thr Cys Ser
Ala Ser Ser Ser Val Ser Tyr Met 20 25 30Tyr Trp Tyr Gln Gln Lys Pro
Gly Ser Ser Pro Arg Leu Leu Ile Tyr 35 40 45Asp Thr Ser Asn Leu Ala
Ser Gly Val Pro Val Arg Phe Ser Gly Ser 50 55 60Gly Ser Gly Thr Ser
Tyr Ser Leu Thr Ile Ser Arg Met Glu Ala Glu65 70 75 80Asp Ala Ala
Thr Tyr Tyr Cys Gln Gln Trp Ser Ser Phe Pro Trp Thr 85 90 95Phe Gly
Gly Gly Thr Lys Leu Glu Ile Lys 100 10572107PRTArtificial
SequenceLight Chain (VL) Variable Domain Sequence 72Asp Ile Gln Met
Thr Gln Ser Ser Ser Ser Phe Ser Gly Ser Leu Gly1 5 10 15Asp Arg Leu
Thr Ile Asn Cys Lys Ala Ser Glu Asp Ile Tyr Asp Arg 20 25 30Val Ala
Trp Tyr Gln Gln Lys Pro Gly Asn Ala Pro Arg Leu Leu Ile 35 40 45Ser
Gly Thr Ala Ser Leu Glu Thr Gly Val Leu Ser Arg Phe Ser Gly 50 55
60Ser Gly Ser Gly Lys Asp Tyr Thr Leu Ser Ile Asn Gly Leu Gln Ala65
70 75 80Glu Asp Val Ala Thr Tyr Tyr Cys Gln Gln Tyr Trp Thr Thr Pro
Trp 85 90 95Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 100
10573106PRTArtificial SequenceLight Chain (VL) Variable Domain
Sequence 73Glu Asn Val Leu Thr Gln Ser Pro Ala Ile Met Ser Ala Ser
Leu Gly1 5 10 15Glu Lys Val Thr Met Ser Cys Arg Ala Ser Ser Ser Val
Asn Tyr Met 20 25 30Tyr Trp Tyr Gln Gln Lys Ser Asp Ala Ser Pro Lys
Leu Trp Ile Tyr 35 40 45Tyr Thr Ser Lys Leu Ala Pro Gly Val Pro Ala
Arg Phe Ser Gly Ser 50 55 60Gly Ser Gly Asn Ser Tyr Ser Leu Thr Ile
Ser Ser Met Glu Gly Glu65 70 75 80Asp Ala Ala Thr Tyr Tyr Cys Gln
Gln Phe Thr Ser Ser Pro Phe Thr 85 90 95Phe Gly Ser Gly Thr Lys Leu
Glu Ile Lys 100 10574107PRTArtificial SequenceLight Chain (VL)
Variable Domain Sequences 74Asp Ile Gln Met Thr Gln Ser Pro Ser Ser
Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Lys Ala
Ser Gln Asp Ile Asn Ser His 20 25 30Leu Ser Trp Tyr Gln Gln Lys Pro
Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Arg Ala Asn Arg Leu Ala
Thr Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp
Phe Thr Phe Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Ile Ala
Thr Tyr Tyr Cys Leu Gln Tyr Asp Glu Phe Pro Tyr 85 90 95Thr Phe Gly
Gly Gly Thr Lys Leu Glu Ile Lys 100 10575107PRTArtificial
SequenceLight Chain (VL) Variable Domain Sequence 75Asp Ile Gln Met
Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val
Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asn Ser His 20 25 30Leu Ser
Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr
Arg Ala Asn Arg Leu Ala Thr Gly Val Pro Ser Arg Phe Ser Gly 50 55
60Ser Gly Ser Gly Thr Asp Phe Thr Phe Thr Ile Ser Ser Leu Glu Tyr65
70 75 80Glu Asp Ile Ala Thr Tyr Tyr Cys Leu Gln Tyr Asp Glu Phe Pro
Tyr 85 90 95Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys 100
10576107PRTArtificial SequenceLight Chain (VL) Variable Domain
Sequence 76Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser
Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile
Asn Ser His 20 25 30Leu Ser Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro
Lys Leu Leu Ile 35 40 45Tyr Arg Ala Asn Arg Leu Ala Thr Gly Val Pro
Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Phe Thr
Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Ile Ala Thr Tyr Tyr Cys
Gln Gln Tyr Asp Glu Phe Pro Tyr 85 90 95Thr Phe Gly Gly Gly Thr Lys
Leu Glu Ile Lys 100 10577107PRTArtificial SequenceLight Chain (VL)
Variable Domain Sequence 77Asp Ile Lys Met Thr Gln Ser Pro Ser Ser
Met Tyr Ala Ser Leu Gly1 5 10 15Gln Arg Val Thr Ile Thr Cys Lys Ala
Ser Gln Asp Ile Asn Ser His 20 25 30Leu Ser Trp Phe Gln Glu Lys Pro
Gly Lys Ser Pro Lys Thr Leu Ile 35 40 45Tyr Arg Ala Asn Arg Leu Ala
Asp Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Gln Asp
Tyr Phe Leu Thr Ile Ser Ser Leu Glu Tyr65 70 75 80Glu Asp Val Gly
Ile Tyr Tyr Cys Leu Gln Tyr Asp Glu Phe Pro Tyr 85 90 95Thr Phe Gly
Gly Gly Thr Lys Leu Glu Ile Lys
100 10578107PRTArtificial SequenceLight Chain (VL) Variable Domain
Sequence 78Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser
Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Glu Asp Ile
Tyr Asp Arg 20 25 30Val Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro
Lys Leu Leu Ile 35 40 45Tyr Gly Thr Ala Ser Leu Glu Thr Gly Val Pro
Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Phe Thr
Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Ile Ala Thr Tyr Tyr Cys
Gln Gln Tyr Trp Thr Thr Pro Trp 85 90 95Thr Phe Gly Gly Gly Thr Lys
Val Glu Ile Lys 100 10579107PRTArtificial SequenceLight Chain (VL)
Variable Domain Sequence 79Asp Ile Gln Met Thr Gln Ser Pro Ser Ser
Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Lys Ala
Ser Glu Asp Ile Tyr Asp Arg 20 25 30Val Ala Trp Tyr Gln Gln Lys Pro
Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Gly Thr Ala Ser Leu Glu
Thr Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp
Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala
Thr Tyr Tyr Cys Gln Gln Tyr Trp Thr Thr Pro Trp 85 90 95Thr Phe Gly
Gly Gly Thr Lys Val Glu Ile Lys 100 10580107PRTArtificial
SequenceLight Chain (VL) Variable Domain Sequence 80Asp Ile Gln Met
Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val
Thr Ile Thr Cys Lys Ala Ser Glu Asp Ile Tyr Asp Arg 20 25 30Val Ala
Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr
Gly Thr Ala Ser Leu Glu Thr Gly Val Leu Ser Arg Phe Ser Gly 50 55
60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Ala65
70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Trp Thr Thr Pro
Trp 85 90 95Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys 100
10581121PRTArtificial SequenceHeavy Chain (VH) Variable Domain
Sequence 81Gln Val Gln Leu Gln Gln Ser Gly Ala Glu Leu Met Lys Pro
Gly Ala1 5 10 15Ser Val Lys Ile Ser Cys Lys Ala Thr Gly Tyr Ser Phe
Thr Lys Tyr 20 25 30Trp Ile Glu Trp Val Lys Gln Arg Pro Gly His Gly
Leu Glu Trp Ile 35 40 45Gly Glu Ile Leu Pro Gly Ser Val Ile Thr Asn
Tyr Asn Glu Lys Phe 50 55 60Lys Gly Lys Ala Thr Phe Thr Ala Asp Thr
Ser Ser Asn Thr Val Tyr65 70 75 80Met Gln Leu Ser Ser Leu Thr Ser
Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95Thr Lys Trp Gly Leu Tyr Asp
Ser Asp Asp Gly Val Asp Tyr Trp Gly 100 105 110Gln Gly Thr Thr Leu
Thr Val Ser Ser 115 12082119PRTArtificial SequenceHeavy Chain (VH)
Variable Domain Sequence 82Glu Val Lys Leu Val Glu Ser Gly Gly Gly
Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Lys Leu Ser Cys Ala Ala Ser
Gly Phe Ser Phe Ser Gly Cys 20 25 30Thr Met Ser Trp Ile Arg Gln Thr
Pro Glu Arg Arg Leu Glu Trp Val 35 40 45Ala Tyr Ile Ser Asn Gly Gly
Asp Ile Thr Tyr Tyr Pro Asp Thr Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Ser
Ser Leu Lys Ser Glu Asp Thr Ala Met Tyr Tyr Cys 85 90 95Ala Arg Leu
Asp Gly Tyr Tyr Tyr Ala Met Asp Phe Trp Gly Gln Gly 100 105 110Thr
Ser Val Thr Val Ser Ser 11583121PRTArtificial SequenceHeavy Chain
(VH) Variable Domain Sequence 83Glu Val Gln Leu Gln Gln Ser Gly Pro
Glu Val Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Met Ser Cys Lys Ala
Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25 30Val Met His Trp Val Lys Gln
Lys Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45Gly Tyr Ile Asn Pro Tyr
Asn Asp Gly Pro Lys Tyr Asn Glu Lys Phe 50 55 60Lys Gly Lys Ala Thr
Leu Thr Ser Asp Lys Ser Ser Ser Thr Ala Tyr65 70 75 80Met Glu Leu
Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Phe Cys 85 90 95Ala Arg
Trp Asp Tyr Phe Asn Ser Ala Ser Gly Phe Ala Phe Trp Gly 100 105
110Gln Gly Thr Leu Val Thr Val Ser Ala 115 12084122PRTArtificial
SequenceHeavy Chain (VH) Variable Domain Sequence 84Glu Val Gln Leu
Gln Gln Ser Gly Pro Asp Leu Val Lys Pro Gly Ala1 5 10 15Ser Val Lys
Ile Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Phe Leu
Asn Trp Val Lys Gln Ser His Gly Lys Ser Leu Glu Trp Ile 35 40 45Gly
Arg Ile Asn Pro Tyr Asn Gly Asp Ser Phe Ile Asn Gln Asn Phe 50 55
60Arg Asp Lys Ala Thr Leu Thr Val Asp Lys Ser Ser Thr Thr Ala His65
70 75 80Met Asp Leu Leu Ser Leu Thr Ser Glu Asp Ser Ala Ile Tyr Tyr
Cys 85 90 95Gly Arg Gly Gly Tyr Asp Gly Tyr Phe Ile Ala Tyr Phe Asp
Tyr Trp 100 105 110Gly Gln Gly Ser Leu Val Thr Val Ser Ala 115
12085122PRTArtificial SequenceHeavy Chain (VH) Variable Domain
Sequence 85Gln Val Gln Leu Gln Gln Ser Ala Ala Glu Leu Ala Arg Pro
Gly Ala1 5 10 15Ser Val Lys Met Ser Cys Lys Ala Ser Gly Tyr Thr Phe
Thr Ser Tyr 20 25 30Thr Met His Trp Val Lys Gln Arg Pro Gly Gln Gly
Leu Glu Trp Ile 35 40 45Gly Tyr Ile Asn Pro Thr Ile Gly Tyr Thr Glu
Tyr Asn Gln Lys Phe 50 55 60Lys Asp Lys Thr Thr Leu Thr Ala Asp Lys
Ser Ser Ser Thr Ala Tyr65 70 75 80Met Gln Leu Ser Ser Leu Thr Ser
Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95Val Arg Leu Val Ile Thr Ser
Val Leu Gly Arg Ala Met Asp Tyr Trp 100 105 110Gly Gln Gly Thr Ser
Val Thr Val Ser Ser 115 12086123PRTArtificial SequenceHeavy Chain
(VH) Variable Domain Sequence 86Gln Ile Gln Leu Val Gln Ser Gly Pro
Glu Leu Lys Lys Pro Gly Glu1 5 10 15Thr Val Lys Ile Ser Cys Lys Ala
Ser Gly Tyr Thr Phe Thr Asp Tyr 20 25 30Gly Val Asn Trp Val Lys Gln
Gly Pro Gly Lys Asp Leu Gln Trp Met 35 40 45Gly Trp Val Asn Thr Asn
Thr Arg Glu Ser Thr Tyr Val Glu Asp Phe 50 55 60Lys Gly Arg Phe Ala
