U.S. patent application number 17/385655 was filed with the patent office on 2022-06-30 for respiratory virus nucleic acid vaccines.
This patent application is currently assigned to ModernaTX, Inc.. The applicant listed for this patent is ModernaTX, Inc.. Invention is credited to Giuseppe Ciaramella, Sunny Himansu.
Application Number | 20220202934 17/385655 |
Document ID | / |
Family ID | |
Filed Date | 2022-06-30 |
United States Patent
Application |
20220202934 |
Kind Code |
A1 |
Ciaramella; Giuseppe ; et
al. |
June 30, 2022 |
RESPIRATORY VIRUS NUCLEIC ACID VACCINES
Abstract
Provided herein, in some embodiments, are vaccines (and
vaccination methods) that include a ribonucleic acid (RNA)
polynucleotide encoding a human metapneumovirus (hMPV) F protein
and a RNA polynucleotide encoding a human parainfluenza virus 3
(hPIV3) F protein.
Inventors: |
Ciaramella; Giuseppe;
(Sudbury, MA) ; Himansu; Sunny; (Winchester,
MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
ModernaTX, Inc. |
Cambridge |
MA |
US |
|
|
Assignee: |
ModernaTX, Inc.
Cambridge
MA
|
Appl. No.: |
17/385655 |
Filed: |
July 26, 2021 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16467142 |
Jun 6, 2019 |
11103578 |
|
|
PCT/US2017/065408 |
Dec 8, 2017 |
|
|
|
17385655 |
|
|
|
|
62431775 |
Dec 8, 2016 |
|
|
|
International
Class: |
A61K 39/295 20060101
A61K039/295; A61K 31/7105 20060101 A61K031/7105; A61K 31/7115
20060101 A61K031/7115; A61K 38/16 20060101 A61K038/16; C12N 15/86
20060101 C12N015/86; A61K 9/51 20060101 A61K009/51; A61K 47/26
20060101 A61K047/26; A61K 9/00 20060101 A61K009/00 |
Claims
1.-96. (canceled)
97. A composition comprising: a human metapneumovirus (hMPV)
messenger ribonucleic acid (mRNA) comprising a 5' UTR that
comprises the sequence of SEQ ID NO: 12, an open reading frame that
comprises the sequence of SEQ ID NO: 4, and a 3' UTR that comprises
the sequence of SEQ ID NO: 13.
98. The composition of claim 97, wherein the hMPV mRNA comprises
the sequence of SEQ ID NO: 14.
99. The composition of claim 97, wherein the hMPV mRNA comprises a
7mG(5')ppp(5')NlmpNp cap.
100. The composition of claim 97, wherein the hMPV mRNA comprises a
polyA tail.
101. The composition of claim 97, wherein the hMPV mRNA comprises a
chemical modification.
102. The composition of claim 101, wherein the chemical
modification is 1-methylpseudouridine.
103. The composition of claim 102, wherein 100% of uracil in the
open reading frame of the hMPV mRNA comprise a
1-methylpseudouridine.
104. The composition of claim 97, comprising 25 .mu.g-200 .mu.g of
the hMPV mRNA.
105. The composition of claim 97, further comprising mRNA encoding
a respiratory syncytial virus (RSV) antigen.
106. The composition of claim 97, wherein the composition further
comprises lipid nanoparticles that comprise 1-5 mol % PEG-modified
lipid; 10-20 mol % non-cationic lipid; 35-45 mol % cholesterol; and
40-50 mol % ionizable cationic lipid.
107. The composition of claim 106, wherein the PEG-modified lipid
is 1,2 dimyristoyl-sn-glycerol, methoxypolyethyleneglycol (PEG2000
DMG), the non-cationic lipid is 1,2
distearoyl-sn-glycero-3-phosphocholine (DSPC), and the ionizable
cationic lipid has the structure of Compound 1: ##STR00008##
108. A composition comprising: 25 .mu.g-200 .mu.g human
metapneumovirus (hMPV) messenger ribonucleic acid (mRNA) comprising
the sequence of SEQ ID NO:14.
109. The composition of claim 108, wherein the composition further
comprises lipid nanoparticles that comprises 1-5 mol % 1,2
dimyristoyl-sn-glycerol, methoxypolyethyleneglycol (PEG2000 DMG);
10-20 mol % 1,2 distearoyl-sn-glycero-3-phosphocholine (DSPC);
35-45 mol % cholesterol; and 40-50 mol % ionizable cationic lipid
having the structure of Compound 1: ##STR00009##
110. The composition of claim 109, further comprising mRNA encoding
a respiratory syncytial virus (RSV) antigen.
111. A method comprising administering to a subject the composition
of claim 109 in an amount effective to induce a neutralizing
antibody response against hMPV in the subject.
112. A method comprising administering to a subject the composition
of claim 110 in an amount effective to induce a neutralizing
antibody response against hMPV and/or RSV in the subject.
113. The method of claim 111, wherein the subject is
immunocompromised and/or has a pulmonary disease.
114. The method of claim 111, wherein the subject is 5 years of age
or younger.
115. The method of claim 111, wherein the subject is 65 years of
age or older.
116. The method of claim 111, comprising administering to the
subject at least two doses of the composition.
Description
RELATED APPLICATIONS
[0001] This application claims the benefit under 35 U.S.C. .sctn.
119(e) of U.S. provisional application No. 62/431,775, filed Dec.
8, 2016, which is incorporated by reference herein in its
entirety.
BACKGROUND
[0002] Human metapneumovirus (hMPV), discovered in 2001, is a
common cause of upper and lower respiratory infections. Although
often mild, this virus can be serious and life-threatening in
high-risk groups, such as children under the age of 5 years,
elderly adults over the age of 65 years, and adults with underlying
disease (e.g., Chronic Obstructive Pulmonary Disease (COPD),
asthma, congestive heart failure, or diabetes). In healthy adults
over the age of 65 years, the annual incidence rate of hMPV
infection is 1.2/1,000, and 38% of these elderly adults require
medical care (compared to 9% of young adults). hMPV infection in
elderly adults is a common cause of respiratory infection outbreaks
(attack rates 13-30%) in residential care facilities, and
hospitalization rates are higher than those for influenza infection
occurring in healthy adults over the age of 50 years. For
individuals who have an underlying pulmonary disease, hMPV
infection is associate with exacerbations of the disease (e.g.,
COPD), and individuals are twice as likely to have symptomatic
disease and requirement for medical care. In immunocompromised
individuals, hMPV is responsible for 6% of total respiratory
infections in lung transplants and 3% of lower respiratory
infections associated with stem cell transplant. hMPV infection is
also thought to be associated with acute graft rejection.
[0003] Likewise, human parainfluenza virus 3 (hPIV3) is also a
common cause of upper and lower respiratory infections. This
serotype is the most pathogenic of the four PIV serotypes.
Infection of hPIV3 in high risk groups can result in serious lower
respiratory infections, including bronchiolitis and/or
pneumonia.
SUMMARY
[0004] Provided herein, in some embodiments, are ribodeoxynucleic
acid (RNA) (e.g., mRNA) vaccine compositions and methods for
preventing and/or treating lower respiratory human metapneumovirus
(hMPV) and human parainfluenza virus 3 (hPIV3) infections, for
example, in infants and young adults, in elderly adults, and in
those with underlying respiratory diseases. The hMPV/hPIV3 vaccines
of the present disclosure produce proteins inside cells, which in
turn are secreted or are active intracellularly. In some instances,
RNA (e.g., mRNA) vaccines produce much larger antibody titers and
produce immune responses earlier, relative to current anti-viral
therapeutic treatments. Without being bound by theory, it is
believed that the hMPV/hPIV3 RNA vaccines, as provided here, are
better designed to produce the appropriate protein conformation
upon translation, as the RNA vaccines co-opt natural cellular
machinery. Unlike traditional vaccines, which are manufactured ex
vivo and may trigger unwanted cellular responses, RNA vaccines are
presented to the cellular system in a more native fashion.
[0005] Surprisingly, administration of the hMPV/hPIV3 vaccine of
the disclosure induces high neutralizing antibody titers and
reduced viral load, but does not result in alveolitis or
interstitial pneumonia.
[0006] Some embodiments of the present disclosure provide a
vaccine, comprising (a) a ribonucleic acid (RNA) polynucleotide
encoding a human metapneumovirus (hMPV) antigenic polypeptide
comprising the amino acid sequence identified by SEQ ID NO:7 or an
amino acid sequence that is at least 95% identical to the amino
acid sequence identified by SEQ ID NO:7, and (b) a RNA
polynucleotide encoding human parainfluenza virus 3 (hPIV3)
antigenic polypeptide comprising the amino acid sequence identified
by SEQ ID NO:8 or an amino acid sequence that is at least 95%
identical to the amino acid sequence identified by SEQ ID NO:8.
[0007] Some embodiments of the present disclosure provide a
vaccine, comprising (a) a RNA polynucleotide comprising a nucleic
acid sequence identified by SEQ ID NO:4 encoding a hMPV antigenic
polypeptide or an amino acid sequence that is at least 95%
identical to the amino acid sequence identified by SEQ ID NO:4
encoding a hMPV antigenic polypeptide and (b) a RNA polynucleotide
comprising a nucleic acid sequence identified by SEQ ID NO:5
encoding a hPIV3 antigenic polypeptide or an amino acid sequence
that is at least 95% identical to the amino acid sequence
identified by SEQ ID NO:5 encoding a hPIV3 antigenic
polypeptide.
[0008] In some embodiments, the RNA polynucleotides of (a) and (b)
are formulated in a lipid nanoparticle comprising a cationic lipid,
a PEG-modified lipid, a sterol and a non-cationic lipid.
[0009] In some embodiments, the vaccine comprises (a) a RNA
polynucleotide comprising the nucleic acid sequence identified by
SEQ ID NO:4 encoding a hMPV antigenic polypeptide and (b) a RNA
polynucleotide comprising the nucleic acid sequence identified by
SEQ ID NO:5 encoding a hPIV3 antigenic polypeptide. In some
embodiments, the vaccine includes a 5' UTR, a 3' UTR, a polyA tail
(e.g., 100 nucleotides), a cap (e.g., 7mG(5')ppp(5')NlmpNp), or any
combination of two or more of the foregoing components. In some
embodiments, the 5' UTR comprises a sequence identified by SEQ ID
NO:12. In some embodiments, the 3' UTR comprises a sequence
identified by SEQ ID NO:13. Other known UTR sequences may be used.
In some embodiments, the RNA polynucleotide of (a) and/or (b) is
chemically modified (e.g., comprises 1-methylpseudouridine
modifications). In some embodiments, the vaccine comprises (a) a
RNA polynucleotide comprising the nucleic acid sequence identified
by SEQ ID NO:14 encoding a hMPV antigenic polypeptide and (b) a RNA
polynucleotide comprising the nucleic acid sequence identified by
SEQ ID NO:15 encoding a hPIV3 antigenic polypeptide. In some
embodiments, the vaccine is formulated in a lipid nanoparticle,
such as a cationic lipid nanoparticles. In some embodiments, the
cationic lipid nanoparticle comprises a mixture of: Compound 1
lipids; 1,2-dimyristoyl-sn-glycerol, methoxypolyethyleneglycol
(PEG2000-DMG); 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC);
and cholesterol. In some embodiments, the vaccine comprises a 12.5
.mu.g-200 12.5 .mu.g dose of the RNA polynucleotide of (a) and a
12.5 .mu.g-200 12.5 .mu.g dose of the RNA polynucleotide of
(b).
[0010] In some embodiments, the vaccine comprises (a) a RNA
polynucleotide comprising a the nucleic acid sequence identified by
SEQ ID NO:14 encoding a hMPV antigenic polypeptide and (b) a RNA
polynucleotide comprising the nucleic acid sequence identified by
SEQ ID NO. 15 encoding a hPIV3 antigenic polypeptide, wherein the
RNA polynucleotide of (a) and the RNA polynucleotide of (b) are
co-formulated in a cationic lipid nanoparticle that comprises a
mixture of: Compound 1 lipids; 1,2-dimyristoyl-sn-glycerol,
methoxypolyethyleneglycol (PEG2000-DMG);
1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC); and cholesterol.
In some embodiments, the RNA polynucleotide of (a) and the RNA
polynucleotide of (b) are formulated in separate cationic lipid
nanoparticles that comprises a mixture of: Compound 1 lipids;
1,2-dimyristoyl-sn-glycerol, methoxypolyethyleneglycol
(PEG2000-DMG); 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC);
and cholesterol. In some embodiments, the vaccine comprises a 12.5
.mu.g-200 12.5 .mu.g dose of the RNA polynucleotide of (a) and a
12.5 .mu.g-200 12.5 .mu.g dose of the RNA polynucleotide of
(b).
[0011] In some embodiments, hMPV and/or hPIV3 viral load is
undetectable in subjects after challenge with the virus(es)
following administration of less than three doses of the vaccine.
In some embodiments, hMPV and/or hPIV3 viral load is undetectable
in subjects after challenge with the virus(es) following
administration of two doses of the vaccine. In some embodiments,
hMPV and/or hPIV3 viral load is undetectable in subjects after
challenge with the virus(es) following administration of a single
dose of the vaccine.
[0012] In some embodiments, the anti-hPIV3 neutralizing antibody
titer produced in a subject following administration of a dose of
the vaccine is at least 3-fold higher than the anti-hPIV3
neutralizing antibody titer produced in a subject following
administration of a comparable dose of a vaccine comprising mRNA
encoding hPIV3 HN protein.
[0013] In some embodiments, the vaccine provides an effective
immune response against both hMPV and hPIV3.
[0014] In some embodiments, the anti-hPIV3 and/or anti-hMPV
neutralizing antibody titer produced in cotton rats following
administration of the vaccine is at least 9 on a log base 2 scale,
as measured at the 60% reduction end point of virus control.
[0015] In some embodiments, the hMPV viral load in the lung and/or
nose is below the limit of quantification in subjects following
administration of the vaccine and challenge with hMPV.
[0016] In some embodiments, the hPIV3 viral load in the lung and/or
nose is below the limit of quantification in subjects following
administration of the vaccine and challenge with the hPIV3.
[0017] In some embodiments, a subject administered the vaccine does
not exhibit symptoms of vaccine-enhanced respiratory disease (e.g.,
alveolitis (cells within the alveolar spaces) or interstitial
pneumonia (inflammatory cell infiltration and thickening of
alveolar walls)).
[0018] In some embodiments, the neutralizing antibody titer against
hMPV in a subject following administration of a second dose of the
vaccine is increased by 8-10 fold at 14 days post-administration of
the second dose.
[0019] In some embodiments, the neutralizing antibody titer against
hPIV3 in a subject following administration of a second dose of the
vaccine is increased by 4-10 fold at 14 days post-administration of
the second dose.
[0020] Other embodiments of the present disclosure provide a
vaccine, comprising a ribonucleic acid (RNA) polynucleotide
encoding a human metapneumovirus (hMPV) antigenic polypeptide
comprising the amino acid sequence identified by SEQ ID NO:7,
wherein the hMPV RNA polynucleotide is formulated in a lipid
nanoparticle comprising a cationic lipid, a PEG-modified lipid, a
sterol and a non-cationic lipid.
[0021] Yet other embodiments of the present disclosure provide a
vaccine, comprising a ribonucleic acid (RNA) polynucleotide
encoding human parainfluenza virus 3 (hPIV3) antigenic polypeptide
comprising the amino acid sequence identified by SEQ ID NO:8,
wherein the hPIV3 RNA polynucleotide is formulated in a lipid
nanoparticle comprising a cationic lipid, a PEG-modified lipid, a
sterol and a non-cationic lipid.
[0022] In some embodiments, the vaccine further comprises a RNA
polynucleotide encoding a respiratory syncytial virus (RSV)
antigenic polypeptide.
[0023] In some embodiments, the cationic lipid is an ionizable
lipid.
[0024] In some embodiments, the sterol is a cholesterol.
[0025] In some embodiments, the non-cationic lipid is a neutral
lipid.
[0026] In some embodiments, the cationic lipid comprises a compound
of Formula I. In some embodiments, the compound of Formula I is
Compound 3, 18, 20, 25, 26, 29, 30, 60, 108-112, or 122. In some
embodiments, the compound of Formula I is Compound 25.
[0027] In some embodiments, the lipid nanoparticle comprises a
molar ratio of about 20-60% cationic lipid, 0.5-15% PEG-modified
lipid, 25-55% sterol, and 25% non-cationic lipid.
[0028] In some embodiments, the lipid nanoparticle has a
polydispersity value of less than 0.4.
[0029] In some embodiments, the lipid nanoparticle has a net
neutral charge at a neutral pH value.
[0030] In some embodiments, the vaccine is formulated in an
effective amount to prevent or treat a lower respiratory hMPV/hPIV3
infection in a subject.
[0031] In some embodiments, the effective amount is 5 .mu.g-100
.mu.g of the RNA polynucleotide encoding hMPV antigenic polypeptide
and/or 5 .mu.g-100 .mu.g of the RNA polynucleotide encoding hPIV3
antigenic polypeptide. In some embodiments, the effective amount is
12.5 .mu.g of the RNA polynucleotide encoding hMPV antigenic
polypeptide and/or 12.5 .mu.g of the RNA polynucleotide encoding
hPIV3 antigenic polypeptide. In some embodiments, the effective
amount is 25 .mu.g of the RNA polynucleotide encoding hMPV
antigenic polypeptide and/or 25 .mu.g of the RNA polynucleotide
encoding hPIV3 antigenic polypeptide. In some embodiments, the
effective amount is 50 .mu.g of the RNA polynucleotide encoding
hMPV antigenic polypeptide and/or 50 .mu.g of the RNA
polynucleotide encoding hPIV3 antigenic polypeptide.
[0032] In some embodiments, the RNA polynucleotide encoding hMPV
antigenic polypeptide and/or the RNA polynucleotide encoding hPIV3
antigenic polypeptide comprises at least one chemical
modification.
[0033] In some embodiments, the chemical modification is selected
from pseudouridine, N1-methylpseudouridine, N1-ethylpseudouridine,
2-thiouridine, 4'-thiouridine, 5-methyl cytosine, 5-methyluridine,
2-thio-1-methyl-1-deaza-pseudouridine,
2-thio-1-methyl-pseudouridine, 2-thio-5-aza-uridine,
2-thio-dihydropseudouridine, 2-thio-dihydrouridine,
2-thio-pseudouridine, 4-methoxy-2-thio-pseudouridine,
4-methoxy-pseudouridine, 4-thio-1-methyl-pseudouridine,
4-thio-pseudouridine, 5-aza-uridine, dihydropseudouridine,
5-methoxyuridine and 2'-O-methyl uridine.
[0034] In some embodiments, the chemical modification is in the
5-position of the uracil. In some embodiments, the chemical
modification is a N1-methylpseudouridine or
N1-ethylpseudouridine.
[0035] In some embodiments, at least 80% of the uracil in the open
reading frame have a chemical modification. In some embodiments, at
least 90% of the uracil in the open reading frame have a chemical
modification. In some embodiments, 100% of the uracil in the open
reading frame have a chemical modification.
[0036] In some embodiments, the RNA polynucleotide encoding hMPV
antigenic polypeptide and/or the RNA polynucleotide encoding hPIV3
antigenic polypeptide further encodes at least one 5' terminal cap.
In some embodiments, the 5' terminal cap is
7mG(5')ppp(5')NlmpNp.
[0037] In some embodiments, the vaccine further comprises an
adjuvant. In some embodiments, the adjuvant is a flagellin protein
or peptide.
[0038] Some embodiments provide a method of preventing a lower
respiratory human metapneumovirus and/or human parainfluenza virus
3 (hMPV/hPIV3) infection in elderly subjects, comprising
administering to a subject who is 65 years of age or older the
vaccine of the present disclosure in an effective amount to prevent
a lower respiratory hMPV/hPIV3 infection in the subject.
[0039] Other embodiments provide a method of treating a lower
respiratory human metapneumovirus and/or human parainfluenza virus
3 (hMPV/hPIV3) infection in elderly subjects, comprising
administering to a subject who is 65 years of age or older and is
infected with hMPV/hPIV3 the vaccine of the present disclosure in
an effective amount to treat a lower respiratory hMPV/hPIV3
infection in the subject.
[0040] Yet other embodiments provide a method of preventing a lower
respiratory human metapneumovirus and/or human parainfluenza virus
3 (hMPV/hPIV3) infection in a child, comprising administering to a
subject who is 5 years of age or younger the vaccine of the present
disclosure in an effective amount to prevent a lower respiratory
hMPV/hPIV3 infection in the subject.
[0041] Still other embodiments provide a method of treating a lower
respiratory human metapneumovirus and/or human parainfluenza virus
3 (hMPV/hPIV3) infection in a child, comprising administering to a
subject who is 5 years of age or younger and is infected with
hMPV/hPIV3 the vaccine of the present disclosure in an effective
amount to treat a lower respiratory hMPV/hPIV3 infection in the
subject. In some embodiments, the subject is between 6 and 12
months of age.
[0042] Further embodiments provide a method of preventing a lower
respiratory human metapneumovirus and/or human parainfluenza virus
3 (hMPV/hPIV3) infection in subjects having a pulmonary disease,
comprising administering to a subject having a pulmonary disease
the vaccine of the present disclosure in an effective amount to
prevent a lower respiratory hMPV/hPIV3 infection in the
subject.
[0043] Still further embodiments provide a method of treating a
lower respiratory human metapneumovirus and/or human parainfluenza
virus 3 (hMPV/hPIV3) infection in subjects having a pulmonary
disease, comprising administering to a subject having a pulmonary
condition the vaccine of the present disclosure in an effective
amount to treat a lower respiratory hMPV/hPIV3 infection in the
subject. In some embodiments, the pulmonary condition is associated
with is Chronic Obstructive Pulmonary Disease (COPD), asthma,
congestive heart failure or diabetes, or any combination
thereof.
[0044] Some embodiments provide a method of preventing a lower
respiratory human metapneumovirus and/or human parainfluenza virus
3 (hMPV/hPIV3) infection in immunocompromised subjects, comprising
administering to an immunocompromised subject the vaccine of the
present disclosure in an effective amount to prevent a lower
respiratory hMPV/hPIV3 infection in the subject.
[0045] Other embodiments provide a method of treating a lower
respiratory human metapneumovirus and/or human parainfluenza virus
3 (hMPV/hPIV3) infection in immunocompromised subjects, comprising
administering to an immunocompromised subject the vaccine of the
present disclosure in an effective amount to treat a lower
respiratory hMPV/hPIV3 infection in the subject.
[0046] In some embodiments, a single dose of the vaccine is
administered to the subject. In some embodiments, a booster dose of
the vaccine is administered to the subject.
[0047] In some embodiments, the efficacy of the vaccine against the
hMPV/hPIV3 infection is at least 50% following administration of
the booster dose of the vaccine. In some embodiments, the efficacy
of the vaccine against the hMPV/hPIV3 infection is at least 60%
following administration of the booster dose of the vaccine.
[0048] In some embodiments, the efficacy of the vaccine against the
hMPV and/or hPIV3 infection is at least 65% following
administration of a single dose of the vaccine. In some
embodiments, the efficacy of the vaccine against the hMPV and/or
hPIV3 infection is at least 70% following administration of a
single dose of the vaccine. In some embodiments, the efficacy of
the vaccine against the hMPV and/or hPIV3 infection is at least 75%
following administration of a single dose of the vaccine.
[0049] In some embodiments, the vaccine immunizes the subject
against hMPV/hPIV3 for up to 2 years. In some embodiments, the
vaccine immunizes the subject against hMPV/hPIV3 for more than 2
years.
[0050] Also provided herein is a vaccine, comprising (a) 12.5
.mu.g-200 .mu.g a human metapneumovirus (hMPV) ribonucleic acid
(RNA) polynucleotide comprising the nucleic acid sequence
identified by SEQ ID NO:4, and (b) 12.5 .mu.g-200 .mu.g a human
parainfluenza virus 3 (hPIV3) RNA polynucleotide comprising the
nucleic acid sequence identified by SEQ ID NO:5, wherein the RNA
polynucleotides of (a) and (b) are formulated in a lipid
nanoparticle comprising a Compound 25 of Formula (I), a
PEG-modified lipid, a sterol and a non-cationic lipid. In some
embodiments, the efficacy of the vaccine against the hMPV/hPIV3
infection is at least 50% following administration of the booster
dose of the vaccine. In some embodiments, the efficacy of the
vaccine against the hMPV and/or hPIV3 infection is at least 70%
following administration of a single dose of the vaccine.
[0051] Further provided herein is a use of the vaccine of the
present disclosure in the manufacture of a medicament for use in a
method of inducing an antigen specific immune response to
hMPV/hPIV3 in a subject, the method comprising administering to the
subject the vaccine in an amount effective to produce an antigen
specific immune response to hMPV/hPIV3 in the subject.
[0052] Some embodiments provide a pharmaceutical composition for
use in vaccination of a subject comprising an effective dose of the
vaccine of the present disclosure, wherein the effective dose is
sufficient to produce detectable levels of antigen as measured in
serum of the subject at 1-72 hours post administration. In some
embodiments, the cut off index of the antigen is 1-2. Some
embodiments provide a pharmaceutical composition for use in
vaccination of a subject comprising an effective dose of the
vaccine of the present disclosure, wherein the effective dose is
sufficient to produce detectable levels of antigen as measured in
serum of the subject within 14 days hours post administration.
[0053] Other embodiments provide a pharmaceutical composition for
use in vaccination of a subject comprising an effective dose of the
vaccine of the present disclosure, wherein the effective dose is
sufficient to produce a 1,000-10,000 neutralization titer produced
by neutralizing antibody against hMPV/hPIV3 antigen as measured in
serum of the subject at 1-72 hours post administration. Yet other
embodiments provide a pharmaceutical composition for use in
vaccination of a subject comprising an effective dose of the
vaccine of the present disclosure, wherein the effective dose is
sufficient to produce a 1,000-10,000 neutralization titer produced
by neutralizing antibody against hMPV/hPIV3 antigen as measured in
serum of the subject within 14 days post administration.
[0054] Further embodiments provide a vaccine, comprising (a) a
human metapneumovirus (hMPV) ribonucleic acid (RNA) polynucleotide
comprising the nucleic acid sequence identified by SEQ ID NO:4 or a
nucleic acid sequence that is at least 95% identical to the nucleic
acid sequence identified by SEQ ID NO:4, and (b) a human
parainfluenza virus 3 (hPIV3) RNA polynucleotide comprising the
nucleic acid sequence identified by SEQ ID NO:5 or a nucleic acid
sequence that is at least 95% identical to the nucleic acid
sequence identified by SEQ ID NO:5, wherein the RNA polynucleotides
of (a) and (b) are formulated in a lipid nanoparticle comprising a
cationic lipid, a PEG-modified lipid, a sterol and a non-cationic
lipid.
[0055] Still further embodiments provide a vaccine, comprising (a)
a human metapneumovirus (hMPV) ribonucleic acid (RNA)
polynucleotide encoded by a nucleic acid comprising the nucleic
acid sequence identified by SEQ ID NO:1 or a nucleic acid sequence
that is at least 95% identical to the nucleic acid sequence
identified by SEQ ID NO:1, and (b) a human parainfluenza virus 3
(hPIV3) RNA polynucleotide encoded by a nucleic acid comprising the
nucleic acid sequence identified by SEQ ID NO:2 or a nucleic acid
sequence that is at least 95% identical to the nucleic acid
sequence identified by SEQ ID NO:2, wherein the RNA polynucleotides
of (a) and (b) are formulated in a lipid nanoparticle comprising a
cationic lipid, a PEG-modified lipid, a sterol and a non-cationic
lipid.
BRIEF DESCRIPTION OF THE DRAWINGS
[0056] FIGS. 1A-1B are graphs showing that cells transfected with
(1) mRNA having an open reading frame (SEQ ID NO:4) encoding hMPV F
protein (SEQ ID NO:7) and (2) mRNA having an open reading frame
(SEQ ID NO:5) encoding hPIV3 F protein (SEQ ID NO:8) expressed hMPV
protein and hPIV3 protein on the cell surface. FIG. 1A, left panel,
shows a hMPV F protein-positive (fluorescent) cell count for cells
transfected with a mock construct. FIG. 1A, right panel, shows a
hMPV F protein-positive (fluorescent) cell count for cells
transfected with hMPV/hPIV3 vaccine constructs. hMPV F protein was
detected using antibodies specific for hMPV F protein (MEP8). FIG.
1A, middle panel, shows fluorescence obtained from untransfected
control cells, using only a secondary antibody. FIG. 1B shows the
surface expression of hPIV3 F protein in Hel a cells detected using
antibodies specific for hPIV3 F protein (MAB10207).
[0057] FIGS. 2A-2B are graphs showing the results of cotton rat
hMPV and hPIV3 challenge experiments using animals immunized with a
vaccine containing (1) mRNA having an open reading frame (SEQ ID
NO:4) encoding hMPV F protein (SEQ ID NO:7) and (2) mRNA having an
open reading frame (SEQ ID NO:5) encoding hPIV3 F protein (SEQ ID
NO:8) (see Table 2 for study design). FIG. 2A shows viral titers
from the nose and lungs of cotton rats challenged with hMPV. FIG.
2B shows viral titers from the nose and lungs of cotton rats
challenged with hPIV3. Cotton rats immunized with the mRNA vaccine
were protected from hMPV infection and hPIV3 infection.
[0058] FIGS. 3A-3B are graphs showing neutralizing antibody titers
against hMPV/A2 (FIG. 3A) or hPIV3 (FIG. 3B) from the serum of
cotton rats immunized with a vaccine containing (1) mRNA having an
open reading frame (SEQ ID NO:4) encoding hMPV F protein (SEQ ID
NO:7) and (2) mRNA having an open reading frame (SEQ ID NO:5)
encoding hPIV3 F protein (SEQ ID NO:8) formulated in either MC3
lipids or Compound 1 lipids (see Table 2 for study design). The two
formulations yielded comparable levels of neutralizing antibody
titers.
[0059] FIGS. 4A-4B are graphs showing hMPV (FIG. 4A) and PIV3 (FIG.
4B) serum neutralizing antibody titers in cotton rats. PIV3
neutralizing antibody titers detected at high levels in all animals
immunized with PIV3-F and/or PIV3-HN mRNA (Groups 9-13).
[0060] FIGS. 5A-5B are graphs showing viral load after hMPV (FIG.
5A) or PIV3 (FIG. 5B) challenge of cotton rats. High level of virus
was detected in PBS control animals (Groups 5 and 14), but was
close to or below the limit of quantification in all mRNA-immunized
animals (Groups 2-4 and 9-13), demonstrating full protection in
both the lung and the nose.
[0061] FIGS. 6A-6B are graphs showing the average lung pathology
score after hMPV (FIG. 6A) or PIV3 (FIG. 6B) challenge of cotton
rats. All mRNA-immunized animals (Groups 2-4 and 9-13) exhibited
lung histopathology scores equivalent to the PBS controls (Groups 5
and 14), indicating no vaccine-enhanced respiratory disease
(ERD).
[0062] FIGS. 7A-7B are graphs showing results of African green
monkey hMPV and hPIV3 challenge experiments using animals immunized
with a vaccine containing (1) mRNA having an open reading frame
(SEQ ID NO:4) encoding hMPV F protein (SEQ ID NO:7) and (2) mRNA
having an open reading frame (SEQ ID NO:5) encoding hPIV3 F protein
(SEQ ID NO:8) (see Table 3 for study design). FIG. 7A shows viral
titers from the nose and lungs of African green monkeys challenged
with hMPV. FIG. 7B shows viral titers from the nose and lungs of
African green monkeys challenged with hPIV3. Sero-negative African
green monkeys immunized with 2 doses of the mRNA vaccine were
completely protected from hMPV infection and hPIV3 infection.
[0063] FIGS. 8A-8D are graphs showing neutralizing antibody titers
against hMPV in sero-negative African green monkeys immunized with
two doses of a vaccine containing (1) mRNA having an open reading
frame (SEQ ID NO:4) encoding hMPV F protein (SEQ ID NO:7) and (2)
mRNA having an open reading frame (SEQ ID NO:5) encoding hPIV3 F
protein (SEQ ID NO:8) on days 0 and 28 at 200 .mu.g per dose (FIG.
8A), 100 .mu.g per dose (FIG. 8B), 10 .mu.g per dose (FIG. 8C) per
dose, or placebo (FIG. 8D). The mRNA vaccines were formulated with
Compound 1 lipids.
[0064] FIGS. 9A-9C are graphs showing neutralizing antibody titers
against hMPV in sero-negative African green monkeys immunized with
one dose of a vaccine containing (1) mRNA having an open reading
frame (SEQ ID NO:4) encoding hMPV F protein (SEQ ID NO:7) and (2)
mRNA having an open reading frame (SEQ ID NO:5) encoding hPIV3 F
protein (SEQ ID NO:8) on day 0 at 200 .mu.g per dose (FIG. 9A), 100
.mu.g per dose (FIG. 9B), or 50 .mu.g per dose (FIG. 9C) per dose.
The mRNA vaccines were formulated with Compound 1 lipids.
[0065] FIGS. 10A-10D are graphs showing the neutralizing antibody
titers against hPIV3 in sero-negative African green monkeys
immunized with two doses of a vaccine containing (1) mRNA having an
open reading frame (SEQ ID NO:4) encoding hMPV F protein (SEQ ID
NO:7) and (2) mRNA having an open reading frame (SEQ ID NO:5)
encoding hPIV3 F protein (SEQ ID NO:8) on days 0 and 28 at 200
.mu.g per dose (FIG. 10A), 100 .mu.g per dose (FIG. 10B), 10 .mu.g
per dose (FIG. 10C) per dose, or placebo (FIG. 10D). The mRNA
vaccines were formulated with Compound 1 lipids.
[0066] FIGS. 11A-11B are graphs showing the neutralizing antibody
titers against hPIV3 in sero-negative African green monkeys
immunized with two 200 .mu.g doses a vaccine containing mRNA having
an open reading frame (SEQ ID NO:5) encoding hPIV3 F protein (SEQ
ID NO:8) (FIG. 11A) or a vaccine containing mRNA having an open
reading frame (SEQ ID NO:6) encoding hPIV3 HN protein (SEQ ID NO:9)
(FIG. 11B). The vaccine encoding hPIV3-F protein induced higher
neutralizing antibody titers than the vaccine encoding hPIV3-HN.
The mRNA vaccines were formulated with Compound 1 lipids.
[0067] FIGS. 12A-12C are graphs showing the neutralizing antibody
titers against hPIV3 in sero-negative African green monkeys
immunized with one dose of a vaccine containing (1) mRNA having an
open reading frame (SEQ ID NO:4) encoding hMPV F protein (SEQ ID
NO:7) and (2) mRNA having an open reading frame (SEQ ID NO:5)
encoding hPIV3 F protein (SEQ ID NO:8) on days 0 at 200 .mu.g per
dose (FIG. 12B), 50 .mu.g per dose (FIG. 12C), or placebo (FIG.
12A). The mRNA vaccines were formulated with Compound 1 lipids.
[0068] FIGS. 13A-13B are graphs showing the neutralizing antibodies
against hMPV/A2 in sero-negative African green monkeys or
sero-positive African green monkeys. FIG. 13A shows that 2 doses of
200 .mu.g and 100 .mu.g of a vaccine containing (1) mRNA having an
open reading frame (SEQ ID NO:4) encoding hMPV F protein (SEQ ID
NO:7) and (2) mRNA having an open reading frame (SEQ ID NO:5)
encoding hPIV3 F protein (SEQ ID NO:8) elicits high levels of hMPV
neutralizing antibodies. FIG. 13B shows that a single dose of the
hMPVhPIV3 mRNA vaccine boosts hMPV neutralizing antibodies by 8-10
fold in sero-positive African green monkeys.
[0069] FIGS. 14A-14B are graphs showing the neutralizing antibodies
against hPIV3 in sero-negative African green monkeys (AGMs) or
sero-positive African green monkeys. FIG. 14A shows that 2 doses of
200 .mu.g and 100 .mu.g of a vaccine containing (1) mRNA having an
open reading frame (SEQ ID NO:4) encoding hMPV F protein (SEQ ID
NO:7) and (2) mRNA having an open reading frame (SEQ ID NO:5)
encoding hPIV3 F protein (SEQ ID NO:8) elicits high levels of hMPV
neutralizing antibodies. FIG. 14B shows that a single dose of the
hMPV/hPIV3 mRNA vaccine boosts hPIV3 neutralizing antibodies by
4-10 folds in sero-positive African green monkeys.
[0070] FIGS. 15A-15B are graphs showing the neutralizing antibody
titers to hMPV (FIG. 15A) and hPIV3 (FIG. 15B). hMPV or PIV3
neutralizing antibody titers could be detected in all
previously-exposed AGM (Groups 11-13 for hMPV and Groups 14-16 for
PIV3) and were stable for the 4 weeks preceding immunization. In
all cases the peak neutralizing antibody response was reached by 14
days post immunization, and was generally stable for the subsequent
42 days.
[0071] FIGS. 16A-16B are graphs showing the neutralizing antibody
titers to hMPV (FIG. 16A) and hPIV3 (FIG. 16B) in AGM. hMPV
neutralizing antibodies were detected in serum of the majority of
animals 28 days after the first immunization with the
hMPV-F/PIV3-F/PIV3-HN mRNA vaccine, and titers were boosted by the
second immunization. PIV3 neutralizing antibodies were detected in
serum of the majority of animals 28 days after the first
immunization with the hMPV/PIV3 mRNA vaccines, and titers were
boosted by the second immunization.
[0072] FIGS. 17A-17B are graphs showing viral load after hMPV (FIG.
17A) or hPIV3 (FIG. 17B) challenge of AGM. The hMPV/PIV3
combination vaccine affords full protection against both viruses in
the lung and the nose.
DETAILED DESCRIPTION
[0073] The present disclosure provides, in some embodiments,
combination vaccine therapies that comprise administering RNA
(e.g., mRNA) polynucleotides encoding a human metapneumovirus
(hMPV) F protein and a human parainfluenza virus type 3 (hPIV3) F
protein, either formulated as a combination vaccine or formulated
as single vaccines administered simultaneously or sequentially. In
some embodiments, a combination vaccine may further comprise a RNA
(e.g., mRNA) polynucleotide encoding a respiratory syncytial virus
(RSV) antigenic polypeptide.
[0074] Also provided herein are vaccines (vaccine compositions)
comprising RNA encoding hMPV F protein and/or hPIV3 F protein,
methods of manufacturing these vaccines, and nucleic acids encoding
these vaccines.
[0075] For simplicity, the term "hMPV/hPIV3" should be understood
to encompass hMPV, hPIV3, or both hMPV and hPIV3. "hMPV/hPIV3"
compositions contain, for example, a mRNA encoding hMPV, a mRNA
encoding hPIV3 as well as one or more additional mRNAs encoding
respiratory antigens (e.g., RSV antigens).
[0076] The hMPV/hPIV3 RNA (e.g., mRNA) vaccines, in some
embodiments, are formulated in a lipid nanoparticle comprising a
cationic lipid, a PEG-modified lipid, a sterol and a non-cationic
lipid. In some embodiments, the non-cationic lipid is Compound 1 of
Formula (I). Thus, in some embodiments, a hMPV/PIV3 RNA vaccine is
formulated in a lipid nanoparticle that comprises Compound 1.
[0077] In some embodiments, the hMPV/hPIV3 RNA (e.g., mRNA)
vaccines may be used to treat a lower respiratory hMPV and/or hPIV3
infection in a child, an elderly person, a young adult, or an
immunocompromised person. The hMPV/hPIV3 RNA (e.g., mRNA) vaccines,
in some embodiments, may be used to induce a balanced immune
response, comprising both cellular and humoral immunity, without
many of the risks associated with DNA vaccination.
[0078] It has been discovered that the mRNA vaccines described
herein are superior to current vaccines in several ways. First, the
lipid nanoparticle (LNP) delivery is superior to other formulations
including a protamine base approach described in the literature and
no additional adjuvants are to be necessary. The use of LNPs
enables the effective delivery of chemically modified or unmodified
mRNA vaccines. Additionally it has been demonstrated herein that
both modified and unmodified LNP formulated mRNA vaccines were
superior to conventional vaccines by a significant degree. In some
embodiments the mRNA vaccines of the present disclosure are
superior to conventional vaccines by a factor of at least 10 fold,
20 fold, 40 fold, 50 fold, 100 fold, 500 fold or 1,000 fold.
[0079] In addition, the vaccines of the present disclosure result
in effective immune responses against both hMPV and PIV3 (e.g., as
measured by a reduction in infectious virus isolated from the nasal
and/or lung passages upon exposure to virus), but do not result in
visible respiratory pathology (e.g., alveolitis (cells within the
alveolar spaces) or interstitial pneumonia (inflammatory cell
infiltration and thickening of alveolar walls)). For example, viral
load (e.g., as determined by plaque assay and pulmonary
histopathology) was evaluated on hematoxylin and eosin (H&E)
stained fixed lung sections of vaccinated animals. The sections
were evaluated on a 0-4 severity scale and subsequently converted
to a 0-100% histopathology scale. The lung histopathology scores
were equivalent to the control, indicating no vaccine-enhanced
respiratory disease (ERD).
[0080] Although attempts have been made to produce functional RNA
vaccines, including mRNA vaccines and self-replicating RNA
vaccines, the therapeutic efficacy of these RNA vaccines have not
yet been fully established. Quite surprisingly, the inventors have
discovered, according to aspects of the present disclosure a class
of formulations for delivering mRNA vaccines in vivo that results
in significantly enhanced, and in many respects synergistic, immune
responses including enhanced antigen generation and functional
antibody production with neutralization capability. These results
can be achieved even when significantly lower doses of the mRNA are
administered in comparison with mRNA doses used in other classes of
lipid based formulations. The formulations of the present
disclosure have demonstrated significant unexpected in vivo immune
responses sufficient to establish the efficacy of functional mRNA
vaccines as prophylactic and therapeutic agents. Additionally,
self-replicating RNA vaccines rely on viral replication pathways to
deliver enough RNA to a cell to produce an immunogenic response.