Phe Ser Leu Glu Thr Ser Ala Ser Thr Ala Tyr65 70 75 80Leu Gln Ile
Asn Asn Leu Lys Asn Glu Asp Ser Ser Thr Tyr Phe Cys 85 90 95Ala Arg
Gly Ala Tyr Asp Ala Tyr Tyr Tyr Tyr Tyr Gly Met Asp Tyr 100 105
110Trp Gly Gln Gly Thr Ser Val Thr Val Ser Ser 115
12087121PRTArtificial SequenceHeavy Chain (VH) Variable Domain
Sequence 87Glu Val Gln Leu Gln Gln Ser Gly Pro Glu Leu Val Lys Pro
Gly Ala1 5 10 15Ser Val Lys Met Ser Cys Arg Ala Ser Gly Tyr Thr Phe
Ser Thr Tyr 20 25 30Val Met His Trp Ile Lys His Arg Pro Gly Gln Gly
Leu Glu Trp Ile 35 40 45Gly Tyr Ile Asn Pro Asn Asn Asp Gly Pro Asn
Tyr Asn Glu Lys Phe 50 55 60Lys Gly Lys Ala Thr Leu Thr Ser Asp Ile
Ser Ser Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Thr Ser
Glu Asp Ser Ala Val Tyr Phe Cys 85 90 95Ser Arg Trp Asp Ser Tyr Asn
Ser Ala Ala Gly Phe Ala Tyr Trp Gly 100 105 110His Gly Thr Leu Val
Thr Val Ser Ala 115 12088115PRTArtificial SequenceHeavy Chain (VH)
Variable Domain Sequence 88Glu Val Gln Leu Gln Glu Ser Gly Gly Gly
Leu Val Lys Pro Gly Gly1 5 10 15Ser Leu Lys Leu Ser Cys Ala Ala Ser
Gly Phe Thr Leu Ser Thr Tyr 20 25 30Thr Met Ser Trp Val Arg Gln Thr
Pro Glu Lys Arg Leu Glu Trp Val 35 40 45Ala Ile Ile Thr Ser Gly Asp
Thr Tyr Thr Tyr Tyr Pro Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ala Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Ser
Ser Leu Lys Ser Glu Asp Thr Gly Met Tyr Tyr Cys 85 90 95Thr Arg Asp
Arg Pro Leu Phe His Trp Gly Gln Gly Thr Thr Leu Thr 100 105 110Val
Ser Thr 11589119PRTArtificial SequenceHeavy Chain (VH) Variable
Domain Sequence 89Glu Val Gln Leu Gln Glu Ser Gly Ala Glu Leu Val
Arg Pro Gly Ala1 5 10 15Ser Val Lys Leu Ser Cys Lys Ala Leu Gly Tyr
Thr Phe Thr Asp Tyr 20 25 30Glu Ile His Trp Val Lys Glu Thr Pro Val
Tyr Gly Leu Glu Trp Ile 35 40 45Gly Asp Ile His Pro Gly Ser Gly Gly
Thr Ala Asn Asn Gln Lys Phe 50 55 60Lys Gly Lys Ala Thr Leu Thr Ala
Asp Lys Ser Ser Asn Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu
Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95Thr Arg Ala Val Ser
Gly Tyr Tyr Ala Met Asp Tyr Trp Gly Gln Gly 100 105 110Thr Ser Val
Thr Val Ser Ser 11590118PRTArtificial SequenceHeavy Chain (VH)
Variable Domain Sequence 90Glu Val Gln Leu Gln Glu Ser Gly Ala Glu
Leu Val Arg Pro Gly Thr1 5 10 15Ser Val Lys Met Ser Cys Lys Ala Ala
Gly Tyr Thr Phe Ser Asn Tyr 20 25 30Leu Ile Gly Trp Ile Lys Gln Arg
Pro Gly His Gly Leu Glu Trp Ile 35 40 45Gly Asp Ile Tyr Pro Gly Asp
Asn Asn Thr Asn Tyr Asn Glu Lys Phe 50 55 60Arg Val Lys Ala Thr Leu
Thr Ala Asp Thr Ser Ser Asn Thr Ala Tyr65 70 75 80Met His Leu Thr
Ser Leu Thr Ser Glu Asp Ser Ala Ile Tyr Tyr Cys 85 90 95Ala Gly Gly
Thr Asp Tyr Asp Gly Phe Ala Asn Trp Gly Gln Gly Thr 100 105 110Leu
Val Thr Val Ser Ala 11591122PRTArtificial SequenceHeavy Chain (VH)
Variable Domain Sequence 91Gln Val Gln Leu Val Gln Ser Gly Ala Glu
Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser
Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Phe Leu Asn Trp Val Arg Gln Ala
Pro Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Arg Ile Asn Pro Tyr Asn
Gly Asp Ser Phe Ile Asn Gln Asn Phe 50 55 60Arg Asp Arg Val Thr Met
Thr Arg Asp Thr Ser Thr Ser Thr Val Tyr65 70 75 80Met Glu Leu Ser
Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Gly
Gly Tyr Asp Gly Tyr Phe Ile Ala Tyr Phe Asp Tyr Trp 100 105 110Gly
Ala Gly Thr Thr Val Thr Val Ser Ser 115 12092122PRTArtificial
SequenceHeavy Chain (VH) Variable Domain Sequence 92Gln Val Gln Leu
Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ser1 5 10 15Ser Val Lys
Val Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Phe Leu
Asn Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45Gly
Arg Ile Asn Pro Tyr Asn Gly Asp Ser Phe Ile Asn Gln Asn Phe 50 55
60Arg Asp Arg Val Thr Ile Thr Ala Asp Lys Ser Thr Ser Thr Ala Tyr65
70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Ala Arg Gly Gly Tyr Asp Gly Tyr Phe Ile Ala Tyr Phe Asp
Tyr Trp 100 105 110Gly Ala Gly Thr Thr Val Thr Val Ser Ser 115
12093122PRTArtificial SequenceHeavy Chain (VH) Variable Domain
Sequence 93Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro
Gly Glu1 5 10 15Ser Leu Lys Ile Ser Cys Lys Gly Ser Gly Tyr Ser Phe
Thr Asp Tyr 20 25 30Phe Leu Asn Trp Val Arg Gln Met Pro Gly Lys Gly
Leu Glu Trp Met 35 40 45Gly Arg Ile Asn Pro Tyr Asn Gly Asp Ser Phe
Ile Asn Gln Asn Phe 50 55 60Arg Asp Gln Val Thr Ile Ser Ala Asp Lys
Ser Ile Ser Thr Ala Tyr65 70 75 80Leu Gln Trp Ser Ser Leu Lys Ala
Ser Asp Thr Ala Met Tyr Tyr Cys 85 90 95Ala Arg Gly Gly Tyr Asp Gly
Tyr Phe Ile Ala Tyr Phe Asp Tyr Trp 100 105 110Gly Ala Gly Thr Thr
Val Thr Val Ser Ser 115 12094122PRTArtificial SequenceHeavy Chain
(VH) Variable Domain Sequence 94Gln Val Gln Leu Val Gln Ser Gly Ala
Glu Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala
Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25 30Phe Leu Asn Trp Val Arg Gln
Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Arg Ile Asn Pro Tyr
Asn Gly Asp Ser Phe Ile Asn Gln Asn Phe 50 55 60Arg Asp Arg Val Thr
Met Thr Val Asp Thr Ser Thr Ser Thr Val Tyr65 70 75 80Met Glu Leu
Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg
Gly Gly Tyr Asp Gly Tyr Phe Ile Ala Tyr Phe Asp Tyr Trp 100 105
110Gly Ala Gly Thr Thr Val Thr Val Ser Ser 115
12095119PRTArtificial SequenceHeavy Chain (VH) Variable Domain
Sequence 95Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro
Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe
Thr Asp Tyr 20 25 30Glu Ile His Trp Val Arg Gln Ala Pro Gly Gln Gly
Leu Glu Trp Met 35 40 45Gly Asp Ile His Pro Gly Ser Gly Gly Thr Ala
Asn Asn Gln Lys Phe 50 55 60Lys Gly Arg Val Thr Met Thr Arg Asp Thr
Ser Thr Ser Thr Val Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser
Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ala Val Ser Gly Tyr
Tyr Ala Met Asp Tyr Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val
Ser Ser 11596119PRTArtificial SequenceHeavy Chain (VH) Variable
Domain Sequence 96Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys
Lys Pro Gly Ser1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr
Thr Phe Thr Asp Tyr 20 25 30Glu Ile His Trp Val Arg Gln Ala Pro Gly
Gln Gly Leu Glu Trp Met 35 40 45Gly Asp Ile His Pro Gly Ser Gly Gly
Thr Ala Asn Asn Gln Lys Phe 50 55 60Lys Gly Arg Val Thr Ile Thr Ala
Asp Glu Ser Thr Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu
Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ala Val Ser
Gly Tyr Tyr Ala Met Asp Tyr Trp Gly Gln Gly 100 105 110Thr Leu Val
Thr Val Ser Ser 11597119PRTArtificial SequenceHeavy Chain (VH)
Variable Domain Sequence 97Gln Val Gln Leu Val Gln Ser Gly Ala Glu
Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser
Gly Tyr Thr Phe Thr Asp Tyr 20 25 30Glu Ile His Trp Val Arg Gln Ala
Pro Gly Gln Gly Leu
Glu Trp Met 35 40 45Gly Asp Ile His Pro Gly Ser Gly Gly Thr Ala Asn
Asn Gln Lys Phe 50 55 60Lys Gly Arg Val Thr Met Thr Ala Asp Thr Ser
Thr Ser Thr Val Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu
Asp Thr Ala Val Tyr Tyr Cys 85 90 95Thr Arg Ala Val Ser Gly Tyr Tyr
Ala Met Asp Tyr Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser
Ser 11598213PRTArtificial SequenceLight Chain (LC) Sequence 98Glu
Asn Val Leu Thr Gln Ser Pro Ala Ile Met Ser Ala Ser Leu Gly1 5 10
15Glu Lys Val Thr Met Ser Cys Arg Ala Ser Ser Gly Val Asn Tyr Met
20 25 30Tyr Trp Tyr Gln Gln Lys Ser Asp Ala Ser Pro Lys Leu Leu Ile
Tyr 35 40 45Tyr Thr Ser Ile Leu Ala Pro Gly Val Pro Ala Arg Phe Ser
Gly Ser 50 55 60Gly Ser Gly Asn Ser Tyr Ser Leu Thr Ile Ser Ser Met
Glu Gly Glu65 70 75 80Asp Ala Ala Thr Tyr Tyr Cys Gln Gln Phe Thr
Ser Ser Pro Tyr Thr 85 90 95Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys
Arg Ala Asp Ala Ala Pro 100 105 110Thr Val Ser Ile Phe Pro Pro Ser
Ser Glu Gln Leu Thr Ser Gly Gly 115 120 125Ala Ser Val Val Cys Phe
Leu Asn Asn Phe Tyr Pro Lys Asp Ile Asn 130 135 140Val Lys Trp Lys
Ile Asp Gly Ser Glu Arg Gln Asn Gly Val Leu Asn145 150 155 160Ser
Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser Met Ser Ser 165 170
175Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg His Asn Ser Tyr Thr
180 185 190Cys Glu Ala Thr His Lys Thr Ser Thr Ser Pro Ile Val Lys
Ser Phe 195 200 205Asn Arg Asn Glu Cys 21099214PRTArtificial
SequenceLight Chain (LC) Sequence 99Asp Ile Leu Leu Thr Gln Ser Pro
Ala Ile Leu Ser Val Ser Pro Gly1 5 10 15Glu Arg Val Ser Phe Ser Cys
Arg Ala Ser Gln Ser Ile Gly Thr Ser 20 25 30Ile His Trp Tyr Gln Gln
Arg Thr Asn Gly Ser Pro Arg Leu Leu Ile 35 40 45Lys Tyr Gly Ser Glu
Ser Ile Ser Gly Ile Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly
Thr Asp Phe Thr Leu Ser Ile Asn Ser Val Glu Ser65 70 75 80Glu Asp
Ile Ala Asp Tyr Tyr Cys Gln Gln Ser Asn Thr Trp Pro Leu 85 90 95Thr
Phe Gly Asp Gly Thr Lys Leu Glu Leu Lys Arg Ala Asp Ala Ala 100 105
110Pro Thr Val Ser Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser Gly
115 120 125Gly Ala Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys
Asp Ile 130 135 140Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln
Asn Gly Val Leu145 150 155 160Asn Ser Trp Thr Asp Gln Asp Ser Lys
Asp Ser Thr Tyr Ser Met Ser 165 170 175Ser Thr Leu Thr Leu Thr Lys
Asp Glu Tyr Glu Arg His Asn Ser Tyr 180 185 190Thr Cys Glu Ala Thr
His Lys Thr Ser Thr Ser Pro Ile Val Lys Ser 195 200 205Phe Asn Arg
Asn Glu Cys 210100215PRTArtificial SequenceLight Chain (LC)
Sequence 100Glu Ile Val Leu Thr Gln Ser Pro Thr Thr Met Ala Ala Ser
Pro Gly1 5 10 15Glu Lys Ile Thr Ile Ile Cys Ser Ala Ser Ser Ile Ile
Gly Ser Asp 20 25 30Phe Leu His Trp Tyr Gln Gln Arg Pro Gly Phe Ser
Pro Lys Phe Leu 35 40 45Ile Tyr Arg Thr Ser Ile Leu Ala Ser Gly Val
Pro Thr Arg Phe Thr 50 55 60Gly Ser Gly Ser Gly Thr Ser Tyr Ser Leu
Thr Ile Gly Thr Met Glu65 70 75 80Ala Glu Asp Val Ala Thr Tyr Tyr
Cys Gln Gln Gly Ser Gly Leu Pro 85 90 95Leu Thr Phe Gly Ser Gly Thr
Lys Leu Glu Met Lys Arg Ala Asp Ala 100 105 110Ala Pro Thr Val Ser
Ile Phe Pro Pro Ser Ser Glu Gln Leu Thr Ser 115 120 125Gly Gly Ala
Ser Val Val Cys Phe Leu Asn Asn Phe Tyr Pro Lys Asp 130 135 140Ile
Asn Val Lys Trp Lys Ile Asp Gly Ser Glu Arg Gln Asn Gly Val145 150
155 160Leu Asn Ser Trp Thr Asp Gln Asp Ser Lys Asp Ser Thr Tyr Ser
Met 165 170 175Ser Ser Thr Leu Thr Leu Thr Lys Asp Glu Tyr Glu Arg
His Asn Ser 180 185 190Tyr Thr Cys Glu Ala Thr His Lys Thr Ser Thr
Ser Pro Ile Val Lys 195 200 205Ser Phe Asn Arg Asn Glu Cys 210
215101214PRTArtificial SequenceLight Chain (LC) Sequence 101Asp Ile
Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp
Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asn Ser His 20 25
30Leu Ser Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile
35 40 45Tyr Arg Ala Asn Arg Leu Ala Thr Gly Val Pro Ser Arg Phe Ser
Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Phe Thr Ile Ser Ser Leu
Gln Pro65 70 75 80Glu Asp Ile Ala Thr Tyr Tyr Cys Leu Gln Tyr Asp
Glu Phe Pro Tyr 85 90 95Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys
Arg Thr Val Ala Ala 100 105 110Pro Ser Val Phe Ile Phe Pro Pro Ser
Asp Glu Gln Leu Lys Ser Gly 115 120 125Thr Ala Ser Val Val Cys Leu
Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140Lys Val Gln Trp Lys
Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150 155 160Glu Ser
Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165 170
175Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr
180 185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr
Lys Ser 195 200 205Phe Asn Arg Gly Glu Cys 210102214PRTArtificial
SequenceLight Chain (LC) Sequence 102Asp Ile Gln Met Thr Gln Ser
Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr
Cys Lys Ala Ser Gln Asp Ile Asn Ser His 20 25 30Leu Ser Trp Tyr Gln
Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Arg Ala Asn
Arg Leu Ala Thr Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser
Gly Thr Asp Phe Thr Phe Thr Ile Ser Ser Leu Glu Tyr65 70 75 80Glu
Asp Ile Ala Thr Tyr Tyr Cys Leu Gln Tyr Asp Glu Phe Pro Tyr 85 90
95Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala Ala
100 105 110Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys
Ser Gly 115 120 125Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr
Pro Arg Glu Ala 130 135 140Lys Val Gln Trp Lys Val Asp Asn Ala Leu
Gln Ser Gly Asn Ser Gln145 150 155 160Glu Ser Val Thr Glu Gln Asp
Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165 170 175Ser Thr Leu Thr Leu
Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr 180 185 190Ala Cys Glu
Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser 195 200 205Phe
Asn Arg Gly Glu Cys 210103214PRTArtificial SequenceLight Chain (LC)
Sequence 103Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser
Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile
Asn Ser His 20 25 30Leu Ser Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro
Lys Leu Leu Ile 35 40 45Tyr Arg Ala Asn Arg Leu Ala Thr Gly Val Pro
Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Phe Thr
Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Ile Ala Thr Tyr Tyr Cys
Gln Gln Tyr Asp Glu Phe Pro Tyr 85 90 95Thr Phe Gly Gly Gly Thr Lys
Leu Glu Ile Lys Arg Thr Val Ala Ala 100 105 110Pro Ser Val Phe Ile
Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120 125Thr Ala Ser
Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140Lys
Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150
155 160Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu
Ser 165 170 175Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His
Lys Val Tyr 180 185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser
Pro Val Thr Lys Ser 195 200 205Phe Asn Arg Gly Glu Cys
210104214PRTArtificial SequenceLight Chain (LC) Sequence 104Asp Ile
Lys Met Thr Gln Ser Pro Ser Ser Met Tyr Ala Ser Leu Gly1 5 10 15Gln
Arg Val Thr Ile Thr Cys Lys Ala Ser Gln Asp Ile Asn Ser His 20 25
30Leu Ser Trp Phe Gln Glu Lys Pro Gly Lys Ser Pro Lys Thr Leu Ile
35 40 45Tyr Arg Ala Asn Arg Leu Ala Asp Gly Val Pro Ser Arg Phe Ser
Gly 50 55 60Ser Gly Ser Gly Gln Asp Tyr Phe Leu Thr Ile Ser Ser Leu
Glu Tyr65 70 75 80Glu Asp Val Gly Ile Tyr Tyr Cys Leu Gln Tyr Asp
Glu Phe Pro Tyr 85 90 95Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys
Arg Thr Val Ala Ala 100 105 110Pro Ser Val Phe Ile Phe Pro Pro Ser
Asp Glu Gln Leu Lys Ser Gly 115 120 125Thr Ala Ser Val Val Cys Leu
Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140Lys Val Gln Trp Lys
Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150 155 160Glu Ser
Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165 170
175Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr
180 185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr
Lys Ser 195 200 205Phe Asn Arg Gly Glu Cys 210105214PRTArtificial
SequenceLight Chain (LC) Sequence 105Asp Ile Gln Met Thr Gln Ser
Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr
Cys Lys Ala Ser Glu Asp Ile Tyr Asp Arg 20 25 30Val Ala Trp Tyr Gln
Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Gly Thr Ala
Ser Leu Glu Thr Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser
Gly Thr Asp Phe Thr Phe Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu
Asp Ile Ala Thr Tyr Tyr Cys Gln Gln Tyr Trp Thr Thr Pro Trp 85 90
95Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala
100 105 110Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys
Ser Gly 115 120 125Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr
Pro Arg Glu Ala 130 135 140Lys Val Gln Trp Lys Val Asp Asn Ala Leu
Gln Ser Gly Asn Ser Gln145 150 155 160Glu Ser Val Thr Glu Gln Asp
Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165 170 175Ser Thr Leu Thr Leu
Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr 180 185 190Ala Cys Glu
Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser 195 200 205Phe
Asn Arg Gly Glu Cys 210106214PRTArtificial SequenceLight Chain (LC)
Sequence 106Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser
Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Lys Ala Ser Glu Asp Ile
Tyr Asp Arg 20 25 30Val Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro
Lys Leu Leu Ile 35 40 45Tyr Gly Thr Ala Ser Leu Glu Thr Gly Val Pro
Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr
Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys
Gln Gln Tyr Trp Thr Thr Pro Trp 85 90 95Thr Phe Gly Gly Gly Thr Lys
Val Glu Ile Lys Arg Thr Val Ala Ala 100 105 110Pro Ser Val Phe Ile
Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120 125Thr Ala Ser
Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140Lys
Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150
155 160Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu
Ser 165 170 175Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His
Lys Val Tyr 180 185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser
Pro Val Thr Lys Ser 195 200 205Phe Asn Arg Gly Glu Cys
210107214PRTArtificial SequenceLight Chain (LC) Sequence 107Asp Ile
Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp
Arg Val Thr Ile Thr Cys Lys Ala Ser Glu Asp Ile Tyr Asp Arg 20 25
30Val Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile
35 40 45Tyr Gly Thr Ala Ser Leu Glu Thr Gly Val Leu Ser Arg Phe Ser
Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu
Gln Ala65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Tyr Trp
Thr Thr Pro Trp 85 90 95Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys
Arg Thr Val Ala Ala 100 105 110Pro Ser Val Phe Ile Phe Pro Pro Ser
Asp Glu Gln Leu Lys Ser Gly 115 120 125Thr Ala Ser Val Val Cys Leu
Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140Lys Val Gln Trp Lys
Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150 155 160Glu Ser
Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165 170
175Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr
180 185 190Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr
Lys Ser 195 200 205Phe Asn Arg Gly Glu Cys 210108214PRTArtificial
SequenceLight Chain (LC) Sequence 108Asp Ile Gln Met Thr Gln Ser
Ser Ser Ser Phe Ser Gly Ser Leu Gly1 5 10 15Asp Arg Leu Thr Ile Asn
Cys Lys Ala Ser Glu Asp Ile Tyr Asp Arg 20 25 30Val Ala Trp Tyr Gln