The formulations of the present disclosure do not require viral
replication to produce enough protein to result in a strong immune
response. Thus, the mRNA of the present disclosure are not
self-replicating RNA and do not include components necessary for
viral replication.
[0081] The present disclosure involves, in some aspects, the
surprising finding that lipid nanoparticle (LNP) formulations
significantly enhance the effectiveness of mRNA vaccines, including
chemically modified and unmodified mRNA vaccines. The efficacy of
mRNA vaccines formulated in LNP was examined in vivo using several
distinct antigens. The results presented herein demonstrate the
unexpected superior efficacy of the mRNA vaccines formulated in LNP
over other commercially available vaccines.
[0082] In addition to providing an enhanced immune response, the
formulations of the present disclosure generate a more rapid immune
response with fewer doses of antigen than other vaccines tested.
The mRNA-LNP formulations of the present disclosure also produce
quantitatively and qualitatively better immune responses than
vaccines formulated in a different carriers.
[0083] The LNP used in the studies described herein has been used
previously to deliver siRNA in various animal models as well as in
humans. In view of the observations made in association with the
siRNA delivery of LNP formulations, the fact that LNP is useful in
vaccines is quite surprising. It has been observed that therapeutic
delivery of siRNA formulated in LNP causes an undesirable
inflammatory response associated with a transient IgM response,
typically leading to a reduction in antigen production and a
compromised immune response. In contrast to the findings observed
with siRNA, the LNP-mRNA formulations of the present disclosure are
demonstrated herein to generate enhanced IgG levels, sufficient for
prophylactic and therapeutic methods rather than transient IgM
responses.
[0084] hMPV/hPIV3 RNA Vaccine Compositions
[0085] In some embodiments, a vaccine of the present disclosure
comprises a RNA (e.g., mRNA) polynucleotide encoding a human
metapneumovirus (hMPV) fusion (F) protein. In other embodiments, a
vaccine of the present disclosure comprises a RNA (e.g., mRNA)
polynucleotide encoding a human parainfluenza virus type 3 (hPIV3)
fusion (F) protein. In yet other embodiments, a vaccine of the
present disclosure comprises a RNA (e.g., mRNA) polynucleotide
encoding a hMPV F protein and a RNA (e.g., mRNA) polynucleotide
encoding a hPIV3 F protein.
[0086] In some embodiments, the vaccine of the present disclosure
comprises a RNA (e.g., mRNA) polynucleotide encoding a hMPV F
protein comprising the amino acid sequence identified by SEQ ID
NO:7. In some embodiments, a vaccine of the present disclosure
comprises a RNA (e.g., mRNA) polynucleotide encoding a hMPV F
protein comprising an amino acid sequence that is at least 85%
identical to the amino acid sequence identified by SEQ ID NO:7. For
example, a vaccine may comprises a RNA (e.g., mRNA) polynucleotide
encoding a hMPV F protein comprising an amino acid sequence that is
at least 85%, at least 86%, at least 87%, at least 88%, at least
89%, at least 90%, at least 91%, at least 92%, at least 93%, at
least 94%, at least 95%, at least 96%, at least 97%, at least 98%,
or at least 99% identical to the amino acid sequence identified by
SEQ ID NO:7. In some embodiments, a vaccine comprises a RNA (e.g.,
mRNA) polynucleotide encoding a hMPV F protein comprising an amino
acid sequence that is 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98%, or 99% identical to the amino acid
sequence identified by SEQ ID NO:7.
[0087] In some embodiments, a vaccine of the present disclosure
comprises a RNA (e.g., mRNA) polynucleotide comprising the
nucleotide sequence identified by SEQ ID NO:4. In some embodiments,
a vaccine comprises a RNA (e.g., mRNA) polynucleotide comprising a
nucleotide sequence that is at least 85% identical to the
nucleotide sequence identified by SEQ ID NO:4. For example, a
vaccine may comprise a RNA (e.g., mRNA) polynucleotide comprising a
nucleotide sequence that is at least 85%, at least 86%, at least
87%, at least 88%, at least 89%, at least 90%, at least 91%, at
least 92%, at least 93%, at least 94%, at least 95%, at least 96%,
at least 97%, at least 98%, or at least 99% identical to the
nucleotide sequence identified by SEQ ID NO:4. In some embodiments,
a vaccine of the present disclosure comprises a RNA (e.g., mRNA)
polynucleotide comprising a nucleotide sequence that is 85%, 86%,
87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%
identical to the nucleotide sequence identified by SEQ ID NO:4.
[0088] In some embodiments, a vaccine of the present disclosure
comprises a RNA (e.g., mRNA) polynucleotide encoding a hPIV3 F
protein comprising the amino acid sequence identified by SEQ ID
NO:8. In some embodiments, a vaccine comprises a RNA (e.g., mRNA)
polynucleotide encoding a hPIV3 F protein comprising an amino acid
sequence that is at least 85% identical to the amino acid sequence
identified by SEQ ID NO:8. For example, a vaccine may comprise a
RNA (e.g., mRNA) polynucleotide encoding a hPIV3 F protein
comprising an amino acid sequence that is at least 85%, at least
86%, at least 87%, at least 88%, at least 89%, at least 90%, at
least 91%, at least 92%, at least 93%, at least 94%, at least 95%,
at least 96%, at least 97%, at least 98%, or at least 99% identical
to the amino acid sequence identified by SEQ ID NO:8. In some
embodiments, a vaccine comprises a RNA (e.g., mRNA) polynucleotide
encoding a hPIV3 F protein comprising an amino acid sequence that
is 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
98%, or 99% identical to the amino acid sequence identified by SEQ
ID NO:8.
[0089] In some embodiments, a vaccine of the present disclosure
comprises a RNA (e.g., mRNA) polynucleotide comprising a nucleotide
sequence identified by SEQ ID NO:5. In some embodiments, a vaccine
comprises a RNA (e.g., mRNA) polynucleotide comprising a nucleotide
sequence that is at least 85% identical to the nucleotide sequence
identified by SEQ ID NO:5. For example, a vaccine may comprise a
RNA (e.g., mRNA) polynucleotide comprising a nucleotide sequence
that is at least 85%, at least 86%, at least 87%, at least 88%, at
least 89%, at least 90%, at least 91%, at least 92%, at least 93%,
at least 94%, at least 95%, at least 96%, at least 97%, at least
98%, or at least 99% identical to the nucleotide sequence
identified by SEQ ID NO:5. In some embodiments, a vaccine comprises
a RNA (e.g., mRNA) polynucleotide comprising a nucleotide sequence
that is 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%, 98%, or 99% identical to the nucleotide sequence identified by
SEQ ID NO:5.
[0090] In some embodiments, the RNA (e.g., mRNA) vaccine of the
present disclosure comprises a RNA (e.g., mRNA) polynucleotide
encoding a hPIV3 hemagglutinin-neuraminidase (HN) comprising the
amino acid sequence identified by SEQ ID NO:9. In some embodiments,
the RNA (e.g., mRNA) vaccine of the present disclosure comprises a
RNA (e.g., mRNA) polynucleotide encoding a hPIV3
hemagglutinin-neuraminidase (FIN) comprising an amino acid sequence
that is at least 85% identical to the amino acid sequence
identified by SEQ ID NO:9. For example, the RNA (e.g., mRNA)
vaccine of the present disclosure comprises a RNA (e.g., mRNA)
polynucleotide encoding a hPIV3 hemagglutinin-neuraminidase (FIN)
comprising an amino acid sequence that is at least 85%, at least
86%, at least 87%, at least 88%, at least 89%, at least 90%, at
least 91%, at least 92%, at least 93%, at least 94%, at least 95%,
at least 96%, at least 97%, at least 98%, or at least 99% identical
to the amino acid sequence identified by SEQ ID NO:9. In some
embodiments, the RNA (e.g., mRNA) vaccine of the present disclosure
comprises a RNA (e.g., mRNA) polynucleotide encoding a hPIV3
hemagglutinin-neuraminidase (HN) comprising an amino acid sequence
that is 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%/0 98% or 99% identical to the amino acid sequence identified by
SEQ ID NO:9.
[0091] In some embodiments, a vaccine of the present disclosure
comprises a RNA (e.g., mRNA) polynucleotide comprising a nucleotide
sequence identified by SEQ ID NO:6. In some embodiments, a vaccine
comprises a RNA (e.g., mRNA) polynucleotide comprising a nucleotide
sequence that is at least 85% identical to the nucleotide sequence
identified by SEQ ID NO:6. For example, a vaccine may comprise a
RNA (e.g., mRNA) polynucleotide comprising a nucleotide sequence
that is at least 85%, at least 86%, at least 87%, at least 88%, at
least 89%, at least 90%, at least 91%, at least 92%, at least 93%,
at least 94%, at least 95%, at least 96%, at least 97%, at least
98%, or at least 99% identical to the nucleotide sequence
identified by SEQ ID NO:6. In some embodiments, a vaccine comprises
a RNA (e.g., mRNA) polynucleotide comprising a nucleotide sequence
that is 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
97%, 98%, or 99% identical to the nucleotide sequence identified by
SEQ ID NO:6.
[0092] In some embodiments, a vaccine of the present disclosure is
a combination vaccine comprising a RNA (e.g., mRNA) polynucleotide
encoding a hMPV F protein and a RNA (e.g., mRNA) polynucleotide
encoding a hPIV3 F protein. In some embodiments, a vaccine
comprises (a) a RNA (e.g., mRNA) polynucleotide encoding a hMPV F
protein comprising the amino acid sequence identified by SEQ ID
NO:7 or an amino acid sequence that is at least 90% (e.g., 90%,
91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) identical to the
amino acid sequence identified by SEQ ID NO:7, and (b) a RNA
polynucleotide encoding a hPIV3 F protein comprising the amino acid
sequence identified by SEQ ID NO:8 or an amino acid sequence that
is at least 90% (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%,
or 99%) identical to the amino acid sequence identified by SEQ ID
NO:8.
[0093] In some embodiments, a vaccine of the present disclosure is
a combination vaccine comprising (a) a hMPV ribonucleic acid (RNA)
polynucleotide comprising the nucleic acid sequence identified by
SEQ ID NO:4 or a nucleic acid sequence that is at least 90% (e.g.,
90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) identical to
the nucleic acid sequence identified by SEQ ID NO:4, and (b) a
hPIV3 RNA polynucleotide comprising the nucleic acid sequence
identified by SEQ ID NO:5 or a nucleic acid sequence that is at
least 90% (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or
99%) identical to the nucleic acid sequence identified by SEQ ID
NO:5.
[0094] In some embodiments, a vaccine of the present disclosure is
a combination vaccine comprising (a) a hMPV ribonucleic acid (RNA)
polynucleotide encoded by a nucleic acid comprising the nucleic
acid sequence identified by SEQ ID NO:1 or a nucleic acid sequence
that is at least 90% (e.g., 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
98%, or 99%) identical to the nucleic acid sequence identified by
SEQ ID NO:1, and (b) a hPIV3 RNA polynucleotide encoded by a
nucleic acid comprising the nucleic acid sequence identified by SEQ
ID NO:2 or a nucleic acid sequence that is at least 90% (e.g., 90%,
91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%) identical to the
nucleic acid sequence identified by SEQ ID NO:2.
hMPV/hPIV3 Fusion (F) Proteins and Other Antigens/Antigenic
Polypeptides
[0095] Human Metapneumovirus (hMPV) F Protein. hMPV shares
substantial homology with respiratory syncytial virus (RSV) in its
surface glycoproteins. hMPV fusion protein (F) is related to other
paramyxovirus fusion proteins and appears to have homologous
regions that may have similar functions. The hMPV F protein amino
acid sequence contains features characteristic of other
paramyxovirus F proteins, including a putative cleavage site and
potential N-linked glycosylation sites. Paramyxovirus F proteins
are synthesized as inactive precursors (F0) that are cleaved by
host cell proteases into the biologically fusion-active F1 and F2
domains (see, e.g., Cseke G. et al. Journal of Virology 2007;
81(2):698-707, incorporated herein by reference). hMPV has one
putative cleavage site, in contrast to the two sites established
for RSV F, and only shares 34% amino acid sequence identity with
RSV F. F2 is extracellular and disulfide linked to F1. F proteins
are type I glycoproteins existing as trimers, with two 4-3 heptad
repeat domains at the N- and C-terminal regions of the protein (HR1
and HR2), which form coiled-coil alpha-helices. These coiled coils
become apposed in an antiparallel fashion when the protein
undergoes a conformational change into the fusogenic state. There
is a hydrophobic fusion peptide N proximal to the N-terminal heptad
repeat, which is thought to insert into the target cell membrane,
while the association of the heptad repeats brings the
transmembrane domain into close proximity, inducing membrane fusion
(see, e.g., Baker, K A et al. Mol. Cell 1999; 3:309-319). This
mechanism has been proposed for a number of different viruses,
including RSV, influenza virus, and human immunodeficiency virus. F
proteins are major antigenic determinants for all known
paramyxoviruses and for other viruses that possess similar fusion
proteins such as human immunodeficiency virus, influenza virus, and
Ebola virus.
[0096] Human Parainfluenza Virus Type 3 (hPIV3) F Protein.
Parainfluenza viruses belong to the family Paramyxoviridae. These
are enveloped viruses with a negative-sense single-stranded RNA
genome. Parainfluenza viruses belong to the subfamily
Paramyxoviridae, which is subdivided into three genera:
Respirovirus (PIV-1, PIV-3, and Sendai virus (SeV)), Rubulavirus
(PIV-2, PIV-4 and mumps virus) and Morbillivirus (measles virus,
rinderpest virus and canine distemper virus (CDV)). Their genome, a
.about.15,500 nucleotide-long negative-sense RNA molecule, encodes
two envelope glycoproteins, the hemagglutinin-neuraminidase (HN),
the fusion protein (F or F0), which is cleaved into F1 and F2
subunits, a matrix protein (M), a nucleocapsid protein (N) and
several nonstructural proteins including the viral replicase (L).
All parainfluenza viruses, except for PIV1, express a
non-structural V protein that blocks IFN signaling in the infected
cell and acts therefore as a virulence factor (see, e.g., Nishio M
et al. J Virol. 2008; 82(13):6130-38).
[0097] PIV3 fusion protein (PIV3 F) is located on the viral
envelope, where it facilitates the viral fusion and cell entry. The
F protein is initially inactive, but proteolytic cleavage leads to
its active forms, F1 and F2, which are linked by disulfide bonds.
This occurs when the TIN protein binds its receptor on the host
cell's surface. During early phases of infection, the F
glycoprotein mediates penetration of the host cell by fusion of the
viral envelope to the plasma membrane. In later stages of the
infection, the F protein facilitates the fusion of the infected
cells with neighboring uninfected cells, which leads to the
formation of a syncytium and spread of the infection.
[0098] An antigenic polypeptide (e.g., hMPV/hPIV3 F protein)
encoded by a RNA vaccine of the present disclosure may be naturally
occurring polypeptides, synthetic polypeptides, homologs,
orthologs, paralogs, fragments and other equivalents, variants, and
analogs of the foregoing. A polypeptide may be a single molecule or
may be a multi-molecular complex such as a dimer, trimer or
tetramer. Polypeptides may also comprise single chain polypeptides
or multichain polypeptides, such as antibodies or insulin, and may
be associated or linked to each other. Most commonly, disulfide
linkages are found in multichain polypeptides. The term
"polypeptide" may also apply to amino acid polymers in which at
least one amino acid residue is an artificial chemical analogue of
a corresponding naturally-occurring amino acid.
[0099] A "polypeptide variant" is a molecule that differs in its
amino acid sequence relative to a native sequence or a reference
sequence. Amino acid sequence variants may possess substitutions,
deletions, insertions, or a combination of any two or three of the
foregoing, at certain positions within the amino acid sequence, as
compared to a native sequence or a reference sequence. Ordinarily,
variants possess at least 50% identity to a native sequence or a
reference sequence. In some embodiments, variants share at least
80% identity or at least 90% identity with a native sequence or a
reference sequence.
[0100] Vaccines of the present disclosure may include a variant of
a hMPV and/or hPIV3 F protein. These include, for example,
substitutional, insertional, deletion and covalent variants and
derivatives. The term "derivative" is synonymous with the term
"variant" and generally refers to a molecule that has been modified
and/or changed in any way relative to a reference molecule or a
starting molecule.
[0101] As such, polynucleotides encoding peptides or polypeptides
containing substitutions, insertions and/or additions, deletions
and covalent modifications with respect to reference sequences, in
particular the polypeptide sequences disclosed herein, are included
within the scope of this disclosure. For example, sequence tags or
amino acids, such as one or more lysines, can be added to peptide
sequences (e.g., at the N-terminal or C-terminal ends). Sequence
tags can be used for peptide detection, purification or
localization. Lysines can be used to increase peptide solubility or
to allow for biotinylation. Alternatively, amino acid residues
located at the carboxy and amino terminal regions of the amino acid
sequence of a peptide or protein may optionally be deleted
providing for truncated sequences. Certain amino acids (e.g.,
C-terminal residues or N-terminal residues) alternatively may be
deleted depending on the use of the sequence, as for example,
expression of the sequence as part of a larger sequence that is
soluble, or linked to a solid support.
[0102] "Substitutional variants" when referring to polypeptides are
those that have at least one amino acid residue in a native or
starting sequence removed and a different amino acid inserted in
its place at the same position. Substitutions may be single, where
only one amino acid in the molecule has been substituted, or they
may be multiple, where two or more (e.g., 3, 4 or 5) amino acids
have been substituted in the same molecule.
[0103] As used herein the term "conservative amino acid
substitution" refers to the substitution of an amino acid that is
normally present in the sequence with a different amino acid of
similar size, charge, or polarity. Examples of conservative
substitutions include the substitution of a non-polar (hydrophobic)
residue such as isoleucine, valine and leucine for another
non-polar residue. Likewise, examples of conservative substitutions
include the substitution of one polar (hydrophilic) residue for
another such as between arginine and lysine, between glutamine and
asparagine, and between glycine and serine. Additionally, the
substitution of a basic residue such as lysine, arginine or
histidine for another, or the substitution of one acidic residue
such as aspartic acid or glutamic acid for another acidic residue
are additional examples of conservative substitutions. Examples of
non-conservative substitutions include the substitution of a
non-polar (hydrophobic) amino acid residue such as isoleucine,
valine, leucine, alanine, methionine for a polar (hydrophilic)
residue such as cysteine, glutamine, glutamic acid or lysine and/or
a polar residue for a non-polar residue.
[0104] "Features" when referring to polypeptide or polynucleotide
are defined as distinct amino acid sequence-based or
nucleotide-based components of a molecule respectively. Features of
the polypeptides encoded by the polynucleotides include surface
manifestations, local conformational shape, folds, loops,
half-loops, domains, half-domains, sites, termini and any
combination(s) thereof.
[0105] When referring to polypeptides the term "domain" refers to a
motif of a polypeptide having one or more identifiable structural
or functional characteristics or properties (e.g., binding
capacity, serving as a site for protein-protein interactions).
[0106] When referring to polypeptides the terms "site" as it
pertains to amino acid based embodiments is used synonymously with
"amino acid residue" and "amino acid side chain." As used herein
when referring to polynucleotides the terms "site" as it pertains
to nucleotide based embodiments is used synonymously with
"nucleotide." A site represents a position within a peptide or
polypeptide or polynucleotide that may be modified, manipulated,
altered, derivatized or varied within the polypeptide-based or
polynucleotide-based molecules.
[0107] The terms "termini" or "terminus" when referring to
polypeptides or polynucleotides refers to an extremity of a
polypeptide or polynucleotide respectively. Such extremity is not
limited only to the first or final site of the polypeptide or
polynucleotide but may include additional amino acids or
nucleotides in the terminal regions. Polypeptide-based molecules
may be characterized as having both an N-terminus (terminated by an
amino acid with a free amino group (NH2)) and a C-terminus
(terminated by an amino acid with a free carboxyl group (COOH)).
Proteins are in some cases made up of multiple polypeptide chains
brought together by disulfide bonds or by non-covalent forces
(multimers, oligomers). These proteins have multiple N- and
C-termini. Alternatively, the termini of the polypeptides may be
modified such that they begin or end, as the case may be, with a
non-polypeptide based moiety such as an organic conjugate.
[0108] As recognized by those skilled in the art, protein
fragments, functional protein domains, and homologous proteins are
also considered to be within the scope of polypeptides of interest.
For example, provided herein is any protein fragment (meaning a
polypeptide sequence at least one amino acid residue shorter than a
reference polypeptide sequence but otherwise identical) of a
reference protein having a length of 10, 20, 30, 40, 50, 60, 70,
80, 90, 100 or longer than 100 amino acids. In another example, any
protein that includes a stretch of 20, 30, 40, 50, or 100
(contiguous) amino acids that are 40%, 50%, 60%, 70%, 80%, 90%,
95%, or 100% identical to any of the sequences described herein can
be utilized in accordance with the disclosure. In some embodiments,
a polypeptide includes 2, 3, 4, 5, 6, 7, 8, 9, 10, or more
mutations as shown in any of the sequences provided herein or
referenced herein. In another example, any protein that includes a
stretch of 20, 30, 40, 50, or 100 amino acids that are greater than
80%, 90%, 95%, or 100% identical to any of the sequences described
herein, wherein the protein has a stretch of 5, 10, 15, 20, 25, or
30 amino acids that are less than 80%, 75%, 70%, 65% to 60%
identical to any of the sequences described herein can be utilized
in accordance with the disclosure.
[0109] Polypeptide or polynucleotide molecules of the present
disclosure may share a certain degree of sequence identity with the
reference molecules (e.g., reference polypeptides or reference
polynucleotides), for example, an F protein having an amino acid
sequence identified by SEQ ID NO:7 or SEQ ID NO:8. The term
"identity" refers to the overall relatedness between polymeric
molecules, for example, between polynucleotide molecules (e.g. DNA
molecules and/or RNA molecules) and/or between polypeptide
molecules. Calculation of the percent identity of two polynucleic
acid sequences, for example, can be performed by aligning the two
sequences for optimal comparison purposes (e.g., gaps can be
introduced in one or both of a first and a second nucleic acid
sequences for optimal alignment and non-identical sequences can be
disregarded for comparison purposes). In certain embodiments, the
length of a sequence aligned for comparison purposes is at least
30%, at least 40%, at least 50%, at least 60%, at least 70%, at
least 80%, at least 90%, at least 95%, or 100% of the length of the
reference sequence. The nucleotides at corresponding nucleotide
positions are then compared. When a position in the first sequence
is occupied by the same nucleotide as the corresponding position in
the second sequence, then the molecules are identical at that
position. The percent identity between the two sequences is a
function of the number of identical positions shared by the
sequences, taking into account the number of gaps, and the length
of each gap, which needs to be introduced for optimal alignment of
the two sequences. The comparison of sequences and determination of
percent identity between two sequences can be accomplished using a
mathematical algorithm. For example, the percent identity between
two nucleic acid sequences can be determined using methods such as
those described in Computational Molecular Biology, Lesk, A. M.,
ed., Oxford University Press, New York, 1988; Biocomputing:
Informatics and Genome Projects, Smith, D. W., ed., Academic Press,
New York, 1993; Sequence Analysis in Molecular Biology, von Heinje,
G., Academic Press, 1987; Computer Analysis of Sequence Data, Part
I, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New
Jersey, 1994; and Sequence Analysis Primer, Gribskov, M. and
Devereux, J., eds., M Stockton Press, New York, 1991; each of which
is incorporated herein by reference. For example, the percent
identity between two nucleic acid sequences can be determined using
the algorithm of Meyers and Miller (CABIOS, 1989, 4:11-17), which
has been incorporated into the ALIGN program (version 2.0) using a
PAM120 weight residue table, a gap length penalty of 12 and a gap
penalty of 4. The percent identity between two nucleic acid
sequences can, alternatively, be determined using the GAP program
in the GCG software package using an NWSgapdna.CMP matrix. Methods
commonly employed to determine percent identity between sequences
include, but are not limited to those disclosed in Carillo, H., and
Lipman, D., SIAM J Applied Math., 48:1073 (1988); incorporated
herein by reference. Techniques for determining identity are
codified in publicly available computer programs. Exemplary
computer software to determine homology between two sequences
include, but are not limited to, GCG program package, Devereux, J.,
et al., Nucleic Acids Research, 12(1), 387 (1984)), BLASTP, BLASTN,
and FASTA Altschul, S. F. et al., J Molec. Biol., 215, 403
(1990)).
[0110] Thus, the term "identity" refers to a relationship between
the sequences of two or more polypeptides or polynucleotides, as
determined by comparing the sequences. In the art, identity also
means the degree of sequence relatedness between two sequences as
determined by the number of matches between strings of two or more
amino acid residues or nucleic acid residues. Identity measures the
percent of identical matches between the smaller of two or more
sequences with gap alignments (if any) addressed by a particular
mathematical model or computer program (e.g., "algorithms").
Identity of related peptides can be readily calculated by known
methods. "% identity" as it applies to polypeptide or
polynucleotide sequences is defined as the percentage of residues
(amino acid residues or nucleic acid residues) in the candidate
amino acid or nucleic acid sequence that are identical with the
residues in the amino acid sequence or nucleic acid sequence of a
second sequence after aligning the sequences and introducing gaps,
if necessary, to achieve the maximum percent identity. Methods and
computer programs for the alignment are well known in the art.
Identity depends on a calculation of percent identity but may
differ in value due to gaps and penalties introduced in the
calculation. Generally, variants of a particular polynucleotide or
polypeptide have at least 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%,
80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% but less
than 100% sequence identity to that particular reference
polynucleotide or polypeptide as determined by sequence alignment
programs and parameters described herein and known to those skilled
in the art. Such tools for alignment include those of the BLAST
suite (Stephen F. Altschul, et al. (1997)." Gapped BLAST and
PSI-BLAST: a new generation of protein database search programs,"
Nucleic Acids Res. 25:3389-3402). Another popular local alignment
technique is based on the Smith-Waterman algorithm (Smith, T. F.
& Waterman, M. S. (1981) "Identification of common molecular
subsequences." J. Mol. Biol. 147:195-197). A general global
alignment technique based on dynamic programming is the
Needleman-Wunsch algorithm (Needleman, S. B. & Wunsch, C. D.
(1970) "A general method applicable to the search for similarities
in the amino acid sequences of two proteins." J. Mol. Biol.
48:443-453). More recently, a Fast Optimal Global Sequence
Alignment Algorithm (FOGSAA) was developed that purportedly
produces global alignment of nucleotide and protein sequences
faster than other optimal global alignment methods, including the
Needleman-Wunsch algorithm.
[0111] The term "homology" refers to the overall relatedness
between polymeric molecules, e.g. between nucleic acid molecules
(e.g. DNA molecules and/or RNA molecules) and/or between
polypeptide molecules. Polymeric molecules (e.g. nucleic acid
molecules (e.g. DNA molecules and/or RNA molecules) and/or
polypeptide molecules) that share a threshold level of similarity
or identity determined by alignment of matching residues are termed
homologous. Homology is a qualitative term that describes a
relationship between molecules and can be based upon the
quantitative similarity or identity. Similarity or identity is a
quantitative term that defines the degree of sequence match between
two compared sequences. In some embodiments, polymeric molecules
are considered to be "homologous" to one another if their sequences
are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%,
80%, 85%, 90%, 95%, or 99% identical or similar. The term
"homologous" necessarily refers to a comparison between at least
two sequences (polynucleotide or polypeptide sequences). Two
polynucleotide sequences are considered homologous if the
polypeptides they encode are at least 50%, 60%, 70%, 80%, 90%, 95%,
or even 99% for at least one stretch of at least 20 amino acids. In
some embodiments, homologous polynucleotide sequences are
characterized by the ability to encode a stretch of at least 4-5
uniquely specified amino acids. For polynucleotide sequences less
than 60 nucleotides in length, homology is determined by the
ability to encode a stretch of at least 4-5 uniquely specified
amino acids. Two protein sequences are considered homologous if the
proteins are at least 50%, 60%, 70%, 80%, or 90% identical for at
least one stretch of at least 20 amino acids.
[0112] Homology implies that the compared sequences diverged in
evolution from a common origin. The term "homolog" refers to a
first amino acid sequence or nucleic acid sequence (e.g., gene (DNA
or RNA) or protein sequence) that is related to a second amino acid
sequence or nucleic acid sequence by descent from a common
ancestral sequence. The term "homolog" may apply to the
relationship between genes and/or proteins separated by the event
of speciation or to the relationship between genes and/or proteins
separated by the event of genetic duplication. "Orthologs" are
genes (or proteins) in different species that evolved from a common
ancestral gene (or protein) by speciation. Typically, orthologs
retain the same function in the course of evolution. "Paralogs" are
genes (or proteins) related by duplication within a genome.
Orthologs retain the same function in the course of evolution,
whereas paralogs evolve new functions, even if these are related to
the original one.
Nucleic Acids/Polynucleotides
[0113] The term "nucleic acid" includes any compound and/or
substance that comprises a polymer of nucleotides (nucleotide
monomer). These polymers are referred to as polynucleotides. Thus,
the terms "nucleic acid" and "polynucleotide" are used
interchangeably.
[0114] Nucleic acids may be or may include, for example,
ribonucleic acids (RNAs), deoxyribonucleic acids (DNAs), threose
nucleic acids (TNAs), glycol nucleic acids (GNAs), peptide nucleic
acids (PNAs), locked nucleic acids (LNAs, including LNA having a
.beta.-D-ribo configuration, .alpha.-LNA having an .alpha.-L-ribo
configuration (a diastereomer of LNA), 2'-amino-LNA having a
2'-amino functionalization, and 2'-amino-.alpha.-LNA having a
2'-amino functionalization), ethylene nucleic acids (ENA),
cyclohexenyl nucleic acids (CeNA) or chimeras or combinations
thereof.
[0115] In some embodiments, polynucleotides of the present
disclosure function as messenger RNA (mRNA). "Messenger RNA" (mRNA)
refers to any polynucleotide that encodes a (at least one)
polypeptide (a naturally-occurring, non-naturally-occurring, or
modified polymer of amino acids) and can be translated to produce
the encoded polypeptide in vitro, in vivo, in situ or ex vivo. The
skilled artisan will appreciate that, except where otherwise noted,
polynucleotide sequences set forth in the instant application will
recite "T"s in a representative DNA sequence but where the sequence
represents RNA (e.g., mRNA), the "T"s would be substituted for
"U"s. Thus, any of the RNA polynucleotides encoded by a DNA
identified by a particular sequence identification number may also
comprise the corresponding RNA (e.g., mRNA) sequence encoded by the
DNA, where each "T" of the DNA sequence is substituted with
"U."
[0116] The basic components of an mRNA molecule typically include
at least one coding region, a 5' untranslated region (UTR), a 3'
UTR, a 5' cap and a poly-A tail. Polynucleotides of the present
disclosure may function as mRNA but can be distinguished from
wild-type mRNA in their functional and/or structural design
features, which serve to overcome existing problems of effective
polypeptide expression using nucleic-acid based therapeutics.
[0117] Polynucleotides of the present disclosure, in some
embodiments, are codon optimized. Codon optimization methods are
known in the art and may be used as provided herein. Codon
optimization, in some embodiments, may be used to match codon
frequencies in target and host organisms to ensure proper folding;
bias GC content to increase mRNA stability or reduce secondary
structures; minimize tandem repeat codons or base runs that may
impair gene construction or expression; customize transcriptional
and translational control regions; insert or remove protein
trafficking sequences; remove/add post translation modification
sites in encoded protein (e.g. glycosylation sites); add, remove or
shuffle protein domains; insert or delete restriction sites; modify
ribosome binding sites and mRNA degradation sites; adjust
translational rates to allow the various domains of the protein to
fold properly; or to reduce or eliminate problem secondary
structures within the polynucleotide. Codon optimization tools,
algorithms and services are known in the art--non-limiting examples
include services from GeneArt (Life Technologies), DNA2.0 (Menlo
Park Calif.) and/or proprietary methods. In some embodiments, the
open reading frame (ORF) sequence is optimized using optimization
algorithms.
[0118] In some embodiments, a codon optimized sequence shares less
than 95% sequence identity, less than 90% sequence identity, less
than 85% sequence identity, less than 80% sequence identity, or
less than 75% sequence identity to a naturally-occurring or
wild-type sequence (e.g., a naturally-occurring or wild-type mRNA
sequence encoding a polypeptide or protein of interest (e.g., F
protein)).
[0119] In some embodiments, a codon-optimized sequence shares
between 65% and 85% (e.g., between about 67% and about 85%, or
between about 67% and about 80%) sequence identity to a
naturally-occurring sequence or a wild-type sequence (e.g., a
naturally-occurring or wild-type mRNA sequence encoding a
polypeptide or protein of interest (e.g., an antigenic protein or
polypeptide)). In some embodiments, a codon-optimized sequence
shares between 65% and 75%, or about 80% sequence identity to a
naturally-occurring sequence or wild-type sequence (e.g., a
naturally-occurring or wild-type mRNA sequence encoding a
polypeptide or protein of interest (e.g., an antigenic protein or
polypeptide)).
[0120] In some embodiments a codon-optimized RNA (e.g., mRNA) may,
for instance, be one in which the levels of G/C are enhanced. The
G/C-content of nucleic acid molecules may influence the stability
of the RNA. RNA having an increased amount of guanine (G) and/or
cytosine (C) residues may be functionally more stable than nucleic
acids containing a large amount of adenine (A) and thymine (T) or
uracil (U) nucleotides. WO02/098443 discloses a pharmaceutical
composition containing an mRNA stabilized by sequence modifications
in the translated region. Due to the degeneracy of the genetic
code, the modifications work by substituting existing codons for
those that promote greater RNA stability without changing the
resulting amino acid. The approach is limited to coding regions of
the RNA.
Variants
[0121] In some embodiments, an RNA of the present disclosure
encodes a hMPV/hPIV3 antigen variant. Antigen or other polypeptide
variants refers to molecules that differ in their amino acid
sequence from a wild-type, native or reference sequence. The
antigen/polypeptide variants may possess substitutions, deletions,
and/or insertions at certain positions within the amino acid
sequence, as compared to a native or reference sequence.
Ordinarily, variants possess at least 50% identity to a wild-type,
native or reference sequence. In some embodiments, variants share
at least 80%, or at least 90% identity with a wild-type, native or
reference sequence.
[0122] Variant antigens/polypeptides encoded by nucleic acids of
the disclosure may contain amino acid changes that confer any of a
number of desirable properties, e.g., that enhance their
immunogenicity, enhance their expression, and/or improve their
stability or PK/PD properties in a subject. Variant
antigens/polypeptides can be made using routine mutagenesis
techniques and assayed as appropriate to determine whether they
possess the desired property. Assays to determine expression levels
and immunogenicity are well known in the art and exemplary such
assays are set forth in the Examples section. Similarly, PK/PD
properties of a protein variant can be measured using art
recognized techniques, e.g., by determining expression of antigens
in a vaccinated subject over time and/or by looking at the
durability of the induced immune response. The stability of
protein(s) encoded by a variant nucleic acid may be measured by
assaying thermal stability or stability upon urea denaturation or
may be measured using in silico prediction. Methods for such
experiments and in silico determinations are known in the art.
[0123] In some embodiments, a hMPV/hPIV3 vaccine comprises an mRNA
ORF having a nucleotide sequence identified by any one of the
sequences provided herein (see e.g., Sequence Listing), or having a
nucleotide sequence at least 80%, at least 85%, at least 90%, at
least 95%, at least 96%, at least 97%, at least 98%, or at least
99% identical to a nucleotide sequence identified by any one of the
sequence provided herein.
[0124] The term "identity" refers to a relationship between the
sequences of two or more polypeptides (e.g. antigens) or
polynucleotides (nucleic acids), as determined by comparing the
sequences. Identity also refers to the degree of sequence
relatedness between or among sequences as determined by the number
of matches between strings of two or more amino acid residues or
nucleic acid residues. Identity measures the percent of identical
matches between the smaller of two or more sequences with gap
alignments (if any) addressed by a particular mathematical model or
computer program (e.g., "algorithms"). Identity of related antigens
or nucleic acids can be readily calculated by known methods.
"Percent (%) identity" as it applies to polypeptide or
polynucleotide sequences is defined as the percentage of residues
(amino acid residues or nucleic acid residues) in the candidate
amino acid or nucleic acid sequence that are identical with the
residues in the amino acid sequence or nucleic acid sequence of a
second sequence after aligning the sequences and introducing gaps,
if necessary, to achieve the maximum percent identity. Methods and
computer programs for the alignment are well known in the art. It
is understood that identity depends on a calculation of percent
identity but may differ in value due to gaps and penalties
introduced in the calculation. Generally, variants of a particular
polynucleotide or polypeptide (e.g., antigen) have at least 40%,
45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98%, 99% but less than 100% sequence identity
to that particular reference polynucleotide or polypeptide as
determined by sequence alignment programs and parameters described
herein and known to those skilled in the art. Such tools for
alignment include those of the BLAST suite (Stephen F. Altschul, et
al (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein
database search programs", Nucleic Acids Res. 25:3389-3402).
Another popular local alignment technique is based on the
Smith-Waterman algorithm (Smith, T. F. & Waterman, M. S. (1981)
"Identification of common molecular subsequences." J. Mol. Biol.
147:195-197). A general global alignment technique based on dynamic
programming is the Needleman-Wunsch algorithm (Needleman, S. B.
& Wunsch, C. D. (1970) "A general method applicable to the
search for similarities in the amino acid sequences of two
proteins." J. Mol. Biol. 48:443-453). More recently a Fast Optimal
Global Sequence Alignment Algorithm (FOGSAA) has been developed
that purportedly produces global alignment of nucleotide and
protein sequences faster than other optimal global alignment
methods, including the Needleman-Wunsch algorithm.
[0125] As such, polynucleotides encoding peptides or polypeptides
containing substitutions, insertions and/or additions, deletions
and covalent modifications with respect to reference sequences, in
particular the polypeptide (e.g., antigen) sequences disclosed
herein, are included within the scope of this disclosure. For
example, sequence tags or amino acids, such as one or more lysines,
can be added to peptide sequences (e.g., at the N-terminal or
C-terminal ends). Sequence tags can be used for peptide detection,
purification or localization. Lysines can be used to increase
peptide solubility or to allow for biotinylation. Alternatively,
amino acid residues located at the carboxy and amino terminal
regions of the amino acid sequence of a peptide or protein may
optionally be deleted providing for truncated sequences. Certain
amino acids (e.g., C-terminal or N-terminal residues) may
alternatively be deleted depending on the use of the sequence, as
for example, expression of the sequence as part of a larger
sequence which is soluble, or linked to a solid support. In some
embodiments, sequences for (or encoding) signal sequences,
termination sequences, transmembrane domains, linkers,
multimerization domains (such as, e.g., foldon regions) and the
like may be substituted with alternative sequences that achieve the
same or a similar function. In some embodiments, cavities in the
core of proteins can be filled to improve stability, e.g., by
introducing larger amino acids. In other embodiments, buried
hydrogen bond networks may be replaced with hydrophobic resides to
improve stability. In yet other embodiments, glycosylation sites
may be removed and replaced with appropriate residues. Such
sequences are readily identifiable to one of skill in the art. It
should also be understood that some of the sequences provided
herein contain sequence tags or terminal peptide sequences (e.g.,
at the N-terminal or C-terminal ends) that may be deleted, for
example, prior to use in the preparation of an RNA (e.g., mRNA)
vaccine.
[0126] As recognized by those skilled in the art, protein
fragments, functional protein domains, and homologous proteins are
also considered to be within the scope of hMPV/hPIV3 antigens of
interest. For example, provided herein is any protein fragment
(meaning a polypeptide sequence at least one amino acid residue
shorter than a reference antigen sequence but otherwise identical)
of a reference protein, provided that the fragment is immunogenic
and confers a protective immune response to hMPV/hPIV3. In addition
to variants that are identical to the reference protein but are
truncated, in some embodiments, an antigen includes 2, 3, 4, 5, 6,
7, 8, 9, 10, or more mutations, as shown in any of the sequences
provided or referenced herein. Antigens/antigenic polypeptides can
range in length from about 4, 6, or 8 amino acids to full length
proteins.
Stabilizing Elements
[0127] Naturally-occurring eukaryotic mRNA molecules have been
found to contain stabilizing elements, including, but not limited
to untranslated regions (UTR) at their 5'-end (5'UTR) and/or at
their 3'-end (3'UTR), in addition to other structural features,
such as a 5'-cap structure or a 3'-poly(A) tail. Both the 5'UTR and
the 3'UTR are typically transcribed from the genomic DNA and are
elements of the premature mRNA. Characteristic structural features
of mature mRNA, such as the 5'-cap and the 3'-poly(A) tail are
usually added to the transcribed (premature) mRNA during mRNA
processing. The 3'-poly(A) tail is typically a stretch of adenine
nucleotides added to the 3'-end of the transcribed mRNA. It can
comprise up to about 400 adenine nucleotides. In some embodiments
the length of the 3'-poly(A) tail may be an essential element with
respect to the stability of the individual mRNA.
[0128] In some embodiments the RNA (e.g., mRNA) vaccine may include
one or more stabilizing elements. Stabilizing elements may include
for instance a histone stem-loop. A stem-loop binding protein
(SLBP), a 32 kDa protein has been identified. It is associated with
the histone stem-loop at the 3'-end of the histone messages in both
the nucleus and the cytoplasm. Its expression level is regulated by
the cell cycle; it peaks during the S-phase, when histone mRNA
levels are also elevated. The protein has been shown to be
essential for efficient 3'-end processing of histone pre-mRNA by
the U7 snRNP. SLBP continues to be associated with the stem-loop
after processing, and then stimulates the translation of mature
histone mRNAs into histone proteins in the cytoplasm. The RNA
binding domain of SLBP is conserved through metazoa and protozoa;
its binding to the histone stem-loop depends on the structure of
the loop. The minimum binding site includes at least three
nucleotides 5' and two nucleotides 3' relative to the
stem-loop.