Gln Lys Pro Gly Asn Ala Pro Arg Leu Leu Ile 35 40 45Ser Gly Thr Ala
Ser Leu Glu Thr Gly Val Leu Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser
Gly Lys Asp Tyr Thr Leu Ser Ile Asn Gly Leu Gln Ala65 70 75 80Glu
Asp Val Ala Thr Tyr Tyr Cys Gln Gln Tyr Trp Thr Thr Pro Trp 85 90
95Thr Phe Gly Gly Gly Thr Lys Leu Glu Ile Lys Arg Thr Val Ala Ala
100 105 110Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys
Ser Gly 115 120 125Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr
Pro Arg Glu Ala 130 135 140Lys Val Gln Trp Lys Val Asp Asn Ala Leu
Gln Ser Gly Asn Ser Gln145 150 155 160Glu Ser Val Thr Glu Gln Asp
Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165 170 175Ser Thr Leu Thr Leu
Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr 180 185 190Ala
Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser 195 200
205Phe Asn Arg Gly Glu Cys 210109445PRTArtificial SequenceHeavy
Chain (HC) Sequence 109Gln Val Gln Leu Gln Gln Ser Gly Ala Glu Leu
Met Lys Pro Gly Ala1 5 10 15Ser Val Lys Ile Ser Cys Lys Ala Thr Gly
Tyr Ser Phe Thr Lys Tyr 20 25 30Trp Ile Glu Trp Val Lys Gln Arg Pro
Gly His Gly Leu Glu Trp Ile 35 40 45Gly Glu Ile Leu Pro Gly Ser Val
Ile Thr Asn Tyr Asn Glu Lys Phe 50 55 60Lys Gly Lys Ala Thr Phe Thr
Ala Asp Thr Ser Ser Asn Thr Val Tyr65 70 75 80Met Gln Leu Ser Ser
Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90 95Thr Lys Trp Gly
Leu Tyr Asp Ser Asp Asp Gly Val Asp Tyr Trp Gly 100 105 110Gln Gly
Thr Thr Leu Thr Val Ser Ser Ala Lys Thr Thr Pro Pro Ser 115 120
125Val Tyr Pro Leu Ala Pro Gly Ser Ala Ala Gln Thr Asn Ser Met Val
130 135 140Thr Leu Gly Cys Leu Val Lys Gly Tyr Phe Pro Glu Pro Val
Thr Val145 150 155 160Thr Trp Asn Ser Gly Ser Leu Ser Ser Gly Val
His Thr Phe Pro Ala 165 170 175Val Leu Gln Ser Asp Leu Tyr Thr Leu
Ser Ser Ser Val Thr Val Pro 180 185 190Ser Ser Thr Trp Pro Ser Glu
Thr Val Thr Cys Asn Val Ala His Pro 195 200 205Ala Ser Ser Thr Lys
Val Asp Lys Lys Ile Val Pro Arg Asp Cys Gly 210 215 220Cys Lys Pro
Cys Ile Cys Thr Val Pro Glu Val Ser Ser Val Phe Ile225 230 235
240Phe Pro Pro Lys Pro Lys Asp Val Leu Thr Ile Thr Leu Thr Pro Lys
245 250 255Val Thr Cys Val Val Val Asp Ile Ser Lys Asp Asp Pro Glu
Val Gln 260 265 270Phe Ser Trp Phe Val Asp Asp Val Glu Val His Thr
Ala Gln Thr Gln 275 280 285Pro Arg Glu Glu Gln Phe Asn Ser Thr Phe
Arg Ser Val Ser Glu Leu 290 295 300Pro Ile Met His Gln Asp Trp Leu
Asn Gly Lys Glu Phe Lys Cys Arg305 310 315 320Val Asn Ser Ala Ala
Phe Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys 325 330 335Thr Lys Gly
Arg Pro Lys Ala Pro Gln Val Tyr Thr Ile Pro Pro Pro 340 345 350Lys
Glu Gln Met Ala Lys Asp Lys Val Ser Leu Thr Cys Met Ile Thr 355 360
365Asp Phe Phe Pro Glu Asp Ile Thr Val Glu Trp Gln Trp Asn Gly Gln
370 375 380Pro Ala Glu Asn Tyr Lys Asn Thr Gln Pro Ile Met Asp Thr
Asp Gly385 390 395 400Ser Tyr Phe Val Tyr Ser Lys Leu Asn Val Gln
Lys Ser Asn Trp Glu 405 410 415Ala Gly Asn Thr Phe Thr Cys Ser Val
Leu His Glu Gly Leu His Asn 420 425 430His His Thr Glu Lys Ser Leu
Ser His Ser Pro Gly Lys 435 440 445110443PRTArtificial
SequenceHeavy Chain (HC) Sequence 110Glu Val Lys Leu Val Glu Ser
Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Lys Leu Ser Cys
Ala Ala Ser Gly Phe Ser Phe Ser Gly Cys 20 25 30Thr Met Ser Trp Ile
Arg Gln Thr Pro Glu Arg Arg Leu Glu Trp Val 35 40 45Ala Tyr Ile Ser
Asn Gly Gly Asp Ile Thr Tyr Tyr Pro Asp Thr Val 50 55 60Lys Gly Arg
Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu
Gln Met Ser Ser Leu Lys Ser Glu Asp Thr Ala Met Tyr Tyr Cys 85 90
95Ala Arg Leu Asp Gly Tyr Tyr Tyr Ala Met Asp Phe Trp Gly Gln Gly
100 105 110Thr Ser Val Thr Val Ser Ser Ala Lys Thr Thr Pro Pro Ser
Val Tyr 115 120 125Pro Leu Ala Pro Gly Ser Ala Ala Gln Thr Asn Ser
Met Val Thr Leu 130 135 140Gly Cys Leu Val Lys Gly Tyr Phe Pro Glu
Pro Val Thr Val Thr Trp145 150 155 160Asn Ser Gly Ser Leu Ser Ser
Gly Val His Thr Phe Pro Ala Val Leu 165 170 175Gln Ser Asp Leu Tyr
Thr Leu Ser Ser Ser Val Thr Val Pro Ser Ser 180 185 190Thr Trp Pro
Ser Glu Thr Val Thr Cys Asn Val Ala His Pro Ala Ser 195 200 205Ser
Thr Lys Val Asp Lys Lys Ile Val Pro Arg Asp Cys Gly Cys Lys 210 215
220Pro Cys Ile Cys Thr Val Pro Glu Val Ser Ser Val Phe Ile Phe
Pro225 230 235 240Pro Lys Pro Lys Asp Val Leu Thr Ile Thr Leu Thr
Pro Lys Val Thr 245 250 255Cys Val Val Val Asp Ile Ser Lys Asp Asp
Pro Glu Val Gln Phe Ser 260 265 270Trp Phe Val Asp Asp Val Glu Val
His Thr Ala Gln Thr Gln Pro Arg 275 280 285Glu Glu Gln Phe Asn Ser
Thr Phe Arg Ser Val Ser Glu Leu Pro Ile 290 295 300Met His Gln Asp
Trp Leu Asn Gly Lys Glu Phe Lys Cys Arg Val Asn305 310 315 320Ser
Ala Ala Phe Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys 325 330
335Gly Arg Pro Lys Ala Pro Gln Val Tyr Thr Ile Pro Pro Pro Lys Glu
340 345 350Gln Met Ala Lys Asp Lys Val Ser Leu Thr Cys Met Ile Thr
Asp Phe 355 360 365Phe Pro Glu Asp Ile Thr Val Glu Trp Gln Trp Asn
Gly Gln Pro Ala 370 375 380Glu Asn Tyr Lys Asn Thr Gln Pro Ile Met
Asp Thr Asp Gly Ser Tyr385 390 395 400Phe Val Tyr Ser Lys Leu Asn
Val Gln Lys Ser Asn Trp Glu Ala Gly 405 410 415Asn Thr Phe Thr Cys
Ser Val Leu His Glu Gly Leu His Asn His His 420 425 430Thr Glu Lys
Ser Leu Ser His Ser Pro Gly Lys 435 440111445PRTArtificial
SequenceHeavy Chain (HC) Sequence 111Glu Val Gln Leu Gln Gln Ser
Gly Pro Glu Val Val Lys Pro Gly Ala1 5 10 15Ser Val Lys Met Ser Cys
Lys Ala Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25 30Val Met His Trp Val
Lys Gln Lys Pro Gly Gln Gly Leu Glu Trp Ile 35 40 45Gly Tyr Ile Asn
Pro Tyr Asn Asp Gly Pro Lys Tyr Asn Glu Lys Phe 50 55 60Lys Gly Lys
Ala Thr Leu Thr Ser Asp Lys Ser Ser Ser Thr Ala Tyr65 70 75 80Met
Glu Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Phe Cys 85 90
95Ala Arg Trp Asp Tyr Phe Asn Ser Ala Ser Gly Phe Ala Phe Trp Gly
100 105 110Gln Gly Thr Leu Val Thr Val Ser Ala Ala Lys Thr Thr Pro
Pro Ser 115 120 125Val Tyr Pro Leu Ala Pro Gly Ser Ala Ala Gln Thr
Asn Ser Met Val 130 135 140Thr Leu Gly Cys Leu Val Lys Gly Tyr Phe
Pro Glu Pro Val Thr Val145 150 155 160Thr Trp Asn Ser Gly Ser Leu
Ser Ser Gly Val His Thr Phe Pro Ala 165 170 175Val Leu Gln Ser Asp
Leu Tyr Thr Leu Ser Ser Ser Val Thr Val Pro 180 185 190Ser Ser Thr
Trp Pro Ser Glu Thr Val Thr Cys Asn Val Ala His Pro 195 200 205Ala
Ser Ser Thr Lys Val Asp Lys Lys Ile Val Pro Arg Asp Cys Gly 210 215
220Cys Lys Pro Cys Ile Cys Thr Val Pro Glu Val Ser Ser Val Phe
Ile225 230 235 240Phe Pro Pro Lys Pro Lys Asp Val Leu Thr Ile Thr
Leu Thr Pro Lys 245 250 255Val Thr Cys Val Val Val Asp Ile Ser Lys
Asp Asp Pro Glu Val Gln 260 265 270Phe Ser Trp Phe Val Asp Asp Val
Glu Val His Thr Ala Gln Thr Gln 275 280 285Pro Arg Glu Glu Gln Phe
Asn Ser Thr Phe Arg Ser Val Ser Glu Leu 290 295 300Pro Ile Met His
Gln Asp Trp Leu Asn Gly Lys Glu Phe Lys Cys Arg305 310 315 320Val
Asn Ser Ala Ala Phe Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys 325 330
335Thr Lys Gly Arg Pro Lys Ala Pro Gln Val Tyr Thr Ile Pro Pro Pro
340 345 350Lys Glu Gln Met Ala Lys Asp Lys Val Ser Leu Thr Cys Met
Ile Thr 355 360 365Asp Phe Phe Pro Glu Asp Ile Thr Val Glu Trp Gln
Trp Asn Gly Gln 370 375 380Pro Ala Glu Asn Tyr Lys Asn Thr Gln Pro
Ile Met Asp Thr Asp Gly385 390 395 400Ser Tyr Phe Val Tyr Ser Lys
Leu Asn Val Gln Lys Ser Asn Trp Glu 405 410 415Ala Gly Asn Thr Phe
Thr Cys Ser Val Leu His Glu Gly Leu His Asn 420 425 430His His Thr
Glu Lys Ser Leu Ser His Ser Pro Gly Lys 435 440
445112449PRTArtificial SequenceHeavy Chain (HC) Sequence 112Gln Val
Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Ser
Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr 20 25
30Phe Leu Asn Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met
35 40 45Gly Arg Ile Asn Pro Tyr Asn Gly Asp Ser Phe Ile Asn Gln Asn
Phe 50 55 60Arg Asp Arg Val Thr Met Thr Arg Asp Thr Ser Thr Ser Thr
Val Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala
Val Tyr Tyr Cys 85 90 95Ala Arg Gly Gly Tyr Asp Gly Tyr Phe Ile Ala
Tyr Phe Asp Tyr Trp 100 105 110Gly Ala Gly Thr Thr Val Thr Val Ser
Ser Ala Ser Thr Lys Gly Pro 115 120 125Ser Val Phe Pro Leu Ala Pro
Cys Ser Arg Ser Thr Ser Glu Ser Thr 130 135 140Ala Ala Leu Gly Cys
Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr145 150 155 160Val Ser
Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro 165 170
175Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr
180 185 190Val Pro Ser Ser Ser Leu Gly Thr Lys Thr Tyr Thr Cys Asn
Val Asp 195 200 205His Lys Pro Ser Asn Thr Lys Val Asp Lys Arg Val
Glu Ser Lys Tyr 210 215 220Gly Pro Pro Cys Pro Pro Cys Pro Ala Pro
Glu Phe Leu Gly Gly Pro225 230 235 240Ser Val Phe Leu Phe Pro Pro
Lys Pro Lys Asp Thr Leu Met Ile Ser 245 250 255Arg Thr Pro Glu Val
Thr Cys Val Val Val Asp Val Ser Gln Glu Asp 260 265 270Pro Glu Val
Gln Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 275 280 285Ala
Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn Ser Thr Tyr Arg Val 290 295
300Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys
Glu305 310 315 320Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro Ser
Ser Ile Glu Lys 325 330 335Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg
Glu Pro Gln Val Tyr Thr 340 345 350Leu Pro Pro Ser Gln Glu Glu Met
Thr Lys Asn Gln Val Ser Leu Thr 355 360 365Cys Leu Val Lys Gly Phe
Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 370 375 380Ser Asn Gly Gln
Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu385 390 395 400Asp
Ser Asp Gly Ser Phe Phe Leu Tyr Ser Arg Leu Thr Val Asp Lys 405 410
415Ser Arg Trp Gln Glu Gly Asn Val Phe Ser Cys Ser Val Met His Glu
420 425 430Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser
Leu Gly 435 440 445Lys113449PRTArtificial SequenceHeavy Chain (HC)
Sequence 113Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro
Gly Ser1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ser Phe
Thr Asp Tyr 20 25 30Phe Leu Asn Trp Val Arg Gln Ala Pro Gly Gln Gly
Leu Glu Trp Met 35 40 45Gly Arg Ile Asn Pro Tyr Asn Gly Asp Ser Phe
Ile Asn Gln Asn Phe 50 55 60Arg Asp Arg Val Thr Ile Thr Ala Asp Lys
Ser Thr Ser Thr Ala Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser
Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Gly Gly Tyr Asp Gly
Tyr Phe Ile Ala Tyr Phe Asp Tyr Trp 100 105 110Gly Ala Gly Thr Thr
Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro 115 120 125Ser Val Phe
Pro Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser Thr 130 135 140Ala
Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr145 150
155 160Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe
Pro 165 170 175Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser
Val Val Thr 180 185 190Val Pro Ser Ser Ser Leu Gly Thr Lys Thr Tyr
Thr Cys Asn Val Asp 195 200 205His Lys Pro Ser Asn Thr Lys Val Asp
Lys Arg Val Glu Ser Lys Tyr 210 215 220Gly Pro Pro Cys Pro Pro Cys
Pro Ala Pro Glu Phe Leu Gly Gly Pro225 230 235 240Ser Val Phe Leu
Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 245 250 255Arg Thr
Pro Glu Val Thr Cys Val Val Val Asp Val Ser Gln Glu Asp 260 265
270Pro Glu Val Gln Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn
275 280 285Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn Ser Thr Tyr
Arg Val 290 295 300Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu
Asn Gly Lys Glu305 310 315 320Tyr Lys Cys Lys Val Ser Asn Lys Gly
Leu Pro Ser Ser Ile Glu Lys 325 330 335Thr Ile Ser Lys Ala Lys Gly
Gln Pro Arg Glu Pro Gln Val Tyr Thr 340 345 350Leu Pro Pro Ser Gln
Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr 355 360 365Cys Leu Val
Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 370 375 380Ser
Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu385 390
395 400Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Arg Leu Thr Val Asp
Lys 405 410 415Ser Arg Trp Gln Glu Gly Asn Val Phe Ser Cys Ser Val
Met His Glu 420 425 430Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu
Ser Leu Ser Leu Gly 435 440 445Lys114449PRTArtificial SequenceHeavy
Chain (HC) Sequence 114Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val
Lys Lys Pro Gly Glu1 5 10 15Ser Leu Lys Ile Ser Cys Lys Gly Ser Gly
Tyr Ser Phe Thr Asp Tyr 20 25 30Phe Leu Asn Trp Val Arg Gln Met Pro
Gly Lys Gly Leu Glu Trp Met 35 40 45Gly Arg Ile Asn Pro Tyr Asn Gly
Asp Ser Phe Ile Asn Gln Asn Phe 50 55 60Arg Asp Gln Val Thr Ile Ser
Ala Asp Lys Ser Ile Ser Thr Ala Tyr65 70 75 80Leu Gln Trp Ser Ser
Leu Lys Ala Ser Asp Thr Ala Met Tyr Tyr Cys 85 90 95Ala Arg Gly Gly
Tyr Asp Gly Tyr Phe Ile Ala Tyr Phe Asp Tyr Trp 100 105 110Gly Ala
Gly Thr Thr Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro 115 120
125Ser Val Phe Pro Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser Thr
130 135 140Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro
Val Thr145 150 155 160Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly
Val His Thr Phe Pro 165 170 175Ala Val Leu Gln Ser
Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr 180 185 190Val Pro Ser
Ser Ser Leu Gly Thr Lys Thr Tyr Thr Cys Asn Val Asp 195 200 205His
Lys Pro Ser Asn Thr Lys Val Asp Lys Arg Val Glu Ser Lys Tyr 210 215
220Gly Pro Pro Cys Pro Pro Cys Pro Ala Pro Glu Phe Leu Gly Gly
Pro225 230 235 240Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
Leu Met Ile Ser 245 250 255Arg Thr Pro Glu Val Thr Cys Val Val Val
Asp Val Ser Gln Glu Asp 260 265 270Pro Glu Val Gln Phe Asn Trp Tyr
Val Asp Gly Val Glu Val His Asn 275 280 285Ala Lys Thr Lys Pro Arg
Glu Glu Gln Phe Asn Ser Thr Tyr Arg Val 290 295 300Val Ser Val Leu
Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu305 310 315 320Tyr
Lys Cys Lys Val Ser Asn Lys Gly Leu Pro Ser Ser Ile Glu Lys 325 330
335Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
340 345 350Leu Pro Pro Ser Gln Glu Glu Met Thr Lys Asn Gln Val Ser
Leu Thr 355 360 365Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
Val Glu Trp Glu 370 375 380Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys
Thr Thr Pro Pro Val Leu385 390 395 400Asp Ser Asp Gly Ser Phe Phe
Leu Tyr Ser Arg Leu Thr Val Asp Lys 405 410 415Ser Arg Trp Gln Glu
Gly Asn Val Phe Ser Cys Ser Val Met His Glu 420 425 430Ala Leu His
Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Leu Gly 435 440
445Lys115449PRTArtificial SequenceHeavy Chain (HC) Sequence 115Gln
Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10
15Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Ser Phe Thr Asp Tyr
20 25 30Phe Leu Asn Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp
Met 35 40 45Gly Arg Ile Asn Pro Tyr Asn Gly Asp Ser Phe Ile Asn Gln
Asn Phe 50 55 60Arg Asp Arg Val Thr Met Thr Val Asp Thr Ser Thr Ser
Thr Val Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90 95Ala Arg Gly Gly Tyr Asp Gly Tyr Phe Ile
Ala Tyr Phe Asp Tyr Trp 100 105 110Gly Ala Gly Thr Thr Val Thr Val
Ser Ser Ala Ser Thr Lys Gly Pro 115 120 125Ser Val Phe Pro Leu Ala
Pro Cys Ser Arg Ser Thr Ser Glu Ser Thr 130 135 140Ala Ala Leu Gly
Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr145 150 155 160Val
Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro 165 170
175Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr
180 185 190Val Pro Ser Ser Ser Leu Gly Thr Lys Thr Tyr Thr Cys Asn
Val Asp 195 200 205His Lys Pro Ser Asn Thr Lys Val Asp Lys Arg Val
Glu Ser Lys Tyr 210 215 220Gly Pro Pro Cys Pro Pro Cys Pro Ala Pro
Glu Phe Leu Gly Gly Pro225 230 235 240Ser Val Phe Leu Phe Pro Pro
Lys Pro Lys Asp Thr Leu Met Ile Ser 245 250 255Arg Thr Pro Glu Val
Thr Cys Val Val Val Asp Val Ser Gln Glu Asp 260 265 270Pro Glu Val
Gln Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn 275 280 285Ala
Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn Ser Thr Tyr Arg Val 290 295
300Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys
Glu305 310 315 320Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro Ser
Ser Ile Glu Lys 325 330 335Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg
Glu Pro Gln Val Tyr Thr 340 345 350Leu Pro Pro Ser Gln Glu Glu Met
Thr Lys Asn Gln Val Ser Leu Thr 355 360 365Cys Leu Val Lys Gly Phe
Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 370 375 380Ser Asn Gly Gln
Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu385 390 395 400Asp
Ser Asp Gly Ser Phe Phe Leu Tyr Ser Arg Leu Thr Val Asp Lys 405 410
415Ser Arg Trp Gln Glu Gly Asn Val Phe Ser Cys Ser Val Met His Glu
420 425 430Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser
Leu Gly 435 440 445Lys116449PRTArtificial SequenceHeavy Chain (HC)
Sequence 116Glu Val Gln Leu Gln Gln Ser Gly Pro Asp Leu Val Lys Pro
Gly Ala1 5 10 15Ser Val Lys Ile Ser Cys Lys Ala Ser Gly Tyr Ser Phe
Thr Asp Tyr 20 25 30Phe Leu Asn Trp Val Lys Gln Ser His Gly Lys Ser
Leu Glu Trp Ile 35 40 45Gly Arg Ile Asn Pro Tyr Asn Gly Asp Ser Phe
Ile Asn Gln Asn Phe 50 55 60Arg Asp Lys Ala Thr Leu Thr Val Asp Lys
Ser Ser Thr Thr Ala His65 70 75 80Met Asp Leu Leu Ser Leu Thr Ser
Glu Asp Ser Ala Ile Tyr Tyr Cys 85 90 95Gly Arg Gly Gly Tyr Asp Gly
Tyr Phe Ile Ala Tyr Phe Asp Tyr Trp 100 105 110Gly Gln Gly Ser Leu
Val Thr Val Ser Ala Ala Ser Thr Lys Gly Pro 115 120 125Ser Val Phe
Pro Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser Thr 130 135 140Ala
Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr145 150
155 160Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr Phe
Pro 165 170 175Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser
Val Val Thr 180 185 190Val Pro Ser Ser Ser Leu Gly Thr Lys Thr Tyr
Thr Cys Asn Val Asp 195 200 205His Lys Pro Ser Asn Thr Lys Val Asp
Lys Arg Val Glu Ser Lys Tyr 210 215 220Gly Pro Pro Cys Pro Pro Cys
Pro Ala Pro Glu Phe Leu Gly Gly Pro225 230 235 240Ser Val Phe Leu
Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 245 250 255Arg Thr
Pro Glu Val Thr Cys Val Val Val Asp Val Ser Gln Glu Asp 260 265
270Pro Glu Val Gln Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn
275 280 285Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn Ser Thr Tyr
Arg Val 290 295 300Val Ser Val Leu Thr Val Leu His Gln Asp Trp Leu
Asn Gly Lys Glu305 310 315 320Tyr Lys Cys Lys Val Ser Asn Lys Gly
Leu Pro Ser Ser Ile Glu Lys 325 330 335Thr Ile Ser Lys Ala Lys Gly