[0129] In some embodiments, a hMPV/hPIV3 RNA (e.g., mRNA) vaccine
of the present disclosure comprises a natural 5' cap. In some
embodiments, a 5' cap may be a 5' cap analog, such as a 5'
diguanosine cap, tetraphosphate cap analogs having a methylene-bis
(phosphonate) moiety, cap analogs having a sulfur substitution for
a non-bridging oxygen, N7-benzylated dinucleoside tetraphosphate
analogs, or anti-reverse cap analogs. In some embodiments, the 5'
cap is a 7mG(5')ppp(5')NlmpNp cap. In some embodiments, the 5' cap
is a 7mG(5')ppp(5')NlmpN2mp cap. In some embodiments, the 5'cap
analog is a 5' diguanosine cap.
[0130] In some embodiments, a hMPV/hPIV3 RNA (e.g., mRNA) vaccine
includes a coding region, at least one histone stem-loop, and
optionally, a poly(A) sequence or polyadenylation signal. The
poly(A) sequence or polyadenylation signal generally should enhance
the expression level of the encoded protein. The encoded protein,
in some embodiments, is not a histone protein, a reporter protein
(e.g. luciferase, green fluorescent protein (GFP), enhanced GFP
(EGFP), or .beta.-Galactosidase), or a marker or selection protein
(e.g. alpha-globin, galactokinase and xanthine:guanine
phosphoribosyl transferase (GPT)).
[0131] In some embodiments, the combination of a poly(A) sequence
or polyadenylation signal and at least one histone stem-loop, even
though both represent alternative mechanisms in nature, acts
synergistically to increase the protein expression beyond the level
observed with either of the individual elements. It has been found
that the synergistic effect of the combination of poly(A) and at
least one histone stem-loop does not depend on the order of the
elements or the length of the poly(A) sequence.
[0132] In some embodiments, a hMPV/hPIV3 RNA (e.g., mRNA) vaccine
does not comprise a histone downstream element (HDE). "Histone
downstream element" (HDE) includes a purine-rich polynucleotide
stretch of approximately 15 to 20 nucleotides 3' of naturally
occurring stem-loops, representing the binding site for the U7
snRNA, which is involved in processing of histone pre-mRNA into
mature histone mRNA. Ideally, the inventive nucleic acid does not
include an intron.
[0133] In some embodiments, a hMPV/hPIV3 RNA (e.g., mRNA) vaccine
may or may not contain a enhancer and/or promoter sequence, which
may be modified or unmodified or which may be activated or
inactivated. In some embodiments, the histone stem-loop is
generally derived from histone genes, and includes an
intramolecular base pairing of two neighbored partially or entirely
reverse complementary sequences separated by a spacer, including
(e.g., consisting of) a short sequence, which forms the loop of the
structure. The unpaired loop region is typically unable to base
pair with either of the stem loop elements. It occurs more often in
RNA, as is a key component of many RNA secondary structures, but
may be present in single-stranded DNA as well. Stability of the
stem-loop structure generally depends on the length, number of
mismatches or bulges, and base composition of the paired region. In
some embodiments, wobble base pairing (non-Watson-Crick base
pairing) may result. In some embodiments, the at least one histone
stem-loop sequence comprises a length of 15 to 45 nucleotides.
[0134] In other embodiments a hMPV/hPIV3 RNA (e.g., mRNA) vaccine
may have one or more AU-rich sequences removed. These sequences,
sometimes referred to as AURES are destabilizing sequences found in
the 3'UTR. The AURES may be removed from the RNA (e.g., mRNA)
vaccines. Alternatively the AURES may remain in the RNA (e.g.,
mRNA) vaccine.
Signal Peptides
[0135] In some embodiments, a hMPV/hPIV3 vaccine comprises a RNA
having an ORF that encodes a signal peptide fused to the hMPV/hPIV3
antigen. Signal peptides, comprising the N-terminal 15-60 amino
acids of proteins, are typically needed for the translocation
across the membrane on the secretory pathway and, thus, universally
control the entry of most proteins both in eukaryotes and
prokaryotes to the secretory pathway. In eukaryotes, the signal
peptide of a nascent precursor protein (pre-protein) directs the
ribosome to the rough endoplasmic reticulum (ER) membrane and
initiates the transport of the growing peptide chain across it for
processing. ER processing produces mature proteins, wherein the
signal peptide is cleaved from precursor proteins, typically by a
ER-resident signal peptidase of the host cell, or they remain
uncleaved and function as a membrane anchor. A signal peptide may
also facilitate the targeting of the protein to the cell
membrane.
[0136] A signal peptide may have a length of 15-60 amino acids. For
example, a signal peptide may have a length of 15, 16, 17, 18, 19,
20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36,
37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53,
54, 55, 56, 57, 58, 59, or 60 amino acids. In some embodiments, a
signal peptide has a length of 20-60, 25-60, 30-60, 35-60, 40-60,
45-60, 50-60, 55-60, 15-55, 20-55, 25-55, 30-55, 35-55, 40-55,
45-55, 50-55, 15-50, 20-50, 25-50, 30-50, 35-50, 40-50, 45-50,
15-45, 20-45, 25-45, 30-45, 35-45, 40-45, 15-40, 20-40, 25-40,
30-40, 35-40, 15-35, 20-35, 25-35, 30-35, 15-30, 20-30, 25-30,
15-25, 20-25, or 15-20 amino acids.
[0137] Signal peptides from heterologous genes (which regulate
expression of genes other tha hMPV/hPIV3 antigens in nature) are
known in the art and can be tested for desired properties and then
incorporated into a nucleic acid of the disclosure. In some
embodiments, the signal peptide is a bovine prolactin signal
peptide. For example, the bovine prolactin signal peptide may
comprise sequence MDSKGSSQKGSRLLLLLVVSNLLLPQGVVG (SEQ ID NO: 17).
Other signal peptide sequences may also be used. For example, the
signal peptide may comprise one of the following sequences:
TABLE-US-00001 (SEQ ID NO: 18) MDWTWILFLVAAATRVHS; (SEQ ID NO: 19)
METPAQLLFLLLLWLPDTTG; (SEQ ID NO: 20) MLGSNSGQRVVFTILLLLVAPAYS;
(SEQ ID NO: 21) MKCLLYLAFLFIGVNCA; (SEQ ID NO: 22)
MWLVSLAIVTACAGA.
Fusion Proteins
[0138] In some embodiments, a hMPV/hPIV3 RNA vaccine of the present
disclosure includes an RNA encoding an antigenic fusion protein.
Thus, the encoded antigen or antigens may include two or more
proteins (e.g., protein and/or protein fragment) joined together.
Alternatively, the protein to which a protein antigen is fused does
not promote a strong immune response to itself, but rather to the
hMPV/hPIV3 antigen. Antigenic fusion proteins, in some embodiments,
retain the functional property from each original protein.
Scaffold Moieties
[0139] The RNA (e.g., mRNA) vaccines as provided herein, in some
embodiments, encode fusion proteins which comprise hMPV/hPIV3
antigens linked to scaffold moieties. In some embodiments, such
scaffold moieties impart desired properties to an antigen encoded
by a nucleic acid of the disclosure. For example scaffold proteins
may improve the immunogenicity of an antigen, e.g., by altering the
structure of the antigen, altering the uptake and processing of the
antigen, and/or causing the antigen to bind to a binding
partner.
[0140] In some embodiments, the scaffold moiety is protein that can
self-assemble into protein nanoparticles that are highly symmetric,
stable, and structurally organized, with diameters of 10-150 nm, a
highly suitable size range for optimal interactions with various
cells of the immune system. In some embodiments, viral proteins or
virus-like particles can be used to form stable nanoparticle
structures. Examples of such viral proteins are known in the art.
For example, in some embodiments, the scaffold moiety is a
hepatitis B surface antigen (HBsAg). HBsAg forms spherical
particles with an average diameter of .about.22 nm and which lacked
nucleic acid and hence are non-infectious (Lopez-Sagaseta, J. et
al. Computational and Structural Biotechnology Journal 14 (2016)
58-68). In some embodiments, the scaffold moiety is a hepatitis B
core antigen (HBcAg) self-assembles into particles of 24-31 nm
diameter, which resembled the viral cores obtained from
HBV-infected human liver. HBcAg produced in self-assembles into two
classes of differently sized nanoparticles of 300 .ANG. and 360
.ANG. diameter, corresponding to 180 or 240 protomers. In some
embodiments a hMPV/hPIV3 antigen is fused to HBsAG or HBcAG to
facilitate self-assembly of nanoparticles displaying the hMPV/hPIV3
antigen.
[0141] In another embodiment, bacterial protein platforms may be
used. Non-limiting examples of these self-assembling proteins
include ferritin, lumazine and encapsulin.
[0142] Ferritin is a protein whose main function is intracellular
iron storage. Ferritin is made of 24 subunits, each composed of a
four-alpha-helix bundle, that self-assemble in a quaternary
structure with octahedral symmetry (Cho K. J. et al. J Mol Biol.
2009; 390:83-98). Several high-resolution structures of ferritin
have been determined, confirming that Helicobacter pylori ferritin
is made of 24 identical protomers, whereas in animals, there are
ferritin light and heavy chains that can assemble alone or combine
with different ratios into particles of 24 subunits (Granier T. et
al. J Biol Inorg Chem. 2003; 8:105-111; Lawson D. M. et al. Nature.
1991; 349:541-544). Ferritin self-assembles into nanoparticles with
robust thermal and chemical stability. Thus, the ferritin
nanoparticle is well-suited to carry and expose antigens.
[0143] Lumazine synthase (LS) is also well-suited as a nanoparticle
platform for antigen display. LS, which is responsible for the
penultimate catalytic step in the biosynthesis of riboflavin, is an
enzyme present in a broad variety of organisms, including archaea,
bacteria, fungi, plants, and eubacteria (Weber S.E. Flavins and
Flavoproteins. Methods and Protocols, Series: Methods in Molecular
Biology. 2014). The LS monomer is 150 amino acids long, and
consists of beta-sheets along with tandem alpha-helices flanking
its sides. A number of different quaternary structures have been
reported for LS, illustrating its morphological versatility: from
homopentamers up to symmetrical assemblies of 12 pentamers forming
capsids of 150 .ANG. diameter. Even LS cages of more than 100
subunits have been described (Zhang X. et al. J Mol Biol. 2006;
362:753-770).
[0144] Encapsulin, a novel protein cage nanoparticle isolated from
thermophile Thermotoga maritima, may also be used as a platform to
present antigens on the surface of self-assembling nanoparticles.
Encapsulin is assembled from 60 copies of identical 31 kDa monomers
having a thin and icosahedral T=1 symmetric cage structure with
interior and exterior diameters of 20 and 24 nm, respectively
(Sutter M. et al. Nat Struct Mol Biol. 2008, 15: 939-947). Although
the exact function of encapsulin in T. maritima is not clearly
understood yet, its crystal structure has been recently solved and
its function was postulated as a cellular compartment that
encapsulates proteins such as DyP (Dye decolorizing peroxidase) and
Flp (Ferritin like protein), which are involved in oxidative stress
responses (Rahmanpour R. et al. FEBS J. 2013, 280: 2097-2104).
Linkers and Cleavable Peptides
[0145] In some embodiments, the mRNAs of the disclosure encode more
than one polypeptide, referred to herein as fusion proteins. In
some embodiments, the mRNA further encodes a linker located between
at least one or each domain of the fusion protein. The linker can
be, for example, a cleavable linker or protease-sensitive linker.
In some embodiments, the linker is selected from the group
consisting of F2A linker, P2A linker, T2A linker, E2A linker, and
combinations thereof. This family of self-cleaving peptide linkers,
referred to as 2A peptides, has been described in the art (see for
example, Kim, J. H. et al. (2011) PLoS ONE 6:e18556). In some
embodiments, the linker is an F2A linker. In some embodiments, the
linker is a GGGS linker. In some embodiments, the fusion protein
contains three domains with intervening linkers, having the
structure: domain-linker-domain-linker-domain.
[0146] Cleavable linkers known in the art may be used in connection
with the disclosure. Exemplary such linkers include: F2A linkers,
T2A linkers, P2A linkers, E2A linkers (See, e.g., WO2017127750).
The skilled artisan will appreciate that other art-recognized
linkers may be suitable for use in the constructs of the disclosure
(e.g., encoded by the nucleic acids of the disclosure). The skilled
artisan will likewise appreciate that other polycistronic
constructs (mRNA encoding more than one antigen/polypeptide
separately within the same molecule) may be suitable for use as
provided herein.
Sequence Optimization
[0147] In some embodiments, an ORF encoding an antigen of the
disclosure is codon optimized. Codon optimization methods are known
in the art. For example, an ORF of any one or more of the sequences
provided herein may be codon optimized. Codon optimization, in some
embodiments, may be used to match codon frequencies in target and
host organisms to ensure proper folding; bias GC content to
increase mRNA stability or reduce secondary structures; minimize
tandem repeat codons or base runs that may impair gene construction
or expression; customize transcriptional and translational control
regions; insert or remove protein trafficking sequences; remove/add
post translation modification sites in encoded protein (e.g.,
glycosylation sites); add, remove or shuffle protein domains;
insert or delete restriction sites; modify ribosome binding sites
and mRNA degradation sites; adjust translational rates to allow the
various domains of the protein to fold properly; or reduce or
eliminate problem secondary structures within the polynucleotide.
Codon optimization tools, algorithms and services are known in the
art--non-limiting examples include services from GeneArt (Life
Technologies), DNA2.0 (Menlo Park Calif.) and/or proprietary
methods. In some embodiments, the open reading frame (ORF) sequence
is optimized using optimization algorithms.
[0148] In some embodiments, a codon optimized sequence shares less
than 95% sequence identity to a naturally-occurring or wild-type
sequence ORF (e.g., a naturally-occurring or wild-type mRNA
sequence encoding a hMPV/hPIV3 antigen). In some embodiments, a
codon optimized sequence shares less than 90% sequence identity to
a naturally-occurring or wild-type sequence (e.g., a
naturally-occurring or wild-type mRNA sequence encoding a
hMPV/hPIV3 antigen). In some embodiments, a codon optimized
sequence shares less than 85% sequence identity to a
naturally-occurring or wild-type sequence (e.g., a
naturally-occurring or wild-type mRNA sequence encoding a
hMPV/hPIV3 antigen). In some embodiments, a codon optimized
sequence shares less than 80% sequence identity to a
naturally-occurring or wild-type sequence (e.g., a
naturally-occurring or wild-type mRNA sequence encoding a
hMPV/hPIV3 antigen). In some embodiments, a codon optimized
sequence shares less than 75% sequence identity to a
naturally-occurring or wild-type sequence (e.g., a
naturally-occurring or wild-type mRNA sequence encoding a
hMPV/hPIV3 antigen).
[0149] In some embodiments, a codon optimized sequence shares
between 65% and 85% (e.g., between about 67% and about 85% or
between about 67% and about 80%) sequence identity to a
naturally-occurring or wild-type sequence (e.g., a
naturally-occurring or wild-type mRNA sequence encoding a
hMPV/hPIV3 antigen). In some embodiments, a codon optimized
sequence shares between 65% and 75% or about 80% sequence identity
to a naturally-occurring or wild-type sequence (e.g., a
naturally-occurring or wild-type mRNA sequence encoding a
hMPV/hPIV3 antigen).
[0150] In some embodiments, a codon-optimized sequence encodes an
antigen that is as immunogenic as, or more immunogenic than (e.g.,
at least 10%, at least 20%, at least 30%, at least 40%, at least
50%, at least 100%, or at least 200% more), than a hMPV/hPIV3
antigen encoded by a non-codon-optimized sequence.
[0151] When transfected into mammalian host cells, the modified
mRNAs have a stability of between 12-18 hours, or greater than 18
hours, e.g., 24, 36, 48, 60, 72, or greater than 72 hours and are
capable of being expressed by the mammalian host cells.
[0152] In some embodiments, a codon optimized RNA may be one in
which the levels of G/C are enhanced. The G/C-content of nucleic
acid molecules (e.g., mRNA) may influence the stability of the RNA.
RNA having an increased amount of guanine (G) and/or cytosine (C)
residues may be functionally more stable than RNA containing a
large amount of adenine (A) and thymine (T) or uracil (U)
nucleotides. As an example, WO02/098443 discloses a pharmaceutical
composition containing an mRNA stabilized by sequence modifications
in the translated region. Due to the degeneracy of the genetic
code, the modifications work by substituting existing codons for
those that promote greater RNA stability without changing the
resulting amino acid. The approach is limited to coding regions of
the RNA.
Chemically Unmodified Nucleotides
[0153] In some embodiments, at least one RNA (e.g., mRNA) of a
hMPV/hPIV3 vaccines of the present disclosure is not chemically
modified and comprises the standard ribonucleotides consisting of
adenosine, guanosine, cytosine and uridine. In some embodiments,
nucleotides and nucleosides of the present disclosure comprise
standard nucleoside residues such as those present in transcribed
RNA (e.g. A, G, C, or U). In some embodiments, nucleotides and
nucleosides of the present disclosure comprise standard
deoxyribonucleosides such as those present in DNA (e.g. dA, dG, dC,
or dT).
Chemical Modifications
[0154] hMPV/hPIV3 RNA vaccines of the present disclosure comprise,
in some embodiments, at least one nucleic acid (e.g., RNA) having
an open reading frame encoding at least one hMPV/hPIV3 antigen,
wherein the nucleic acid comprises nucleotides and/or nucleosides
that can be standard (unmodified) or modified as is known in the
art. In some embodiments, nucleotides and nucleosides of the
present disclosure comprise modified nucleotides or nucleosides.
Such modified nucleotides and nucleosides can be
naturally-occurring modified nucleotides and nucleosides or
non-naturally occurring modified nucleotides and nucleosides. Such
modifications can include those at the sugar, backbone, or
nucleobase portion of the nucleotide and/or nucleoside as are
recognized in the art.
[0155] In some embodiments, a naturally-occurring modified
nucleotide or nucleotide of the disclosure is one as is generally
known or recognized in the art. Non-limiting examples of such
naturally occurring modified nucleotides and nucleotides can be
found, inter alia, in the widely recognized MODOMICS database.
[0156] In some embodiments, a non-naturally occurring modified
nucleotide or nucleoside of the disclosure is one as is generally
known or recognized in the art. Non-limiting examples of such
non-naturally occurring modified nucleotides and nucleosides can be
found, inter alia, in published US application Nos.
PCT/US2012/058519; PCT/US2013/075177; PCT/US2014/058897;
PCT/US2014/058891; PCT/US2014/070413; PCT/US2015/36773;
PCT/US2015/36759; PCT/US2015/36771; or PCT/M2017/051367 all of
which are incorporated by reference herein.
[0157] Hence, nucleic acids of the disclosure (e.g., DNA nucleic
acids and RNA nucleic acids, such as mRNA nucleic acids) can
comprise standard nucleotides and nucleosides, naturally-occurring
nucleotides and nucleosides, non-naturally-occurring nucleotides
and nucleosides, or any combination thereof.
[0158] Nucleic acids of the disclosure (e.g., DNA nucleic acids and
RNA nucleic acids, such as mRNA nucleic acids), in some
embodiments, comprise various (more than one) different types of
standard and/or modified nucleotides and nucleosides. In some
embodiments, a particular region of a nucleic acid contains one,
two or more (optionally different) types of standard and/or
modified nucleotides and nucleosides.
[0159] In some embodiments, a modified RNA nucleic acid (e.g., a
modified mRNA nucleic acid), introduced to a cell or organism,
exhibits reduced degradation in the cell or organism, respectively,
relative to an unmodified nucleic acid comprising standard
nucleotides and nucleosides.
[0160] In some embodiments, a modified RNA nucleic acid (e.g., a
modified mRNA nucleic acid), introduced into a cell or organism,
may exhibit reduced immunogenicity in the cell or organism,
respectively (e.g., a reduced innate response) relative to an
unmodified nucleic acid comprising standard nucleotides and
nucleosides.
[0161] Nucleic acids (e.g., RNA nucleic acids, such as mRNA nucleic
acids), in some embodiments, comprise non-natural modified
nucleotides that are introduced during synthesis or post-synthesis
of the nucleic acids to achieve desired functions or properties.
The modifications may be present on internucleotide linkages,
purine or pyrimidine bases, or sugars. The modification may be
introduced with chemical synthesis or with a polymerase enzyme at
the terminal of a chain or anywhere else in the chain. Any of the
regions of a nucleic acid may be chemically modified.
[0162] The present disclosure provides for modified nucleosides and
nucleotides of a nucleic acid (e.g., RNA nucleic acids, such as
mRNA nucleic acids). A "nucleoside" refers to a compound containing
a sugar molecule (e.g., a pentose or ribose) or a derivative
thereof in combination with an organic base (e.g., a purine or
pyrimidine) or a derivative thereof (also referred to herein as
"nucleobase"). A "nucleotide" refers to a nucleoside, including a
phosphate group. Modified nucleotides may by synthesized by any
useful method, such as, for example, chemically, enzymatically, or
recombinantly, to include one or more modified or non-natural
nucleosides. Nucleic acids can comprise a region or regions of
linked nucleosides. Such regions may have variable backbone
linkages. The linkages can be standard phosphodiester linkages, in
which case the nucleic acids would comprise regions of
nucleotides.
[0163] Modified nucleotide base pairing encompasses not only the
standard adenosine-thymine, adenosine-uracil, or guanosine-cytosine
base pairs, but also base pairs formed between nucleotides and/or
modified nucleotides comprising non-standard or modified bases,
wherein the arrangement of hydrogen bond donors and hydrogen bond
acceptors permits hydrogen bonding between a non-standard base and
a standard base or between two complementary non-standard base
structures, such as, for example, in those nucleic acids having at
least one chemical modification. One example of such non-standard
base pairing is the base pairing between the modified nucleotide
inosine and adenine, cytosine or uracil. Any combination of
base/sugar or linker may be incorporated into nucleic acids of the
present disclosure.
[0164] In some embodiments, modified nucleobases in nucleic acids
(e.g., RNA nucleic acids, such as mRNA nucleic acids) comprise
1-methyl-pseudouridine (m1.psi.), 1-ethyl-pseudouridine (e1.psi.)
5-methoxy-uridine (mo5U), 5-methyl-cytidine (m5C), and/or
pseudouridine (w). In some embodiments, modified nucleobases in
nucleic acids (e.g., RNA nucleic acids, such as mRNA nucleic acids)
comprise 5-methoxymethyl uridine, 5-methylthio uridine,
1-methoxymethyl pseudouridine, 5-methyl cytidine, and/or 5-methoxy
cytidine. In some embodiments, the polyribonucleotide includes a
combination of at least two (e.g., 2, 3, 4 or more) of any of the
aforementioned modified nucleobases, including but not limited to
chemical modifications.
[0165] In some embodiments, a RNA nucleic acid of the disclosure
comprises 1-methyl-pseudouridine (m1.psi.) substitutions at one or
more or all uridine positions of the nucleic acid.
[0166] In some embodiments, a RNA nucleic acid of the disclosure
comprises 1-methyl-pseudouridine (m1.psi.) substitutions at one or
more or all uridine positions of the nucleic acid and 5-methyl
cytidine substitutions at one or more or all cytidine positions of
the nucleic acid.
[0167] In some embodiments, a RNA nucleic acid of the disclosure
comprises pseudouridine (.psi.) substitutions at one or more or all
uridine positions of the nucleic acid.
[0168] In some embodiments, a RNA nucleic acid of the disclosure
comprises pseudouridine (.psi.) substitutions at one or more or all
uridine positions of the nucleic acid and 5-methyl cytidine
substitutions at one or more or all cytidine positions of the
nucleic acid.
[0169] In some embodiments, a RNA nucleic acid of the disclosure
comprises uridine at one or more or all uridine positions of the
nucleic acid.
[0170] In some embodiments, nucleic acids (e.g., RNA nucleic acids,
such as mRNA nucleic acids) are uniformly modified (e.g., fully
modified, modified throughout the entire sequence) for a particular
modification. For example, a nucleic acid can be uniformly modified
with 1-methyl-pseudouridine, meaning that all uridine residues in
the mRNA sequence are replaced with 1-methyl-pseudouridine.
Similarly, a nucleic acid can be uniformly modified for any type of
nucleoside residue present in the sequence by replacement with a
modified residue such as those set forth above.
[0171] The nucleic acids of the present disclosure may be partially
or fully modified along the entire length of the molecule. For
example, one or more or all or a given type of nucleotide (e.g.,
purine or pyrimidine, or any one or more or all of A, G, U, C) may
be uniformly modified in a nucleic acid of the disclosure, or in a
predetermined sequence region thereof (e.g., in the mRNA including
or excluding the polyA tail). In some embodiments, all nucleotides
X in a nucleic acid of the present disclosure (or in a sequence
region thereof) are modified nucleotides, wherein X may be any one
of nucleotides A, G, U, C, or any one of the combinations A+G, A+U,
A+C, G+U, G+C, U+C, A+G+U, A+G+C, G+U+C or A+G+C.
[0172] The nucleic acid may contain from about 1% to about 100%
modified nucleotides (either in relation to overall nucleotide
content, or in relation to one or more types of nucleotide, i.e.,
any one or more of A, G, U or C) or any intervening percentage
(e.g., from 1% to 20%, from 1% to 25%, from 1% to 50% from 1% to
60%, from 1% to 70%, from 1% to 80% from 1% to 90%, from 1% to 95%,
from 10% to 20%, from 10% to 25%, from 10% to 50%, from 10% to 60%,
from 10% to 70%, from 10% to 80%, from 10% to 90%, from 10% to 95%,
from 10% to 100%, from 20% to 25%, from 20% to 50%, from 20% to
60%, from 20% to 70%, from 20% to 80%, from 20% to 90%, from 20% to
95%, from 20% to 100%, from 50% to 60%, from 50% to 70%, from 50%
to 80%, from 50% to 90%, from 50% to 95%, from 50% to 100%, from
70% to 80%, from 70% to 90%, from 70% to 95%, from 70% to 100%,
from 80% to 90%, from 80% to 95%, from 80% to 100%, from 90% to
95%, from 90% to 100%, and from 95% to 100%). It will be understood
that any remaining percentage is accounted for by the presence of
unmodified A, G, U, or C.
[0173] The nucleic acids may contain at a minimum 1% and at maximum
100% modified nucleotides, or any intervening percentage, such as
at least 5% modified nucleotides, at least 10% modified
nucleotides, at least 25% modified nucleotides, at least 50%
modified nucleotides, at least 80% modified nucleotides, or at
least 90% modified nucleotides. For example, the nucleic acids may
contain a modified pyrimidine such as a modified uracil or
cytosine. In some embodiments, at least 5%, at least 10%, at least
25%, at least 50%, at least 80%, at least 90% or 100% of the uracil
in the nucleic acid is replaced with a modified uracil (e.g., a
5-substituted uracil). The modified uracil can be replaced by a
compound having a single unique structure, or can be replaced by a
plurality of compounds having different structures (e.g., 2, 3, 4
or more unique structures). In some embodiments, at least 5%, at
least 10%, at least 25%, at least 50%, at least 80%, at least 90%
or 100% of the cytosine in the nucleic acid is replaced with a
modified cytosine (e.g., a 5-substituted cytosine). The modified
cytosine can be replaced by a compound having a single unique
structure, or can be replaced by a plurality of compounds having
different structures (e.g., 2, 3, 4 or more unique structures).
N-Linked Glycosylation Site Mutants
[0174] N-linked glycans of viral proteins play important roles in
modulating the immune response. Glycans can be important for
maintaining the appropriate antigenic conformations, shielding
potential neutralization epitopes, and may alter the proteolytic
susceptibility of proteins. Some viruses have putative N-linked
glycosylation sites. Deletion or modification of an N-linked
glycosylation site may enhance the immune response. Thus, the
present disclosure provides, in some embodiments, hMPV/hPIV3 RNA
(e.g., mRNA) vaccines comprising nucleic acids (e.g., mRNA)
encoding antigenic polypeptides (e.g., hMPV/hPIV3 F proteins) that
comprise a deletion or modification at one or more N-linked
glycosylation sites.
Untranslated Regions (UTRs)
[0175] The nucleic acids of the present disclosure may comprise one
or more regions or parts which act or function as an untranslated
region. Where nucleic acids are designed to encode at least one
antigen of interest, the nucleic may comprise one or more of these
untranslated regions (UTRs). Wild-type untranslated regions of a
nucleic acid are transcribed but not translated. In mRNA, the 5'
UTR starts at the transcription start site and continues to the
start codon but does not include the start codon; whereas, the 3'
UTR starts immediately following the stop codon and continues until
the transcriptional termination signal. There is growing body of
evidence about the regulatory roles played by the UTRs in terms of
stability of the nucleic acid molecule and translation. The
regulatory features of a UTR can be incorporated into the
polynucleotides of the present disclosure to, among other things,
enhance the stability of the molecule. The specific features can
also be incorporated to ensure controlled down-regulation of the
transcript in case they are misdirected to undesired organs sites.
A variety of 5'UTR and 3'UTR sequences are known and available in
the art.
[0176] A 5' UTR is region of an mRNA that is directly upstream (5')
from the start codon (the first codon of an mRNA transcript
translated by a ribosome). A 5' UTR does not encode a protein (is
non-coding). Natural 5'UTRs have features that play roles in
translation initiation. They harbor signatures like Kozak sequences
which are commonly known to be involved in the process by which the
ribosome initiates translation of many genes. Kozak sequences have
the consensus CCR(A/G)CCAUGG (SEQ ID NO: 23), where R is a purine
(adenine or guanine) three bases upstream of the start codon (AUG),
which is followed by another `G`0.5'UTR also have been known to
form secondary structures which are involved in elongation factor
binding.
[0177] In some embodiments of the disclosure, a 5' UTR is a
heterologous UTR, i.e., is a UTR found in nature associated with a
different ORF. In another embodiment, a 5' UTR is a synthetic UTR,
i.e., does not occur in nature. Synthetic UTRs include UTRs that
have been mutated to improve their properties, e.g., which increase
gene expression as well as those which are completely synthetic.
Exemplary 5' UTRs include Xenopus or human derived .alpha.-globin
or b-globin (U.S. Pat. Nos. 8,278,063; 9,012,219), human cytochrome
b-245 a polypeptide, and hydroxysteroid (17b) dehydrogenase, and
Tobacco etch virus (U.S. Pat. Nos. 8,278,063, 9,012,219). CMV
immediate-early 1 (IE1) gene (US20140206753, WO2013/185069), the
sequence GGGAUCCUACC (SEQ ID NO: 24) (WO2014/144196) may also be
used. In another embodiment, 5' UTR of a TOP gene is a 5' UTR of a
TOP gene lacking the 5' TOP motif (the oligopyrimidine tract)
(e.g., WO2015/101414, WO2015/101415, WO2015/062738, WO2015/024667,
WO2015/024667; 5' UTR element derived from ribosomal protein Large
32 (L32) gene (WO2015/101414, WO2015/101415, WO2015/062738), 5' UTR
element derived from the 5'UTR of an hydroxysteroid (17-.beta.)
dehydrogenase 4 gene (HSD17B4) (WO2015/024667), or a 5' UTR element
derived from the 5' UTR of ATP5A1 (WO2015/024667) can be used. In
some embodiments, an internal ribosome entry site (IRES) is used
instead of a 5' UTR.
[0178] In some embodiments, a 5' UTR of the present disclosure
comprises the sequence of SEQ ID NO: 12.
[0179] A 3' UTR is region of an mRNA that is directly downstream
(3') from the stop codon (the codon of an mRNA transcript that
signals a termination of translation). A 3' UTR does not encode a
protein (is non-coding). Natural or wild type 3' UTRs are known to
have stretches of adenosines and uridines embedded in them. These
AU rich signatures are particularly prevalent in genes with high
rates of turnover. Based on their sequence features and functional
properties, the AU rich elements (AREs) can be separated into three
classes (Chen et al, 1995): Class I AREs contain several dispersed
copies of an AUUUA motif within U-rich regions. C-Myc and MyoD
contain class I AREs. Class II AREs possess two or more overlapping
UUAUUUA(U/A)(U/A) (SEQ ID NO: 25) nonamers. Molecules containing
this type of AREs include GM-CSF and TNF-a. Class III ARES are less
well defined. These U rich regions do not contain an AUUUA motif.
c-Jun and Myogenin are two well-studied examples of this class.
Most proteins binding to the AREs are known to destabilize the
messenger, whereas members of the ELAV family, most notably HuR,
have been documented to increase the stability of mRNA. HuR binds
to AREs of all the three classes. Engineering the HuR specific
binding sites into the 3' UTR of nucleic acid molecules will lead
to HuR binding and thus, stabilization of the message in vivo.
[0180] Introduction, removal or modification of 3' UTR AU rich
elements (AREs) can be used to modulate the stability of nucleic
acids (e.g., RNA) of the disclosure. When engineering specific
nucleic acids, one or more copies of an ARE can be introduced to
make nucleic acids of the disclosure less stable and thereby
curtail translation and decrease production of the resultant
protein. Likewise, AREs can be identified and removed or mutated to
increase the intracellular stability and thus increase translation
and production of the resultant protein. Transfection experiments
can be conducted in relevant cell lines, using nucleic acids of the
disclosure and protein production can be assayed at various time
points post-transfection. For example, cells can be transfected
with different ARE-engineering molecules and by using an ELISA kit
to the relevant protein and assaying protein produced at 6 hour, 12
hour, 24 hour, 48 hour, and 7 days post-transfection.
[0181] 3' UTRs may be heterologous or synthetic. With respect to 3'
UTRs, globin UTRs, including Xenopus .beta.-globin UTRs and human
3-globin UTRs are known in the art (U.S. Pat. Nos. 8,278,063,
9,012,219, US20110086907). A modified .beta.-globin construct with
enhanced stability in some cell types by cloning two sequential
human .beta.-globin 3'UTRs head to tail has been developed and is
well known in the art (US2012/0195936, WO2014/071963). In addition
a2-globin, al-globin, UTRs and mutants thereof are also known in
the art (WO2015/101415, WO2015/024667). Other 3' UTRs described in
the mRNA constructs in the non-patent literature include CYBA
(Ferizi et al., 2015) and albumin (Thess et al., 2015). Other
exemplary 3' UTRs include that of bovine or human growth hormone
(wild type or modified) (WO2013/185069, US20140206753,
WO2014/152774), rabbit .beta. globin and hepatitis B virus (HBV),
.alpha.-globin 3' UTR and Viral VEEV 3' UTR sequences are also
known in the art. In some embodiments, the sequence UUUGAAUU
(WO2014/144196) is used. In some embodiments, 3' UTRs of human and
mouse ribosomal protein are used. Other examples include rps9 3'UTR
(WO2015/101414), FIG. 4 (WO2015/101415), and human albumin 7
(WO2015/101415).
[0182] In some embodiments, a 3' UTR of the present disclosure
comprises the sequence of SEQ ID NO: 13.
[0183] Those of ordinary skill in the art will understand that
5'UTRs that are heterologous or synthetic may be used with any
desired 3' UTR sequence. For example, a heterologous 5'UTR may be
used with a synthetic 3'UTR with a heterologous 3'' UTR.
[0184] Non-UTR sequences may also be used as regions or subregions
within a nucleic acid. For example, introns or portions of introns
sequences may be incorporated into regions of nucleic acid of the
disclosure. Incorporation of intronic sequences may increase
protein production as well as nucleic acid levels.
[0185] Combinations of features may be included in flanking regions
and may be contained within other features. For example, the ORF
may be flanked by a 5' UTR which may contain a strong Kozak
translational initiation signal and/or a 3' UTR which may include
an oligo(dT) sequence for templated addition of a poly-A tail. 5'
UTR may comprise a first polynucleotide fragment and a second
polynucleotide fragment from the same and/or different genes such
as the 5' UTRs described in US Patent Application Publication No.
20100293625 and PCT/US2014/069155, herein incorporated by reference
in its entirety.
[0186] It should be understood that any UTR from any gene may be
incorporated into the regions of a nucleic acid. Furthermore,
multiple wild-type UTRs of any known gene may be utilized. It is
also within the scope of the present disclosure to provide
artificial UTRs which are not variants of wild type regions. These
UTRs or portions thereof may be placed in the same orientation as
in the transcript from which they were selected or may be altered
in orientation or location. Hence a 5' or 3' UTR may be inverted,
shortened, lengthened, made with one or more other 5' UTRs or 3'
UTRs. As used herein, the term "altered" as it relates to a UTR
sequence, means that the UTR has been changed in some way in
relation to a reference sequence. For example, a 3' UTR or 5' UTR
may be altered relative to a wild-type or native UTR by the change
in orientation or location as taught above or may be altered by the
inclusion of additional nucleotides, deletion of nucleotides,
swapping or transposition of nucleotides. Any of these changes
producing an "altered" UTR (whether 3' or 5') comprise a variant
UTR.
[0187] In some embodiments, a double, triple or quadruple UTR such
as a 5' UTR or 3' UTR may be used. As used herein, a "double" UTR
is one in which two copies of the same UTR are encoded either in
series or substantially in series. For example, a double
beta-globin 3' UTR may be used as described in US Patent
publication 2010/0129877, the contents of which are incorporated
herein by reference in its entirety.
[0188] It is also within the scope of the present disclosure to
have patterned UTRs. As used herein "patterned UTRs" are those UTRs
which reflect a repeating or alternating pattern, such as ABABAB or
AABBAABBAABB or ABCABCABC or variants thereof repeated once, twice,
or more than 3 times. In these patterns, each letter, A, B, or C
represent a different UTR at the nucleotide level.
[0189] In some embodiments, flanking regions are selected from a
family of transcripts whose proteins share a common function,
structure, feature or property. For example, polypeptides of
interest may belong to a family of proteins which are expressed in
a particular cell, tissue or at some time during development. The
UTRs from any of these genes may be swapped for any other UTR of
the same or different family of proteins to create a new
polynucleotide. As used herein, a "family of proteins" is used in
the broadest sense to refer to a group of two or more polypeptides
of interest which share at least one function, structure, feature,
localization, origin, or expression pattern.
[0190] The untranslated region may also include translation
enhancer elements (TEE). As a non-limiting example, the TEE may
include those described in US patent publication 2009/0226470,
herein incorporated by reference in its entirety, and those known
in the art.
In Vitro Transcription of RNA (e.g., mRNA)
[0191] A hMPV/hPIV3 RNA (e.g., mRNA) vaccine of the present
disclosure comprise at least one RNA polynucleotide, such as a mRNA
(e.g., modified mRNA). mRNA, for example, is transcribed in vitro
from template DNA, referred to as an "in vitro transcription
template." In some embodiments, an in vitro transcription template
encodes a 5' untranslated (UTR) region, contains an open reading
frame, and encodes a 3' UTR and a polyA tail. The particular
nucleic acid sequence composition and length of an in vitro
transcription template will depend on the mRNA encoded by the
template.
[0192] In some embodiments, the in vitro transcription template
used to produce the RNA (e.g., mRNA) polynucleotides of the present
disclosure comprises the nucleotide sequence identified by any one
of SEQ ID NO:1-3.
[0193] A "5' untranslated region" (5'UTR) refers to a region of an
mRNA that is directly upstream (i.e., 5') from the start codon
(i.e., the first codon of an mRNA transcript translated by a
ribosome) that does not encode a polypeptide.
[0194] A "3' untranslated region" (3'UTR) refers to a region of an
mRNA that is directly downstream (i.e., 3') from the stop codon
(i.e., the codon of an mRNA transcript that signals a termination
of translation) that does not encode a polypeptide.
[0195] An "open reading frame" is a continuous stretch of DNA
beginning with a start codon (e.g., methionine (ATG)), and ending
with a stop codon (e.g., TAA, TAG or TGA) and encodes a
polypeptide.
[0196] A "polyA tail" is a region of mRNA that is downstream, e.g.,
directly downstream (i.e., 3'), from the 3' UTR that contains
multiple, consecutive adenosine monophosphates. A polyA tail may
contain 10 to 300 adenosine monophosphates. For example, a polyA
tail may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120,
130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250,
260, 270, 280, 290 or 300 adenosine monophosphates. In some
embodiments, a polyA tail contains 50 to 250 adenosine
monophosphates. In a relevant biological setting (e.g., in cells,
in vivo) the poly(A) tail functions to protect mRNA from enzymatic
degradation, e.g., in the cytoplasm, and aids in transcription
termination, export of the mRNA from the nucleus and
translation.
[0197] In some embodiments, a polynucleotide includes 200 to 3,000
nucleotides. For example, a polynucleotide may include 200 to 500,
200 to 1000, 200 to 1500, 200 to 3000, 500 to 1000, 500 to 1500,
500 to 2000, 500 to 3000, 1000 to 1500, 1000 to 2000, 1000 to 3000,
1500 to 3000, or 2000 to 3000 nucleotides.
Chemical Synthesis
[0198] Solid-phase chemical synthesis. Nucleic acids the present
disclosure may be manufactured in whole or in part using solid
phase techniques. Solid-phase chemical synthesis of nucleic acids
is an automated method wherein molecules are immobilized on a solid
support and synthesized step by step in a reactant solution.
Solid-phase synthesis is useful in site-specific introduction of
chemical modifications in the nucleic acid sequences.
[0199] Liquid Phase Chemical Synthesis. The synthesis of nucleic
acids of the present disclosure by the sequential addition of
monomer building blocks may be carried out in a liquid phase.