Gln Pro Arg Glu Pro Gln Val Tyr Thr 340 345 350Leu Pro Pro Ser Gln
Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr 355 360 365Cys Leu Val
Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 370 375 380Ser
Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu385 390
395 400Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Arg Leu Thr Val Asp
Lys 405 410 415Ser Arg Trp Gln Glu Gly Asn Val Phe Ser Cys Ser Val
Met His Glu 420 425 430Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu
Ser Leu Ser Leu Gly 435 440 445Lys117446PRTArtificial SequenceHeavy
Chain (HC) Sequence 117Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val
Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser Gly
Tyr Thr Phe Thr Asp Tyr 20 25 30Glu Ile His Trp Val Arg Gln Ala Pro
Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Asp Ile His Pro Gly Ser Gly
Gly Thr Ala Asn Asn Gln Lys Phe 50 55 60Lys Gly Arg Val Thr Met Thr
Arg Asp Thr Ser Thr Ser Thr Val Tyr65 70 75 80Met Glu Leu Ser Ser
Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Ala Val
Ser Gly Tyr Tyr Ala Met Asp Tyr Trp Gly Gln Gly 100 105 110Thr Leu
Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser Val Phe 115 120
125Pro Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser Thr Ala Ala Leu
130 135 140Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val Thr Val
Ser Trp145 150 155 160Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr
Phe Pro Ala Val Leu 165 170 175Gln Ser Ser Gly Leu Tyr Ser Leu Ser
Ser Val Val Thr Val Pro Ser 180 185 190Ser Ser Leu Gly Thr Lys Thr
Tyr Thr Cys Asn Val Asp His Lys Pro 195 200 205Ser Asn Thr Lys Val
Asp Lys Arg Val Glu Ser Lys Tyr Gly Pro Pro 210 215 220Cys Pro Pro
Cys Pro Ala Pro Glu Phe Leu Gly Gly Pro Ser Val Phe225 230 235
240Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro
245 250 255Glu Val Thr Cys Val Val Val Asp Val Ser Gln Glu Asp Pro
Glu Val 260 265 270Gln Phe Asn Trp Tyr Val Asp Gly Val Glu Val His
Asn Ala Lys Thr 275 280 285Lys Pro Arg Glu Glu Gln Phe Asn Ser Thr
Tyr Arg Val Val Ser Val 290 295 300Leu Thr Val Leu His Gln Asp Trp
Leu Asn Gly Lys Glu Tyr Lys Cys305 310 315 320Lys Val Ser Asn Lys
Gly Leu Pro Ser Ser Ile Glu Lys Thr Ile Ser 325 330 335Lys Ala Lys
Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro 340 345 350Ser
Gln Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val 355 360
365Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly
370 375 380Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp
Ser Asp385 390 395 400Gly Ser Phe Phe Leu Tyr Ser Arg Leu Thr Val
Asp Lys Ser Arg Trp 405 410 415Gln Glu Gly Asn Val Phe Ser Cys Ser
Val Met His Glu Ala Leu His 420 425 430Asn His Tyr Thr Gln Lys Ser
Leu Ser Leu Ser Leu Gly Lys 435 440 445118446PRTArtificial
SequenceHeavy Chain (HC) Sequence 118Gln Val Gln Leu Val Gln Ser
Gly Ala Glu Val Lys Lys Pro Gly Ser1 5 10 15Ser Val Lys Val Ser Cys
Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr 20 25 30Glu Ile His Trp Val
Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Asp Ile His
Pro Gly Ser Gly Gly Thr Ala Asn Asn Gln Lys Phe 50 55 60Lys Gly Arg
Val Thr Ile Thr Ala Asp Glu Ser Thr Ser Thr Ala Tyr65 70 75 80Met
Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90
95Ala Arg Ala Val Ser Gly Tyr Tyr Ala Met Asp Tyr Trp Gly Gln Gly
100 105 110Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser
Val Phe 115 120 125Pro Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser
Thr Ala Ala Leu 130 135 140Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu
Pro Val Thr Val Ser Trp145 150 155 160Asn Ser Gly Ala Leu Thr Ser
Gly Val His Thr Phe Pro Ala Val Leu 165 170 175Gln Ser Ser Gly Leu
Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser 180 185 190Ser Ser Leu
Gly Thr Lys Thr Tyr Thr Cys Asn Val Asp His Lys Pro 195 200 205Ser
Asn Thr Lys Val Asp Lys Arg Val Glu Ser Lys Tyr Gly Pro Pro 210 215
220Cys Pro Pro Cys Pro Ala Pro Glu Phe Leu Gly Gly Pro Ser Val
Phe225 230 235 240Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
Ser Arg Thr Pro 245 250 255Glu Val Thr Cys Val Val Val Asp Val Ser
Gln Glu Asp Pro Glu Val 260 265 270Gln Phe Asn Trp Tyr Val Asp Gly
Val Glu Val His Asn Ala Lys Thr 275 280 285Lys Pro Arg Glu Glu Gln
Phe Asn Ser Thr Tyr Arg Val Val Ser Val 290 295 300Leu Thr Val Leu
His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys305 310 315 320Lys
Val Ser Asn Lys Gly Leu Pro Ser Ser Ile Glu Lys Thr Ile Ser 325 330
335Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro
340 345 350Ser Gln Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys
Leu Val 355 360 365Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp
Glu Ser Asn Gly 370 375 380Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro
Pro Val Leu Asp Ser Asp385 390 395 400Gly Ser Phe Phe Leu Tyr Ser
Arg Leu Thr Val Asp Lys Ser Arg Trp 405 410 415Gln Glu Gly Asn Val
Phe Ser Cys Ser Val Met His Glu Ala Leu His 420 425 430Asn His Tyr
Thr Gln Lys Ser Leu Ser Leu Ser Leu Gly Lys 435 440
445119446PRTArtificial SequenceHeavy Chain (HC) Sequence 119Gln Val
Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15Ser
Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Asp Tyr 20 25
30Glu Ile His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met
35 40 45Gly Asp Ile His Pro Gly Ser Gly Gly Thr Ala Asn Asn Gln Lys
Phe 50 55 60Lys Gly Arg Val Thr Met Thr Ala Asp Thr Ser Thr Ser Thr
Val Tyr65 70 75 80Met Glu Leu Ser Ser Leu Arg Ser Glu Asp Thr Ala
Val Tyr Tyr Cys 85 90 95Thr Arg Ala Val Ser Gly Tyr Tyr Ala Met Asp
Tyr Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser Ala Ser
Thr Lys Gly Pro Ser Val Phe 115 120 125Pro Leu Ala Pro Cys Ser Arg
Ser Thr Ser Glu Ser Thr Ala Ala Leu 130 135 140Gly Cys Leu Val Lys
Asp Tyr Phe Pro Glu Pro Val Thr Val Ser Trp145 150 155 160Asn Ser
Gly Ala Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu 165 170
175Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser
180 185 190Ser Ser Leu Gly Thr Lys Thr Tyr Thr Cys Asn Val Asp His
Lys Pro 195 200 205Ser Asn Thr Lys Val Asp Lys Arg Val Glu Ser Lys
Tyr Gly Pro Pro 210 215 220Cys Pro Pro Cys Pro Ala Pro Glu Phe Leu
Gly Gly Pro Ser Val Phe225 230 235 240Leu Phe Pro Pro Lys Pro Lys
Asp Thr Leu Met Ile Ser Arg Thr Pro 245 250 255Glu Val Thr Cys Val
Val Val Asp Val Ser Gln Glu Asp Pro Glu Val 260 265 270Gln Phe Asn
Trp Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr 275 280 285Lys
Pro Arg Glu Glu Gln Phe Asn Ser Thr Tyr Arg Val Val Ser Val 290 295
300Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys
Cys305 310 315 320Lys Val Ser Asn Lys Gly Leu Pro Ser Ser Ile Glu
Lys Thr Ile Ser 325 330 335Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln
Val Tyr Thr Leu Pro Pro 340 345 350Ser Gln Glu Glu Met Thr Lys Asn
Gln Val Ser Leu Thr Cys Leu Val 355 360 365Lys Gly Phe Tyr Pro Ser
Asp Ile Ala Val Glu Trp Glu Ser Asn Gly 370
375 380Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser
Asp385 390 395 400Gly Ser Phe Phe Leu Tyr Ser Arg Leu Thr Val Asp
Lys Ser Arg Trp 405 410 415Gln Glu Gly Asn Val Phe Ser Cys Ser Val
Met His Glu Ala Leu His 420 425 430Asn His Tyr Thr Gln Lys Ser Leu
Ser Leu Ser Leu Gly Lys 435 440 445120446PRTArtificial
SequenceHeavy Chain (HC) Sequence 120Glu Val Gln Leu Gln Glu Ser
Gly Ala Glu Leu Val Arg Pro Gly Ala1 5 10 15Ser Val Lys Leu Ser Cys
Lys Ala Leu Gly Tyr Thr Phe Thr Asp Tyr 20 25 30Glu Ile His Trp Val
Lys Glu Thr Pro Val Tyr Gly Leu Glu Trp Ile 35 40 45Gly Asp Ile His
Pro Gly Ser Gly Gly Thr Ala Asn Asn Gln Lys Phe 50 55 60Lys Gly Lys
Ala Thr Leu Thr Ala Asp Lys Ser Ser Asn Thr Ala Tyr65 70 75 80Met
Glu Leu Ser Ser Leu Thr Ser Glu Asp Ser Ala Val Tyr Tyr Cys 85 90
95Thr Arg Ala Val Ser Gly Tyr Tyr Ala Met Asp Tyr Trp Gly Gln Gly
100 105 110Thr Ser Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro Ser
Val Phe 115 120 125Pro Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser
Thr Ala Ala Leu 130 135 140Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu
Pro Val Thr Val Ser Trp145 150 155 160Asn Ser Gly Ala Leu Thr Ser
Gly Val His Thr Phe Pro Ala Val Leu 165 170 175Gln Ser Ser Gly Leu
Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser 180 185 190Ser Ser Leu
Gly Thr Lys Thr Tyr Thr Cys Asn Val Asp His Lys Pro 195 200 205Ser
Asn Thr Lys Val Asp Lys Arg Val Glu Ser Lys Tyr Gly Pro Pro 210 215
220Cys Pro Pro Cys Pro Ala Pro Glu Phe Leu Gly Gly Pro Ser Val
Phe225 230 235 240Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile
Ser Arg Thr Pro 245 250 255Glu Val Thr Cys Val Val Val Asp Val Ser
Gln Glu Asp Pro Glu Val 260 265 270Gln Phe Asn Trp Tyr Val Asp Gly
Val Glu Val His Asn Ala Lys Thr 275 280 285Lys Pro Arg Glu Glu Gln
Phe Asn Ser Thr Tyr Arg Val Val Ser Val 290 295 300Leu Thr Val Leu
His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys305 310 315 320Lys
Val Ser Asn Lys Gly Leu Pro Ser Ser Ile Glu Lys Thr Ile Ser 325 330
335Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro
340 345 350Ser Gln Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys
Leu Val 355 360 365Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp
Glu Ser Asn Gly 370 375 380Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro
Pro Val Leu Asp Ser Asp385 390 395 400Gly Ser Phe Phe Leu Tyr Ser
Arg Leu Thr Val Asp Lys Ser Arg Trp 405 410 415Gln Glu Gly Asn Val
Phe Ser Cys Ser Val Met His Glu Ala Leu His 420 425 430Asn His Tyr
Thr Gln Lys Ser Leu Ser Leu Ser Leu Gly Lys 435 440
445121473PRTArtificial SequenceSIRP alpha sequence 121Glu Glu Glu
Leu Gln Val Ile Gln Pro Asp Lys Ser Val Ser Val Ala1 5 10 15Ala Gly
Glu Ser Ala Ile Leu His Cys Thr Val Thr Ser Leu Ile Pro 20 25 30Val
Gly Pro Ile Gln Trp Phe Arg Gly Ala Gly Pro Ala Arg Glu Leu 35 40
45Ile Tyr Asn Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser
50 55 60Glu Ser Thr Lys Arg Glu Asn Met Asp Phe Ser Ile Ser Ile Ser
Asn65 70 75 80Ile Thr Pro Ala Asp Ala Gly Thr Tyr Tyr Cys Val Lys
Phe Arg Lys 85 90 95Gly Ser Pro Asp Thr Glu Phe Lys Ser Gly Ala Gly
Thr Glu Leu Ser 100 105 110Val Arg Ala Lys Pro Ser Ala Pro Val Val
Ser Gly Pro Ala Ala Arg 115 120 125Ala Thr Pro Gln His Thr Val Ser
Phe Thr Cys Glu Ser His Gly Phe 130 135 140Ser Pro Arg Asp Ile Thr
Leu Lys Trp Phe Lys Asn Gly Asn Glu Leu145 150 155 160Ser Asp Phe
Gln Thr Asn Val Asp Pro Val Gly Glu Ser Val Ser Tyr 165 170 175Ser
Ile His Ser Thr Ala Lys Val Val Leu Thr Arg Glu Asp Val His 180 185
190Ser Gln Val Ile Cys Glu Val Ala His Val Thr Leu Gln Gly Asp Pro
195 200 205Leu Arg Gly Thr Ala Asn Leu Ser Glu Thr Ile Arg Val Pro
Pro Thr 210 215 220Leu Glu Val Thr Gln Gln Pro Val Arg Ala Glu Asn
Gln Val Asn Val225 230 235 240Thr Cys Gln Val Arg Lys Phe Tyr Pro
Gln Arg Leu Gln Leu Thr Trp 245 250 255Leu Glu Asn Gly Asn Val Ser
Arg Thr Glu Thr Ala Ser Thr Val Thr 260 265 270Glu Asn Lys Asp Gly
Thr Tyr Asn Trp Met Ser Trp Leu Leu Val Asn 275 280 285Val Ser Ala
His Arg Asp Asp Val Lys Leu Thr Cys Gln Val Glu His 290 295 300Asp
Gly Gln Pro Ala Val Ser Lys Ser His Asp Leu Lys Val Ser Ala305 310
315 320His Pro Lys Glu Gln Gly Ser Asn Thr Ala Ala Glu Asn Thr Gly
Ser 325 330 335Asn Glu Arg Asn Ile Tyr Ile Val Val Gly Val Val Cys
Thr Leu Leu 340 345 350Val Ala Leu Leu Met Ala Ala Leu Tyr Leu Val
Arg Ile Arg Gln Lys 355 360 365Lys Ala Gln Gly Ser Thr Ser Ser Thr
Arg Leu His Glu Pro Glu Lys 370 375 380Asn Ala Arg Glu Ile Thr Gln
Asp Thr Asn Asp Ile Thr Tyr Ala Asp385 390 395 400Leu Asn Leu Pro
Lys Gly Lys Lys Pro Ala Pro Gln Ala Ala Glu Pro 405 410 415Asn Asn
His Thr Glu Tyr Ala Ser Ile Gln Thr Ser Pro Gln Pro Ala 420 425
430Ser Glu Asp Thr Leu Thr Tyr Ala Asp Leu Asp Met Val His Leu Asn
435 440 445Arg Thr Pro Lys Gln Pro Ala Pro Lys Pro Glu Pro Ser Phe
Ser Glu 450 455 460Tyr Ala Ser Val Gln Val Pro Arg Lys465
470122359PRTArtificial SequenceSIRP gamma sequence 122Glu Glu Glu
Leu Gln Met Ile Gln Pro Glu Lys Leu Leu Leu Val Thr1 5 10 15Val Gly
Lys Thr Ala Thr Leu His Cys Thr Val Thr Ser Leu Leu Pro 20 25 30Val
Gly Pro Val Leu Trp Phe Arg Gly Val Gly Pro Gly Arg Glu Leu 35 40
45Ile Tyr Asn Gln Lys Glu Gly His Phe Pro Arg Val Thr Thr Val Ser
50 55 60Asp Leu Thr Lys Arg Asn Asn Met Asp Phe Ser Ile Arg Ile Ser
Ser65 70 75 80Ile Thr Pro Ala Asp Val Gly Thr Tyr Tyr Cys Val Lys
Phe Arg Lys 85 90 95Gly Ser Pro Glu Asn Val Glu Phe Lys Ser Gly Pro
Gly Thr Glu Met 100 105 110Ala Leu Gly Ala Lys Pro Ser Ala Pro Val
Val Leu Gly Pro Ala Ala 115 120 125Arg Thr Thr Pro Glu His Thr Val
Ser Phe Thr Cys Glu Ser His Gly 130 135 140Phe Ser Pro Arg Asp Ile
Thr Leu Lys Trp Phe Lys Asn Gly Asn Glu145 150 155 160Leu Ser Asp
Phe Gln Thr Asn Val Asp Pro Thr Gly Gln Ser Val Ala 165 170 175Tyr
Ser Ile Arg Ser Thr Ala Arg Val Val Leu Asp Pro Trp Asp Val 180 185
190Arg Ser Gln Val Ile Cys Glu Val Ala His Val Thr Leu Gln Gly Asp
195 200 205Pro Leu Arg Gly Thr Ala Asn Leu Ser Glu Ala Ile Arg Val
Pro Pro 210 215 220Thr Leu Glu Val Thr Gln Gln Pro Met Arg Val Gly
Asn Gln Val Asn225 230 235 240Val Thr Cys Gln Val Arg Lys Phe Tyr
Pro Gln Ser Leu Gln Leu Thr 245 250 255Trp Ser Glu Asn Gly Asn Val
Cys Gln Arg Glu Thr Ala Ser Thr Leu 260 265 270Thr Glu Asn Lys Asp
Gly Thr Tyr Asn Trp Thr Ser Trp Phe Leu Val 275 280 285Asn Ile Ser
Asp Gln Arg Asp Asp Val Val Leu Thr Cys Gln Val Lys 290 295 300His
Asp Gly Gln Leu Ala Val Ser Lys Arg Leu Ala Leu Glu Val Thr305 310
315 320Val His Gln Lys Asp Gln Ser Ser Asp Ala Thr Pro Gly Pro Ala
Ser 325 330 335Ser Leu Thr Ala Leu Leu Leu Ile Ala Val Leu Leu Gly
Pro Ile Tyr 340 345 350Val Pro Trp Lys Gln Lys Thr
355123330PRTArtificial SequenceHuman Fc IgG1 Sequence 123Ala Ser
Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser
Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25
30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser
35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr
Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr
Gln Thr65 70 75 80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr
Lys Val Asp Lys 85 90 95Lys Val Glu Pro Lys Ser Cys Asp Lys Thr His
Thr Cys Pro Pro Cys 100 105 110Pro Ala Pro Glu Leu Leu Gly Gly Pro
Ser Val Phe Leu Phe Pro Pro 115 120 125Lys Pro Lys Asp Thr Leu Met
Ile Ser Arg Thr Pro Glu Val Thr Cys 130 135 140Val Val Val Asp Val
Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp145 150 155 160Tyr Val
Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu 165 170
175Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu
180 185 190His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn 195 200 205Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly 210 215 220Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu
Pro Pro Ser Arg Asp Glu225 230 235 240Leu Thr Lys Asn Gln Val Ser
Leu Thr Cys Leu Val Lys Gly Phe Tyr 245 250 255Pro Ser Asp Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn 260 265 270Asn Tyr Lys
Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe 275 280 285Leu
Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 290 295
300Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
Thr305 310 315 320Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 325
330124330PRTArtificial SequenceHuman Fc IgG1-N297Q Sequence 124Ala
Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10
15Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr
20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr
Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu
Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly
Thr Gln Thr65 70 75 80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn
Thr Lys Val Asp Lys 85 90 95Lys Val Glu Pro Lys Ser Cys Asp Lys Thr
His Thr Cys Pro Pro Cys 100 105 110Pro Ala Pro Glu Leu Leu Gly Gly
Pro Ser Val Phe Leu Phe Pro Pro 115 120 125Lys Pro Lys Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys 130 135 140Val Val Val Asp
Val Ser His Glu Asp Pro Glu Val Lys Phe Asn Trp145 150 155 160Tyr
Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu 165 170
175Glu Gln Tyr Gln Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu
180 185 190His Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn 195 200 205Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly 210 215 220Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu
Pro Pro Ser Arg Asp Glu225 230 235 240Leu Thr Lys Asn Gln Val Ser
Leu Thr Cys Leu Val Lys Gly Phe Tyr 245 250 255Pro Ser Asp Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn 260 265 270Asn Tyr Lys
Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe 275 280 285Leu
Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn 290 295
300Val Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
Thr305 310 315 320Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys 325
330125326PRTArtificial SequenceHuman Fc-IgG2 Sequence 125Ala Ser
Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Cys Ser Arg1 5 10 15Ser
Thr Ser Glu Ser Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25
30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser
35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr
Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser Asn Phe Gly Thr
Gln Thr65 70 75 80Tyr Thr Cys Asn Val Asp His Lys Pro Ser Asn Thr
Lys Val Asp Lys 85 90 95Thr Val Glu Arg Lys Cys Cys Val Glu Cys Pro
Pro Cys Pro Ala Pro 100 105 110Pro Val Ala Gly Pro Ser Val Phe Leu
Phe Pro Pro Lys Pro Lys Asp 115 120 125Thr Leu Met Ile Ser Arg Thr
Pro Glu Val Thr Cys Val Val Val Asp 130 135 140Val Ser His Glu Asp
Pro Glu Val Gln Phe Asn Trp Tyr Val Asp Gly145 150 155 160Val Glu
Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn 165 170
175Ser Thr Phe Arg Val Val Ser Val Leu Thr Val Val His Gln Asp Trp
180 185 190Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly
Leu Pro 195 200 205Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly
Gln Pro Arg Glu 210 215 220Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg
Glu Glu Met Thr Lys Asn225 230 235 240Gln Val Ser Leu Thr Cys Leu
Val Lys Gly Phe Tyr Pro Ser Asp Ile 245 250 255Ala Val Glu Trp Glu
Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr 260 265 270Thr Pro Pro
Met Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys 275 280 285Leu
Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys 290 295
300Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser
Leu305 310 315 320Ser Leu Ser Pro Gly Lys 325126377PRTArtificial
SequenceHuman Fc-IgG3 Sequence 126Ala Ser Thr Lys Gly Pro Ser Val
Phe Pro Leu Ala Pro Cys Ser Arg1 5 10 15Ser Thr Ser Gly Gly Thr Ala
Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr
Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe
Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val
Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Thr
Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90
95Arg Val Glu Leu Lys Thr Pro Leu Gly Asp Thr Thr His Thr Cys Pro
100 105 110Arg Cys Pro Glu Pro Lys Ser Cys Asp Thr Pro Pro Pro Cys
Pro Arg 115 120 125Cys Pro Glu Pro Lys Ser Cys Asp Thr Pro Pro Pro
Cys Pro Arg Cys 130 135 140Pro Glu Pro Lys Ser Cys Asp Thr Pro Pro
Pro Cys Pro Arg Cys Pro145 150 155 160Ala Pro Glu Leu Leu Gly Gly
Pro Ser Val Phe Leu Phe Pro Pro Lys 165 170 175Pro Lys Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val 180 185 190Val Val Asp
Val Ser His Glu Asp Pro Glu Val Gln Phe Lys Trp Tyr 195 200 205Val
Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu 210 215
220Gln Tyr Asn Ser Thr Phe Arg Val Val Ser Val Leu Thr Val Leu
His225 230 235 240Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys
Val Ser Asn Lys 245 250 255Ala Leu Pro Ala Pro Ile Glu Lys Thr Ile
Ser Lys Thr Lys Gly Gln 260 265 270Pro Arg Glu Pro Gln Val Tyr Thr
Leu Pro Pro Ser Arg Glu Glu Met 275 280 285Thr Lys Asn Gln Val Ser
Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro 290 295 300Ser Asp Ile Ala
Val Glu Trp Glu Ser Ser Gly Gln Pro Glu Asn Asn305 310 315 320Tyr
Asn Thr Thr Pro Pro Met Leu Asp Ser Asp Gly Ser Phe Phe Leu 325 330
335Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Ile
340 345 350Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn Arg Phe
Thr Gln 355 360 365Lys Ser Leu Ser Leu Ser Pro Gly Lys 370
375127326PRTArtificial SequenceHuman Fc-IgG4 Sequence 127Ala Ser
Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Cys Ser Arg1 5 10 15Ser
Thr Ser Glu Ser Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25
30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser
35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr
Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr
Lys Thr65 70 75 80Tyr Thr Cys Asn Val Asp His Lys Pro Ser Asn Thr
Lys Val Asp Lys 85 90 95Arg Val Glu Ser Lys Tyr Gly Pro Pro Cys Pro
Ser Cys Pro Ala Pro 100 105 110Glu Phe Leu Gly Gly Pro Ser Val Phe
Leu Phe Pro Pro Lys Pro Lys 115 120 125Asp Thr Leu Met Ile Ser Arg
Thr Pro Glu Val Thr Cys Val Val Val 130 135 140Asp Val Ser Gln Glu
Asp Pro Glu Val Gln Phe Asn Trp Tyr Val Asp145 150 155 160Gly Val
Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe 165 170
175Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp
180 185 190Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys
Gly Leu 195 200 205Pro Ser Ser Ile Glu Lys Thr Ile Ser Lys Ala Lys
Gly Gln Pro Arg 210 215 220Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser
Gln Glu Glu Met Thr Lys225 230 235 240Asn Gln Val Ser Leu Thr Cys
Leu Val Lys Gly Phe Tyr Pro Ser Asp 245 250 255Ile Ala Val Glu Trp
Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 260 265 270Thr Thr Pro
Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 275 280 285Arg
Leu Thr Val Asp Lys Ser Arg Trp Gln Glu Gly Asn Val Phe Ser 290 295
300Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys
Ser305 310 315 320Leu Ser Leu Ser Leu Gly 325128326PRTArtificial
SequenceHuman Fc-IgG4 S228P Sequence 128Ala Ser Thr Lys Gly Pro Ser
Val Phe Pro Leu Ala Pro Cys Ser Arg1 5 10 15Ser Thr Ser Glu Ser Thr
Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val
Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr
Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser
Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Lys Thr65 70 75 80Tyr
Thr Cys Asn Val Asp His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90
95Arg Val Glu Ser Lys Tyr Gly Pro Pro Cys Pro Pro Cys Pro Ala Pro
100 105 110Glu Phe Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys
Pro Lys 115 120 125Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr
Cys Val Val Val 130 135 140Asp Val Ser Gln Glu Asp Pro Glu Val Gln
Phe Asn Trp Tyr Val Asp145 150 155 160Gly Val Glu Val His Asn Ala
Lys Thr Lys Pro Arg Glu Glu Gln Phe 165 170 175Asn Ser Thr Tyr Arg
Val Val Ser Val Leu Thr Val Leu His Gln Asp 180 185 190Trp Leu Asn
Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu 195 200 205Pro
Ser Ser Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg 210 215
220Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Gln Glu Glu Met Thr
Lys225 230 235 240Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
Tyr Pro Ser Asp 245 250 255Ile Ala Val Glu Trp Glu Ser Asn Gly Gln
Pro Glu Asn Asn Tyr Lys 260 265 270Thr Thr Pro Pro Val Leu Asp Ser
Asp Gly Ser Phe Phe Leu Tyr Ser 275 280 285Arg Leu Thr Val Asp Lys
Ser Arg Trp Gln Glu Gly Asn Val Phe Ser 290 295 300Cys Ser Val Met
His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser305 310 315 320Leu
Ser Leu Ser Leu Gly 325129327PRTArtificial SequenceHuman Fc-IgG4 PE
Sequence 129Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Cys
Ser Arg1 5 10 15Ser Thr Ser Glu Ser Thr Ala Ala Leu Gly Cys Leu Val
Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly
Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser
Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser
Ser Leu Gly Thr Lys Thr65 70 75 80Tyr Thr Cys Asn Val Asp His Lys
Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Arg Val Glu Ser Lys Tyr Gly
Pro Pro Cys Pro Pro Cys Pro Ala Pro 100 105 110Glu Phe Glu Gly Gly
Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys 115 120 125Asp Thr Leu
Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val 130 135 140Asp
Val Ser Gln Glu Asp Pro Glu Val Gln Phe Asn Trp Tyr Val Asp145 150
155 160Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln
Phe 165 170 175Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu
His Gln Asp 180 185 190Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val
Ser Asn Lys Gly Leu 195 200 205Pro Ser Ser Ile Glu Lys Thr Ile Ser
Lys Ala Lys Gly Gln Pro Arg 210 215 220Glu Pro Gln Val Tyr Thr Leu
Pro Pro Ser Gln Glu Glu Met Thr Lys225 230 235 240Asn Gln Val Ser
Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp 245 250 255Ile Ala
Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 260 265
270Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser
275 280 285Arg Leu Thr Val Asp Lys Ser Arg Trp Gln Glu Gly Asn Val
Phe Ser 290 295 300Cys Ser Val Met His Glu Ala Leu His Asn His Tyr
Thr Gln Lys Ser305 310 315 320Leu Ser Leu Ser Leu Gly Lys
325130326PRTArtificial SequenceHuman Fc-IgG4 PE' Sequence 130Ala
Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Cys Ser Arg1 5 10
15Ser Thr Ser Glu Ser Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr
20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr
Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu
Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly
Thr Lys Thr65 70 75 80Tyr Thr Cys Asn Val Asp His Lys Pro Ser Asn
Thr Lys Val Asp Lys 85 90 95Arg Val Glu Ser Lys Tyr Gly Pro Pro Cys
Pro Pro Cys Pro Ala Pro 100 105 110Glu Phe Glu Gly Gly Pro Ser Val
Phe Leu Phe Pro Pro Lys Pro Lys 115 120 125Asp Thr Leu Met Ile Ser
Arg Thr Pro Glu Val Thr Cys Val Val Val 130 135 140Asp Val Ser Gln
Glu Asp Pro Glu Val Gln Phe Asn Trp Tyr Val Asp145 150 155 160Gly
Val Glu Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe 165 170
175Asn Ser Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His Gln Asp
180 185 190Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys
Gly Leu 195 200 205Pro Ser Ser Ile Glu Lys Thr Ile Ser Lys Ala Lys
Gly Gln Pro Arg 210 215 220Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser
Gln Glu Glu Met Thr Lys225 230 235 240Asn Gln Val Ser Leu Thr Cys
Leu Val Lys Gly Phe Tyr Pro Ser Asp 245 250 255Ile Ala Val Glu Trp
Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 260 265 270Thr Thr Pro
Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 275 280 285Arg
Leu Thr Val Asp Lys Ser Arg Trp Gln Glu Gly Asn Val Phe Ser 290 295
300Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys
Ser305 310 315 320Leu Ser Leu Ser Leu Gly 325131107PRTArtificial
SequenceHuman kappa LC Sequence 131Arg Thr Val Ala Ala Pro Ser Val
Phe Ile Phe Pro Pro Ser Asp Glu1 5 10 15Gln Leu Lys Ser Gly Thr Ala
Ser Val Val Cys Leu Leu Asn Asn Phe 20 25 30Tyr Pro Arg Glu Ala Lys
Val Gln Trp Lys Val Asp Asn Ala Leu Gln 35 40 45Ser Gly Asn Ser Gln
Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser 50 55 60Thr Tyr Ser Leu
Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu65 70 75 80Lys His
Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser 85 90 95Pro
Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 100 105
* * * * *