[0200] Combination of Synthetic Methods. The synthetic methods
discussed above each has its own advantages and limitations.
Attempts have been conducted to combine these methods to overcome
the limitations. Such combinations of methods are within the scope
of the present disclosure. The use of solid-phase or liquid-phase
chemical synthesis in combination with enzymatic ligation provides
an efficient way to generate long chain nucleic acids that cannot
be obtained by chemical synthesis alone.
Ligation of Nucleic Acid Regions or Subregions
[0201] Assembling nucleic acids by a ligase may also be used. DNA
or RNA ligases promote intermolecular ligation of the 5' and 3'
ends of polynucleotide chains through the formation of a
phosphodiester bond. Nucleic acids such as chimeric polynucleotides
and/or circular nucleic acids may be prepared by ligation of one or
more regions or subregions. DNA fragments can be joined by a ligase
catalyzed reaction to create recombinant DNA with different
functions. Two oligodeoxynucleotides, one with a 5' phosphoryl
group and another with a free 3' hydroxyl group, serve as
substrates for a DNA ligase.
Purification
[0202] Purification of the nucleic acids described herein may
include, but is not limited to, nucleic acid clean-up, quality
assurance and quality control. Clean-up may be performed by methods
known in the arts such as, but not limited to, AGENCOURT.RTM. beads
(Beckman Coulter Genomics, Danvers, Mass.), poly-T beads, LNA.TM.
oligo-T capture probes (EXIQON.RTM. Inc, Vedbaek, Denmark) or HPLC
based purification methods such as, but not limited to, strong
anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC
(RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC). The term
"purified" when used in relation to a nucleic acid such as a
"purified nucleic acid" refers to one that is separated from at
least one contaminant. A "contaminant" is any substance that makes
another unfit, impure or inferior. Thus, a purified nucleic acid
(e.g., DNA and RNA) is present in a form or setting different from
that in which it is found in nature, or a form or setting different
from that which existed prior to subjecting it to a treatment or
purification method.
[0203] A quality assurance and/or quality control check may be
conducted using methods such as, but not limited to, gel
electrophoresis, UV absorbance, or analytical HPLC.
[0204] In some embodiments, the nucleic acids may be sequenced by
methods including, but not limited to
reverse-transcriptase-PCR.
Quantification
[0205] In some embodiments, the nucleic acids of the present
disclosure may be quantified in exosomes or when derived from one
or more bodily fluid. Bodily fluids include peripheral blood,
serum, plasma, ascites, urine, cerebrospinal fluid (CSF), sputum,
saliva, bone marrow, synovial fluid, aqueous humor, amniotic fluid,
cerumen, breast milk, broncheoalveolar lavage fluid, semen,
prostatic fluid, cowper's fluid or pre-ejaculatory fluid, sweat,
fecal matter, hair, tears, cyst fluid, pleural and peritoneal
fluid, pericardial fluid, lymph, chyme, chyle, bile, interstitial
fluid, menses, pus, sebum, vomit, vaginal secretions, mucosal
secretion, stool water, pancreatic juice, lavage fluids from sinus
cavities, bronchopulmonary aspirates, blastocyl cavity fluid, and
umbilical cord blood. Alternatively, exosomes may be retrieved from
an organ selected from the group consisting of lung, heart,
pancreas, stomach, intestine, bladder, kidney, ovary, testis, skin,
colon, breast, prostate, brain, esophagus, liver, and placenta.
[0206] Assays may be performed using construct specific probes,
cytometry, qRT-PCR, real-time PCR, PCR, flow cytometry,
electrophoresis, mass spectrometry, or combinations thereof while
the exosomes may be isolated using immunohistochemical methods such
as enzyme linked immunosorbent assay (ELISA) methods. Exosomes may
also be isolated by size exclusion chromatography, density gradient
centrifugation, differential centrifugation, nanomembrane
ultrafiltration, immunoabsorbent capture, affinity purification,
microfluidic separation, or combinations thereof.
[0207] These methods afford the investigator the ability to
monitor, in real time, the level of nucleic acids remaining or
delivered. This is possible because the nucleic acids of the
present disclosure, in some embodiments, differ from the endogenous
forms due to the structural or chemical modifications.
[0208] In some embodiments, the nucleic acid may be quantified
using methods such as, but not limited to, ultraviolet visible
spectroscopy (UV/Vis). A non-limiting example of a UV/Vis
spectrometer is a NANODROP.RTM. spectrometer (ThermoFisher,
Waltham, Mass.). The quantified nucleic acid may be analyzed in
order to determine if the nucleic acid may be of proper size, check
that no degradation of the nucleic acid has occurred. Degradation
of the nucleic acid may be checked by methods such as, but not
limited to, agarose gel electrophoresis, HPLC based purification
methods such as, but not limited to, strong anion exchange HPLC,
weak anion exchange HPLC, reverse phase HPLC (RP-HPLC), and
hydrophobic interaction HPLC (HIC-HPLC), liquid chromatography-mass
spectrometry (LCMS), capillary electrophoresis (CE) and capillary
gel electrophoresis (CGE).
Pharmaceutical Formulations
[0209] Provided herein are compositions (e.g., pharmaceutical
compositions), methods, kits and reagents for prevention or
treatment of hMPV/hPIV3 in humans and other mammals, for example.
hMPV/hPIV3 RNA (e.g., mRNA) vaccines can be used as therapeutic or
prophylactic agents. They may be used in medicine to prevent and/or
treat infectious disease.
[0210] In some embodiments, a hMPV/hPIV3 vaccine containing RNA
polynucleotides as described herein can be administered to a
subject (e.g., a mammalian subject, such as a human subject), and
the RNA polynucleotides are translated in vivo to produce an
antigenic polypeptide (antigen).
[0211] An "effective amount" of a hMPV/hPIV3 vaccine is based, at
least in part, on the target tissue, target cell type, means of
administration, physical characteristics of the RNA (e.g., length,
nucleotide composition, and/or extent of modified nucleosides),
other components of the vaccine, and other determinants, such as
age, body weight, height, sex and general health of the subject.
Typically, an effective amount of a hMPV/hPIV3 vaccine provides an
induced or boosted immune response as a function of antigen
production in the cells of the subject. In some embodiments, an
effective amount of the hMPV/hPIV3 RNA vaccine containing RNA
polynucleotides having at least one chemical modifications are more
efficient than a composition containing a corresponding unmodified
polynucleotide encoding the same antigen or a peptide antigen.
Increased antigen production may be demonstrated by increased cell
transfection (the percentage of cells transfected with the RNA
vaccine), increased protein translation and/or expression from the
polynucleotide, decreased nucleic acid degradation (as
demonstrated, for example, by increased duration of protein
translation from a modified polynucleotide), or altered antigen
specific immune response of the host cell.
[0212] In some embodiments, a vaccine of the present disclosure is
demonstrated to be effective by showing a desired result in an
animal model, e.g., a rodent or non-human primate model. For
example, vaccination of cotton rats with a hMPV/hPIV3 combination
vaccine as provided herein resulted in the induction of high levels
of neutralizing antibodies and reduced the viral titers in the nose
and lungs of the immunized cotton rats after challenge with hMPV or
hPIV3 viruses, without evidence of vaccine-enhanced respiratory
disease (ERD). Studies of vaccinated African Green Monkeys
demonstrated similar results. The hMPV/PIV3 combination vaccine
afforded full protection against both viruses in the lung and the
nose of the vaccinated animals after less than three intramuscular
doses of the vaccine.
[0213] The term "pharmaceutical composition" refers to the
combination of an active agent with a carrier, inert or active,
making the composition especially suitable for diagnostic or
therapeutic use in vivo or ex vivo. A "pharmaceutically acceptable
carrier," after administered to or upon a subject, does not cause
undesirable physiological effects. The carrier in the
pharmaceutical composition must be "acceptable" also in the sense
that it is compatible with the active ingredient and can be capable
of stabilizing it. One or more solubilizing agents can be utilized
as pharmaceutical carriers for delivery of an active agent.
Examples of a pharmaceutically acceptable carrier include, but are
not limited to, biocompatible vehicles, adjuvants, additives, and
diluents to achieve a composition usable as a dosage form. Examples
of other carriers include colloidal silicon oxide, magnesium
stearate, cellulose, and sodium lauryl sulfate. Additional suitable
pharmaceutical carriers and diluents, as well as pharmaceutical
necessities for their use, are described in Remington's
Pharmaceutical Sciences.
[0214] In some embodiments, RNA vaccines (including polynucleotides
and their encoded polypeptides) in accordance with the present
disclosure may be used for treatment or prevention of hMPV/hPIV3.
hMPV/hPIV3 RNA vaccines may be administered prophylactically or
therapeutically as part of an active immunization scheme to healthy
individuals or early in infection during the incubation phase or
during active infection after onset of symptoms. In some
embodiments, the amount of RNA vaccines of the present disclosure
provided to a cell, a tissue or a subject may be an amount
effective for immune prophylaxis.
[0215] hMPV/hPIV3 RNA (e.g., mRNA) vaccines may be administered
with other prophylactic or therapeutic compounds. As a non-limiting
example, a prophylactic or therapeutic compound may be an adjuvant
or a booster. As used herein, when referring to a prophylactic
composition, such as a vaccine, the term "booster" refers to an
extra administration of the prophylactic (vaccine) composition. A
booster (or booster vaccine) may be given after an earlier
administration of the prophylactic composition. The time of
administration between the initial administration of the
prophylactic composition and the booster may be, but is not limited
to, 1 minute, 2 minutes, 3 minutes, 4 minutes, 5 minutes, 6
minutes, 7 minutes, 8 minutes, 9 minutes, 10 minutes, 15 minutes,
20 minutes 35 minutes, 40 minutes, 45 minutes, 50 minutes, 55
minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7
hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14
hours, 15 hours, 16 hours, 17 hours, 18 hours, 19 hours, 20 hours,
21 hours, 22 hours, 23 hours, 1 day, 36 hours, 2 days, 3 days, 4
days, 5 days, 6 days, 1 week, 10 days, 2 weeks, 3 weeks, 1 month, 2
months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months,
9 months, 10 months, 11 months, 1 year, 18 months, 2 years, 3
years, 4 years, 5 years, 6 years, 7 years, 8 years, 9 years, 10
years, 11 years, 12 years, 13 years, 14 years, 15 years, 16 years,
17 years, 18 years, 19 years, 20 years, 25 years, 30 years, 35
years, 40 years, 45 years, 50 years, 55 years, 60 years, 65 years,
70 years, 75 years, 80 years, 85 years, 90 years, 95 years or more
than 99 years. In exemplary embodiments, the time of administration
between the initial administration of the prophylactic composition
and the booster may be, but is not limited to, 1 week, 2 weeks, 3
weeks, 1 month, 2 months, 3 months, 6 months or 1 year.
[0216] In some embodiments, hMPV/hPIV3 RNA vaccines may be
administered intramuscularly, intranasally or intradermally,
similarly to the administration of inactivated vaccines known in
the art.
[0217] The hMPV/hPIV3 RNA vaccines may be utilized in various
settings depending on the prevalence of the infection or the degree
or level of unmet medical need. As a non-limiting example, the RNA
vaccines may be utilized to treat and/or prevent a variety of
infectious disease. RNA vaccines have superior properties in that
they produce much larger antibody titers, better neutralizing
immunity, produce more durable immune responses, and/or produce
responses earlier than commercially available vaccines.
[0218] Provided herein are pharmaceutical compositions including
hMPV/hPIV3 RNA vaccines and RNA vaccine compositions and/or
complexes optionally in combination with one or more
pharmaceutically acceptable excipients.
[0219] hMPV/hPIV3 RNA (e.g., mRNA) vaccines may be formulated or
administered alone or in conjunction with one or more other
components. For instance, hMPV/hPIV3 RNA vaccines (vaccine
compositions) may comprise other components including, but not
limited to, adjuvants.
[0220] In some embodiments, hMPV/hPIV3 RNA vaccines do not include
an adjuvant (they are adjuvant free).
[0221] hMPV/hPIV3 RNA (e.g., mRNA) vaccines may be formulated or
administered in combination with one or more
pharmaceutically-acceptable excipients. In some embodiments,
vaccine compositions comprise at least one additional active
substances, such as, for example, a therapeutically-active
substance, a prophylactically-active substance, or a combination of
both. Vaccine compositions may be sterile, pyrogen-free or both
sterile and pyrogen-free. General considerations in the formulation
and/or manufacture of pharmaceutical agents, such as vaccine
compositions, may be found, for example, in Remington: The Science
and Practice of Pharmacy 21st ed., Lippincott Williams &
Wilkins, 2005 (incorporated herein by reference in its
entirety).
[0222] In some embodiments, hMPV/hPIV3 RNA vaccines are
administered to humans, human patients or subjects. For the
purposes of the present disclosure, the phrase "active ingredient"
generally refers to the RNA vaccines or the polynucleotides
contained therein, for example, RNA polynucleotides (e.g., mRNA
polynucleotides) encoding antigens.
[0223] Formulations of the vaccine compositions described herein
may be prepared by any method known or hereafter developed in the
art of pharmacology. In general, such preparatory methods include
the step of bringing the active ingredient (e.g., mRNA
polynucleotide) into association with an excipient and/or one or
more other accessory ingredients, and then, if necessary and/or
desirable, dividing, shaping and/or packaging the product into a
desired single- or multi-dose unit.
[0224] Relative amounts of the active ingredient, the
pharmaceutically acceptable excipient, and/or any additional
ingredients in a pharmaceutical composition in accordance with the
disclosure will vary, depending upon the identity, size, and/or
condition of the subject treated and further depending upon the
route by which the composition is to be administered. By way of
example, the composition may comprise between 0.1% and 100%, e.g.,
between 0.5 and 50%, between 1-30%, between 5-80%, at least 80%
(w/w) active ingredient.
[0225] In some embodiments, hMPV/hPIV3 RNA vaccines are formulated
using one or more excipients to: (1) increase stability; (2)
increase cell transfection; (3) permit the sustained or delayed
release (e.g., from a depot formulation); (4) alter the
biodistribution (e.g., target to specific tissues or cell types);
(5) increase the translation of encoded protein in vivo; and/or (6)
alter the release profile of encoded protein (antigen) in vivo. In
addition to traditional excipients such as any and all solvents,
dispersion media, diluents, or other liquid vehicles, dispersion or
suspension aids, surface active agents, isotonic agents, thickening
or emulsifying agents, preservatives, excipients can include,
without limitation, lipidoids, liposomes, lipid nanoparticles,
polymers, lipoplexes, core-shell nanoparticles, peptides, proteins,
cells transfected with hMPV/hPIV3 RNA vaccines (e.g., for
transplantation into a subject), hyaluronidase, nanoparticle mimics
and combinations thereof.
Flagellin Adjuvants
[0226] Flagellin is an approximately 500 amino acid monomeric
protein that polymerizes to form the flagella associated with
bacterial motion. Flagellin is expressed by a variety of
flagellated bacteria (Salmonella typhimurium for example) as well
as non-flagellated bacteria (such as Escherichia coli). Sensing of
flagellin by cells of the innate immune system (dendritic cells,
macrophages, etc.) is mediated by the Toll-like receptor 5 (TLRS)
as well as by Nod-like receptors (NLRs) Ipaf and Naip5. TLRs and
NLRs have been identified as playing a role in the activation of
innate immune response and adaptive immune response. As such,
flagellin provides an adjuvant effect in a vaccine.
[0227] The nucleotide and amino acid sequences encoding known
flagellin polypeptides are publicly available in the NCBI GenBank
database. The flagellin sequences from S. Typhimurium, H. Pylori,
V. Cholera, S. marcesens, S. flexneri, T. Pallidum, L. pneumophila,
B. burgdoiferei, C. difficile, R. meliloti, A. tumefaciens, R.
lupini, B. clarridgeiae, P. Mirabilis, B. suhtilus, T.
monocytogenes, P. aeruginosa, and E. coli, among others are
known.
[0228] A flagellin polypeptide, as used herein, refers to a full
length flagellin protein, immunogenic fragments thereof, and
peptides having at least 50% sequence identify to a flagellin
protein or immunogenic fragments thereof. Exemplary flagellin
proteins include flagellin from Salmonella typhi (UniPro Entry
number: Q56086), Salmonella typhimurium (A0A0C9DG09), Salmonella
enteritidis (A0A0C9BAB7), and Salmonella choleraesuis (Q6V2X8). In
some embodiments, the flagellin protein comprises the following
amino acid sequence:
TABLE-US-00002 (SEQ ID NO: 10)
MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAI
ANRFTANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQSA
NGTNSQSDLDSIQAEITQRLNEIDRVSGQTQFNGVKVLAQDNTLTIQVGA
NDGETIDIDLKEISSKTLGLDKLNVQDAYTPKETAVTVDKTTYKNGTDPI
TAQSNTDIQTAIGGGATGVTGADIKFKDGQYYLDVKGGASAGVYKATYDE
TTKKVNIDTTDKTPLATAEATAIRGTATITHNQIAEVTKEGVDTTTVAAQ
LAAAGVTGADKDNTSLVKLSFEDKNGKVIDGGYAVKMGDDFYAATYDEKT
GAITAKTTTYTDGTGVAQTGAVKFGGANGKSEVVTATDGKTYLASDLDKH
NFRTGGELKEVNTDKTENPLQKIDAALAQVDTLRSDLGAVQNRFNSAITN
LGNTVNNLSSARSRIEDSDYATEVSNMSRAQILQQAGTSVLAQANQVPQN VLSLLR.
In some embodiments, the flagellin polypeptide has at least 60%,
70%, 75%, 80%, 90%, 95%, 97%, 98%, or 99% sequence identify to a
flagellin protein or immunogenic fragments thereof.
[0229] In some embodiments, the flagellin polypeptide is an
immunogenic fragment. An immunogenic fragment is a portion of a
flagellin protein that provokes an immune response. In some
embodiments, the immune response is a TLRS immune response. An
example of an immunogenic fragment is a flagellin protein in which
all or a portion of a hinge region has been deleted or replaced
with other amino acids. For example, an antigenic polypeptide may
be inserted in the hinge region. Hinge regions are the
hypervariable regions of a flagellin. Hinge regions of a flagellin
are also referred to as "D3 domain or region, "propeller domain or
region," "hypervariable domain or region" and "variable domain or
region." "At least a portion of a hinge region," as used herein,
refers to any part of the hinge region of the flagellin, or the
entirety of the hinge region. In other embodiments an immunogenic
fragment of flagellin is a 20, 25, 30, 35, or 40 amino acid
C-terminal fragment of flagellin.
[0230] The flagellin monomer is formed by domains DO through D3. DO
and D1, which form the stem, are composed of tandem long alpha
helices and are highly conserved among different bacteria. The D1
domain includes several stretches of amino acids that are useful
for TLRS activation. The entire Dl domain or one or more of the
active regions within the domain are immunogenic fragments of
flagellin. Examples of immunogenic regions within the D1 domain
include residues 88-114 and residues 411-431 (in Salmonella
typhimurium FliC flagellin. Within the 13 amino acids in the 88-100
region, at least 6 substitutions are permitted between Salmonella
flagellin and other flagellins that still preserve TLRS activation.
Thus, immunogenic fragments of flagellin include flagellin like
sequences that activate TLRS and contain a 13 amino acid motif that
is 53% or more identical to the Salmonella sequence in 88-100 of
FliC (LQRVRELAVQSAN; SEQ ID NO:11).
[0231] In some embodiments, the RNA (e.g., mRNA) vaccine includes
an RNA that encodes a fusion protein of flagellin and one or more
antigenic polypeptides. A "fusion protein" as used herein, refers
to a linking of two components of the construct. In some
embodiments, a carboxy-terminus of the antigenic polypeptide is
fused or linked to an amino terminus of the flagellin polypeptide.
In other embodiments, an amino-terminus of the antigenic
polypeptide is fused or linked to a carboxy-terminus of the
flagellin polypeptide. The fusion protein may include, for example,
one, two, three, four, five, six or more flagellin polypeptides
linked to one, two, three, four, five, six or more antigenic
polypeptides. When two or more flagellin polypeptides and/or two or
more antigenic polypeptides are linked such a construct may be
referred to as a "multimer."
[0232] Each of the components of a fusion protein may be directly
linked to one another or they may be connected through a linker.
For instance, the linker may be an amino acid linker. The amino
acid linker encoded for by the RNA (e.g., mRNA) vaccine to link the
components of the fusion protein may include, for instance, at
least one member selected from the group consisting of a lysine
residue, a glutamic acid residue, a serine residue and an arginine
residue. In some embodiments the linker is 1-30, 1-25, 1-25, 5-10,
5, 15, or 5-20 amino acids in length.
[0233] In other embodiments the RNA (e.g., mRNA) vaccine includes
at least two separate RNA polynucleotides, one encoding one or more
antigenic polypeptides (e.g., F proteins) and the other encoding
the flagellin polypeptide. The at least two RNA polynucleotides may
be co-formulated in a carrier such as a lipid nanoparticle.
Alternatively, the at least two RNA polynucleotides may be
separately formulated.
Lipid Nanoparticles (LNPs)
[0234] In some embodiments, hMPV/hPIV3 RNA (e.g., mRNA) vaccines of
the disclosure are formulated in a lipid nanoparticle (LNP). Lipid
nanoparticles typically comprise ionizable cationic lipid,
non-cationic lipid, sterol and PEG lipid components along with the
nucleic acid cargo of interest. The lipid nanoparticles of the
disclosure can be generated using components, compositions, and
methods as are generally known in the art, see for example
PCT/US2016/052352; PCT/US2016/068300; PCT/US2017/037551;
PCT/US2015/027400; PCT/US2016/047406; PCT/US2016/000129;
PCT/US2016/014280; PCT/US2016/014280; PCT/US2017/038426;
PCT/US2014/027077; PC T/US2014/055394; PCT/US2016/52117;
PCT/US2012/069610; PCT/US2017/027492; PCT/US2016/059575 and
PCT/US2016/069491 all of which are incorporated by reference herein
in their entirety.
[0235] Vaccines of the present disclosure are typically formulated
in lipid nanoparticle. In some embodiments, the lipid nanoparticle
comprises at least one ionizable cationic lipid, at least one
non-cationic lipid, at least one sterol, and/or at least one
polyethylene glycol (PEG)-modified lipid.
[0236] In some embodiments, the lipid nanoparticle comprises a
molar ratio of 20-60% ionizable cationic lipid. For example, the
lipid nanoparticle may comprise a molar ratio of 20-50%, 20-40%,
20-30%, 30-60%, 30-50%, 30-40%, 40-60%, 40-50%, or 50-60% ionizable
cationic lipid. In some embodiments, the lipid nanoparticle
comprises a molar ratio of 20%, 30%, 40%, 50, or 60% ionizable
cationic lipid.
[0237] In some embodiments, the lipid nanoparticle comprises a
molar ratio of 5-25% non-cationic lipid. For example, the lipid
nanoparticle may comprise a molar ratio of 5-20%, 5-15%, 5-10%,
10-25%, 10-20%, 10-25%, 15-25%, 15-20%, or 20-25% non-cationic
lipid. In some embodiments, the lipid nanoparticle comprises a
molar ratio of 5%, 10%, 15%, 20%, or 25% non-cationic lipid.
[0238] In some embodiments, the lipid nanoparticle comprises a
molar ratio of 25-55% sterol. For example, the lipid nanoparticle
may comprise a molar ratio of 25-50%, 25-45%, 25-40%, 25-35%,
25-30%, 30-55%, 30-50%, 30-45%, 30-40%, 30-35%, 35-55%, 35-50%,
35-45%, 35-40%, 40-55%, 40-50%, 40-45%, 45-55%, 45-50%, or 50-55%
sterol. In some embodiments, the lipid nanoparticle comprises a
molar ratio of 25%, 30%, 35%, 40%, 45%, 50%, or 55% sterol.
[0239] In some embodiments, the lipid nanoparticle comprises a
molar ratio of 0.5-15% PEG-modified lipid. For example, the lipid
nanoparticle may comprise a molar ratio of 0.5-10%, 0.5-5%, 1-15%,
1-10%, 1-5%, 2-15%, 2-10%, 2-5%, 5-15%, 5-10%, or 10-15%. In some
embodiments, the lipid nanoparticle comprises a molar ratio of
0.5%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%,
or 15% PEG-modified lipid.
[0240] In some embodiments, the lipid nanoparticle comprises a
molar ratio of 20-60% ionizable cationic lipid, 5-25% non-cationic
lipid, 25-55% sterol, and 0.5-15% PEG-modified lipid.
[0241] In some embodiments, an ionizable cationic lipid of the
disclosure comprises a compound of Formula (I):
##STR00001##
[0242] or a salt or isomer thereof, wherein:
[0243] R.sub.1 is selected from the group consisting of C.sub.5-30
alkyl, C.sub.5-20 alkenyl, --R*YR'', --YR'', and --R''M'R';
[0244] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.1-14 alkyl, C.sub.2-14 alkenyl,
--R*YR'', --YR'', and --R*OR'', or R.sub.2 and R.sub.3, together
with the atom to which they are attached, form a heterocycle or
carbocycle;
[0245] R.sub.4 is selected from the group consisting of a C.sub.3-6
carbocycle, --(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nCHQR, --CHQR,
--CQ(R).sub.2, and unsubstituted C.sub.1-6 alkyl, where Q is
selected from a carbocycle, heterocycle, --OR,
--O(CH.sub.2).sub.nN(R).sub.2, --C(O)OR, --OC(O)R, --CX.sub.3,
--CX.sub.2H, --CXH.sub.2, --CN, --N(R).sub.2, --C(O)N(R).sub.2,
--N(R)C(O)R, --N(R)S(O).sub.2R, --N(R)C(O)N(R).sub.2,
--N(R)C(S)N(R).sub.2, --N(R)R.sub.8, --O(CH.sub.2)--OR,
--N(R)C(.dbd.NR.sub.9)N(R).sub.2,
--N(R)C(.dbd.CHR.sub.9)N(R).sub.2, --OC(O)N(R).sub.2, --N(R)C(O)OR,
--N(OR)C(O)R, --N(OR)S(O).sub.2R, --N(OR)C(O)OR,
--N(OR)C(O)N(R).sub.2, --N(OR)C(S)N(R).sub.2,
--N(OR)C(.dbd.NR.sub.9)N(R).sub.2,
--N(OR)C(.dbd.CHR.sub.9)N(R).sub.2, --C(.dbd.NR.sub.9)N(R).sub.2,
--C(.dbd.NR.sub.9)R, --C(O)N(R)OR, and --C(R)N(R).sub.2C(O)OR, and
each n is independently selected from 1, 2, 3, 4, and 5;
[0246] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0247] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0248] M and M' are independently selected from --C(O)O--,
--OC(O)--, --C(O)N(R')--, --N(R')C(O)--, --C(O)--, --C(S)--,
--C(S)S--, --SC(S)--, --CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--,
--S--S--, an aryl group, and a heteroaryl group;
[0249] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[0250] R.sub.8 is selected from the group consisting of C.sub.3-6
carbocycle and heterocycle;
[0251] R.sub.9 is selected from the group consisting of H, CN,
NO.sub.2, C.sub.1-6 alkyl, --OR, --S(O).sub.2R,
--S(O).sub.2N(R).sub.2, C.sub.2-6 alkenyl, C.sub.3-6 carbocycle and
heterocycle;
[0252] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0253] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.7-18 alkenyl, --R*YR'', --YR'', and
H;
[0254] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl;
[0255] each R* is independently selected from the group consisting
of C.sub.1-12 alkyl and C.sub.2-12 alkenyl;
[0256] each Y is independently a C.sub.3-6 carbocycle;
[0257] each X is independently selected from the group consisting
of F, Cl, Br, and I; and
[0258] m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13.
[0259] In some embodiments, a subset of compounds of Formula (I)
includes those in which when R.sub.4 is --(CH.sub.2).sub.nQ,
--(CH.sub.2).sub.1CHQR, --CHQR, or --CQ(R).sub.2, then (i) Q is not
--N(R).sub.2 when n is 1, 2, 3, 4 or 5, or (ii) Q is not 5, 6, or
7-membered heterocycloalkyl when n is 1 or 2.
[0260] In some embodiments, another subset of compounds of Formula
(I) includes those in which
[0261] R.sub.1 is selected from the group consisting of C.sub.5-30
alkyl, C.sub.5-20 alkenyl, --R*YR'', --YR'', and --R''M'R';
[0262] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.1-14 alkyl, C.sub.2-14 alkenyl,
--R*YR'', --YR'', and --R*OR'', or R.sub.2 and R.sub.3, together
with the atom to which they are attached, form a heterocycle or
carbocycle;
[0263] R.sub.4 is selected from the group consisting of a C.sub.3-6
carbocycle, --(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nCHQR, --CHQR,
--CQ(R).sub.2, and unsubstituted C.sub.1-6 alkyl, where Q is
selected from a C.sub.3-6 carbocycle, a 5- to 14-membered
heteroaryl having one or more heteroatoms selected from N, O, and
S, --OR, --O(CH.sub.2).sub.1N(R).sub.2, --C(O)OR, --OC(O)R,
--CX.sub.3, --CX.sub.2H, --CXH.sub.2, --CN, --C(O)N(R).sub.2,
--N(R)C(O)R, --N(R)S(O).sub.2R, --N(R)C(O)N(R).sub.2,
--N(R)C(S)N(R).sub.2, --CRN(R).sub.2C(O)OR, --N(R)R.sub.8,
--O(CH.sub.2).sub.nOR, --N(R)C(.dbd.NR.sub.9)N(R).sub.2,
--N(R)C(.dbd.CHR.sub.9)N(R).sub.2, --OC(O)N(R).sub.2, --N(R)C(O)OR,
--N(OR)C(O)R, --N(OR)S(O).sub.2R, --N(OR)C(O)OR, --N(OR)C(O)
N(R).sub.2, --N(OR)C(S)N(R).sub.2,
--N(OR)C(.dbd.NR.sub.9)N(R).sub.2,
--N(OR)C(.dbd.CHR.sub.9)N(R).sub.2, --C(.dbd.NR.sub.9)N(R).sub.2,
--C(.dbd.NR.sub.9)R, --C(O)N(R)OR, and a 5- to 14-membered
heterocycloalkyl having one or more heteroatoms selected from N, O,
and S which is substituted with one or more substituents selected
from oxo (.dbd.O), OH, amino, mono- or di-alkylamino, and C.sub.1-3
alkyl, and each n is independently selected from 1, 2, 3, 4, and
5;
[0264] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0265] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0266] M and M' are independently selected from --C(O)O--,
--OC(O)--, --C(O)N(R')--, --N(R')C(O)--, --C(O)--, --C(S)--,
--C(S)S--, --SC(S)--, --CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--,
--S--S--, an aryl group, and a heteroaryl group;
[0267] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[0268] R.sub.8 is selected from the group consisting of C.sub.3-6
carbocycle and heterocycle;
[0269] R.sub.9 is selected from the group consisting of H, CN,
NO.sub.2, C.sub.1-6 alkyl, --OR, --S(O).sub.2R,
--S(O).sub.2N(R).sub.2, C.sub.2-6 alkenyl, C.sub.3-6 carbocycle and
heterocycle;
[0270] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0271] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.7-18 alkenyl, --R*YR'', --YR'', and
H;
[0272] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl;
[0273] each R* is independently selected from the group consisting
of C.sub.1-12 alkyl and C.sub.2-12 alkenyl;
[0274] each Y is independently a C.sub.3-6 carbocycle;
[0275] each X is independently selected from the group consisting
of F, Cl, Br, and I; and
[0276] m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13, or
salts or isomers thereof.
[0277] In some embodiments, another subset of compounds of Formula
(I) includes those in which
[0278] R.sub.1 is selected from the group consisting of C.sub.5-30
alkyl, C.sub.5-20 alkenyl, --R*YR'', --YR'', and --R''M'R';
[0279] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.1-14 alkyl, C.sub.2-14 alkenyl,
--R*YR'', --YR'', and --R*OR'', or R.sub.2 and R.sub.3, together
with the atom to which they are attached, form a heterocycle or
carbocycle;
[0280] R.sub.4 is selected from the group consisting of a C.sub.3-6
carbocycle, --(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nCHQR, --CHQR,
--CQ(R).sub.2, and unsubstituted C.sub.1-6 alkyl, where Q is
selected from a C.sub.3-6 carbocycle, a 5- to 14-membered
heterocycle having one or more heteroatoms selected from N, O, and
S, --OR, --O(CH.sub.2).sub.nN(R).sub.2, --C(O)OR, --OC(O)R,
--CX.sub.3, --CX.sub.2H, --CXH.sub.2, --CN, --C(O)N(R).sub.2,
--N(R)C(O)R, --N(R)S(O).sub.2R, --N(R)C(O)N(R).sub.2,
--N(R)C(S)N(R).sub.2, --CRN(R).sub.2C(O)OR, --N(R)R.sub.8,
--O(CH.sub.2).sub.nOR, --N(R)C(.dbd.NR.sub.9)N(R).sub.2,
--N(R)C(.dbd.CHR.sub.9)N(R).sub.2, --OC(O)N(R).sub.2, --N(R)C(O)OR,
--N(OR)C(O)R, --N(OR)S(O).sub.2R, --N(OR)C(O)OR,
--N(OR)C(O)N(R).sub.2, --N(OR)C(S)N(R).sub.2,
--N(OR)C(.dbd.NR.sub.9)N(R).sub.2,
--N(OR)C(.dbd.CHR.sub.9)N(R).sub.2, --C(.dbd.NR.sub.9)R,
--C(O)N(R)OR, and --C(.dbd.NR.sub.9)N(R).sub.2, and each n is
independently selected from 1, 2, 3, 4, and 5; and when Q is a 5-
to 14-membered heterocycle and (i) R.sub.4 is --(CH.sub.2).sub.nQ
in which n is 1 or 2, or (ii) R.sub.4 is --(CH.sub.2).sub.nCHQR in
which n is 1, or (iii) R.sub.4 is --CHQR, and --CQ(R).sub.2, then Q
is either a 5- to 14-membered heteroaryl or 8- to 14-membered
heterocycloalkyl;
[0281] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0282] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0283] M and M' are independently selected from --C(O)O--,
--OC(O)--, --C(O)N(R')--, --N(R')C(O)--, --C(O)--, --C(S)--,
--C(S)S--, --SC(S)--, --CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--,
--S--S--, an aryl group, and a heteroaryl group;
[0284] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[0285] R.sub.8 is selected from the group consisting of C.sub.3-6
carbocycle and heterocycle;
[0286] R.sub.9 is selected from the group consisting of H, CN,
NO.sub.2, C.sub.1-6 alkyl, --OR, --S(O).sub.2R,
--S(O).sub.2N(R).sub.2, C.sub.2-6 alkenyl, C.sub.3-6 carbocycle and
heterocycle;
[0287] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0288] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.7-18 alkenyl, --R*YR'', --YR'', and
H;
[0289] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl;
[0290] each R* is independently selected from the group consisting
of C.sub.1-12 alkyl and C.sub.2-12 alkenyl;
[0291] each Y is independently a C.sub.3-6 carbocycle;
[0292] each X is independently selected from the group consisting
of F, Cl, Br, and I; and
[0293] m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13,
[0294] or salts or isomers thereof.
[0295] In some embodiments, another subset of compounds of Formula
(I) includes those in which
[0296] R.sub.1 is selected from the group consisting of C.sub.5-30
alkyl, C.sub.5-20 alkenyl, --R*YR'', --YR'', and --R''M'R';
[0297] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.1-14 alkyl, C.sub.2-14 alkenyl,
--R*YR'', --YR'', and --R*OR'', or R.sub.2 and R.sub.3, together
with the atom to which they are attached, form a heterocycle or
carbocycle;
[0298] R.sub.4 is selected from the group consisting of a C.sub.3-6
carbocycle, --(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nQ,
--(CH.sub.2).sub.nCHQR, --CHAR, --CQ(R).sub.2, and unsubstituted
C.sub.1-6 alkyl, where Q is selected from a C.sub.3-6 carbocycle, a
5- to 14-membered heteroaryl having one or more heteroatoms
selected from N, O, and S, --OR, --O(CH.sub.2)--N(R).sub.2,
--C(O)OR, --OC(O)R, --CX.sub.3, --CX.sub.2H, --CXH.sub.2, --CN,
--C(O)N(R).sub.2, --N(R)C(O)R, --N(R)S(O).sub.2R,
--N(R)C(O)N(R).sub.2, --N(R)C(S)N(R).sub.2, --CRN(R).sub.2C(O)OR,
--N(R)R.sub.8, --O(CH.sub.2).sub.nOR,
--N(R)C(.dbd.NR.sub.9)N(R).sub.2,
--N(R)C(.dbd.CHR.sub.9)N(R).sub.2, --OC(O)N(R).sub.2, --N(R)C(O)OR,
--N(OR)C(O)R, --N(OR)S(O).sub.2R, --N(OR)C(O)OR,
--N(OR)C(O)N(R).sub.2, --N(OR)C(S)N(R).sub.2,
--N(OR)C(.dbd.NR.sub.9)N(R).sub.2,
--N(OR)C(.dbd.CHR.sub.9)N(R).sub.2, --C(.dbd.NR.sub.9)R,
--C(O)N(R)OR, and --C(.dbd.NR.sub.9)N(R).sub.2, and each n is
independently selected from 1, 2, 3, 4, and 5;
[0299] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0300] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0301] M and M' are independently selected from --C(O)O--,
--OC(O)--, --C(O)N(R')--, --N(R')C(O)--, --C(O)--, --C(S)--,
--C(S)S--, --SC(S)--, --CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--,
--S--S--, an aryl group, and a heteroaryl group;
[0302] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[0303] R.sub.8 is selected from the group consisting of C.sub.1-6
carbocycle and heterocycle;
[0304] R.sub.9 is selected from the group consisting of H, CN,
NO.sub.2, C.sub.1-6 alkyl, --OR, --S(O).sub.2R,
--S(O).sub.2N(R).sub.2, C.sub.2-6 alkenyl, C.sub.3-6 carbocycle and
heterocycle;
[0305] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0306] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.2-18 alkenyl, --R*YR'', --YR'', and
H;
[0307] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl;
[0308] each R* is independently selected from the group consisting
of C.sub.1-12 alkyl and C.sub.7-12 alkenyl;
[0309] each Y is independently a C.sub.3-6 carbocycle;
[0310] each X is independently selected from the group consisting
of F, Cl, Br, and I; and
[0311] m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13, or
salts or isomers thereof.
[0312] In some embodiments, another subset of compounds of Formula
(I) includes those in which
[0313] R.sub.1 is selected from the group consisting of C.sub.5-30
alkyl, C.sub.5-20 alkenyl, --R*YR'', --YR'', and --R''M'R';
[0314] R.sub.2 and R.sub.3 are independently selected from the
group consisting of H, C.sub.2-14 alkyl, C.sub.2-14 alkenyl,
--R*YR'', --YR'', and --R*OR'', or R.sub.2 and R.sub.3, together
with the atom to which they are attached, form a heterocycle or
carbocycle;
[0315] R.sub.4 is --(CH.sub.2).sub.nQ or --(CH.sub.2).sub.nCHQR,
where Q is --N(R).sub.2, and n is selected from 3, 4, and 5;
[0316] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0317] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.7-3 alkenyl, and H;
[0318] M and M' are independently selected from --C(O)O--,
--OC(O)--, --C(O)N(R')--, --N(R')C(O)--, --C(O)--, --C(S)--,
--C(S)S--, --SC(S)--, --CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--,
--S--S--, an aryl group, and a heteroaryl group;
[0319] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[0320] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0321] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.2-18 alkenyl, --R*YR'', --YR'', and
H;
[0322] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl;
[0323] each R* is independently selected from the group consisting
of C.sub.1-12 alkyl and C.sub.1-12 alkenyl;
[0324] each Y is independently a C.sub.3-6 carbocycle;
[0325] each X is independently selected from the group consisting
of F, Cl, Br, and I; and
[0326] m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13, or
salts or isomers thereof.
[0327] In some embodiments, another subset of compounds of Formula
(I) includes those in which
[0328] R.sub.1 is selected from the group consisting of C.sub.5-30
alkyl, C.sub.5-20 alkenyl, --R*YR'', --YR'', and --R''M'R';
[0329] R.sub.2 and R.sub.3 are independently selected from the
group consisting of C.sub.1-14 alkyl, C.sub.2-14 alkenyl, --R*YR'',
--YR'', and --R*OR'', or R.sub.2 and R.sub.3, together with the
atom to which they are attached, form a heterocycle or
carbocycle;
[0330] R.sub.4 is selected from the group consisting of
--(CH.sub.2).sub.nQ, --(CH.sub.2).sub.nCHQR, --CHQR, and
--CQ(R).sub.2, where Q is --N(R).sub.2, and n is selected from 1,
2, 3, 4, and 5;
[0331] each R.sub.5 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0332] each R.sub.6 is independently selected from the group
consisting of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0333] M and M' are independently selected from --C(O)O--,
--OC(O)--, --C(O)N(R')--, --N(R')C(O)--, --C(O)--, --C(S)--,
--C(S)S--, --SC(S)--, --CH(OH)--, --P(O)(OR')O--, --S(O).sub.2--,
--S--S--, an aryl group, and a heteroaryl group;
[0334] R.sub.7 is selected from the group consisting of C.sub.1-3
alkyl, C.sub.2-3 alkenyl, and H;
[0335] each R is independently selected from the group consisting
of C.sub.1-3 alkyl, C.sub.2-3 alkenyl, and H;
[0336] each R' is independently selected from the group consisting
of C.sub.1-18 alkyl, C.sub.2-18 alkenyl, --R*YR'', --YR'', and
H;
[0337] each R'' is independently selected from the group consisting
of C.sub.3-14 alkyl and C.sub.3-14 alkenyl;
[0338] each R* is independently selected from the group consisting
of C.sub.1-12 alkyl and C.sub.1-12 alkenyl;
[0339] each Y is independently a C.sub.3-6 carbocycle;
[0340] each X is independently selected from the group consisting
of F, Cl, Br, and I; and
[0341] m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13, or
salts or isomers thereof.
[0342] In some embodiments, a subset of compounds of Formula (I)
includes those of Formula (IA):
##STR00002##
[0343] or a salt or isomer thereof, wherein 1 is selected from 1,
2, 3, 4, and 5; m is selected from 5, 6, 7, 8, and 9; M.sub.1 is a
bond or M'; R.sub.4 is unsubstituted C.sub.1-3 alkyl, or
--(CH.sub.2).sub.nQ, in which Q is OH, --NHC(S)N(R).sub.2,
--NHC(O)N(R).sub.2, --N(R)C(O)R, --N(R)S(O).sub.2R, --N(R)R.sub.8,
--NHC(.dbd.NR.sub.9)N(R).sub.2, --NHC(.dbd.CHR.sub.9)N(R).sub.2,
--OC(O)N(R).sub.2, --N(R)C(O)OR, heteroaryl or heterocycloalkyl; M
and M' are independently selected from --C(O)O--, --OC(O)--,
--C(O)N(R')--, --P(O)(OR')O--, --S--S--, an aryl group, and a
heteroaryl group; and R.sub.2 and R.sub.3 are independently
selected from the group consisting of H, C.sub.1-14 alkyl, and
C.sub.2-14 alkenyl.
[0344] In some embodiments, a subset of compounds of Formula (I)
includes those of Formula (II):
##STR00003##
or a salt or isomer thereof, wherein 1 is selected from 1, 2, 3, 4,
and 5; M.sub.1 is a bond or M'; R.sub.4 is unsubstituted C.sub.1-3
alkyl, or --(CH.sub.2).sub.nQ, in which n is 2, 3, or 4, and Q is
OH, --NHC(S)N(R).sub.2, --NHC(O)N(R).sub.2, --N(R)C(O)R,
--N(R)S(O).sub.2R, --N(R)R.sub.8, --NHC(.dbd.NR.sub.9)N(R).sub.2,
--NHC(.dbd.CHR.sub.9)N(R).sub.2, --OC(O)N(R).sub.2, --N(R)C(O)OR,
heteroaryl or heterocycloalkyl; M and M' are independently selected
from --C(O)O--, --OC(O)--, --C(O)N(R')--, --P(O)(OR')O--, --S--S--,
an aryl group, and a heteroaryl group; and R.sub.2 and R.sub.3 are
independently selected from the group consisting of H, C.sub.1-14
alkyl, and C.sub.2-14 alkenyl.
[0345] In some embodiments, a subset of compounds of Formula (I)
includes those of Formula (IIa), (IIb), (IIc), or (IIe):
##STR00004##
[0346] or a salt or isomer thereof, wherein R.sub.4 is as described
herein.
[0347] In some embodiments, a subset of compounds of Formula (I)
includes those of Formula (IId):
##STR00005##
[0348] or a salt or isomer thereof, wherein n is 2, 3, or 4; and m,
R', R'', and R.sub.2 through R.sub.6 are as described herein. For
example, each of R.sub.2 and R.sub.3 may be independently selected
from the group consisting of C.sub.5-14 alkyl and C.sub.5-14
alkenyl.
[0349] In some embodiments, an ionizable cationic lipid of the
disclosure comprises a compound having structure:
##STR00006##
[0350] In some embodiments, an ionizable cationic lipid of the
disclosure comprises a compound having structure:
##STR00007##
[0351] In some embodiments, a non-cationic lipid of the disclosure
comprises 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC),
1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE),
1,2-dilinoleoyl-sn-glycero-3-phosphocholine (DLPC),
1,2-dimyristoyl-sn-gly cero-phosphocholine (DMPC),
1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC),
1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC),
1,2-diundecanoyl-sn-glycero-phosphocholine (DUPC),
1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC),
1,2-di-O-octadecenyl-sn-glycero-3-phosphocholine (18:0 Diether PC),
1-oleoyl-2 cholesterylhemisuccinoyl-sn-glycero-3-phosphocholine
(OChemsPC), 1-hexadecyl-sn-glycero-3-phosphocholine (C16 Lyso PC),
1,2-dilinolenoyl-sn-glycero-3-phosphocholine,
1,2-diarachidonoyl-sn-glycero-3-phosphocholine,
1,2-didocosahexaenoyl-sn-glycero-3-phosphocholine,
1,2-diphytanoyl-sn-glycero-3-phosphoethanolamine (ME 16.0 PE),
1,2-distearoyl-sn-glycero-3-phosphoethanol amine,
1,2-dilinoleoyl-sn-glycero-3-phosphoethanolamine,
1,2-dilinolenoyl-sn-glycero-3-phosphoethanolamine,
1,2-diarachidonoyl-sn-glycero-3-phosphoethanolamine,
1,2-didocosahexaenoyl-sn-glycero-3-phosphoethanolamine,
1,2-dioleoyl-sn-glycero-3-phospho-rac-(1-glycerol) sodium salt
(DOPG), sphingomyelin, and mixtures thereof.
[0352] In some embodiments, a PEG modified lipid of the disclosure
comprises a PEG-modified phosphatidylethanolamine, a PEG-modified
phosphatidic acid, a PEG-modified ceramide, a PEG-modified
dialkylamine, a PEG-modified diacylglycerol, a PEG-modified
dialkylglycerol, and mixtures thereof. In some embodiments, the
PEG-modified lipid is PEG-DMG, PEG-c-DOMG (also referred to as
PEG-DOMG), PEG-DSG and/or PEG-DPG.
[0353] In some embodiments, a sterol of the disclosure comprises
cholesterol, fecosterol, sitosterol, ergosterol, campesterol,
stigmasterol, brassicasterol, tomatidine, ursolic acid,
alpha-tocopherol, and mixtures thereof.
[0354] In some embodiments, a LNP of the disclosure comprises an
ionizable cationic lipid of Compound 1, wherein the non-cationic
lipid is DSPC, the structural lipid that is cholesterol, and the
PEG lipid is PEG-DMG.
[0355] In some embodiments, a LNP of the disclosure comprises a
mixture of 4 lipids, including Compound 1;
1,2-dimyristoyl-sn-glycerol, methoxypolyethyleneglycol
(PEG2000-DMG); 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC);
and cholesterol. In some embodiments, a vaccine comprises a mRNA
encoding a hMPV F protein of strain
[0356] A/TN92-4 (e.g., SEQ ID NO:4) and a mRNA encoding a PIV3 F
protein of strain PER/FLA4815/2008 (e.g., SEQ ID NO:5) formulated
in a LNP that comprises a mixture of 4 lipids, including Compound
1; 1,2-dimyristoyl-sn-glycerol, methoxypolyethyleneglycol
(PEG2000-DMG); DSPC; and cholesterol.
[0357] In some embodiments, a LNP of the disclosure comprises an
N:P ratio of from about 2:1 to about 30:1.
[0358] In some embodiments, a LNP of the disclosure comprises an
N:P ratio of about 6:1.
[0359] In some embodiments, a LNP of the disclosure comprises an
N:P ratio of about 3:1.
[0360] In some embodiments, a LNP of the disclosure comprises a
wt/wt ratio of the ionizable cationic lipid component to the RNA of
from about 10:1 to about 100:1.
[0361] In some embodiments, a LNP of the disclosure comprises a
wt/wt ratio of the ionizable cationic lipid component to the RNA of
about 20:1.
[0362] In some embodiments, a LNP of the disclosure comprises a
wt/wt ratio of the ionizable cationic lipid component to the RNA of
about 10:1.
[0363] In some embodiments, a LNP of the disclosure has a mean
diameter from about 50 nm to about 150 nm.
[0364] In some embodiments, a LNP of the disclosure has a mean
diameter from about 70 nm to about 120 nm.
Multivalent Vaccines
[0365] The hMPV/hPIV3 vaccines, as provided herein, may include an
RNA (e.g. mRNA) or multiple RNAs encoding two or more antigens of
the same or different hMPV/hPIV3 species. In some embodiments, a
hMPV/hPIV3 vaccine includes an RNA or multiple RNAs encoding two or
more antigens selected from hMPV F protein and hPIVs F protein. In
some embodiments, the RNA (at least one RNA) of a hMPV/hPIV3
vaccine may encode 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or more
antigens.
[0366] In some embodiments, two or more different RNA (e.g., mRNA)
encoding antigens may be formulated in the same lipid nanoparticle.
In other embodiments, two or more different RNA encoding antigens
may be formulated in separate lipid nanoparticles (each RNA
formulated in a single lipid nanoparticle). The lipid nanoparticles
may then be combined and administered as a single vaccine
composition (e.g., comprising multiple RNA encoding multiple
antigens) or may be administered separately.
Combination Vaccines
[0367] The hMPV/hPIV3 vaccines, as provided herein, may include an
RNA or multiple RNAs encoding two or more antigens of the same or
different hMPV/hPIV3 strains. Also provided herein are combination
vaccines that include RNA encoding one or more hMPV/hPIV3
antigen(s) and one or more antigen(s) of a different organisms
(e.g., bacterial and/or viral organism). For example, in some
embodiments, an hMPV/PIV3 vaccine of the present disclosure
comprises an hMPV fusion (F) protein and a PIV3 F protein. In some
embodiments, the two F proteins are co-formulated at a 1:1 mass
ratio in an LNP. In some embodiments, the two F proteins are
formulated separately in separate LNPs. Thus, the vaccines of the
present disclosure may be combination vaccines that target one or
more antigens of the same strain/species, or one or more antigens
of different strains/species, e.g., antigens which induce immunity
to organisms which are found in the same geographic areas where the
risk of hMPV/hPIV3 infection is high or organisms to which an
individual is likely to be exposed to when exposed to hMPV/hPIV3.
In some embodiments, the hMPV F protein is of the A/TN92-4 hMPV
strain and the hPIV3 F protein is of the PER/FLA4815/2008
strain.
Dosing/Administration
[0368] Provided herein are compositions (e.g., pharmaceutical
compositions), methods, kits and reagents for prevention and/or
treatment of hMPV/hPIV3 in humans and other mammals. hMPV/hPIV3 RNA
vaccines can be used as therapeutic or prophylactic agents. In some
aspects, the RNA vaccines of the disclosure are used to provide
prophylactic protection from hMPV/hPIV3. In some aspects, the RNA
vaccines of the disclosure are used to treat a hMPV/hPIV3
infection. In some embodiments, the hMPV/hPIV3 vaccines of the
present disclosure are used in the priming of immune effector
cells, for example, to activate peripheral blood mononuclear cells
(PBMCs) ex vivo, which are then infused (re-infused) into a
subject.
[0369] A subject may be any mammal, including non-human primate and
human subjects. Typically, a subject is a human subject.
[0370] In some embodiments, the hMPV/hPIV3 vaccines are
administered to a subject (e.g., a mammalian subject, such as a
human subject) in an effective amount to induce an antigen-specific
immune response. The RNA encoding the hMPV/hPIV3 antigen is
expressed and translated in vivo to produce the antigen, which then
stimulates an immune response in the subject.
[0371] In some embodiments, an hMPV/hPIV3 vaccine of the disclosure
results in high neutralizing antibody titers (e.g., as measured by
the 60% reduction end point assay) after fewer than three doses
(e.g., after one or two doses). In some embodiments, a cotton rat
model can be used to test the vaccine and a titer of at least 9
(log 2 transformed titer using 60% PRNT assay) can be measured
using this assay. In some embodiments, a vaccine of the disclosure
results in a higher titer than that observed with a traditional
formalin inactivated protein vaccine (e.g., FI-PIV3 or FI-HMPV). In
another embodiment, an hMPV/hPIV3 vaccine of the disclosure
protects against challenge infection, e.g., as measured by reduced
viral load in both the nose and lung after fewer than three doses.
In some embodiments, a cotton rat model can be used to test this
end point. Surprisingly, an hMPV/hPIV3 vaccine of the disclosure
results in neutralizing antibody titers and reduced viral load, but
does not result in alveolitis or interstitial pneumonia. In some
embodiments, a cotton rat model can be used to determine lung
pathology. In another embodiment, the protection provided by an
hMPV/hPIV3 vaccine of the disclosure protects against challenge
with HPIV3 even though PIV3-HN mRNA is not present in the
vaccine.
[0372] Prophylactic protection from hMPV/hPIV3 can be achieved
following administration of a hMPV/hPIV3 RNA vaccine of the present
disclosure. Vaccines can be administered once, twice, three times,
four times or more but it is likely sufficient to administer the
vaccine once (optionally followed by a single booster). It is
possible, although less desirable, to administer the vaccine to an
infected individual to achieve a therapeutic response. Dosing may
need to be adjusted accordingly.
[0373] A method of eliciting an immune response in a subject
against hMPV/hPIV3 is provided in aspects of the present
disclosure. The method involves administering to the subject a
hMPV/hPIV3 RNA vaccine comprising at least one RNA (e.g., mRNA)
having an open reading frame encoding at least one hMPV/hPIV3
antigen, thereby inducing in the subject an immune response
specific to hMPV/hPIV3 antigen, wherein anti-antigen antibody titer
in the subject is increased following vaccination relative to
anti-antigen antibody titer in a subject vaccinated with a
prophylactically effective dose of a traditional vaccine against
the hMPV/hPIV3. An "anti-antigen antibody" is a serum antibody the
binds specifically to the antigen.
[0374] A prophylactically effective dose is an effective dose that
prevents infection with the virus at a clinically acceptable level.
In some embodiments, the effective dose is a dose listed in a
package insert for the vaccine. A traditional vaccine, as used
herein, refers to a vaccine other than the mRNA vaccines of the
present disclosure. For instance, a traditional vaccine includes,
but is not limited, to live microorganism vaccines, killed
microorganism vaccines, subunit vaccines, protein antigen vaccines,
DNA vaccines, virus like particle (VLP) vaccines, etc. In exemplary
embodiments, a traditional vaccine is a vaccine that has achieved
regulatory approval and/or is registered by a national drug
regulatory body, for example the Food and Drug Administration (FDA)
in the United States or the European Medicines Agency (EMA).
[0375] In some embodiments, the anti-antigen antibody titer in the
subject is increased 1 log to 10 log following vaccination relative
to anti-antigen antibody titer in a subject vaccinated with a
prophylactically effective dose of a traditional vaccine against
the hMPV/hPIV3 or an unvaccinated subject. In some embodiments, the
anti-antigen antibody titer in the subject is increased 1 log, 2
log, 3 log, 4 log, 5 log, or 10 log following vaccination relative
to anti-antigen antibody titer in a subject vaccinated with a
prophylactically effective dose of a traditional vaccine against
the hMPV/hPIV3 or an unvaccinated subject.
[0376] A method of eliciting an immune response in a subject
against a hMPV/hPIV3 is provided in other aspects of the
disclosure. The method involves administering to the subject a
hMPV/hPIV3 RNA vaccine comprising at least one RNA polynucleotide
having an open reading frame encoding at least one hMPV/hPIV3
antigen, thereby inducing in the subject an immune response
specific to hMPV/hPIV3 antigen, wherein the immune response in the
subject is higher than or equivalent to an immune response in a
subject vaccinated with a traditional vaccine against the
hMPV/hPIV3. In some embodiments, the response is higher for the
mRNA vaccine of the disclosure even when the protein vaccine is
administered at 2 times to 100 times the dosage level relative to
the RNA vaccine.
[0377] In some embodiments, the immune response in the subject is
equivalent to an immune response in a subject vaccinated with a
traditional vaccine at twice the dosage level relative to the
hMPV/hPIV3 RNA vaccine. In some embodiments, the immune response in
the subject is equivalent to an immune response in a subject
vaccinated with a traditional vaccine at three times the dosage
level relative to the hMPV/hPIV3 RNA vaccine. In some embodiments,
the immune response in the subject is equivalent to an immune
response in a subject vaccinated with a traditional vaccine at 4
times, 5 times, 10 times, 50 times, or 100 times the dosage level
relative to the hMPV/hPIV3 RNA vaccine. In some embodiments, the
immune response in the subject is equivalent to an immune response
in a subject vaccinated with a traditional vaccine at 10 times to
1000 times the dosage level relative to the hMPV/hPIV3 RNA vaccine.
In some embodiments, the immune response in the subject is
equivalent to an immune response in a subject vaccinated with a
traditional vaccine at 100 times to 1000 times the dosage level
relative to the hMPV/hPIV3 RNA vaccine.
[0378] In other embodiments, the immune response is assessed by
determining [protein] antibody titer in the subject. In other
embodiments, the ability of serum or antibody from an immunized
subject is tested for its ability to neutralize viral uptake or
reduce hMPV/hPIV3 transformation of human B lymphocytes. In other
embodiments, the ability to promote a robust T cell response(s) is
measured using art recognized techniques.
[0379] Other aspects the disclosure provide methods of eliciting an
immune response in a subject against a hMPV/hPIV3 by administering
to the subject a hMPV/hPIV3 RNA vaccine comprising at least one RNA
polynucleotide having an open reading frame encoding at least one
hMPV/hPIV3 antigen, thereby inducing in the subject an immune
response specific to hMPV/hPIV3 antigen, wherein the immune
response in the subject is induced 2 days to 10 weeks earlier
relative to an immune response induced in a subject vaccinated with
a prophylactically effective dose of a traditional vaccine against
the hMPV/hPIV3. In some embodiments, the immune response in the
subject is induced in a subject vaccinated with a prophylactically
effective dose of a traditional vaccine at 2 times to 100 times the
dosage level relative to the RNA vaccine.
[0380] In some embodiments, the immune response in the subject is
induced within 14 days of vaccine administration. In some
embodiments, the immune response in the subject increases (e.g., by
at least 50%) over the course of 14 to 27 days, 14 to 56 days, or
27 to 56 days following vaccination.
[0381] In some embodiments, the immune response in the subject is
induced 2 days, 3 days, 1 week, 2 weeks, 3 weeks, 5 weeks, or 10
weeks earlier relative to an immune response induced in a subject
vaccinated with a prophylactically effective dose of a traditional
vaccine.
[0382] Also provided herein are methods of eliciting an immune
response in a subject against a hMPV/hPIV3 by administering to the
subject a hMPV/hPIV3 RNA vaccine having an open reading frame
encoding a first antigen, wherein the RNA polynucleotide does not
include a stabilization element, and wherein an adjuvant is not
co-formulated or co-administered with the vaccine.
[0383] hMPV/hPIV3 RNA (e.g., mRNA) vaccines may be administered by
any route which results in a therapeutically effective outcome.
These include, but are not limited, to intradermal, intramuscular,
intranasal, and/or subcutaneous administration. The present
disclosure provides methods comprising administering RNA vaccines
to a subject in need thereof. The exact amount required will vary
from subject to subject, depending on the species, age, and general
condition of the subject, the severity of the disease, the
particular composition, its mode of administration, its mode of
activity, and the like. hMPV/hPIV3 RNA (e.g., mRNA) vaccines
compositions are typically formulated in dosage unit form for ease
of administration and uniformity of dosage. It will be understood,
however, that the total daily usage of hMPV/hPIV3 RNA (e.g.,
mRNA)vaccines compositions may be decided by the attending
physician within the scope of sound medical judgment. The specific
therapeutically effective, prophylactically effective, or
appropriate imaging dose level for any particular patient will
depend upon a variety of factors including the disorder being
treated and the severity of the disorder; the activity of the
specific compound employed; the specific composition employed; the
age, body weight, general health, sex and diet of the patient; the
time of administration, route of administration, and rate of
excretion of the specific compound employed; the duration of the
treatment; drugs used in combination or coincidental with the
specific compound employed; and like factors well known in the
medical arts.
[0384] The effective amount of a hMPV/hPIV3 vaccine, as provided
herein, may be as low as 20 .mu.s, administered for example as a
single dose or as two 10 .mu.g doses. In some embodiments, the
effective amount is a total dose of 20 .mu.g-200 .mu.s. For
example, the effective amount may be a total dose of 20 .mu.g, 25
.mu.g, 30 .mu.g, 35 .mu.g, 40 .mu.g, 45 .mu.g, 50 .mu.g, 55 .mu.g,
60 .mu.g, 65 .mu.g, 70 .mu.g, 75 .mu.g, 80 .mu.s, 85 .mu.g, 90
.mu.g, 95 .mu.g, 100 .mu.g, 110 .mu.g, 120 .mu.g, 130 .mu.g, 140
.mu.g, 150 .mu.g, 160 .mu.g, 170 .mu.g, 180 .mu.g, 190 .mu.g or 200
.mu.s. In some embodiments, the effective amount is a total dose of
25 .mu.g-200 .mu.g. In some embodiments, the effective amount is a
total dose of 50 .mu.g-200
[0385] In some embodiments, hMPV/hPIV3 RNA (e.g., mRNA) vaccines
compositions may be administered at dosage levels sufficient to
deliver 0.0001 mg/kg to 100 mg/kg, 0.001 mg/kg to 0.05 mg/kg, 0.005
mg/kg to 0.05 mg/kg, 0.001 mg/kg to 0.005 mg/kg, 0.05 mg/kg to 0.5
mg/kg, 0.01 mg/kg to 50 mg/kg, 0.1 mg/kg to 40 mg/kg, 0.5 mg/kg to
30 mg/kg, 0.01 mg/kg to 10 mg/kg, 0.1 mg/kg to 10 mg/kg, or 1 mg/kg
to 25 mg/kg, of subject body weight per day, one or more times a
day, per week, per month, etc. to obtain the desired therapeutic,
diagnostic, prophylactic, or imaging effect (see e.g., the range of
unit doses described in International Publication No. WO2013078199,
herein incorporated by reference in its entirety). The desired
dosage may be delivered three times a day, two times a day, once a
day, every other day, every third day, every week, every two weeks,
every three weeks, every four weeks, every 2 months, every three
months, every 6 months, etc. In certain embodiments, the desired
dosage may be delivered using multiple administrations (e.g., two,
three, four, five, six, seven, eight, nine, ten, eleven, twelve,
thirteen, fourteen, or more administrations). When multiple
administrations are employed, split dosing regimens such as those
described herein may be used. In exemplary embodiments, hMPV/hPIV3
RNA (e.g., mRNA) vaccines compositions may be administered at
dosage levels sufficient to deliver 0.0005 mg/kg to 0.01 mg/kg,
e.g., about 0.0005 mg/kg to about 0.0075 mg/kg, e.g., about 0.0005
mg/kg, about 0.001 mg/kg, about 0.002 mg/kg, about 0.003 mg/kg,
about 0.004 mg/kg or about 0.005 mg/kg.
[0386] In some embodiments, hMPV/hPIV3 RNA (e.g., mRNA) vaccine
compositions may be administered once or twice (or more) at dosage
levels sufficient to deliver 0.025 mg/kg to 0.250 mg/kg, 0.025
mg/kg to 0.500 mg/kg, 0.025 mg/kg to 0.750 mg/kg, or 0.025 mg/kg to
1.0 mg/kg.
[0387] In some embodiments, hMPV/hPIV3 RNA (e.g., mRNA) vaccine
compositions may be administered twice (e.g., Day 0 and Day 7, Day
0 and Day 14, Day 0 and Day 21, Day 0 and Day 28, Day 0 and Day 60,
Day 0 and Day 90, Day 0 and Day 120, Day 0 and Day 150, Day 0 and
Day 180, Day 0 and 3 months later, Day 0 and 6 months later, Day 0
and 9 months later, Day 0 and 12 months later, Day 0 and 18 months
later, Day 0 and 2 years later, Day 0 and 5 years later, or Day 0
and 10 years later) at a total dose of or at dosage levels
sufficient to deliver a total dose of 0.0100 mg, 0.025 mg, 0.050
mg, 0.075 mg, 0.100 mg, 0.125 mg, 0.150 mg, 0.175 mg, 0.200 mg,
0.225 mg, 0.250 mg, 0.275 mg, 0.300 mg, 0.325 mg, 0.350 mg, 0.375
mg, 0.400 mg, 0.425 mg, 0.450 mg, 0.475 mg, 0.500 mg, 0.525 mg,
0.550 mg, 0.575 mg, 0.600 mg, 0.625 mg, 0.650 mg, 0.675 mg, 0.700
mg, 0.725 mg, 0.750 mg, 0.775 mg, 0.800 mg, 0.825 mg, 0.850 mg,
0.875 mg, 0.900 mg, 0.925 mg, 0.950 mg, 0.975 mg, or 1.0 mg. Higher
and lower dosages and frequency of administration are encompassed
by the present disclosure. For example, a hMPV/hPIV3 RNA (e.g.,
mRNA) vaccine composition may be administered three or four
times.
[0388] In some embodiments, hMPV/hPIV3 RNA (e.g., mRNA) vaccine
compositions may be administered twice (e.g., Day 0 and Day 7, Day
0 and Day 14, Day 0 and Day 21, Day 0 and Day 28, Day 0 and Day 60,
Day 0 and Day 90, Day 0 and Day 120, Day 0 and Day 150, Day 0 and
Day 180, Day 0 and 3 months later, Day 0 and 6 months later, Day 0
and 9 months later, Day 0 and 12 months later, Day 0 and 18 months
later, Day 0 and 2 years later, Day 0 and 5 years later, or Day 0
and 10 years later) at a total dose of or at dosage levels
sufficient to deliver a total dose of 0.010 mg, 0.025 mg, 0.100 mg
or 0.400 mg.
[0389] In some embodiments, the hMPV/hPIV3 RNA (e.g., mRNA) vaccine
for use in a method of vaccinating a subject is administered the
subject a single dosage of between 10 .mu.g/kg and 400 .mu.g/kg of
the nucleic acid vaccine in an effective amount to vaccinate the
subject. In some embodiments, the RNA vaccine for use in a method
of vaccinating a subject is administered the subject a single
dosage of between 10 .mu.g and 400 .mu.g of the nucleic acid
vaccine in an effective amount to vaccinate the subject. In some
embodiments, a hMPV/hPIV3 RNA (e.g., mRNA) vaccine for use in a
method of vaccinating a subject is administered to the subject as a
single dosage of 25-1000 .mu.g (e.g., a single dosage of mRNA
encoding a hMPV/hPIV3 antigen). In some embodiments, a hMPV/hPIV3
RNA vaccine is administered to the subject as a single dosage of
25, 50, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650,
700, 750, 800, 850, 900, 950 or 1000 .mu.g. For example, a
hMPV/hPIV3 RNA vaccine may be administered to a subject as a single
dose of 25-100, 25-500, 50-100, 50-500, 50-1000, 100-500, 100-1000,
250-500, 250-1000, or 500-1000 .mu.s. In some embodiments, a
hMPV/hPIV3 RNA (e.g., mRNA) vaccine for use in a method of
vaccinating a subject is administered to the subject as two
dosages, the combination of which equals 25-1000 .mu.g of the
hMPV/hPIV3 RNA (e.g., mRNA) vaccine.
[0390] A hMPV/hPIV3 RNA (e.g., mRNA) vaccine pharmaceutical
composition described herein can be formulated into a dosage form
described herein, such as an intranasal, intratracheal, or
injectable (e.g., intravenous, intraocular, intravitreal,
intramuscular, intradermal, intracardiac, intraperitoneal, and
subcutaneous).
Methods of Treatment
[0391] Provided herein are compositions (e.g., pharmaceutical
compositions), methods, kits and reagents for prevention and/or
treatment of hMPV and/or hPIV3 infections. The RNA (e.g. mRNA)
vaccines can be used as therapeutic or prophylactic agents, alone
or in combination with other vaccine(s). They may be used in
medicine to prevent and/or treat respiratory disease/infection
(e.g., lower respiratory hMPV/hPIV3 infection). In some
embodiments, the RNA (e.g., mRNA) vaccines of the present
disclosure are used to provide prophylactic protection from hMPV
and/or hPIV3. Prophylactic protection can be achieved following
administration of a RNA (e.g., mRNA) vaccine of the present
disclosure. RNA (e.g., mRNA) vaccines of the present disclosure may
be used to treat or prevent viral "co-infections" containing two or
more respiratory infections. Vaccines can be administered once,
twice, three times, four times or more, but it is likely sufficient
to administer the vaccine once (optionally followed by a single
booster). It is possible, although less desirable, to administer
the vaccine to an infected individual to achieve a therapeutic
response. Dosing may need to be adjusted accordingly.
[0392] A method of eliciting an immune response in a subject
against hMPV/hPIV3 is provided in aspects of the present
disclosure. The method involves administering to the subject an
effective amount of a RNA (e.g., mRNA) vaccine described herein, to
thereby inducing in the subject an immune response specific to hMPV
and/or hPIV3, wherein antibody titer of antibodies against hMPV
and/or hPIV3 in the subject is increased following vaccination
relative to antibody titer in a subject vaccinated with a
prophylactically effective dose of a traditional vaccine against
hMPV and/or hPIV3.
[0393] In some embodiments, a RNA (e.g., mRNA) vaccine (e.g., a
hMPV/hPIV3 RNA vaccine) capable of eliciting an immune response is
administered intramuscularly via a composition including a compound
according to Formula (I), (IA), (II), (IIa), (IIb), (IIc), (IId) or
(IIe) (e.g., Compound 3, 18, 20, 25, 26, 29, 30, 60, 108-112, or
122).
[0394] A prophylactically effective dose is a therapeutically
effective dose that prevents infection with the virus at a
clinically acceptable level. In some embodiments the
therapeutically effective dose is a dose listed in a package insert
for the vaccine. A traditional vaccine, as used herein, refers to a
vaccine other than the RNA (e.g., mRNA) vaccines of the present
disclosure. For instance, a traditional vaccine includes but is not
limited to live/attenuated microorganism vaccines,
killed/inactivated microorganism vaccines, subunit vaccines,
protein antigen vaccines, DNA vaccines, VLP vaccines, etc. In
exemplary embodiments, a traditional vaccine is a vaccine that has
achieved regulatory approval and/or is registered by a national
drug regulatory body, for example the Food and Drug Administration
(FDA) in the United States or the European Medicines Agency
(EMA).
[0395] In some embodiments the anti-hMPV F protein and/or anti-hPIV
F protein antibody titer in the subject is increased 1 log to 10
log following vaccination relative to anti-hMPV F protein and/or
anti-hPIV F protein antibody titer in a subject vaccinated with a
prophylactically effective dose of a traditional vaccine against
hMPV and/or hPIV3.
[0396] In some embodiments the anti-hMPV F protein and/or anti-hPIV
F protein antibody titer in the subject is increased 1 log, 2 log,
3 log, 5 log or 10 log following vaccination relative to anti-hMPV
F protein and/or anti-hPIV F protein antibody titer in a subject
vaccinated with a prophylactically effective dose of a traditional
vaccine against hMPV and/or hPIV3.
[0397] A method of eliciting an immune response in a subject
against hMPV and/or hPIV3 is provided in other aspects of the
disclosure. The method involves administering to the subject an
effective amount of a RNA (e.g., mRNA) vaccine described herein, to
thereby inducing in the subject an immune response specific to hMPV
and/or hPIV3, wherein the immune response in the subject is
equivalent to an immune response in a subject vaccinated with a
traditional vaccine against the hMPV and/or hPIV3 at 2 times to 100
times the dosage level relative to the RNA (e.g., mRNA)
vaccine.
[0398] In some embodiments, the immune response in the subject is
equivalent to an immune response in a subject vaccinated with a
traditional vaccine at 2, 3, 4, 5, 10, 50, 100 times the dosage
level relative to the hMPV and/or hPIV3RNA (e.g., mRNA) vaccine. In
some embodiments the immune response in the subject is equivalent
to an immune response in a subject vaccinated with a traditional
vaccine at 10-100 times, or 100-1000 times, the dosage level
relative to the hMPV and/or hPIV3RNA (e.g., mRNA) vaccine. In some
embodiments the immune response is assessed by determining
[protein] antibody titer in the subject.
[0399] In some embodiments, the immune response in the subject is
induced 2 days earlier, or 3 days earlier, relative to an immune
response induced in a subject vaccinated with a prophylactically
effective dose of a traditional vaccine. In some embodiments the
immune response in the subject is induced 1 week, 2 weeks, 3 weeks,
5 weeks, or 10 weeks earlier relative to an immune response induced
in a subject vaccinated with a prophylactically effective dose of a
traditional vaccine.
Therapeutic and Prophylactic Compositions
[0400] Provided herein are compositions (e.g., pharmaceutical
compositions), methods, kits and reagents for prevention, treatment
or diagnosis of hMPV and/or hPIV3 in humans and other mammals, for
example. The RNA (e.g. mRNA) vaccines can be used as therapeutic or
prophylactic agents. They may be used in medicine to prevent and/or
treat infectious disease. In some embodiments, the respiratory RNA
(e.g., mRNA) vaccines of the present disclosure are used fin the
priming of immune effector cells, for example, to activate
peripheral blood mononuclear cells (PBMCs) ex vivo, which are then
infused (re-infused) into a subject.
[0401] In some embodiments, a RNA vaccine containing RNA (e.g.,
mRNA) polynucleotides as described herein can be administered to a
subject (e.g., a mammalian subject, such as a human subject), and
the RNA (e.g., mRNA) polynucleotides are translated in vivo to
produce hMPV and/or hPIV3 F protein.
[0402] hMPV/hPIV3RNA (e.g., mRNA) vaccines may be induced for
translation of a polypeptide (e.g., antigen or immunogen) in a
cell, tissue or organism. In some embodiments, such translation
occurs in vivo, although such translation may occur ex vivo, in
culture or in vitro. In some embodiments, the cell, tissue or
organism is contacted with an effective amount of a composition
containing a RNA (e.g., mRNA) vaccine that contains a
polynucleotide that has at least one a translatable region encoding
an antigenic polypeptide (e.g., hMPV F protein and/or hPIV3 F
protein).
[0403] An "effective amount" of an RNA (e.g. mRNA) vaccine is
provided based, at least in part, on the target tissue, target cell
type, means of administration, physical characteristics of the
polynucleotide (e.g., size, and extent of modified nucleosides) and
other components of the vaccine, and other determinants. In
general, an effective amount of the RNA (e.g., mRNA) vaccine
composition provides an induced or boosted immune response as a
function of antigen production in the cell, preferably more
efficient than a composition containing a corresponding unmodified
polynucleotide encoding the same antigen or a peptide antigen.
Increased antigen production may be demonstrated by increased cell
transfection (the percentage of cells transfected with the RNA,
e.g., mRNA, vaccine), increased protein translation from the
polynucleotide, decreased nucleic acid degradation (as
demonstrated, for example, by increased duration of protein
translation from a modified polynucleotide), or altered antigen
specific immune response of the host cell. In some embodiments, RNA
(e.g. mRNA) vaccines (including polynucleotides their encoded
polypeptides) in accordance with the present disclosure may be used
for treatment of hMPV and/or hPIV3.
[0404] RNA (e.g. mRNA) vaccines may be administered
prophylactically or therapeutically as part of an active
immunization scheme to healthy individuals or early in infection
during the incubation phase or during active infection after onset
of symptoms.
[0405] In some embodiments, a subject is an elderly human subject
(e.g., an individual that is at least 65 years of age). For
example, an elderly human subject may be 65, 66, 67, 68, 70, 71,
72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88,
89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 years of age or
older.
[0406] In some embodiments, a subject is a child (e.g., an
individual that is 5 years of age or younger. For example, a
subject that is a child may be 5, 4, 3, 2, 1 years of age or
younger. In some embodiments, a subject that is a child may be 6-12
months of age. For example, a subject that is a child may be 6-7,
6-8, 6-9, 6-10, 6-11, 6-12, 7-8, 7-9, 7-10, 7-11, 7-12, 8-9, 8-10,
8-11, 8-12, 9-10, 9-11, 9-12, 10-11, 10-12, or 11-12 months of age.
In some embodiments, a subject that is a child may be 6 months, 7
months, 8 months, 9 months, 10 months, 11 months, or 12 months of
age.
[0407] In some embodiments, the RNA (e.g. mRNA) vaccines described
herein are used for preventing a lower respiratory hMPV and/or
hPIV3 infection in a subject having a pulmonary condition. A
"pulmonary condition," as used herein, encompasses any condition
that is associated with or results in impaired or reduce pulmonary
function. In some embodiments, the pulmonary condition is
associated with Chronic Obstructive Pulmonary Disease (COPD),
asthma, congestive heart failure, diabetes, and any combination
thereof. In some embodiments, the respiratory RNA (e.g. mRNA)
vaccines described herein are used for preventing a lower
respiratory hMPV and/or hPIV3 infection in a immunocompromised
subject (e.g., an AIDS patient or a transplant recipient).
[0408] In some embodiments, the amount of RNA (e.g., mRNA) vaccine
of the present disclosure provided to a cell, a tissue or a subject
may be an amount effective for immune prophylaxis.
[0409] RNA (e.g. mRNA) vaccines may be administrated with other
prophylactic or therapeutic compounds. As a non-limiting example, a
prophylactic or therapeutic compound may be an adjuvant or a
booster. As used herein, when referring to a prophylactic
composition, such as a vaccine, the term "booster" refers to an
extra administration of the prophylactic (vaccine) composition. A
booster (or booster vaccine) may be given after an earlier
administration of the prophylactic composition. The time of
administration between the initial administration of the
prophylactic composition and the booster may be, but is not limited
to, 1 minute, 2 minutes, 3 minutes, 4 minutes, 5 minutes, 6
minutes, 7 minutes, 8 minutes, 9 minutes, 10 minutes, 15 minutes,
20 minutes 35 minutes, 40 minutes, 45 minutes, 50 minutes, 55
minutes, 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7
hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14
hours, 15 hours, 16 hours, 17 hours, 18 hours, 19 hours, 20 hours,
21 hours, 22 hours, 23 hours, 1 day, 36 hours, 2 days, 3 days, 4
days, 5 days, 6 days, 1 week, 10 days, 2 weeks, 3 weeks, 1 month, 2
months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months,
9 months, 10 months, 11 months, 1 year, 18 months, 2 years, 3
years, 4 years, 5 years, 6 years, 7 years, 8 years, 9 years, 10
years, 11 years, 12 years, 13 years, 14 years, 15 years, 16 years,
17 years, 18 years, 19 years, 20 years, 25 years, 30 years, 35
years, 40 years, 45 years, 50 years, 55 years, 60 years, 65 years,
70 years, 75 years, 80 years, 85 years, 90 years, 95 years or more
than 99 years. In some embodiments, the time of administration
between the initial administration of the prophylactic composition
and the booster may be, but is not limited to, 1 week, 2 weeks, 3
weeks, 1 month, 2 months, 3 months, 6 months or 1 year.
[0410] In some embodiments, hMPV/hPIV3 RNA (e.g. mRNA) vaccines may
be administered intramuscularly or intradermally, similarly to the
administration of inactivated vaccines known in the art.
[0411] RNA (e.g. mRNA) vaccines may be utilized in various settings
depending on the prevalence of the infection or the degree or level
of unmet medical need. As a non-limiting example, the RNA (e.g.,
mRNA) vaccines may be utilized to treat and/or prevent a variety of
respiratory infections. RNA (e.g., mRNA) vaccines have superior
properties in that they produce much larger antibody titers and
produce responses early than commercially available anti-viral
agents/compositions.
[0412] Provided herein are pharmaceutical compositions including
RNA (e.g. mRNA) vaccines and RNA (e.g. mRNA) vaccine compositions
and/or complexes optionally in combination with one or more
pharmaceutically acceptable excipients.
[0413] RNA (e.g. mRNA) vaccines may be formulated or administered
alone or in conjunction with one or more other components. For
instance, hMPV/hPIV3 RNA (e.g., mRNA) vaccines (vaccine
compositions) may comprise other components including, but not
limited to, adjuvants.
[0414] In some embodiments, RNA (e.g. mRNA) vaccines do not include
an adjuvant (they are adjuvant free).
[0415] RNA (e.g. mRNA) vaccines may be formulated or administered
in combination with one or more pharmaceutically-acceptable
excipients. In some embodiments, vaccine compositions comprise at
least one additional active substances, such as, for example, a
therapeutically-active substance, a prophylactically-active
substance, or a combination of both. Vaccine compositions may be
sterile, pyrogen-free or both sterile and pyrogen-free. General
considerations in the formulation and/or manufacture of
pharmaceutical agents, such as vaccine compositions, may be found,
for example, in Remington: The Science and Practice of Pharmacy
21st ed., Lippincott Williams & Wilkins, 2005 (incorporated
herein by reference in its entirety).
[0416] In some embodiments, hMPV/hPIV3 RNA (e.g. mRNA) vaccines are
administered to humans, human patients or subjects. For the
purposes of the present disclosure, the phrase "active ingredient"
generally refers to the RNA (e.g., mRNA) vaccines or the
polynucleotides contained therein, for example, RNA polynucleotides
(e.g., mRNA polynucleotides) encoding antigenic polypeptides (e.g.,
F proteins).
[0417] Formulations of the RNA vaccine compositions described
herein may be prepared by any method known or hereafter developed
in the art of pharmacology. In general, such preparatory methods
include the step of bringing the active ingredient (e.g., mRNA
polynucleotide) into association with an excipient and/or one or
more other accessory ingredients, and then, if necessary and/or
desirable, dividing, shaping and/or packaging the product into a
desired single- or multi-dose unit.
[0418] Relative amounts of the active ingredient, the
pharmaceutically acceptable excipient, and/or any additional
ingredients in a pharmaceutical composition in accordance with the
disclosure will vary, depending upon the identity, size, and/or
condition of the subject treated and further depending upon the
route by which the composition is to be administered. By way of
example, the composition may comprise between 0.1% and 100%, e.g.,
between 0.5 and 50%, between 1-30%, between 5-80%, at least 80%
(w/w) active ingredient.
[0419] RNA (e.g. mRNA) vaccines can be formulated using one or more
excipients to: (1) increase stability; (2) increase cell
transfection; (3) permit the sustained or delayed release (e.g.,
from a depot formulation); (4) alter the biodistribution (e.g.,
target to specific tissues or cell types); (5) increase the
translation of encoded protein in vivo; and/or (6) alter the
release profile of encoded protein (antigen) in vivo. In addition
to traditional excipients such as any and all solvents, dispersion
media, diluents, or other liquid vehicles, dispersion or suspension
aids, surface active agents, isotonic agents, thickening or
emulsifying agents, preservatives, excipients can include, without
limitation, lipidoids, liposomes, lipid nanoparticles, polymers,
lipoplexes, core-shell nanoparticles, peptides, proteins, cells
transfected with RNA (e.g. mRNA)vaccines (e.g., for transplantation
into a subject), hyaluronidase, nanoparticle mimics and
combinations thereof.
Modes of Vaccine Administration
[0420] The hMPV/hPIV3 RNA (e.g. mRNA) vaccines described herein may
be administered by any route which results in a therapeutically
effective outcome. These include, but are not limited, to
intradermal, intramuscular, and/or subcutaneous administration. A
RNA (e.g. mRNA) vaccine pharmaceutical composition described herein
can be formulated into a dosage form described herein, such as an
intranasal, intratracheal, or injectable (e.g., intravenous,
intraocular, intravitreal, intramuscular, intradermal,
intracardiac, intraperitoneal, and subcutaneous).
[0421] The present disclosure provides methods comprising
administering RNA (e.g., mRNA) vaccines to a subject in need
thereof. The exact amount required will vary from subject to
subject, depending on the species, age, and general condition of
the subject, the severity of the disease, the particular
composition, its mode of administration, its mode of activity, and
the like. RNA (e.g., mRNA) vaccines compositions are typically
formulated in dosage unit form for ease of administration and
uniformity of dosage. It will be understood, however, that the
total daily usage of RNA (e.g., mRNA) vaccine compositions may be
decided by the attending physician within the scope of sound
medical judgment. The specific therapeutically effective,
prophylactically effective, or appropriate imaging dose level for
any particular patient will depend upon a variety of factors
including the disorder being treated and the severity of the
disorder; the activity of the specific compound employed; the
specific composition employed; the age, body weight, general
health, sex and diet of the patient; the time of administration,
route of administration, and rate of excretion of the specific
compound employed; the duration of the treatment; drugs used in
combination or coincidental with the specific compound employed;
and like factors well known in the medical arts.
[0422] In some embodiments, RNA (e.g. mRNA) vaccine compositions
may be administered at dosage levels sufficient to deliver 0.0001
mg/kg to 100 mg/kg, 0.001 mg/kg to 0.05 mg/kg, 0.005 mg/kg to 0.05
mg/kg, 0.001 mg/kg to 0.005 mg/kg, 0.05 mg/kg to 0.5 mg/kg, 0.01
mg/kg to 50 mg/kg, 0.1 mg/kg to 40 mg/kg, 0.5 mg/kg to 30 mg/kg,
0.01 mg/kg to 10 mg/kg, 0.1 mg/kg to 10 mg/kg, or 1 mg/kg to 25
mg/kg, of subject body weight per day, one or more times a day, per
week, per month, etc. to obtain the desired therapeutic,
diagnostic, prophylactic, or imaging effect (see, e.g., the range
of unit doses described in International Publication No
WO2013078199, the contents of which are herein incorporated by
reference in their entirety). The desired dosage may be delivered
three times a day, two times a day, once a day, every other day,
every third day, every week, every two weeks, every three weeks,
every four weeks, every 2 months, every three months, every 6
months, etc. In some embodiments, the desired dosage may be
delivered using multiple administrations (e.g., two, three, four,
five, six, seven, eight, nine, ten, eleven, twelve, thirteen,
fourteen, or more administrations). When multiple administrations
are employed, split dosing regimens such as those described herein
may be used. In exemplary embodiments, RNA (e.g., mRNA) vaccines
compositions may be administered at dosage levels sufficient to
deliver 0.0005 mg/kg to 0.01 mg/kg, e.g., about 0.0005 mg/kg to
about 0.0075 mg/kg, e.g., about 0.0005 mg/kg, about 0.001 mg/kg,
about 0.002 mg/kg, about 0.003 mg/kg, about 0.004 mg/kg or about
0.005 mg/kg.
[0423] In some embodiments, RNA (e.g., mRNA) vaccine compositions
may be administered once or twice (or more) at dosage levels
sufficient to deliver 0.025 mg/kg to 0.250 mg/kg, 0.025 mg/kg to
0.500 mg/kg, 0.025 mg/kg to 0.750 mg/kg, or 0.025 mg/kg to 1.0
mg/kg.
[0424] In some embodiments, RNA (e.g., mRNA) vaccine compositions
may be administered twice (e.g., Day 0 and Day 7, Day 0 and Day 14,
Day 0 and Day 21, Day 0 and Day 28, Day 0 and Day 60, Day 0 and Day
90, Day 0 and Day 120, Day 0 and Day 150, Day 0 and Day 180, Day 0
and 3 months later, Day 0 and 6 months later, Day 0 and 9 months
later, Day 0 and 12 months later, Day 0 and 18 months later, Day 0
and 2 years later, Day 0 and 5 years later, or Day 0 and 10 years
later) at a total dose of or at dosage levels sufficient to deliver
a total dose of 0.0100 mg, 0.025 mg, 0.050 mg, 0.075 mg, 0.100 mg,
0.125 mg, 0.150 mg, 0.175 mg, 0.200 mg, 0.225 mg, 0.250 mg, 0.275
mg, 0.300 mg, 0.325 mg, 0.350 mg, 0.375 mg, 0.400 mg, 0.425 mg,
0.450 mg, 0.475 mg, 0.500 mg, 0.525 mg, 0.550 mg, 0.575 mg, 0.600
mg, 0.625 mg, 0.650 mg, 0.675 mg, 0.700 mg, 0.725 mg, 0.750 mg,
0.775 mg, 0.800 mg, 0.825 mg, 0.850 mg, 0.875 mg, 0.900 mg, 0.925
mg, 0.950 mg, 0.975 mg, or 1.0 mg. Higher and lower dosages and
frequency of administration are encompassed by the present
disclosure. For example, a RNA (e.g., mRNA) vaccine composition may
be administered three or four times.
[0425] In some embodiments, hMPV/hPIV3 RNA (e.g., mRNA) vaccine
compositions may be administered twice (e.g., Day 0 and Day 7, Day
0 and Day 14, Day 0 and Day 21, Day 0 and Day 28, Day 0 and Day 60,
Day 0 and Day 90, Day 0 and Day 120, Day 0 and Day 150, Day 0 and
Day 180, Day 0 and 3 months later, Day 0 and 6 months later, Day 0
and 9 months later, Day 0 and 12 months later, Day 0 and 18 months
later, Day 0 and 2 years later, Day 0 and 5 years later, or Day 0
and 10 years later) at a total dose of or at dosage levels
sufficient to deliver a total dose of 0.010 mg, 0.025 mg, 0.100 mg
or 0.400 mg.
[0426] In some embodiments, the hMPV/hPIV3 RNA (e.g., mRNA) vaccine
for use in a method of vaccinating a subject is administered to the
subject as a single dosage of between 10 .mu.g/kg and 400 .mu.g/kg
of the nucleic acid vaccine (in an effective amount to vaccinate
the subject). In some embodiments the RNA (e.g., mRNA) vaccine for
use in a method of vaccinating a subject is administered to the
subject as a single dosage of between 10 .mu.g and 400 .mu.g of the
nucleic acid vaccine (in an effective amount to vaccinate the
subject).
[0427] In some embodiments, a hMPV/hPIV3 RNA (e.g., mRNA) vaccine
for use in a method of vaccinating a subject is administered to the
subject as a single dosage of 2-1000 .mu.g (e.g., a single dosage
of mRNA encoding hMPV, hPIV3, and/or RSV antigen). In some
embodiments, a RNA (e.g., mRNA) vaccine for use in a method of
vaccinating a subject is administered to the subject as a single
dosage of 5-100 .mu.g (e.g., a single dosage of mRNA encoding hMPV
and/or hPIV3 F protein). In some embodiments, a RNA (e.g., mRNA)
vaccine is administered to the subject as a single dosage of 2, 5,
10, 15, 20 25, 50, 100, 150, 200, 250, 300, 350, 400, 450, 500,
550, 600, 650, 700, 750, 800, 850, 900, 950 or 1000 .mu.g. For
example, a RNA (e.g., mRNA) vaccine may be administered to a
subject as a single dose of 5-100, 10-100, 15-100, 20-100, 25-100,
25-500, 50-100, 50-500, 50-1000, 100-500, 100-1000, 250-500,
250-1000, or 500-1000 .mu.g. In some embodiments, a RNA (e.g.,
mRNA) vaccine for use in a method of vaccinating a subject is
administered to the subject as two dosages, the combination of
which equals 10-1000 .mu.g of the RNA (e.g., mRNA) vaccine.
hMPV/hPIV3 RNA (e.g., mRNA) Vaccine Formulations and Methods of
Use
[0428] Some aspects of the present disclosure provide formulations
of a hMPV/hPIV3 RNA (e.g., mRNA) vaccine, wherein the RNA (e.g.,
mRNA) vaccine is formulated in an effective amount to produce an
antigen specific immune response in a subject (e.g., production of
antibodies specific to an hMPV and/or hPIV3 F protein). "An
effective amount" is a dose of an RNA (e.g., mRNA) vaccine
effective to produce an antigen-specific immune response (e.g.,
that results in an ability to clear the virus more rapidly and/or a
reduction in infectious virus in the nasal and/or lung passages
upon exposure to the virus). Also provided herein are methods of
inducing an antigen-specific immune response in a subject.
[0429] In some embodiments, the antigen-specific immune response is
characterized by measuring an anti-hMPV and/or anti-PIV3 F protein
antibody titer produced in a subject administered a RNA (e.g.,
mRNA) vaccine as provided herein. An antibody titer is a
measurement of the amount of antibodies within a subject, for
example, antibodies that are specific to a particular antigen
(e.g., an anti-hMPV and/or anti-PIV3 F protein) or epitope of an
antigen. Antibody titer is typically expressed as the inverse of
the greatest dilution that provides a positive result.
Enzyme-linked immunosorbent assay (ELISA) is a common assay for
determining antibody titers, for example.
[0430] In some embodiments, an antibody titer is used to assess
whether a subject has had an infection or to determine whether
immunizations are required. In some embodiments, an antibody titer
is used to determine the strength of an autoimmune response, to
determine whether a booster immunization is needed, to determine
whether a previous vaccine was effective, and to identify any
recent or prior infections. In accordance with the present
disclosure, an antibody titer may be used to determine the strength
of an immune response induced in a subject by the RNA (e.g., mRNA)
vaccine.
[0431] In some embodiments, an antibody induced by a RNA (e.g.,
mRNA) vaccine is a neutralizing antibody against the hMPV and/or
hPIV3. A neutralizing titer is produced by neutralizing antibody
against hMPV/PIV3 F protein as measured in serum of the subject. In
some embodiments, an effective dose of the hMPV/PIV3 RNA (e.g.,
mRNA) vaccine is sufficient to produce more than a 500
neutralization titer. For example, an effective dose of the
hMPV/PIV3 RNA (e.g., mRNA) vaccine is sufficient to produce a
1000-10,000 neutralization titer. In some embodiments, an effective
dose of the hMPV/PIV3 RNA (e.g., mRNA) vaccine is sufficient to
produce a 1000-2000, 1000-3000, 1000-4000, 1000-5000, 1000-6000,
1000-7000, 1000-8000, 1000-9000, 1000-10,000, 2000-3000, 2000-4000,
2000-5000, 2000-6000, 2000-7000, 2000-8000, 2000-9000, 2000-10,000,
3000-4000, 3000-5000, 3000-6000, 3000-7000, 3000-8000, 3000-9000,
3000-10,000, 4000-5000, 4000-6000, 4000-7000, 4000-8000, 4000-9000,
4000-10,000, 5000-6000, 5000-7000, 5000-8000, 5000-9000;
5000-10,000, 6000-7000, 6000-8000, 6000-9000, 6000-10,000,
7000-8000, 7000-9000, 7000-10,000, 8000-9000, 8000-10,000, or a
9000-10,000 neutralization titer. In some embodiments, an effective
dose of the hMPV/PIV3 RNA (e.g., mRNA) vaccine is sufficient to
produce a 500, 1000, 1500, 2000, 2500, 3000, 3500, 4000, 4500,
5000, 5500, 6000, 6500, 7000, 7500, 8000, 8500, 9000, 9500, 10,000,
11000, 12,000, 13,000, 14,000, 15,000, 16,000, 17,000, 18,000,
19000, 20,000 or higher neutralizing titer. In some embodiments,
neutralizing titer is produced 1-72 hours post administration. For
example, neutralizing titers may be produced 1-10, 1-20, 1-30,
1-40, 1-50, 1-60, 1-70, 1-72, 10-20, 10-30, 10-40, 10-50, 10-60,
10-70, 10-72, 20-30, 20-40, 20-50, 20-60, 20-70, 20-72, 30-40,
30-50, 30-60, 30-70, 30-72, 40-50, 40-60, 40-70, 40-72, 50-60,
50-70, 50-72, 60-70, 60-72, or 70-72 hours post administration. In
some embodiments, neutralizing titers may be produced 1, 2, 3, 4,
5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22,
23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39,
40, 41, 42, 43, 44, 45, 56, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56,
57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, or 72
hours post administration. In some embodiments, neutralizing titer
is produced within 14 days of vaccine administration. In some
embodiments, neutralizing titer is produced within 5, 6, 7, 8, 9,
10, 11, 12, 13, or 14 days of vaccine administration.
[0432] In some embodiments, an effective dose of the hMPV/PIV3 RNA
(e.g., mRNA) vaccine is comparable to the dose of the vaccine
required to produce, in a cotton rat model or an African Green
Monkey model, a neutralization titer of at least 6, at least 7, at
least 8, or at least 9 on a log 2 based scale, as measured by 60%
plaque reduction neutralization test (PRNT). In some embodiments,
an effective dose of the hMPV/PIV3 RNA (e.g., mRNA) vaccine is
comparable to the dose of the vaccine required to produce, in a
cotton rat model or an African Green Monkey model, a neutralization
titer of 6, 7, 8, 9, 10, 11 or 12 on a log2 based scale, as
measured by 60% plaque reduction neutralization test (PRNT). In
some embodiments, an effective dose of the hMPV/PIV3 RNA (e.g.,
mRNA) vaccine is comparable to the dose of the vaccine required to
produce, in a cotton rat model or an African Green Monkey model, a
neutralization titer of 6-12, 7-12, 8-12, or 9-12 on a log2 based
scale, as measured by 60% plaque reduction neutralization test
(PRNT). In some embodiments, the high neutralizing antibody titer
is induced within 14 days of vaccine administration. In some
embodiments, the high neutralizing antibody titer is induced within
21 days of vaccine administration. In some embodiments, the high
neutralizing antibody titer is induced within 28 days of vaccine
administration.
[0433] In some embodiments, an anti-hMPV F protein and/or anti-PIV3
F protein antibody titer produced in a subject is increased by at
least 1 log relative to a control. For example, anti-hMPV F protein
and/or anti-PIV3 F protein antibody titer produced in a subject may
be increased by at least 1.5, at least 2, at least 2.5, or at least
3 log relative to a control. In some embodiments, the anti-hMPV F
protein and/or anti-PIV3 F protein polypeptide antibody titer
produced in the subject is increased by 1, 1.5, 2, 2.5 or 3 log
relative to a control. In some embodiments, the anti-hMPV F protein
and/or anti-PIV3 F protein antibody titer produced in the subject
is increased by 1-3 log relative to a control. For example, the
anti-hMPV F protein and/or anti-PIV3 F protein antibody titer
produced in a subject may be increased by 1-1.5, 1-2, 1-2.5, 1-3,
1.5-2, 1.5-2.5, 1.5-3, 2-2.5, 2-3, or 2.5-3 log relative to a
control.
[0434] In some embodiments, the anti-hMPV F protein and/or
anti-PIV3 F protein antibody titer produced in a subject is
increased at least 2 times relative to a control. For example, the
anti-hMPV F protein and/or anti-PIV3 F protein antibody titer
produced in a subject may be increased at least 3 times, at least 4
times, at least 5 times, at least 6 times, at least 7 times, at
least 8 times, at least 9 times, or at least 10 times relative to a
control. In some embodiments, the anti-hMPV F protein and/or
anti-PIV3 F protein antibody titer produced in the subject is
increased 2, 3, 4, 5, 6, 7, 8, 9, or 10 times relative to a
control. In some embodiments, the anti-hMPV F protein and/or
anti-PIV3 F protein antibody titer produced in a subject is
increased 2-10 times relative to a control. For example, the
anti-hMPV F protein and/or anti-PIV3 F protein antibody titer
produced in a subject may be increased 2-10, 2-9, 2-8, 2-7, 2-6,
2-5, 2-4, 2-3, 3-10, 3-9, 3-8, 3-7, 3-6, 3-5, 3-4, 4-10, 4-9, 4-8,
4-7, 4-6, 4-5, 5-10, 5-9, 5-8, 5-7, 5-6, 6-10, 6-9, 6-8, 6-7, 7-10,
7-9, 7-8, 8-10, 8-9, or 9-10 times relative to a control.
[0435] A control, in some embodiments, is the anti-hMPV F protein
and/or anti-PIV3 F protein antibody titer produced in a subject who
has not been administered a RNA (e.g., mRNA) vaccine of the present
disclosure. In some embodiments, a control is an anti-hMPV F
protein and/or anti-PIV3 F protein (antibody titer produced in a
subject who has been administered a live attenuated hMPV and/or
hPIV3 vaccine or an inactivated hMPV and/or hPIV3 vaccine. An
attenuated vaccine is a vaccine produced by reducing the virulence
of a viable (live). An attenuated virus is altered in a manner that
renders it harmless or less virulent relative to live, unmodified
virus. In some embodiments, a control is an anti-hMPV F protein
and/or anti-PIV3 F protein antibody titer produced in a subject
administered inactivated hMPV and/or hPIV3 vaccine. In some
embodiments, a control is anti-hMPV F protein and/or anti-PIV3 F
protein antibody titer produced in a subject administered a
recombinant or purified hMPV and/or hPIV3 protein vaccine.
Recombinant protein vaccines typically include protein antigens
that either have been produced in a heterologous expression system
(e.g., bacteria or yeast) or purified from large amounts of the
pathogenic organism. In some embodiments, a control is an antibody
titer produced in a subject who has been administered an hMPV
and/or hPIV3 virus-like particle (VLP) vaccine. For example, an
hMPV VLP vaccine used as a control may be a hMPV VLPs, comprising
(or consisting of) viral matrix (M) and fusion (F) proteins,
generated by expressing viral proteins in suspension-adapted human
embryonic kidney epithelial (293-F) cells (see, e.g., Cox R G et
al., J Virol. 2014 June; 88(11): 6368-6379, the contents of which
are herein incorporated by reference).
[0436] In some embodiments, an effective amount of a hMPV/hPIV3 RNA
(e.g., mRNA) vaccine is a dose that is reduced compared to the
standard of care dose of a recombinant hMPV and/or hPIV3 protein
vaccine. A "standard of care," as provided herein, refers to a
medical or psychological treatment guideline and can be general or
specific. "Standard of care" specifies appropriate treatment based
on scientific evidence and collaboration between medical
professionals involved in the treatment of a given condition. It is
the diagnostic and treatment process that a physician/clinician
should follow for a certain type of patient, illness or clinical
circumstance. A "standard of care dose," as provided herein, refers
to the dose of a recombinant or purified hMPV and/or hPIV3 protein
vaccine, or a live attenuated or inactivated hMPV and/or hPIV3
vaccine, that a physician/clinician or other medical professional
would administer to a subject to treat or prevent hMPV and/or
hPIV3, or a hMPV- and/or hPIV3-related condition, while following
the standard of care guideline for treating or preventing hMPV
and/or hPIV3, or a hMPV- and/or hPIV3-related condition.
[0437] In some embodiments, the an anti-hMPV F protein and/or
anti-PIV3 F protein antibody titer produced in a subject
administered an effective amount of a RNA (e.g., mRNA) vaccine is
equivalent to an anti-hMPV F protein and/or anti-PIV3 F protein
antibody titer produced in a control subject administered a
standard of care dose of a recombinant or purified hMPV and/or
hPIV3 protein vaccine or a live attenuated or inactivated hMPV
and/or hPIV3 vaccine.
[0438] In some embodiments, an effective amount of a RNA (e.g.,
mRNA) vaccine is a dose equivalent to an at least 2-fold reduction
in a standard of care dose of a recombinant or purified hMPV and/or
hPIV3 protein vaccine. For example, an effective amount of a RNA
(e.g., mRNA) vaccine may be a dose equivalent to an at least
3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least
7-fold, at least 8-fold, at least 9-fold, or at least 10-fold
reduction in a standard of care dose of a recombinant or purified
hMPV and/or hPIV3 protein vaccine. In some embodiments, an
effective amount of a RNA (e.g., mRNA) vaccine is a dose equivalent
to an at least at least 100-fold, at least 500-fold, or at least
1000-fold reduction in a standard of care dose of a recombinant or
purified hMPV and/or hPIV3 protein vaccine. In some embodiments, an
effective amount of a RNA (e.g., mRNA) vaccine is a dose equivalent
to a 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 20-, 50-, 100-, 250-,
500-, or 1000-fold reduction in a standard of care dose of a
recombinant or purified hMPV and/or hPIV3 protein vaccine. In some
embodiments, the anti-hMPV F protein and/or anti-hPIV F protein
antibody titer produced in a subject administered an effective
amount of a RNA (e.g., mRNA) vaccine is equivalent to an anti-hMPV
F protein and/or anti-hPIV F protein antibody titer produced in a
control subject administered the standard of care dose of a
recombinant or protein hMPV and/or hPIV3, protein vaccine or a live
attenuated or inactivated hMPV and/or hPIV3 vaccine. In some
embodiments, an effective amount of a RNA (e.g., mRNA) vaccine is a
dose equivalent to a 2-fold to 1000-fold (e.g., 2-fold to 100-fold,
10-fold to 1000-fold) reduction in the standard of care dose of a
recombinant or purified hMPV and/or hPIV3 protein vaccine, wherein
the anti-hMPV F protein and/or anti-hPIV F protein antibody titer
produced in the subject is equivalent to an anti-hMPV F protein
and/or anti-hPIV F protein antibody titer produced in a control
subject administered the standard of care dose of a recombinant or
purified hMPV and/or hPIV3 protein vaccine or a live attenuated or
inactivated hMPV and/or hPIV3 vaccine.
[0439] In some embodiments, the effective amount of a hMPV/hPIV3
RNA (e.g., mRNA) vaccine is a dose equivalent to a 2 to 1000-, 2 to
900-, 2 to 800-, 2 to 700-, 2 to 600-, 2 to 500-, 2 to 400-, 2 to
300-, 2 to 200-, 2 to 100-, 2 to 90-, 2 to 80-, 2 to 70-, 2 to 60-,
2 to 50-, 2 to 40-, 2 to 30-, 2 to 20-, 2 to 10-, 2 to 9-, 2 to 8-,
2 to 7-, 2 to 6-, 2 to 5-, 2 to 4-, 2 to 3-, 3 to 1000-, 3 to 900-,
3 to 800-, 3 to 700-, 3 to 600-, 3 to 500-, 3 to 400-, 3 to 3 to
00-, 3 to 200-, 3 to 100-, 3 to 90-, 3 to 80-, 3 to 70-, 3 to 60-,
3 to 50-, 3 to 40-, 3 to 30-, 3 to 20-, 3 to 10-, 3 to 9-, 3 to 8-,
3 to 7-, 3 to 6-, 3 to 5-, 3 to 4-, 4 to 1000-, 4 to 900-, 4 to
800-, 4 to 700-, 4 to 600-, 4 to 500-, 4 to 400-, 4 to 4 to 00-, 4
to 200-, 4 to 100-, 4 to 90-, 4 to 80-, 4 to 70-, 4 to 60-, 4 to
50-, 4 to 40-, 4 to 30-, 4 to 20-, 4 to 10-, 4 to 9-, 4 to 8-, 4 to
7-, 4 to 6-, 4 to 5-, 4 to 4-, 5 to 1000-, 5 to 900-, 5 to 800-, 5
to 700-, 5 to 600-, 5 to 500-, 5 to 400-, 5 to 300-, 5 to 200-, 5
to 100-, 5 to 90-, 5 to 80-, 5 to 70-, 5 to 60-, 5 to 50-, 5 to
40-, 5 to 30-, 5 to 20-, 5 to 10-, 5 to 9-, 5 to 8-, 5 to 7-, 5 to
6-, 6 to 1000-, 6 to 900-, 6 to 800-, 6 to 700-, 6 to 600-, 6 to
500-, 6 to 400-, 6 to 300-, 6 to 200-, 6 to 100-, 6 to 90-, 6 to
80-, 6 to 70-, 6 to 60-, 6 to 50-, 6 to 40-, 6 to 30-, 6 to 20-, 6
to 10-, 6 to 9-, 6 to 8-, 6 to 7-, 7 to 1000-, 7 to 900-, 7 to
800-, 7 to 700-, 7 to 600-, 7 to 500-, 7 to 400-, 7 to 300-, 7 to
200-, 7 to 100-, 7 to 90-, 7 to 80-, 7 to 70-, 7 to 60-, 7 to 50-,
7 to 40-, 7 to 30-, 7 to 20-, 7 to 10-, 7 to 9-, 7 to 8-, 8 to
1000-, 8 to 900-, 8 to 800-, 8 to 700-, 8 to 600-, 8 to 500-, 8 to
400-, 8 to 300-, 8 to 200-, 8 to 100-, 8 to 90-, 8 to 80-, 8 to
70-, 8 to 60-, 8 to 50-, 8 to 40-, 8 to 30-, 8 to 20-, 8 to 10-, 8
to 9-, 9 to 1000-, 9 to 900-, 9 to 800-, 9 to 700-, 9 to 600-, 9 to
500-, 9 to 400-, 9 to 300-, 9 to 200-, 9 to 100-, 9 to 90-, 9 to
80-, 9 to 70-, 9 to 60-, 9 to 50-, 9 to 40-, 9 to 30-, 9 to 20-, 9
to 10-, 10 to 1000-, 10 to 900-, 10 to 800-, 10 to 700-, 10 to
600-, 10 to 500-, 10 to 400-, 10 to 300-, 10 to 200-, 10 to 100-,
10 to 90-, 10 to 80-, 10 to 70-, 10 to 60-, 10 to 50-, 10 to 40-,
10 to 30-, 10 to 20-, 20 to 1000-, 20 to 900-, 20 to 800-, 20 to
700-, 20 to 600-, 20 to 500-, 20 to 400-, 20 to 300-, 20 to 200-,
20 to 100-, 20 to 90-, 20 to 80-, 20 to 70-, 20 to 60-, 20 to 50-,
20 to 40-, 20 to 30-, 30 to 1000-, 30 to 900-, 30 to 800-, 30 to
700-, 30 to 600-, 30 to 500-, 30 to 400-, 30 to 300-, 30 to 200-,
30 to 100-, 30 to 90-, 30 to 80-, 30 to 70-, 30 to 60-, 30 to 50-,
30 to 40-, 40 to 1000-, 40 to 900-, 40 to 800-, 40 to 700-, 40 to
600-, 40 to 500-, 40 to 400-, 40 to 300-, 40 to 200-, 40 to 100-,
40 to 90-, 40 to 80-, 40 to 70-, 40 to 60-, 40 to 50-, 50 to 1000-,
50 to 900-, 50 to 800-, 50 to 700-, 50 to 600-, 50 to 500-, 50 to
400-, 50 to 300-, 50 to 200-, 50 to 100-, 50 to 90-, 50 to 80-, 50
to 70-, 50 to 60-, 60 to 1000-, 60 to 900-, 60 to 800-, 60 to 700-,
60 to 600-, 60 to 500-, 60 to 400-, 60 to 300-, 60 to 200-, 60 to
100-, 60 to 90-, 60 to 80-, 60 to 70-, 70 to 1000-, 70 to 900-, 70
to 800-, 70 to 700-, 70 to 600-, 70 to 500-, 70 to 400-, 70 to
300-, 70 to 200-, 70 to 100-, 70 to 90-, 70 to 80-, 80 to 1000-, 80
to 900-, 80 to 800-, 80 to 700-, 80 to 600-, 80 to 500-, 80 to
400-, 80 to 300-, 80 to 200-, 80 to 100-, 80 to 90-, 90 to 1000-,
90 to 900-, 90 to 800-, 90 to 700-, 90 to 600-, 90 to 500-, 90 to
400-, 90 to 300-, 90 to 200-, 90 to 100-, 100 to 1000-, 100 to
900-, 100 to 800-, 100 to 700-, 100 to 600-, 100 to 500-, 100 to
400-, 100 to 300-, 100 to 200-, 200 to 1000-, 200 to 900-, 200 to
800-, 200 to 700-, 200 to 600-, 200 to 500-, 200 to 400-, 200 to
300-, 300 to 1000-, 300 to 900-, 300 to 800-, 300 to 700-, 300 to
600-, 300 to 500-, 300 to 400-, 400 to 1000-, 400 to 900-, 400 to
800-, 400 to 700-, 400 to 600-, 400 to 500-, 500 to 1000-, 500 to
900-, 500 to 800-, 500 to 700-, 500 to 600-, 600 to 1000-, 600 to
900-, 600 to 800-, 600 to 700-, 700 to 1000-, 700 to 900-, 700 to
800-, 800 to 1000-, 800 to 900-, or 900 to 1000-fold reduction in
the standard of care dose of a recombinant hMPV and/or hPIV3
protein vaccine. In some embodiments, the anti-HMP F protein and/or
anti-hPIV3 F protein antibody titer produced in the subject is
equivalent to an anti-hMPV F protein and/or anti-hPIV F protein
antibody titer produced in a control subject administered the
standard of care dose of a recombinant or purified hMPV and/or
hPIV3 protein vaccine or a live attenuated or inactivated hMPV
and/or hPIV3 vaccine. In some embodiments, the effective amount is
a dose equivalent to (or equivalent to an at least) 2-, 3-, 4-, 5-,
6-, 7-, 8-, 9-, 10-, 20-, 30-, 40-, 50-, 60-, 70-, 80-, 90-, 100-,
110-, 120-, 130-, 140-, 150-, 160-, 170-, 1280-, 190-, 200-, 210-,
220-, 230-, 240-, 250-, 260-, 270-, 280-, 290-, 300-, 310-, 320-,
330-, 340-, 350-, 360-, 370-, 380-, 390-, 400-, 410-, 420-, 430-,
440-, 450-, 4360-, 470-, 480-, 490-, 500-, 510-, 520-, 530-, 540-,
550-, 560-, 5760-, 580-, 590-, 600-, 610-, 620-, 630-, 640-, 650-,
660-, 670-, 680-, 690-, 700-, 710-, 720-, 730-, 740-, 750-, 760-,
770-, 780-, 790-, 800-, 810-, 820-, 830-, 840-, 850-, 860-, 870-,
880-, 890-, 900-, 910-, 920-, 930-, 940-, 950-, 960-, 970-, 980-,
990-, or 1000-fold reduction in the standard of care dose of a
recombinant hMPV and/or hPIV3 protein vaccine. In some embodiments,
an anti-hMPV F protein and/or anti-hPIV3 F protein antibody titer
produced in the subject is equivalent to an an anti-hMPV F protein
and/or anti-hPIV3 F protein antibody titer produced in a control
subject administered the standard of care dose of a recombinant or
purified hMPV and/or hPIV3protein vaccine or a live attenuated or
inactivated hMPV and/or hPIV3 vaccine.
[0440] In some embodiments, the effective amount is 5 .mu.g-100
.mu.g of the RNA polynucleotide encoding hMPV F protein and/or
5-100 .mu.g of the RNA polynucleotide encoding hPIV3 F protein. For
example, the effective amount may be 5-10 .mu.g, 5-20 .mu.g, 5-30
.mu.g, 5-40 .mu.g, 5 .mu.g-50 .mu.g, 5-60 .mu.g, 5 .mu.g-70 .mu.g,
5-80 .mu.g, 5 .mu.g-90 .mu.g, 5 .mu.g-100 .mu.g, 10 .mu.g-20 .mu.g,
10 .mu.g-30 .mu.g, 10 .mu.g-40 .mu.g, 10 .mu.g-50 .mu.g, 10
.mu.g-60 .mu.g, 10 .mu.g-70 .mu.g, 10 .mu.g-80 .mu.g, 10 .mu.g-90
.mu.g, 10 .mu.g-100 .mu.g, 25 .mu.g-30 .mu.g, 25 .mu.g-40 .mu.g, 25
.mu.g-50 .mu.g, 25 .mu.g-60 .mu.g, 25 .mu.g-70 .mu.g, 25 .mu.g-80
.mu.g, 25 .mu.g-90 .mu.g, 25 .mu.g-100 .mu.g, 50 .mu.g-60 .mu.g, 50
.mu.g-70 .mu.g, 50 .mu.g-80 .mu.g, 50 .mu.g-90 .mu.g, or 50
.mu.g-100 .mu.g of the RNA polynucleotide encoding hMPV F protein
and/or 5-10 .mu.s, 5-20 .mu.g, 5-30 .mu.g, 5-40 .mu.g, 5-50 .mu.g,
5 .mu.g-60 .mu.g, 5-70 .mu.g, 5-80 .mu.g, 5-90 .mu.g, 5-100 .mu.g,
10 .mu.g-20 .mu.g, 10 .mu.g-30 .mu.g, 10 .mu.g-40 .mu.g, 10
.mu.g-50 .mu.g, 10 .mu.g-60 .mu.g, 10 .mu.g-70 .mu.g, 10 .mu.g-80
.mu.g, 10 .mu.g-90 .mu.g, 10 .mu.g-100 .mu.g, 25 .mu.g-30 .mu.g, 25
.mu.g-40 .mu.g, 25 .mu.g-50 .mu.g, 25 .mu.g-60 .mu.g, 25 .mu.g-70
.mu.g, 25 .mu.g-80 .mu.g, 25 .mu.g-90 .mu.g, 25 .mu.g-100 .mu.g, 50
.mu.g-60 .mu.g, 50 .mu.g-70 .mu.g, 50 .mu.g-80 .mu.g, 50 .mu.g-90
.mu.g, or 50 .mu.g-100 .mu.g of the RNA polynucleotide encoding
hPIV3 F protein. In some embodiments, the effective amount is 5
.mu.g, 10 .mu.g, 12.5 .mu.g, 20 .mu.g, 25 .mu.g, 30 .mu.g, 40
.mu.g, 50 .mu.g, 60 .mu.g, 70 .mu.g, 80 .mu.g, 90 .mu.g, 100 .mu.g
of the RNA polynucleotide encoding hMPV F protein and/or 5 .mu.g,
10 .mu.g, 12.5 .mu.g, 20 .mu.g, 25 .mu.g, 30 .mu.g, 40 .mu.g, 50
.mu.g, 60 .mu.g, 70 .mu.g, 80 .mu.g, 90 .mu.g, 100 .mu.g of the RNA
polynucleotide encoding hPIV3 F protein. In some embodiments, the
effective amount is 12.5 .mu.g of the RNA polynucleotide encoding
hMPV F protein and/or 12.5 .mu.g of the RNA polynucleotide encoding
hPIV3 F protein. In some embodiments, the effective amount is 25
.mu.g of the RNA polynucleotide encoding hMPV F protein and/or 25
.mu.g of the RNA polynucleotide encoding hPIV3 F protein. In some
embodiments, the effective amount is 50 .mu.g of the RNA
polynucleotide encoding hMPV F protein and/or 50 .mu.g of the RNA
polynucleotide encoding hPIV3 F protein. In some embodiments, the
effective amount is 100 .mu.g of the RNA polynucleotide encoding
hMPV F protein and/or 100 .mu.g of the RNA polynucleotide encoding
hPIV3 F protein.
[0441] In some embodiments, an effective dose of the RNA (e.g.,
mRNA) vaccine described herein is sufficient to produce detectable
levels of F protein as measured in serum of the subject at 1-72
hours post administration. For example, hMPV F protein and/or hPIV3
F protein may be detected at 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20,
25, 30, 35, 40, 45, 50, 55, 60, 65, 70, or 72 hours post
administration. In some embodiments, an effective dose of the RNA
(e.g., mRNA) vaccine described herein is sufficient to produce
detectable levels of F protein as measured in serum of the subject
within 14 days of administration. In some embodiments, the cut off
index of the antigen is 1-2 (e.g., 1, 1.5, or 2). In some
embodiments, wherein the effective dose is sufficient to produce a
1,000-10,000 neutralization titer produced by neutralizing antibody
against hMPV F protein and/or hPIV3 F protein as measured in serum
of the subject at 1-72 hours post administration. In some
embodiments, wherein the effective dose is sufficient to produce a
1,000-10,000 neutralization titer produced by neutralizing antibody
against hMPV F protein and/or hPIV3 F protein as measured in serum
of the subject within 14 days of administration. In some
embodiments, the cut-off index of hMPV F protein and/or hPIV3 F
protein is 1-2.
Vaccine Efficacy
[0442] Some aspects of the present disclosure provide formulations
of the hMPV/hPIV3 RNA (e.g., mRNA) vaccine, wherein the hMPV/hPIV3
RNA vaccine is formulated in an effective amount to produce an
antigen specific immune response in a subject (e.g., production of
antibodies specific to an anti-hMPV/hPIV3 antigen). "An effective
amount" is a dose of a hMPV/hPIV3 RNA (e.g., mRNA) vaccine
effective to produce an antigen-specific immune response. Also
provided herein are methods of inducing an antigen-specific immune
response in a subject.
[0443] As used herein, an immune response to a vaccine or LNP of
the present disclosure is the development in a subject of a humoral
and/or a cellular immune response to a (one or more) hMPV/hPIV3
protein(s) present in the vaccine. For purposes of the present
disclosure, a "humoral" immune response refers to an immune
response mediated by antibody molecules, including, e.g., secretory
(IgA) or IgG molecules, while a "cellular" immune response is one
mediated by T-lymphocytes (e.g., CD4+ helper and/or CD8+ T cells
(e.g., CTLs) and/or other white blood cells. One important aspect
of cellular immunity involves an antigen-specific response by
cytolytic T-cells (CTLs). CTLs have specificity for peptide
antigens that are presented in association with proteins encoded by
the major histocompatibility complex (MHC) and expressed on the
surfaces of cells. CTLs help induce and promote the destruction of
intracellular microbes or the lysis of cells infected with such
microbes. Another aspect of cellular immunity involves and
antigen-specific response by helper T-cells. Helper T-cells act to
help stimulate the function, and focus the activity nonspecific
effector cells against cells displaying peptide antigens in
association with MHC molecules on their surface. A cellular immune
response also leads to the production of cytokines, chemokines, and
other such molecules produced by activated T-cells and/or other
white blood cells including those derived from CD4+ and CD8+
T-cells.
[0444] In some embodiments, the antigen-specific immune response is
characterized by measuring an anti-hMPV/hPIV3 antigen antibody
titer produced in a subject administered a hMPV/hPIV3 RNA (e.g.,
mRNA) vaccine as provided herein. An antibody titer is a
measurement of the amount of antibodies within a subject, for
example, antibodies that are specific to a particular antigen
(e.g., an anti-hMPV/hPIV3 antigen) or epitope of an antigen.
Antibody titer is typically expressed as the inverse of the
greatest dilution that provides a positive result. Enzyme-linked
immunosorbent assay (ELISA) is a common assay for determining
antibody titers, for example.
[0445] In some embodiments, an antibody titer is used to assess
whether a subject has had an infection or to determine whether
immunizations are required. In some embodiments, an antibody titer
is used to determine the strength of an autoimmune response, to
determine whether a booster immunization is needed, to determine
whether a previous vaccine was effective, and to identify any
recent or prior infections. In accordance with the present
disclosure, an antibody titer may be used to determine the strength
of an immune response induced in a subject by the hMPV/hPIV3 RNA
(e.g., mRNA) vaccine.
[0446] In some embodiments, an anti-hMPV/hPIV3 antigen antibody
titer produced in a subject is increased by at least 1 log relative
to a control. For example, anti-hMPV/hPIV3 antigen antibody titer
produced in a subject may be increased by at least 1.5, at least 2,
at least 2.5, or at least 3 log relative to a control. In some
embodiments, the anti-hMPV/hPIV3 antigen antibody titer produced in
the subject is increased by 1, 1.5, 2, 2.5 or 3 log relative to a
control. In some embodiments, the anti-hMPV/hPIV3 antigen antibody
titer produced in the subject is increased by 1-3 log relative to a
control. For example, the anti-hMPV/hPIV3 antigen antibody titer
produced in a subject may be increased by 1-1.5, 1-2, 1-2.5, 1-3,
1.5-2, 1.5-2.5, 1.5-3, 2-2.5, 2-3, or 2.5-3 log relative to a
control.
[0447] In some embodiments, the anti-hMPV/hPIV3 antigen antibody
titer produced in a subject is increased at least 2 times relative
to a control. For example, the anti-hMPV/hPIV3 antigen antibody
titer produced in a subject may be increased at least 3 times, at
least 4 times, at least 5 times, at least 6 times, at least 7
times, at least 8 times, at least 9 times, or at least 10 times
relative to a control. In some embodiments, the anti-hMPV/hPIV3
antigen antibody titer produced in the subject is increased 2, 3,
4, 5, 6, 7, 8, 9, or 10 times relative to a control. In some
embodiments, the anti-hMPV/hPIV3 antigen antibody titer produced in
a subject is increased 2-10 times relative to a control. For
example, the anti-hMPV/hPIV3 antigen antibody titer produced in a
subject may be increased 2-10, 2-9, 2-8, 2-7, 2-6, 2-5, 2-4, 2-3,
3-10, 3-9, 3-8, 3-7, 3-6, 3-5, 3-4, 4-10, 4-9, 4-8, 4-7, 4-6, 4-5,
5-10, 5-9, 5-8, 5-7, 5-6, 6-10, 6-9, 6-8, 6-7, 7-10, 7-9, 7-8,
8-10, 8-9, or 9-10 times relative to a control.
[0448] A control, in some embodiments, is the anti-hMPV/hPIV3
antigen antibody titer produced in a subject who has not been
administered a hMPV/hPIV3 RNA (e.g., mRNA) vaccine. In some
embodiments, a control is an anti-hMPV/hPIV3 antigen antibody titer
produced in a subject administered a recombinant or purified
hMPV/hPIV3 protein vaccine. Recombinant protein vaccines typically
include protein antigens that either have been produced in a
heterologous expression system (e.g., bacteria or yeast) or
purified from large amounts of the pathogenic organism.
[0449] In some embodiments, the ability of a hMPV/hPIV3 vaccine to
be effective is measured in a murine model. For example, the
hMPV/hPIV3 vaccines may be administered to a murine model and the
murine model assayed for induction of neutralizing antibody titers.
Viral challenge studies may also be used to assess the efficacy of
a vaccine of the present disclosure. For example, the hMPV/hPIV3
vaccines may be administered to a murine model, the murine model
challenged with hMPV/hPIV3, and the murine model assayed for
survival and/or immune response (e.g., neutralizing antibody
response, T cell response (e.g., cytokine response)).
[0450] In some embodiments, an effective amount of a hMPV/hPIV3 RNA
(e.g., mRNA) vaccine is a dose that is reduced compared to the
standard of care dose of a recombinant hMPV/hPIV3 protein vaccine.
A "standard of care," as provided herein, refers to a medical or
psychological treatment guideline and can be general or specific.
"Standard of care" specifies appropriate treatment based on
scientific evidence and collaboration between medical professionals
involved in the treatment of a given condition. It is the
diagnostic and treatment process that a physician/clinician should
follow for a certain type of patient, illness or clinical
circumstance. A "standard of care dose," as provided herein, refers
to the dose of a recombinant or purified hMPV/hPIV3 protein
vaccine, or a live attenuated or inactivated hMPV/hPIV3 vaccine, or
a hMPV/hPIV3 VLP vaccine, that a physician/clinician or other
medical professional would administer to a subject to treat or
prevent hMPV/hPIV3, or a hMPV/hPIV3-related condition, while
following the standard of care guideline for treating or preventing
hMPV/hPIV3, or a hMPV/hPIV3-related condition.
[0451] In some embodiments, the anti-hMPV/hPIV3 antigen antibody
titer produced in a subject administered an effective amount of a
hMPV/hPIV3 RNA vaccine is equivalent to an anti-hMPV/hPIV3 antigen
antibody titer produced in a control subject administered a
standard of care dose of a recombinant or purified hMPV/hPIV3
protein vaccine, or a live attenuated or inactivated hMPV/hPIV3
vaccine, or a hMPV/hPIV3 VLP vaccine.
[0452] In some embodiments, an effective amount of a hMPV/hPIV3 RNA
(e.g., mRNA) vaccine is a dose equivalent to an at least 2-fold
reduction in a standard of care dose of a recombinant or purified
hMPV/hPIV3 protein vaccine. For example, an effective amount of a
hMPV/hPIV3 RNA vaccine may be a dose equivalent to an at least
3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least
7-fold, at least 8-fold, at least 9-fold, or at least 10-fold
reduction in a standard of care dose of a recombinant or purified
hMPV/hPIV3 protein vaccine. In some embodiments, an effective
amount of a hMPV/hPIV3 RNA vaccine is a dose equivalent to an at
least at least 100-fold, at least 500-fold, or at least 1000-fold
reduction in a standard of care dose of a recombinant or purified
hMPV/hPIV3 protein vaccine. In some embodiments, an effective
amount of a hMPV/hPIV3 RNA vaccine is a dose equivalent to a 2-,
3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 20-, 50-, 100-, 250-, 500-, or
1000-fold reduction in a standard of care dose of a recombinant or
purified hMPV/hPIV3 protein vaccine. In some embodiments, the
anti-hMPV/hPIV3 antigen antibody titer produced in a subject
administered an effective amount of a hMPV/hPIV3 RNA vaccine is
equivalent to an anti-hMPV/hPIV3 antigen antibody titer produced in
a control subject administered the standard of care dose of a
recombinant or protein hMPV/hPIV3 protein vaccine, or a live
attenuated or inactivated hMPV/hPIV3 vaccine, or a hMPV/hPIV3 VLP
vaccine. In some embodiments, an effective amount of a hMPV/hPIV3
RNA (e.g., mRNA) vaccine is a dose equivalent to a 2-fold to
1000-fold (e.g., 2-fold to 100-fold, 10-fold to 1000-fold)
reduction in the standard of care dose of a recombinant or purified
hMPV/hPIV3 protein vaccine, wherein the anti-hMPV/hPIV3 antigen
antibody titer produced in the subject is equivalent to an
anti-hMPV/hPIV3 antigen antibody titer produced in a control
subject administered the standard of care dose of a recombinant or
purified hMPV/hPIV3 protein vaccine, or a live attenuated or
inactivated hMPV/hPIV3 vaccine, or a hMPV/hPIV3 VLP vaccine.
[0453] In some embodiments, the effective amount of a hMPV/hPIV3
RNA (e.g., mRNA) vaccine is a total dose of 50-1000 .mu.g. In some
embodiments, the effective amount of a hMPV/hPIV3 RNA (e.g., mRNA)
vaccine is a total dose of 50-1000, 50-900, 50-800, 50-700, 50-600,
50-500, 50-400, 50-300, 50-200, 50-100, 50-90, 50-80, 50-70, 50-60,
60-1000, 60-900, 60-800, 60-700, 60-600, 60-500, 60-400, 60-300,
60-200, 60-100, 60-90, 60-80, 60-70, 70-1000, 70-900, 70-800,
70-700, 70-600, 70-500, 70-400, 70-300, 70-200, 70-100, 70-90,
70-80, 80-1000, 80-900, 80-800, 80-700, 80-600, 80-500, 80-400,
80-300, 80-200, 80-100, 80-90, 90-1000, 90-900, 90-800, 90-700,
90-600, 90-500, 90-400, 90-300, 90-200, 90-100, 100-1000, 100-900,
100-800, 100-700, 100-600, 100-500, 100-400, 100-300, 100-200,
200-1000, 200-900, 200-800, 200-700, 200-600, 200-500, 200-400,
200-300, 300-1000, 300-900, 300-800, 300-700, 300-600, 300-500,
300-400, 400-1000, 400-900, 400-800, 400-700, 400-600, 400-500,
500-1000, 500-900, 500-800, 500-700, 500-600, 600-1000, 600-900,
600-900, 600-700, 700-1000, 700-900, 700-800, 800-1000, 800-900, or
900-1000 .mu.g. In some embodiments, the effective amount of a
hMPV/hPIV3 RNA (e.g., mRNA) vaccine is a total dose of 50, 100,
150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750,
800, 850, 900, 950 or 1000 .mu.g. In some embodiments, the
effective amount is a dose of 25-500 .mu.g administered to the
subject a total of two times. In some embodiments, the effective
amount of a hMPV/hPIV3 RNA (e.g., mRNA) vaccine is a dose of
25-500, 25-400, 25-300, 25-200, 25-100, 25-50, 50-500, 50-400,
50-300, 50-200, 50-100, 100-500, 100-400, 100-300, 100-200,
150-500, 150-400, 150-300, 150-200, 200-500, 200-400, 200-300,
250-500, 250-400, 250-300, 300-500, 300-400, 350-500, 350-400,
400-500 or 450-500 .mu.g administered to the subject a total of two
times. In some embodiments, the effective amount of a hMPV/hPIV3
RNA (e.g., mRNA) vaccine is a total dose of 25, 50, 100, 150, 200,
250, 300, 350, 400, 450, or 500 .mu.g administered to the subject a
total of two times.
[0454] Vaccine efficacy may be assessed using standard analyses
(see, e.g., Weinberg et al., J Infect Dis. 2010 Jun. 1;
201(11):1607-10). For example, vaccine efficacy may be measured by
double-blind, randomized, clinical controlled trials. Vaccine
efficacy may be expressed as a proportionate reduction in disease
attack rate (AR) between the unvaccinated (ARU) and vaccinated
(ARV) study cohorts and can be calculated from the relative risk
(RR) of disease among the vaccinated group with use of the
following formulas:
Efficacy=(ARU-ARV)/ARU.times.100; and
Efficacy=(1-RR).times.100.
[0455] Likewise, vaccine effectiveness may be assessed using
standard analyses (see, e.g., Weinberg et al., J Infect Dis. 2010
Jun. 1; 201(11):1607-10). Vaccine effectiveness is an assessment of
how a vaccine (which may have already proven to have high vaccine
efficacy) reduces disease in a population. This measure can assess
the net balance of benefits and adverse effects of a vaccination
program, not just the vaccine itself, under natural field
conditions rather than in a controlled clinical trial. Vaccine
effectiveness is proportional to vaccine efficacy (potency) but is
also affected by how well target groups in the population are
immunized, as well as by other non-vaccine-related factors that
influence the `real-world` outcomes of hospitalizations, ambulatory
visits, or costs. For example, a retrospective case control
analysis may be used, in which the rates of vaccination among a set
of infected cases and appropriate controls are compared. Vaccine
effectiveness may be expressed as a rate difference, with use of
the odds ratio (OR) for developing infection despite
vaccination:
Effectiveness=(1-OR).times.100.
[0456] In some embodiments, efficacy of the hMPV/hPIV3 vaccine is
at least 60% relative to unvaccinated control subjects. For
example, efficacy of the hMPV/hPIV3 vaccine may be at least 65%, at
least 70%, at least 75%, at least 80%, at least 85%, at least 95%,
at least 98%, or 100% relative to unvaccinated control
subjects.
[0457] Sterilizing Immunity. Sterilizing immunity refers to a
unique immune status that prevents effective pathogen infection
into the host. In some embodiments, the effective amount of a
hMPV/hPIV3 vaccine of the present disclosure is sufficient to
provide sterilizing immunity in the subject for at least 1 year.
For example, the effective amount of a hMPV/hPIV3 vaccine of the
present disclosure is sufficient to provide sterilizing immunity in
the subject for at least 2 years, at least 3 years, at least 4
years, or at least 5 years. In some embodiments, the effective
amount of a hMPV/hPIV3 vaccine of the present disclosure is
sufficient to provide sterilizing immunity in the subject at an at
least 5-fold lower dose relative to control. For example, the
effective amount may be sufficient to provide sterilizing immunity
in the subject at an at least 10-fold lower, 15-fold, or 20-fold
lower dose relative to a control.
[0458] Detectable Antigen. In some embodiments, the effective
amount of a hMPV/hPIV3 vaccine of the present disclosure is
sufficient to produce detectable levels of hMPV/hPIV3 antigen as
measured in serum of the subject at 1-72 hours post administration.
In some embodiments, the effective amount of a hMPV/hPIV3 vaccine
of the present disclosure is sufficient to produce detectable
levels of hMPV/hPIV3 antigen as measured in serum of the subject
within 14 days (e.g., at 7-14 days) post administration.
[0459] Titer. An antibody titer is a measurement of the amount of
antibodies within a subject, for example, antibodies that are
specific to a particular antigen (e.g., an anti-hMPV/hPIV3
antigen). Antibody titer is typically expressed as the inverse of
the greatest dilution that provides a positive result.
Enzyme-linked immunosorbent assay (ELISA) is a common assay for
determining antibody titers, for example.
[0460] In some embodiments, the effective amount of a hMPV/hPIV3
vaccine of the present disclosure is sufficient to produce a
1,000-10,000 neutralizing antibody titer produced by neutralizing
antibody against the hMPV/hPIV3 antigen as measured in serum of the
subject at 1-72 hours post administration. In some embodiments, the
effective amount is sufficient to produce a 1,000-5,000
neutralizing antibody titer produced by neutralizing antibody
against the hMPV/hPIV3 antigen as measured in serum of the subject
at 1-72 hours post administration. In some embodiments, the
effective amount is sufficient to produce a 5,000-10,000
neutralizing antibody titer produced by neutralizing antibody
against the hMPV/hPIV3 antigen as measured in serum of the subject
at 1-72 hours post administration.
[0461] In some embodiments, the effective amount of a hMPV/hPIV3
vaccine of the present disclosure is sufficient to produce a
1,000-10,000 neutralizing antibody titer produced by neutralizing
antibody against the hMPV/hPIV3 antigen as measured in serum of the
subject within 14 days of vaccine administration. In some
embodiments, the effective amount is sufficient to produce a
1,000-5,000 neutralizing antibody titer produced by neutralizing
antibody against the hMPV/hPIV3 antigen as measured in serum of the
subject within 14 days of vaccine administration. In some
embodiments, the effective amount is sufficient to produce a
5,000-10,000 neutralizing antibody titer produced by neutralizing
antibody against the hMPV/hPIV3 antigen as measured in serum of the
subject within 14 days of vaccine administration.
[0462] In some embodiments, the neutralizing antibody titer is at
least 100 NT.sub.50. For example, the neutralizing antibody titer
may be at least 200, 300, 400, 500, 600, 700, 800, 900 or 1000
NT.sub.50. In some embodiments, the neutralizing antibody titer is
at least 10,000 NT.sub.50.
[0463] In some embodiments, the neutralizing antibody titer is at
least 100 neutralizing units per milliliter (NU/mL). For example,
the neutralizing antibody titer may be at least 200, 300, 400, 500,
600, 700, 800, 900 or 1000 NU/mL. In some embodiments, the
neutralizing antibody titer is at least 10,000 NU/mL.
[0464] In some embodiments, an anti-hMPV/hPIV3 antigen antibody
titer produced in the subject is increased by at least 1 log
relative to a control. For example, an anti-hMPV/hPIV3 antigen
antibody titer produced in the subject may be increased by at least
2, 3, 4, 5, 6, 7, 8, 9 or 10 log relative to a control.
[0465] In some embodiments, an anti-hMPV/hPIV3 antigen antibody
titer produced in the subject is increased at least 2 times
relative to a control. For example, an anti-hMPV/hPIV3 antigen
antibody titer produced in the subject is increased by at least 3,
4, 5, 6, 7, 8, 9 or 10 times relative to a control.
[0466] In some embodiments, a geometric mean, which is the nth root
of the product of n numbers, is generally used to describe
proportional growth. Geometric mean, in some embodiments, is used
to characterize antibody titer produced in a subject.
[0467] A control may be, for example, an unvaccinated subject, or a
subject administered a live attenuated hMPV/hPIV3 vaccine, an
inactivated hMPV/hPIV3 vaccine, or a protein subunit hMPV/hPIV3
vaccine.
EXAMPLES
[0468] The data provided below demonstrates that RNA vaccines
comprising hMPV/hPIV3 RNA polynucleotides, formulated in lipid
nanoparticles comprising Compound 25 of Formula (I), protect
animals from challenge by both viruses. Virus was not detectable in
the lung or nose, and there was no evidence of interference between
vaccine components. Cotton rats were completely protected from
hPIV3 or hMPV after receiving 2 doses of the hMPV/hPIV3 RNA
vaccine. hPIV3 F alone had higher neutralization titers than hPIV3
HN or the combination of hPIV3 HN and hPIV3 F. Further,
seronegative monkeys were completely protected from hMPV and hPIV3
challenge after 2 doses of the hMPV/hPIV3 RNA vaccine. In naturally
seropositive animals, a single dose of vaccine boosted hMPV and
hPIV3 titers 4-10 fold. Again, hPIV3 F alone had higher
neutralization titers than hPIV3 HN or the combination of hPIV3 HN
and hPIV3 F.
Example 1: Manufacture of Polynucleotides
[0469] According to the present disclosure, the manufacture of
polynucleotides and/or parts or regions thereof may be accomplished
utilizing the methods taught in International Publication
WO2014/152027, entitled "Manufacturing Methods for Production of
RNA Transcripts," the contents of which is incorporated herein by
reference in its entirety.
[0470] Purification methods may include those taught in
International Publication WO2014/152030 and International
Publication WO2014/152031, each of which is incorporated herein by
reference in its entirety.
[0471] Detection and characterization methods of the
polynucleotides may be performed as taught in International
Publication WO2014/144039, which is incorporated herein by
reference in its entirety.
[0472] Characterization of the polynucleotides of the disclosure
may be accomplished using polynucleotide mapping, reverse
transcriptase sequencing, charge distribution analysis, detection
of RNA impurities, or any combination of two or more of the
foregoing. "Characterizing" comprises determining the RNA
transcript sequence, determining the purity of the RNA transcript,
or determining the charge heterogeneity of the RNA transcript, for
example. Such methods are taught in, for example, International
Publication WO2014/144711 and International Publication
WO2014/144767, the content of each of which is incorporated herein
by reference in its entirety.
Example 2: Chimeric Polynucleotide Synthesis
[0473] According to the present disclosure, two regions or parts of
a chimeric polynucleotide may be joined or ligated using
triphosphate chemistry. A first region or part of 100 nucleotides
or less is chemically synthesized with a 5' monophosphate and
terminal 3' desOH or blocked OH, for example. If the region is
longer than 80 nucleotides, it may be synthesized as two strands
for ligation.
[0474] If the first region or part is synthesized as a
non-positionally modified region or part using in vitro
transcription (IVT), conversion the 5'monophosphate with subsequent
capping of the 3' terminus may follow.
[0475] Monophosphate protecting groups may be selected from any of
those known in the art.
[0476] The second region or part of the chimeric polynucleotide may
be synthesized using either chemical synthesis or IVT methods. IVT
methods may include an RNA polymerase that can utilize a primer
with a modified cap. Alternatively, a cap of up to 130 nucleotides
may be chemically synthesized and coupled to the IVT region or
part.
[0477] For ligation methods, ligation with DNA T4 ligase, followed
by treatment with DNase should readily avoid concatenation.
[0478] The entire chimeric polynucleotide need not be manufactured
with a phosphate-sugar backbone. If one of the regions or parts
encodes a polypeptide, then such region or part may comprise a
phosphate-sugar backbone.
[0479] Ligation is then performed using any known click chemistry,
orthoclick chemistry, solulink, or other bioconjugate chemistries
known to those in the art.
[0480] Synthetic Route
[0481] The chimeric polynucleotide may be made using a series of
starting segments. Such segments include:
[0482] (a) a capped and protected 5' segment comprising a normal
3'OH (SEG. 1)
[0483] (b) a 5' triphosphate segment, which may include the coding
region of a polypeptide and a normal 3'OH (SEG. 2)
[0484] (c) a 5' monophosphate segment for the 3' end of the
chimeric polynucleotide (e.g., the tail) comprising cordycepin or
no 3'OH (SEG. 3)
[0485] After synthesis (chemical or IVT), segment 3 (SEG. 3) may be
treated with cordycepin and then with pyrophosphatase to create the
5' monophosphate.
[0486] Segment 2 (SEG. 2) may then be ligated to SEG. 3 using RNA
ligase. The ligated polynucleotide is then purified and treated
with pyrophosphatase to cleave the diphosphate. The treated
SEG.2-SEG. 3 construct may then be purified and SEG. 1 is ligated
to the 5' terminus. A further purification step of the chimeric
polynucleotide may be performed.
[0487] Where the chimeric polynucleotide encodes a polypeptide, the
ligated or joined segments may be represented as: 5'UTR (SEG. 1),
open reading frame or ORF (SEG. 2) and 3'UTR+PolyA (SEG. 3).
[0488] The yields of each step may be as much as 90-95%
Example 3: PCR for cDNA Production
[0489] PCR procedures for the preparation of cDNA may be performed
using 2.times. KAPA HIFI.TM. HotStart ReadyMix by Kapa Biosystems
(Woburn, Mass.). This system includes 2.times. KAPA ReadyMix 12.5
.mu.l; Forward Primer (10 .mu.M) 0.75 .mu.l; Reverse Primer (10
.mu.M) 0.75 .mu.l; Template cDNA 100 ng; and dH.sub.2O diluted to
25.0 W. The reaction conditions may be at 95.degree. C. for 5 min.
The reaction may be performed for 25 cycles of 98.degree. C. for 20
sec, then 58.degree. C. for 15 sec, then 72.degree. C. for 45 sec,
then 72.degree. C. for 5 min, then 4.degree. C. to termination.
[0490] The reaction may be cleaned up using Invitrogen's
PURELINK.TM. PCR Micro Kit (Carlsbad, Calif.) per manufacturer's
instructions (up to 5 .mu.g). Larger reactions may require a
cleanup using a product with a larger capacity. Following the
cleanup, the cDNA may be quantified using the NANODROP.TM. and
analyzed by agarose gel electrophoresis to confirm that the cDNA is
the expected size. The cDNA may then be submitted for sequencing
analysis before proceeding to the in vitro transcription
reaction.
Example 4: In Vitro Transcription (IVT)
[0491] The in vitro transcription reaction generates RNA
polynucleotides. Such polynucleotides may comprise a region or part
of the polynucleotides of the disclosure, including chemically
modified RNA (e.g., mRNA) polynucleotides. The chemically modified
RNA polynucleotides can be uniformly modified polynucleotides. The
in vitro transcription reaction utilizes a custom mix of nucleotide
triphosphates (NTPs). The NTPs may comprise chemically modified
NTPs, or a mix of natural and chemically modified NTPs, or natural
NTPs.
[0492] A typical in vitro transcription reaction includes the
following:
TABLE-US-00003 1) Template cDNA 1.0 .mu.g 2) 10.times.
transcription buffer 2.0 .mu.l (400 mM Tris-HCl pH 8.0, 190 mM
MgCl.sub.2, 50 mM DTT, 10 mM Spermidine) 3) Custom NTPs (25 mM
each) 0.2 .mu.l 4) RNase Inhibitor 20 U 5) T7 RNA polymerase 3000 U
6) dH.sub.20 up to 20.0 .mu.l. and 7) Incubation at 37.degree. C.
for 3 hr-5 hrs
[0493] The crude IVT mix may be stored at 4.degree. C. overnight
for cleanup the next day. 1 U of RNase-free DNase may then be used
to digest the original template. After 15 minutes of incubation at
37.degree. C., the mRNA may be purified using Ambion's
MEGACLEAR.TM. Kit (Austin, Tex.) following the manufacturer's
instructions. This kit can purify up to 500 .mu.g of RNA. Following
the cleanup, the RNA polynucleotide may be quantified using the
NanoDrop and analyzed by agarose gel electrophoresis to confirm the
RNA polynucleotide is the proper size and that no degradation of
the RNA has occurred.
Example 5: Enzymatic Capping
[0494] Capping of a RNA polynucleotide is performed as follows
where the mixture includes: IVT RNA 60 .mu.g-180 .mu.g and
dH.sub.2O up to 72 .mu.l. The mixture is incubated at 65.degree. C.
for 5 minutes to denature RNA, and then is transferred immediately
to ice.
[0495] The protocol then involves the mixing of 10.times. Capping
Buffer (0.5 M Tris-HCl (pH 8.0), 60 mM KCl, 12.5 mM MgCl.sub.2)
(10.0 .mu.l); 20 mM GTP (5.0 .mu.l); 20 mM S-Adenosyl Methionine
(2.5 RNase Inhibitor (100 U); 2'-O-Methyltransferase (400U);
Vaccinia capping enzyme (Guanylyl transferase) (40 U); dH.sub.2O
(Up to 28 .mu.l); and incubation at 37.degree. C. for 30 minutes
for 60 .mu.s RNA or up to 2 hours for 180 .mu.s of RNA.
[0496] The RNA polynucleotide may then be purified using Ambion's
MEGACLEAR.TM. Kit (Austin, Tex.) following the manufacturer's
instructions. Following the cleanup, the RNA may be quantified
using the NANODROP.TM. (ThermoFisher, Waltham, Mass.) and analyzed
by agarose gel electrophoresis to confirm the RNA polynucleotide is
the proper size and that no degradation of the RNA has occurred.
The RNA polynucleotide product may also be sequenced by running a
reverse-transcription-PCR to generate the cDNA for sequencing.
Example 6: PolyA Tailing Reaction
[0497] Without a poly-T in the cDNA, a poly-A tailing reaction must
be performed before cleaning the final product. This is done by
mixing capped IVT RNA (100 .mu.l); RNase Inhibitor (20 U); 10x
Tailing Buffer (0.5 M Tris-HCl (pH 8.0), 2.5 M NaCl, 100 mM
MgCl.sub.2) (12.0 .mu.l); 20 mM ATP (6.0 .mu.l); Poly-A Polymerase
(20 U); dH.sub.2O up to 123.5 .mu.l and incubation at 37.degree. C.
for 30 min. If the poly-A tail is already in the transcript, then
the tailing reaction may be skipped and proceed directly to cleanup
with Ambion's MEGACLEAR.TM. kit (Austin, Tex.) (up to 500 .mu.g).
Poly-A Polymerase may be a recombinant enzyme expressed in
yeast.
[0498] It should be understood that the processivity or integrity
of the polyA tailing reaction may not always result in an exact
size polyA tail. Hence, polyA tails of approximately between 40-200
nucleotides, e.g., about 40, 50, 60, 70, 80, 90, 91, 92, 93, 94,
95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108,
109, 110, 150-165, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164
or 165 are within the scope of the present disclosure.
Example 7: Natural 5' Caps and 5' Cap Analogues
[0499] 5'-capping of polynucleotides may be completed concomitantly
during the in vitro-transcription reaction using the following
chemical RNA cap analogs to generate the 5'-guanosine cap structure
according to manufacturer protocols: 3'-O-Me-m7G(5')ppp(5') G [the
ARCA cap]; G(5')ppp(5')A; G(5')ppp(5')G; m7G(5')ppp(5')A;
m7G(5')ppp(5')G (New England BioLabs, Ipswich, Mass.). 5'-capping
of modified RNA may be completed post-transcriptionally using a
Vaccinia Virus Capping Enzyme to generate the "Cap 0" structure:
m7G(5')ppp(5')G (New England BioLabs, Ipswich, Mass.). Cap 1
structure may be generated using both Vaccinia Virus Capping Enzyme
and a 2'-O methyl-transferase to generate:
m7G(5')ppp(5')G-2'-O-methyl. Cap 2 structure may be generated from
the Cap 1 structure followed by the 2'-O-methylation of the
5'-antepenultimate nucleotide using a 2'-O methyl-transferase. Cap
3 structure may be generated from the Cap 2 structure followed by
the 2'-O-methylation of the 5'-preantepenultimate nucleotide using
a 2'-O methyl-transferase. Enzymes are preferably derived from a
recombinant source.
[0500] When transfected into mammalian cells, the modified mRNAs
have a stability of between 12-18 hours or more than 18 hours,
e.g., 24, 36, 48, 60, 72 or greater than 72 hours.
Example 8: Capping Assays
Protein Expression Assay
[0501] Polynucleotides (e.g., mRNA) encoding a polypeptide,
containing any of the caps taught herein, can be transfected into
cells at equal concentrations. The amount of protein secreted into
the culture medium can be assayed by ELISA at 6, 12, 24 and/or 36
hours post-transfection. Synthetic polynucleotides that secrete
higher levels of protein into the medium correspond to a synthetic
polynucleotide with a higher translationally-competent cap
structure.
Purity Analysis Synthesis
[0502] RNA (e.g., mRNA) polynucleotides encoding a polypeptide,
containing any of the caps taught herein can be compared for purity
using denaturing Agarose-Urea gel electrophoresis or HPLC analysis.
RNA polynucleotides with a single, consolidated band by
electrophoresis correspond to the higher purity product compared to
polynucleotides with multiple bands or streaking bands. Chemically
modified RNA polynucleotides with a single HPLC peak also
correspond to a higher purity product. The capping reaction with a
higher efficiency provides a more pure polynucleotide
population.
Cytokine Analysis
[0503] RNA (e.g., mRNA) polynucleotides encoding a polypeptide,
containing any of the caps taught herein can be transfected into
cells at multiple concentrations. The amount of pro-inflammatory
cytokines, such as TNF-alpha and IFN-beta, secreted into the
culture medium can be assayed by ELISA at 6, 12, 24 and/or 36 hours
post-transfection. RNA polynucleotides resulting in the secretion
of higher levels of pro-inflammatory cytokines into the medium
correspond to a polynucleotides containing an immune-activating cap
structure.
Capping Reaction Efficiency
[0504] RNA (e.g., mRNA) polynucleotides encoding a polypeptide,
containing any of the caps taught herein can be analyzed for
capping reaction efficiency by LC-MS after nuclease treatment.
Nuclease treatment of capped polynucleotides yield a mixture of
free nucleotides and the capped 5'-5-triphosphate cap structure
detectable by LC-MS. The amount of capped product on the LC-MS
spectra can be expressed as a percent of total polynucleotide from
the reaction and correspond to capping reaction efficiency. The cap
structure with a higher capping reaction efficiency has a higher
amount of capped product by LC-MS.
Example 9: Agarose Gel Electrophoresis of Modified RNA or RT PCR
Products
[0505] Individual RNA polynucleotides (200-400 ng in a 20 .mu.l
volume) or reverse transcribed PCR products (200-400 ng) may be
loaded into a well on a non-denaturing 1.2% Agarose E-Gel
(Invitrogen, Carlsbad, Calif.) and run for 12-15 minutes, according
to the manufacturer protocol.
Example 10: Nanodrop Modified RNA Quantification and UV Spectral
Data
[0506] Chemically modified RNA polynucleotides in TE buffer (1
.mu.l) are used for Nanodrop UV absorbance readings to quantitate
the yield of each polynucleotide from an chemical synthesis or in
vitro transcription reaction.
Example 11: Formulation of Modified mRNA Using Lipidoids
[0507] RNA (e.g., mRNA) polynucleotides may be formulated for in
vitro experiments by mixing the polynucleotides with the lipidoid
at a set ratio prior to addition to cells. In vivo formulation may
require the addition of extra ingredients to facilitate circulation
throughout the body. To test the ability of these lipidoids to form
particles suitable for in vivo work, a standard formulation process
used for siRNA-lipidoid formulations may be used as a starting
point. After formation of the particle, polynucleotide is added and
allowed to integrate with the complex. The encapsulation efficiency
is determined using a standard dye exclusion assays.
Example 12: Expression of hMPV and hPIV3 Fusion Protein on Cell
Surface
[0508] The instant study was designed to show that hMPV/hPIV3 mRNA
vaccines encoding the hMPV F protein and the hPIV3 F protein led to
cell surface expression of the antigen in cultured Hela cells. The
mRNA constructs were transfected into Hela cells. Expression of the
hMPV F protein was detected by fluorescent staining using
hMPV-F-specific antibodies MPE-8 (Table 1). Untransfected cells
(mock) were also stained as negative control. In untransfected
cells or cells stained only with secondary antibodies, no hMPV F
protein signal was detected, while hMPV F protein signal was
detected in transfected cells stained with MPE-8 antibodies (FIG.
1A). Expression of the hPIV3 F protein was detected by staining
using the hPIV3-F-specific antibodies MAB10207 and surface
expression of hPIV3 protein was detected (FIG. 1B)
TABLE-US-00004 TABLE 1 Fluorescent Staining of Cells Transfected
with hMPV/HPTV3 mRNA Vaccine Constructs Sample Mean FL4-H
Mock-unstained 494.38 Mock-Secondary' only 3,944.18 Mock- MPE8 (500
nM) 5,452.55 hMPV-Secondary only 2,160.82 hMPV- MPE8 (500 nM)
617,307.76
Example 13: hMPV/hPIV3 Cotton Rat Challenge
[0509] The instant study was designed to show that the hMPV/hPIV3
mRNA vaccine constructs encoding the hMPV F protein and the hPIV3 F
protein induced high levels of neutralizing antibodies in cotton
rats and reduced the viral titers in the nose and lungs of the
immunized cotton rats after challenge with hMPV or hPIV3 viruses.
The study design is shown in Table 2. Animals were dosed on Days 0
and 28 and were challenged on Day 56. Animals were bled on Days-1,
27 and 56. Viral titers were determined 5 days post challenge.
[0510] Cotton rats that are negative for hMPV and hPIV3 were
divided into 19 groups (n=8), and each group was vaccinated with 2
doses of mRNA vaccines on days 0 and 28. The mRNA vaccines were
formulated in either MC3 lipids or Compound 1 lipids. Immunized
cotton rats were challenged with a lethal dose of hMPV or hPIV3 on
day 57 post immunization. The viral titers in the nose and lungs of
the challenged cotton rats were measured on day 5 post challenge
and the serum neutralizing antibody titers were measured one day
prior to immunization, and on days 27 and 56 post immunization.
[0511] All cotton rats receiving 2 doses of hMPV/HPIV3 mRNA vaccine
were completely protected from hMPV or hPIV3 infection, and the two
formulations with either MC3 or Compound 1 lipids yielded similar
levels of protection (FIGS. 2A-2B). Neutralizing antibody titers in
the sera of the immunized cotton rats were analyzed. The results
show that the hMPV/HPIV3 mRNA vaccines induced high levels of
neutralizing antibodies against hMPV (FIG. 3A) or hPIV3 (FIG. 3B)
in immunized cotton rat. Further, mRNA vaccine formulations with
Compound 1 or MC3 lipids induced comparable levels of neutralizing
antibodies against hMPV (FIG. 3A, compare Group 2 with Group 7). A
control group immunized with Fl-hMPV showed very low neutralizing
antibody titers as expected (FIG. 3A, Group 6). Similarly, mRNA
vaccine formulations with Compound 1 or MC3 lipids induced
comparable levels of neutralizing antibodies against hPIV3 (FIG. 3,
compare Group 9 with Group 16). MRNA vaccines encoding hPIV3 F
protein induced neutralizing antibody titers that is 3-fold higher
than that of mRNA vaccines encoding hPIV3 HN protein at the same
dosage (25 .mu.g) (FIG. 3B, compare Group 10 with Group 11).
Further, the presence of mRNA constructs in the mRNA vaccine
encoding hMPV antigen does not interfere with the immunogenicity of
mRNA constructs encoding hPIV3 antigen (FIG. 3B, compare Group 9
with Group 12).
TABLE-US-00005 TABLE 2 Cotton Rat Challenge Study Design Cotton Rat
Dose Challenge Group n Vaccine (.mu.g) Formulation Vaccine (Day 57)
Endpoint 1 8 hMPV/PIV/RS 10/10/30 Compound D0,D28 hMPV Lung and
Nose V 1 viral titer: 2 8 hMPV/PIV 25/25 Compound D0,D28 Day 5 post
1 challenge and 3 8 hMPV 25 Compound D0,D28 Neutralizing anti- 1
body titer 4 8 hMPV 10 Compound D0,D28 (Day-1, D27,D56) 1 5 8 PBS
NA NA D0,D28 6 8 FI-hMPV NA NA D0,D28 7 8 hMPV/PIV 25/25 MC3 D0,D28
8 8 hMPV/PIV/RS 10/10/30 Compound D0,D28 PIV3 V 1 9 8 hMPV/PIV
25/25 Compound D0,D28 1 10 8 hMPV/PIV-F 25/25 Compound D0,D28 1 11
8 hMPV/PIV-HN 25/25 Compound D0,D28 1 12 8 PIV 25 Compound D0,D28 1
13 8 PIV 10 Compound D0,D28 14 8 PBS NA NA D0,D28 15 8 FI-PIV3 NA
NA D0,D28 16 8 hMPV/PIV 25/25 MC3 D0,D28 17 8 hMPV/PIV/RS 10/10/30
Compound D0,D28 RSV V 1 18 8 RSV 30 Compound D0,D28 1 19 8 PBS NA
NA D0,D28
Example 14: Safety and Efficacy of hMPV/hPIV3 Vaccination in Cotton
Rat Challenge
[0512] The instant study was designed to evaluate the safety and
efficacy of human metapneumovirus (hMPV)/parainfluenza 3 (PIV3)
mRNA vaccines in the cotton rat model of hMPV or PIV3 challenge.
Lipid nanoparticle (LNP)-formulated combinations of mRNA encoding
the following antigens: [0513] hMPV fusion (F) protein (Strain:
A/TN92-4) (SEQ ID NO: 4) [0514] PIV3 F protein (strain:
PER/FLA4815/2008) (SEQ ID NO: 5) [0515] PIV3
hemagglutinin-neuraminidase (HN) protein (Strain: 612507167) (SEQ
ID NO: 6) The mRNAs were formulated in a mixture of 4 lipids,
including Compound 1; 1,2-dimyristoyl-sn-glycerol,
methoxypolyethyleneglycol (PEG2000-DMG);
1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC); and
cholesterol.
[0516] The combination vaccine includes hMPV-F and PIV3-F mRNA
co-formulated at a 1:1 mass ratio in LNP.
[0517] Groups of 8 female cotton rats were immunized with different
dose levels of LNP-formulated mRNAs encoding hMPV-F, PIV3-F, and
PIV3-HN, either alone or in combination, as indicated in Table 3.
Control groups were inoculated with phosphate-buffered saline
(PBS), formalin-inactivated (FI)-hMPV, or FI-PIV3. FI-hMPV and
FI-PIV3 were produced, and are used as positive controls for
vaccine-mediated enhanced respiratory disease (ERD) after hMPV or
PIV3 challenge, respectively. All animals were immunized
intramuscularly (IM) on Days 0 and 28. Serum was collected on Day
56 for measurement of neutralizing antibody titers to hMPV (Groups
2-6) or PIV3 (Groups 9-15) by 60% plaque reduction neutralization
test (PRNT). Animals were challenged intra-nasally on Day 56 with
either 10.sup.5 pfu hMPV/A2 (Groups 2-6) or 10.sup.5 pfu PIV3
(Groups 9-15). Five days later (Day 61) nasal tissue and lungs were
collected. Viral load in both tissues was determined by plaque
assay and pulmonary histopathology was evaluated on hematoxylin and
eosin (H&E) stained fixed lung sections. Parameters of
pulmonary inflation include interstitial pneumonia (inflammatory
cell infiltration and thickening of alveolar walls) and alveolitis
(cells within the alveolar spaces). Sections were evaluated on a
0-4 severity scale and subsequently converted to a 0-100%
histopathology scale.
TABLE-US-00006 TABLE 3 mRNAdose (.mu.g) Vaccine Challenge Group n
Vaccine total hMPV-F PIV3-F PIV3-HN Schedule (Day 56) 2 8
hMPV-F/PIV3-F/PIV3-HN 50 25 12.5 12.5 Day 0 & 28 hMPV 3 8
hMPV-F 25 25 0 0 Day 0 & 28 hMPV 4 8 hMPV-F 10 10 0 0 Day 0
& 28 hMPV 5 8 PBS NA NA NA NA Day 0 & 28 hMPV 6 8 FI-hMPV
NA NA NA NA Day 0 & 28 hMPV 9 8 hMPV-F/PIV3-F/PIV3-HN 50 25
12.5 12.5 Day 0 & 28 PIV3 10 8 hMPV-F/PIV3-F 50 25 25 0 Day 0
& 28 PIV3 11 8 hMPV-F/PIV3-HN 50 25 0 25 Day 0 & 28 PIV3 12
8 PIV3-F/PIV3-HN 25 0 12.5 12.5 Day 0 & 28 PIV3 13 8
PIV3-F/PIV3-HN 10 0 5 5 Day 0 & 28 PIV3 14 8 PBS NA NA NA NA
Day 0 & 28 PIV3 15 8 FI-PIV3 NA NA NA NA Day 0 & 28 PIV3 NA
-- not applicable
hMPV Lung and Nose Viral Titration
[0518] Lung and nose homogenates were clarified by centrifugation
and diluted in EMEM. Confluent MK-2 monolayers were infected in
duplicates with diluted homogenates in 24 well plates. After one
hour incubation at 37.degree. C. in a 5% CO.sub.2 incubator, the
wells were overlaid with 0.75% methylcellulose medium. After 7 days
of incubation, the overlays were removed and the cells were fixed
for one hour and air dried for immune-staining. Upon blocking the
wells, mouse anti-hMPV nucleoprotein (N) at a 1:1000 dilution to
each well, followed by horseradish peroxidase (HRP) conjugated goat
anti-mouse IgG diluted at 1:1000. TrueBlue peroxidase substrate was
added to each well and incubated at room temperature for 10 to 15
minutes. Visible plaques were counted and virus titers were
expressed as plaque forming units (pfu) per gram (g) of tissue.
Viral titers were reported as mean+standard deviation (SD) of log
10 transformed values for all animals in a group.
PIV3 Lung and Nose Viral Titration
[0519] Lung and nose homogenates were clarified by centrifugation
and diluted in EMEM. Confluent MA-104 (monkey kidney cells)
monolayers were infected in duplicates with diluted homogenates in
24 well plates. After two-hour incubation at 37.degree. C. in a 5%
CO.sub.2 incubator, the wells were overlaid with 0.75%
methylcellulose medium. After 4 days of incubation, the overlays
were removed and the cells were fixed and stained with 0.1% crystal
violet for one hour and then rinsed and air dried. Plaques were
counted and virus titers were expressed as pfu/g of tissue. Viral
loads were reported as mean+SD of log10 transformed values for all
animals in a group.
hMPV Neutralizing Antibody Assay
[0520] Heat inactivated sera samples were diluted 1:10 with EMEM
and serially diluted further 1:4. Diluted serum samples were
incubated with hMPV/A2 (25-50 pfu) for 1 hour at room temperature
and inoculated in duplicates onto confluent MK-2 monolayers in 24
well plates. After one hour incubation at 37.degree. C. in a 5%
CO.sub.2 incubator, the wells were overlaid with 0.75%
Methylcellulose medium. After 7 days of incubation, the overlays
were removed and the cells were fixed in cold acetone/methanol
solution for one hour and air dried for immune-staining. Upon
blocking the wells with blotto, mouse anti-hMPV N protein at a
1:1000 dilution to each well, followed by HRP conjugated goat
anti-mouse IgG diluted at 1:1000. TrueBlue peroxidase substrate was
added to each well and incubated at room temperature for 10 to 15
minutes. Visible plaques were counted and the corresponding
reciprocal neutralizing antibody titers were determined at the 60%
reduction end-point of the virus control using the statistics
program "plqrd.manual.entry". Neutralizing titers were reported as
mean+/-SD of log 2 transformed titers for all animals in a
group.
PIV3 Neutralizing Antibody Assay (60% Reduction)
[0521] Heat inactivated sera samples were diluted 1:10 with EMEM
and serially diluted further 1:4. Diluted serum samples were
incubated with PIV3 (25-50 pfu) for 1 hour at room temperature and
inoculated in duplicates onto confluent MA-104 monolayers in 24
well plates. After two-hour incubation at 37.degree. C. in a 5%
CO.sub.2 incubator, the wells were overlaid with 0.75%
Methylcellulose medium. After 4 days of incubation, the overlays
were removed and the cells were fixed and stained with 0.1% crystal
violet for one hour and then rinsed and air dried. The
corresponding reciprocal neutralizing antibody titers were
determined at the 60% reduction end-point of the virus control
using a statistics program. Neutralizing titers were reported as
mean+SD of log 2 transformed titers for all animals in a group.
Pulmonary Histopathology
[0522] Lungs were dissected and inflated with 10% neutral buffered
formalin to their normal volume, and then immersed in the same
fixative solution. Following fixation, the lungs were embedded in
paraffin, sectioned and stained with H&E. Four parameters of
pulmonary inflammation were evaluated: peribronchiolitis
(inflammatory cell infiltration around the bronchioles),
perivasculitis (inflammatory cell infiltration around the small
blood vessels), interstitial pneumonia (inflammatory cell
infiltration and thickening of alveolar walls), and alveolitis
(cells within the alveolar spaces). Slides were scored blind on a
0-4 severity scale. The scores were subsequently converted to a
0-100% histopathology scale, and reported as mean+SD of all animals
in a group.
[0523] hMPV neutralizing antibody titers were measured in Day 56
serum from Groups 2-6 (FIG. 4A) and were detected at high levels in
all animals immunized with hMPV-F mRNA (Groups 2-4) as well as at
low levels in animals immunized with FI-hMPV (Group 6). There was a
small dose response to the monovalent hMPV-F vaccine (Group 3 vs.
Group 4). Neutralizing antibody titers were similar in Groups 2 and
3, demonstrating no interference of the anti-hMPV antibody response
by mRNA encoding hPIV3 proteins.
[0524] PIV3 neutralizing antibody titers were measured in Day 56
serum from Groups 9-15 (FIG. 4B) and were detected at high levels
in all animals immunized with PIV3-F and/or PIV3-HN mRNA (Groups
9-13) as well as at low levels in animals immunized with FI-PIV3
(Group 15). There was a small dose response to the PIV3-F/PIV3-HN
vaccine (Group 12 vs. Group 13). Neutralizing antibody titers were
similar in Groups 9 and 12, demonstrating no interference of the
anti-PIV3 antibody response by mRNA encoding hMPV-F. The PIV3-F
vaccine elicited higher antibody titers than the PIV3-HN vaccine
(Group 10 vs. Group 11), suggesting that the PIV3 neutralizing
antibody responses induced by the vaccines containing both PIV3-F
and PIV3-HN (Groups 9, 12, and 13) were likely dominated primarily
by the response to PIV3-F. Among the combination vaccine groups
tested, Group 10, the combination of PIV3-F/hMPV-F showed the
highest level of PIV3 Neutralizing antibody titers.
[0525] The ability of the hMPV/PIV3 mRNA vaccines to protect
against challenge was determined by measuring viral load in lung
and nose from immunized animals 5 days after hMPV intranasal
challenge (Groups 2-6) (FIG. 5A) or PIV3 challenge (Groups 9-15)
(FIG. 5B). High level of virus was detected in PBS control animals
(Groups 5 and 14), but was close to or below the limit of
quantification in all mRNA-immunized animals (Groups 2-4 and 9-13),
demonstrating full protection in both the lung and the nose. The
FI-hMPV vaccine (Group 6) afforded only a small level of protection
against hMPV challenge, and the FI-PIV3 vaccine (Group 15) provided
no protection against PIV3 challenge.
[0526] Lung pathology was scored in tissues obtained 5 days after
hMPV intranasal challenge (Groups 2-6) (FIG. 6A) or PIV3 challenge
(Groups 9-15) (FIG. 6B). All mRNA-immunized animals (Groups 2-4 and
9-13) exhibited lung histopathology scores equivalent to the PBS
controls (Groups 5 and 14), indicating no vaccine-enhanced
respiratory disease (ERD). In contrast, animals vaccinated with the
FI-hMPV (Group 6) or FI-PIV3 (Group 15) positive controls
demonstrated elevated levels of both alveolitis and interstitial
pneumonia after hMPV or PIV3 challenge, respectively.
Example 15: hMPV/hPIV3 African Green Monkey Challenge
[0527] The instant study was designed to show that the hMPV/HPIV3
mRNA vaccine constructs encoding the hMPV F protein and the hPIV3 F
protein induced high levels of neutralizing antibodies in African
green monkeys and reduced the viral titers in the nose and lungs of
the immunized African green monkeys after challenge with hMPV or
hPIV3 viruses. The study design is shown in Table 4 (G=Group).
[0528] Sero-negative (to both hMPV and hPIV3) African green monkeys
were divided into 10 groups (n=3) and hMPV sero-positive or hPIV3
sero-positive African green monkeys were divided into 3 groups,
respectively (n=3). Each sero-negative group was vaccinated with 2
doses of mRNA vaccines on days 0 and 28. Each sero-positive group
was vaccinated with 1 dose of mRNA vaccines on day 0. The mRNA
vaccines were formulated in either MC3 lipids or Compound 1 lipids.
All African green monkeys were monitored for injection site
reactions 4 hours, 24 hours, and 72 hours after each injection and
no erythema or edema was observed in any African green monkey.
[0529] Immunized sero-negative African green monkeys were
challenged with a lethal dose of hMPV or hPIV3 on day 57 post
immunization. The viral titers in the nose and lungs of the
challenged sero-negative African green monkeys were measured on day
5 post challenge and the serum neutralizing antibody titers were
measured one day prior to immunization, and on days 27 and 56 post
immunization. Serum neutralizing antibody titers of sero-positive
African green monkeys were measured 28 days prior to immunization,
on the day of immunizations, and days 14, 42, and 56 post
immunization.
[0530] Sero-negative African green monkeys were completely
protected from hMPV and hPIV3 infection after two doses of the
hMPV/HPIV3 mRNA vaccine (FIGS. 7A-7B). Serum neutralizing antibody
titers induced by the hMPV/HPIV3 mRNA vaccines in African green
monkeys were analyzed. The results show that in sero-negative
African green monkeys, two doses of 200 .mu.g or 100 .mu.g mRNA
vaccine induced high levels of neutralizing antibody titers against
hMPV (FIGS. 8A and 8B, and FIG. 13A), while two doses of 10.mu.
mRNA vaccine induced lower levels of neutralizing antibody titers
against hMPV (FIG. 8C). In hMPV sero-positive African green
monkeys, one dose of 200 .mu.g or 50 .mu.g mRNA vaccine induced
high levels of neutralizing antibody titers against hMPV (FIGS. 9B
and 9C), while the placebo did not induce neutralizing antibodies
(FIG. 9A). Similarly, in sero-negative African green monkeys, two
doses of 200 .mu.s, 100 .mu.g, or 10 .mu.g mRNA vaccine induced
high levels of neutralizing antibody titers against hPIV3 (FIGS.
10A-10C, and FIG. 11A). In hPIV3 sero-positive African green
monkeys, one dose of 200 .mu.g or 50 .mu.s mRNA vaccine induced
high levels of neutralizing antibody titers against hPIV3 (FIGS.
12B and 12C), while the placebo did not induce neutralizing
antibodies (FIG. 12A). Further, mRNA vaccines encoding hPIV3 F
protein induced neutralizing antibody titers that is 3-fold higher
than that of mRNA vaccines encoding hPIV3 HN protein at the same
dosage (FIGS. 11A-11B). However, at day 56 post immunization,
neutralizing antibody titer induced by hPIV3 F protein or HN
protein became comparable (FIG. 14A). hPIV3 mRNA vaccine alone
induced comparable neutralizing antibody titers as the hMPV/HPIV3
mRNA vaccine, indicating that hPIV3 F protein alone is sufficient
to generate strong protective response against hPIV3.
[0531] For sero-positive African green monkeys, a single dose of
hMPV/HPIV3 mRNA vaccine was able to boost neutralizing antibody
titers against hMPV by 8-10 fold (FIG. 13B), and against hPIV3 by
4-10 fold (FIG. 14B) 42 days post immunization.
TABLE-US-00007 TABLE 4 African Green Monkey Challenge Study Design
Challenge G n Vaccine Dose Formulation Vaccine (Day 57) Endpoint
hMPV 1 3 hMPV/PIV 100/100 Compound 1 D0,D28 hMPV Neutra- Nose sero-
2 3 hMPV/PIV 50/50 Compound 1 D0,D28 lizing and positive 3 3
hMPV/PIV 5/5 Compound 1 D0,D28 and Trachea 4 3 PBS NA NA D0,D28
total viral 5 3 hMPV/PIV 100/100 Compound 1 D0,D28 PIV3 IgG titer
by 6 3 hMPV/PIV 50/50 Compound 1 D0,D28 titer: RT- 7 3 hMPV/PIV 5/5
Compound 1 D0,D28 Pre- PCR 8 3 hMPV/PIV- 50/50 Compound 1 D0,D28
bleeds, F Day 27, 9 3 hMPV/PIV-HN 50/50 SM012 D0,D28 Day 56 10 3
PBS NA NA D0,D28 11 3 PBS NA NA D0 Neutralizing antibody titers: 12
3 hMPV/PIV 100/100 Compound 1 D0 Day 28,0,14,42,56 13 3 hMPV/PIV
25/25 Compound 1 D0 PIV3 14 3 PBS NA NA D0 sero- 15 3 hMPV/PIV
100/100 Compound 1 D0 positive 16 3 hMPV/PIV 25/25 Compound 1
D0
Example 16: Immunogenicity of hMPV/hPIV3 mRNA Vaccines in African
Green Monkeys
[0532] Lipid nanoparticle (LNP)-formulated combination of mRNA
encoding the following antigens: [0533] hMPV Fusion (F)
protein(Strain: A/TN92-4) (SEQ ID NO: 4) [0534] PIV3 F protein
(strain: PER/FLA4815/2008) (SEQ ID NO: 5) [0535] PIV3
hemagglutinin-neuraminidase (HN) protein (Strain: 612507167) (SEQ
ID NO: 6)
[0536] The mRNAs were formulated in a mixture of 4 lipids,
including Compound 1;
1,2-dimyristoyl-sn-glycerol, methoxypolyethyleneglycol
(PEG2000-DMG); 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC);
and cholesterol.
[0537] The immunogenicity of the LNP-formulated hMPV/PIV3-F/PIV3-HN
mRNA vaccine was evaluated in African Green Monkeys that had been
experimentally infected with hMPV or PIV3 previously, and therefore
had serum hMPV or PIV3 neutralizing antibody titers prior to
vaccination. African green monkeys previously exposed to hMPV or
PIV3 provide a model of immune memory recall responses to
vaccination that is intended to mimic the responses that can be
anticipated in seropositive human adults. Groups of three
hMPV-exposed (Groups 11-13) or PIV3-exposed (Groups 14-16) AGM were
immunized intramuscularly (IM) a single time on Day 0 with
different dose levels of the hMPV-F/PIV3-F/PIV3-HN vaccine or with
a phosphate-buffered saline (PBS) control, as indicated in Table 5.
The results in previous Example 15 show that PIV3-HN contributes
minimally to the PIV3 neutralizing antibody response. Serum was
collected 28 days before immunization (Day-28), the day of
immunization (Day 0), and 14, 42, and 56 days after immunization.
Serum neutralizing antibody titers to hMPV (Groups 11-13) or PIV3
(Groups 14-16) were measured by 60% plaque reduction neutralization
test (PRNT).
TABLE-US-00008 TABLE 5 previous mRNAdose (ug) Vaccine Group n
infection Vaccine total hMPV-F PIV-F PIV3-HN Schedule 11 3 hMPV PBS
NA NA NA NA Day 0 12 3 hMPV hMPV-F/PIV3-F/PIV3-HN 200 100 50 50 Day
0 13 3 hMPV hMPV-F/PIV3-E/PIV3-HN 50 25 12.5 12.5 Day 0 14 3 PIV3
PBS NA NA NA NA Day 0 15 3 PN3 hMPV-F/PIV3-F/PIV3-HN 200 100 50 50
Day 0 16 3 PIV3 hMPV-F/PIV3-F/PIV3-HN 50 25 12.5 12.5 Day 0 NA --
not applicable
hMPV Neutralizing Antibody Assay
[0538] Heat inactivated sera samples are diluted 1:10 and serially
diluted further 1:4. Diluted serum samples are incubated with
hMPV/A2 (25-50 plaque forming units (pfu)) for 1 hour at room
temperature and inoculated in duplicates onto confluent MK-2
monolayers in 24-well plates. After one hour incubation at
37.degree. C. in a 5% CO.sub.2 incubator, the wells are overlaid
with 0.75% Methylcellulose medium. After 7 days of incubation, the
overlays are removed and washed once in PBS. The cells are fixed in
cold acetone/methanol solution for one hour and air dried for
immuno-staining. The cells are permeabilized in 0.4% Triton-X
solution and incubated in blocking solution (10% bovine serum
albumin). Mouse anti-hMPV nucleoprotein (N) at a 1:1,000 dilution
is added to each well, followed by horseradish peroxidase (HRP)
conjugated rabbit anti-mouse IgG diluted at 1:5,000. AEC chromogen
detection solution is used for coloration after two hours of
incubation or until red plaques are visible. Plaques are counted
and virus titers are expressed as plaque forming units. The
corresponding reciprocal neutralizing antibody titers are
determined at the 60% reduction end-point of the virus control
using a statistics program. Neutralizing titers are reported as
mean+/-SD of log 2 transformed titers for all animals in a group at
a given time point.
PIV3 Neutralizing Antibody Assay
[0539] Heat inactivated sera samples are diluted 1:10 with EMEM and
serially diluted further 1:4. Diluted serum samples are incubated
with PIV3 (25-50 pfu) for 1 hour at room temperature and inoculated
in duplicates onto confluent MA-104 monolayers in 24-well plates.
After two-hour incubation at 37.degree. C. in a 5% CO.sub.2
incubator, the wells are overlaid with 0.75% Methylcellulose
medium. After 4 days of incubation, the overlays are removed and
the cells are fixed and stained with 0.1% crystal violet for one
hour and then rinsed and air dried. The corresponding reciprocal
neutralizing antibody titers are determined at the 60% reduction
end-point of the virus control using a statistics program.
Neutralizing titers are reported as mean+/-SD of log 2 transformed
titers for all animals in a group at a given time point.
[0540] hMPV or PIV3 neutralizing antibody titers could be detected
in all previously-exposed AGM (Groups 11-13 for hMPV and Groups
14-16 for PIV3) and were stable for the 4 weeks preceding
immunization (FIGS. 15A-15B). A single 200 .mu.g dose of the
hMPV-F/PIV3-F/PIV3-HN mRNA vaccine boosted neutralizing antibody
titers to both hMPV (Group 12) and PIV3 (Group 15) by approximately
10 fold. A single 50 .mu.g dose boosted neutralizing antibody
titers to hMPV by approximately 8-fold (Groups 13) and to PIV3 by
approximately 4-fold (Group 16). In all cases the peak neutralizing
antibody response was reached by 14 days post immunization, and was
generally stable for the subsequent 42 days.
[0541] These data show that the hMPV/PIV3 combination vaccine is a
potent booster of neutralizing antibodies primed by hMPV or PIV3
infection in African Green Monkeys.
Example 17. Immunogenicity and Efficacy of hMPV/PIV3 mRNA Vaccines
in African Green Monkeys
[0542] Lipid nanoparticle (LNP)-formulated combinations of mRNA
encoding the following antigens: [0543] hMPV Fusion (F) protein
(Strain: A/TN92-4) (SEQ ID NO: 4) [0544] PIV3 F protein (strain:
PER/FLA4815/2008) (SEQ ID NO: 5) [0545] PIV3
hemagglutinin-neuraminidase (HN) protein (Strain: 612507167) (SEQ
IDNO: 6)
[0546] The mRNAs were formulated in a mixture of 4 lipids,
including Compound 1;
1,2-dimyristoyl-sn-glycerol, methoxypolyethyleneglycol
(PEG2000-DMG); 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC);
and cholesterol.
[0547] The combination vaccine consists of hMPV-F and PIV3-F mRNA
co-formulated at a 1:1 mass ratio in LNP.
[0548] The immunogenicity and efficacy of hMPV/PIV3 mRNA vaccines
was evaluated in the African Green Monkey models of hMPV or PIV3
challenge. Groups of three African Green Monkeys were immunized
with different dose levels of LNP-formulated mRNAs encoding hMPV-F,
PIV3-F, and/or PIV3 HN as indicated in Table 6. Control groups were
inoculated with phosphate-buffered saline (PBS). All animals were
immunized intramuscularly (IM) on Days 0 and 28. Serum was
collected before the first immunization and on Days 27 and 56 for
measurement of neutralizing antibody titers to hMPV (Groups 1-4) or
PIV3 (Groups 5-10) by 60% plaque reduction neutralization test
(PRNT). Animals in groups 1-4 were inoculated intratracheally on
Day 57 with 5.times.10.sup.5 plaque-forming units (pfu) of hMPV
strain NL/1/00(A1) and viral load was determined by plaque assay on
nose and lung samples collected on Day 61 (4 days post challenge).
Animals in groups 5-10 were inoculated intra-nasally and
intratracheally on Day 57 with 1.times.10.sup.6 pfu of PIV3 strain
JS and viral load was determined by plaque assay on nose and lung
samples collected on Day 60 (3 days post challenge).
TABLE-US-00009 TABLE 6 mRNAdose (pg) Vaccine Challenge Group n
Vaccine total hMPV-F PIV3-F PIV3-HN Schedule (Day 57) 1 3
hMPV-F/PIV3-F/PIV3-HN 200 100 50 50 Day 0 & 28 hMPV 2 3
hMPV-F/PIV3-F/PIV3-HN 100 50 25 25 Day 0 & 28 hMPV 3 3
hMPV-F/PIV3-F/PIV3-HN 10 5 2.5 2.5 Day 0 & 28 hMPV 4 3 PBS NA
NA NA NA Day 0 & 28 hMPV 5 3 hMPV-F/PIV3-F/PIV3-HN 200 100 50
50 Day 0 & 28 PIV3 6 3 hMPV-F/PIV3-F/PIV3-HN 100 50 25 25 Day 0
& 28 PIV3 7 3 hMPV-F/PIV3-F/PIV3-HN 10 5 2.5 2.5 Day 0 & 28
PIV3 8 3 hMPV-F/PIV3-F 100 50 50 0 Day 0 & 28 PIV3 9 3
hMPV-F/PIV3-HN 100 50 0 50 Day 0 & 28 PIV3 10 3 PBS NA NA NA NA
Day 0 & 28 PIV3 NA -- not applicable
hMPV Lung and Nose Viral Titration
[0549] Lung and nose homogenates are clarified by centrifugation
and diluted in EMEM. Confluent MK-2 monolayers are infected in
duplicates with diluted homogenates in 24 well plates. After one
hour incubation at 37.degree. C. in a 5% CO.sub.2 incubator, the
wells are overlaid with 0.75% methylcellulose medium. After 7 days
of incubation, the overlays are removed and the cells are fixed for
one hour and air dried for immune-staining. Upon blocking the
wells, mouse anti-hMPV nucoleoprotein (N) at a 1:1000 dilution to
each well, followed by horseradish peroxidase (HRP) conjugated goat
anti-mouse IgG diluted at 1:1000 TrueBlue peroxidase substrate is
added to each well and incubated at room temperature for 10 to 15
minutes. Visible plaques are counted and virus titers are expressed
as pfu per gram (g) of tissue. Viral titers are reported as
mean.+-.standard deviation (SD) of log 10 transformed values for
all animals in a group.
PIV3 Lung and Nose Viral Titration
[0550] Lung and nose homogenates are clarified by centrifugation
and diluted in EMEM. Confluent MA-104 (monkey kidney cells)
monolayers are infected in duplicates with diluted homogenates in
24 well plates. After two hour incubation at 37.degree. C. in a 5%
CO.sub.2 incubator, the wells are overlaid with 0.75%
methylcellulose medium. After 4 days of incubation, the overlays
are removed and the cells are fixed and stained with 0.1% crystal
violet for one hour and then rinsed and air dried. Plaques are
counted and virus titers are expressed as pfu/g of tissue. Viral
loads are reported as mean+/-SD of log 10 transformed values for
all animals in a group.
hMPV Neutralizing Antibody Assay
[0551] Heat inactivated sera samples are diluted 1:10 with OptiMEM
and serially diluted further 1:4. Diluted serum samples are
incubated with hMPV/A2 (25-50 pfu) for 1 hour at room temperature
and inoculated in duplicates onto confluent MK-2 monolayers in
24-well plates. After one hour incubation at 37.degree. C. in a 5%
CO.sub.2 incubator, the wells are overlaid with 0.75%
Methylcellulose medium. After 7 days of incubation, the overlays
are removed and washed once in PBS. The cells are fixed in cold
acetone/methanol solution for one hour and air dried for
immuno-staining. The cells are permeablized in 0.4% Triton-X
solution and incubated in blocking solution (10% bovine serum
albumin). Mouse anti-hMPV N protein at a 1:1,000 dilution is added
to each well, followed by HRP conjugated rabbit anti-mouse IgG
diluted at 1:5,000. AEC chromogen detection solution is used for
coloration after two hours of incubation or until red plaques are
visible. Plaques are counted and virus titers are expressed as
plaque forming units. The corresponding reciprocal neutralizing
antibody titers are determined at the 60% reduction end-point of
the virus control using a statistics program "plqrd.manual.entry".
Neutralizing titers are reported as mean+/-SD of log 2 transformed
titers for all animals in a group at a given time point.
PIV3 Neutralizing Antibody Assay
[0552] Heat inactivated sera samples are diluted 1:10 with EMEM and
serially diluted further 1:4. Diluted serum samples are incubated
with PIV3 (25-50 pfu) for 1 hour at room temperature and inoculated
in duplicates onto confluent MA-104 monolayers in 24 well plates.
After two hour incubation at 37.degree. C. in a 5% CO.sub.2
incubator, the wells are overlaid with 0.75% Methylcellulose
medium. After 4 days of incubation, the overlays are removed and
the cells are fixed and stained with 0.1% crystal violet for one
hour and then rinsed and air dried. The corresponding reciprocal
neutralizing antibody titers are determined at the 60% reduction
end-point of the virus control using a statistics program.
Neutralizing titers are reported as mean+/-SD of log 2 transformed
titers for all animals in a group at a given time point.
Results
[0553] hMPV neutralizing antibodies were detected in serum of the
majority of animals 28 days after the first immunization with the
hMPV-F/PIV3-F/PIV3-HN mRNA vaccine, and titers were boosted by the
second immunization (FIG. 16A). The magnitude of the responses were
quite high in animals dosed with 200 or 100 .mu.g mRNA (Groups 1
and 2; containing 100 and 50 .mu.g of hMPV-F mRNA, respectively),
but was significantly lower in animals dosed with 10 .mu.g mRNA
(Group 3; containing 5 .mu.g of hMPV-F mRNA).
PIV3 neutralizing antibodies were detected in serum of the majority
of animals 28 days after the first immunization with the hMPV/PIV3
mRNA vaccines, and titers were boosted by the second immunization
(FIG. 16B). The magnitude of the responses were quite high in all
groups, although dose dependent (Groups 5-7). The response induced
by the PIV3-F mRNA was equivalent or greater to the response
induced by the PIV3-HN mRNA (Group 8 vs. Group 9), and adding
PIV3-HN to PIV-F did not enhance PIV3 neutralizing antibody titers
(Group 8 vs. Group 5).
[0554] The ability of the hMPV/PIV3 mRNA vaccines to protect
African Green Monkeys against challenge was determined by measuring
viral load in lungs and noses from immunized animals 4 days after
hMPV intratracheal inoculation (Groups 1-4) or 3 days after PIV3
intratracheal and intranasal inoculation (Groups 5-10) (FIGS.
17A-17B). High levels of both viruses were detected in PBS control
animals (Groups 4 and 10), but were below the limit of
quantification in animals immunized with 100 .mu.g or greater mRNA
(Groups 1, 2, 5, 6, 8 and 9), demonstrating that the hMPV/PIV3
combination vaccine affords full protection against both viruses in
the lung and the nose. The 10 .mu.g low dose vaccine (Groups 3 and
7) afforded some, but not complete protection against hMPV and
PIV3. The animals immunized with the hMPV-F/PIV3-F vaccine (Group
8, which does not include PIV3-HN) were also protected from PIV3
challenge, demonstrating that the immune response to the PIV3-F
protein is sufficient for protection against PIV3.
[0555] It should be understood that any of the mRNA sequences
described herein may include a 5' UTR and/or a 3' UTR. The UTR
sequences may be selected from the following sequences, or other
known UTR sequences may be used. It should also be understood that
any of the mRNA constructs described herein may further comprise a
polyA tail and/or cap (e.g., 7mG(5')ppp(5')NlmpNp). Further, while
many of the mRNAs and encoded antigen sequences described herein
include a signal peptide and/or a peptide tag (e.g., C-terminal His
tag), it should be understood that the indicated signal peptide
and/or peptide tag may be substituted for a different signal
peptide and/or peptide tag, or the signal peptide and/or peptide
tag may be omitted.
TABLE-US-00010 5' UTR: (SEQ ID NO: 12)
GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGAGCCACC 3' UTR: (SEQ ID NO:
13) UGAUAAUAGGCUGGAGCCUCGGUGGCCAUGCUUCUUGCCCCUUGGGCCUC
CCCCCAGCCCCUCCUCCCCUUCCUGCACCCGUACCCCCGUGGUCUUUGAA
UAAAGUCUGAGUGGGCGGC
TABLE-US-00011 TABLE 7 Sequences of Antigens encoded by hMPV/HPIV3
mRNA vaccines hmPv F protein SEQ ID NO: 14 consists of from 5' end
to 3' end, 5' UTR SEQ ID NO: 12, mRNA ORF SEQ 14 ID NO: 4, and 3'
UTR SEQ ID NO: 13. Chemistry 1-methylpseudouridine Cap
7mG(5')ppp(5')NlmpNp 5' UTR GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUA
12 AGAGCCACC ORF of DNA Construct
ATGAGCTGGAAGGTGGTGATTATCTTCAGCCTGCTGATTAC 1
ACCTCAACACGGCCTGAAGGAGAGCTACCTGGAAGAGAGC
TGCTCCACCATCACCGAGGGCTACCTGAGCGTGCTGCGGAC
CGGCTGGTACACCAACGTGTTCACCCTGGAGGTGGGCGAC
GTGGAGAACCTGACCTGCAGCGACGGCCCTAGCCTGATCA
AGACCGAGCTGGACCTGACCAAGAGCGCTCTGAGAGAGCT
GAAGACCGTGTCCGCCGACCAGCTGGCCAGAGAGGAACAG
ATCGAGAACCCTCGGCAGAGCAGATTCGTGCTGGGCGCCA
TCGCTCTGGGAGTCGCCGCTGCCGCTGCAGTGACAGCTGGA
GTGGCCATTGCTAAGACCATCAGACTGGAAAGCGAGGTGA
CAGCCATCAACAATGCCCTGAAGAAGACCAACGAGGCCGT
GAGCACCCTGGGCAATGGAGTGAGAGTGCTGGCCACAGCC
GTGCGGGAGCTGAAGGACTTCGTGAGCAAGAACCTGACCA
GAGCCATCAACAAGAACAAGTGCGACATCGATGACCTGAA
GATGGCCGTGAGCTTCTCCCAGTTCAACAGACGGTTCCTGA
ACGTGGTGAGACAGTTCTCCGACAACGCTGGAATCACACCT
GCCATTAGCCTGGACCTGATGACCGACGCCGAGCTGGCTA
GAGCCGTGCCCAACATGCCCACCAGCGCTGGCCAGATCAA
GCTGATGCTGGAGAACAGAGCCATGGTGCGGAGAAAGGGC
TTCGGCATCCTGATTGGGGTGTATGGAAGCTCCGTGATCTA
CATGGTGCAGCTGCCCATCTTCGGCGTGATCGACACACCCT
GCTGGATCGTGAAGGCCGCTCCTAGCTGCTCCGAGAAGAA
AGGAAACTATGCCTGTCTGCTGAGAGAGGACCAGGGCTGG
TACTGCCAGAACGCCGGAAGCACAGTGTACTATCCCAACG
AGAAGGACTGCGAGACCAGAGGCGACCACGTGTTCTGCGA
CACCGCTGCCGGAATCAACGTGGCCGAGCAGAGCAAGGAG
TGCAACATCAACATCAGCACAACCAACTACCCCTGCAAGG
TGAGCACCGGACGGCACCCCATCAGCATGGTGGCTCTGAG
CCCTCTGGGCGCTCTGGTGGCCTGCTATAAGGGCGTGTCCT
GTAGCATCGGCAGCAATCGGGTGGGCATCATCAAGCAGCT
GAACAAGGGATGCTCCTACATCACCAACCAGGACGCCGAC
ACCGTGACCATCGACAACACCGTGTACCAGCTGAGCAAGG
TGGAGGGCGAGCAGCACGTGATCAAGGGCAGACCCGTGAG
CTCCAGCTTCGACCCCATCAAGTTCCCTGAGGACCAGTTCA
ACGTGGCCCTGGACCAGGTGTTTGAGAACATCGAGAACAG
CCAGGCCCTGGTGGACCAGAGCAACAGAATCCTGTCCAGC
GCTGAGAAGGGCAACACCGGCTTCATCATTGTGATCATTCT
GATCGCCGTGCTGGGCAGCTCCATGATCCTGGTGAGCATCT
TCATCATTATCAAGAAGACCAAGAAACCCACCGGAGCCCC
TCCTGAGCTGAGCGGCGTGACCAACAATGGCTTCATTCCCC ACAACTGA ORF of mRNA
AUGAGCUGGAAGGUGGUGAUUAUCUUCAGCCUGCUGAUU 4 Construct
ACACCUCAACACGGCCUGAAGGAGAGCUACCUGGAAGAG
AGCUGCUCCACCAUCACCGAGGGCUACCUGAGCGUGCUGC
GGACCGGCUGGUACACCAACGUGUUCACCCUGGAGGUGG
GCGACGUGGAGAACCUGACCUGCAGCGACGGCCCUAGCC
UGAUCAAGACCGAGCUGGACCUGACCAAGAGCGCUCUGA
GAGAGCUGAAGACCGUGUCCGCCGACCAGCUGGCCAGAG
AGGAACAGAUCGAGAACCCUCGGCAGAGCAGAUUCGUGC
UGGGCGCCAUCGCUCUGGGAGUCGCCGCUGCCGCUGCAG
UGACAGCUGGAGUGGCCAUUGCUAAGACCAUCAGACUGG
AAAGCGAGGUGACAGCCAUCAACAAUGCCCUGAAGAAGA
CCAACGAGGCCGUGAGCACCCUGGGCAAUGGAGUGAGAG
UGCUGGCCACAGCCGUGCGGGAGCUGAAGGACUUCGUGA
GCAAGAACCUGACCAGAGCCAUCAACAAGAACAAGUGCG
ACAUCGAUGACCUGAAGAUGGCCGUGAGCUUCUCCCAGU
UCAACAGACGGUUCCUGAACGUGGUGAGACAGUUCUCCG
ACAACGCUGGAAUCACACCUGCCAUUAGCCUGGACCUGA
UGACCGACGCCGAGCUGGCUAGAGCCGUGCCCAACAUGCC
CACCAGCGCUGGCCAGAUCAAGCUGAUGCUGGAGAACAG
AGCCAUGGUGCGGAGAAAGGGCUUCGGCAUCCUGAUUGG
GGUGUAUGGAAGCUCCGUGAUCUACAUGGUGCAGCUGCC
CAUCUUCGGCGUGAUCGACACACCCUGCUGGAUCGUGAA
GGCCGCUCCUAGCUGCUCCGAGAAGAAAGGAAACUAUGC
CUGUCUGCUGAGAGAGGACCAGGGCUGGUACUGCCAGAA
CGCCGGAAGCACAGUGUACUAUCCCAACGAGAAGGACUG
CGAGACCAGAGGCGACCACGUGUUCUGCGACACCGCUGCC
GGAAUCAACGUGGCCGAGCAGAGCAAGGAGUGCAACAUC
AACAUCAGCACAACCAACUACCCCUGCAAGGUGAGCACCG
GACGGCACCCCAUCAGCAUGGUGGCUCUGAGCCCUCUGG
GCGCUCUGGUGGCCUGCUAUAAGGGCGUGUCCUGUAGCA
UCGGCAGCAAUCGGGUGGGCAUCAUCAAGCAGCUGAACA
AGGGAUGCUCCUACAUCACCAACCAGGACGCCGACACCGU
GACCAUCGACAACACCGUGUACCAGCUGAGCAAGGUGGA
GGGCGAGCAGCACGUGAUCAAGGGCAGACCCGUGAGCUC
CAGCUUCGACCCCAUCAAGUUCCCUGAGGACCAGUUCAAC
GUGGCCCUGGACCAGGUGUUUGAGAACAUCGAGAACAGC
CAGGCCCUGGUGGACCAGAGCAACAGAAUCCUGUCCAGC
GCUGAGAAGGGCAACACCGGCUUCAUCAUUGUGAUCAUU
CUGAUCGCCGUGCUGGGCAGCUCCAUGAUCCUGGUGAGC
AUCUUCAUCAUUAUCAAGAAGACCAAGAAACCCACCGGA
GCCCCUCCUGAGCUGAGCGGCGUGACCAACAAUGGCUUC AUUCCCCACAACUGA 3' UTR
UGAUAAUAGGCUGGAGCCUCGGUGGCCAUGCUUCUUGCC 13
CCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGCACC
CGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCGG C Corresponding amino
MSWKVVIIFSLLITPQHGLKESYLEESCSTITEGYLSVLRTGWY 7 acid sequence
TNVFTLEVGDVENLTCSDGPSLIKTELDLTKSALRELKTVSAD
QLAREEQIENPRQSRFVLGAIALGVAAAAAVTAGVAIAKTIRL
ESEVTAINNALKKTNEAVSTLGNGVRVLATAVRELKDFVSKN
LTRAINKNKCDIDDLKMAVSFSQFNRRFLNVVRQFSDNAGITP
AISLDLMTDAELARAVPNMPTSAGQIKLMLENRAMVRRKGF
GILIGVYGSSVIYMVQLPIFGVIDTPCWIVKAAPSCSEKKGNYA
CLLREDQGWYCQNAGSTVYYPNEKDCETRGDHVFCDTAAGI
NVAEQSKECNINISTTNYPCKVSTGRHPISMVALSPLGALVAC
YKGVSCSIGSNRVGIIKQLNKGCSYITNQDADTVTIDNTVYQL
SKVEGEQHVIKGRPVSSSFDPIKFPEDQFNVALDQVFENIENSQ
ALVDQSNRILSSAEKGNTGFIIVIILIAVLGSSMILVSIFIIIKKTK
KPTGAPPELSGVTNNGFIPHN PolyAtail 100 nt hPIV3 F protein SEQ ID NO:
15 consists of from 5' end to 3' end, 5' UTR SEQ ID NO: 12, mRNA
ORF SEQ 15 ID NO: 5, and 3' UTR SEQ ID NO: 13. Chemistry
1-methylpseudouridine Cap 7mG(5')ppp(5')NlmpNp 5' UTR
GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUA 12 AGAGCCACC ORF of DNA
Construct ATGCCCATCAGCATCCTGCTGATCATCACCACAATGATCAT 2
GGCCAGCCACTGCCAGATCGACATCACCAAGCTGCAGCAC
GTGGGCGTGCTCGTGAACAGCCCCAAGGGCATGAAGATCA
GCCAGAACTTCGAGACACGCTACCTGATCCTGAGCCTGATC
CCCAAGATCGAGGACAGCAACAGCTGCGGCGACCAGCAGA
TCAAGCAGTACAAGCGGCTGCTGGACAGACTGATCATCCC
CCTGTACGACGGCCTGCGGCTGCAGAAAGACGTGATCGTG
ACCAACCAGGAAAGCAACGAGAACACCGACCCCCGGACCG
AGAGATTCTTCGGCGGCGTGATCGGCACAATCGCCCTGGG
AGTGGCCACAAGCGCCCAGATTACAGCCGCTGTGGCCCTG
GTGGAAGCCAAGCAGGCCAGAAGCGACATCGAGAAGCTGA
AAGAGGCCATCCGGGACACCAACAAGGCCGTGCAGAGCGT
GCAGTCCAGCGTGGGCAATCTGATCGTGGCCATCAAGTCCG
TGCAGGACTACGTGAACAAAGAAATCGTGCCCTCTATCGCC
CGGCTGGGCTGTGAAGCTGCCGGACTGCAGCTGGGCATTG
CCCTGACACAGCACTACAGCGAGCTGACCAACATCTTCGGC
GACAACATCGGCAGCCTGCAGGAAAAGGGCATTAAGCTGC
AGGGAATCGCCAGCCTGTACCGCACCAACATCACCGAGAT
CTTCACCACCAGCACCGTGGATAAGTACGACATCTACGACC
TGCTGTTCACCGAGAGCATCAAAGTGCGCGTGATCGACGTG
GACCTGAACGACTACAGCATCACCCTGCAAGTGCGGCTGC
CCCTGCTGACCAGACTGCTGAACACCCAGATCTACAAGGTG
GACAGCATCTCCTACAACATCCAGAACCGCGAGTGGTACA
TCCCTCTGCCCAGCCACATTATGACCAAGGGCGCCTTTCTG
GGCGGAGCCGACGTGAAAGAGTGCATCGAGGCCTTCAGCA
GCTACATCTGCCCCAGCGACCCTGGCTTCGTGCTGAACCAC
GAGATGGAAAGCTGCCTGAGCGGCAACATCAGCCAGTGCC
CCAGAACCACCGTGACCTCCGACATCGTGCCCAGATACGCC
TTCGTGAATGGCGGCGTGGTGGCCAACTGCATCACCACCAC
CTGTACCTGCAACGGCATCGGCAACCGGATCAACCAGCCTC
CCGATCAGGGCGTGAAGATTATCACCCACAAAGAGTGTAA
CACCATCGGCATCAACGGCATGCTGTTCAATACCAACAAA
GAGGGCACCCTGGCCTTCTACACCCCCGACGATATCACCCT
GAACAACTCCGTGGCTCTGGACCCCATCGACATCTCCATCG
AGCTGAACAAGGCCAAGAGCGACCTGGAAGAGTCCAAAGA
GTGGATCCGGCGGAGCAACCAGAAGCTGGACTCTATCGGC
AGCTGGCACCAGAGCAGCACCACCATCATCGTGATCCTGAT
TATGATGATTATCCTGTTCATCATCAACATTACCATCATCAC
TATCGCCATTAAGTACTACCGGATCCAGAAACGGAACCGG
GTGGACCAGAATGACAAGCCCTACGTGCTGACAAACAAG ORF of mRNA
AUGCCCAUCAGCAUCCUGCUGAUCAUCACCACAAUGAUC 5 Construct
AUGGCCAGCCACUGCCAGAUCGACAUCACCAAGCUGCAGC
ACGUGGGCGUGCUCGUGAACAGCCCCAAGGGCAUGAAGA
UCAGCCAGAACUUCGAGACACGCUACCUGAUCCUGAGCC
UGAUCCCCAAGAUCGAGGACAGCAACAGCUGCGGCGACC
AGCAGAUCAAGCAGUACAAGCGGCUGCUGGACAGACUGA
UCAUCCCCCUGUACGACGGCCUGCGGCUGCAGAAAGACG
UGAUCGUGACCAACCAGGAAAGCAACGAGAACACCGACC
CCCGGACCGAGAGAUUCUUCGGCGGCGUGAUCGGCACAA
UCGCCCUGGGAGUGGCCACAAGCGCCCAGAUUACAGCCGC
UGUGGCCCUGGUGGAAGCCAAGCAGGCCAGAAGCGACAU
CGAGAAGCUGAAAGAGGCCAUCCGGGACACCAACAAGGC
CGUGCAGAGCGUGCAGUCCAGCGUGGGCAAUCUGAUCGU
GGCCAUCAAGUCCGUGCAGGACUACGUGAACAAAGAAAU
CGUGCCCUCUAUCGCCCGGCUGGGCUGUGAAGCUGCCGG
ACUGCAGCUGGGCAUUGCCCUGACACAGCACUACAGCGA
GCUGACCAACAUCUUCGGCGACAACAUCGGCAGCCUGCA
GGAAAAGGGCAUUAAGCUGCAGGGAAUCGCCAGCCUGUA
CCGCACCAACAUCACCGAGAUCUUCACCACCAGCACCGUG
GAUAAGUACGACAUCUACGACCUGCUGUUCACCGAGAGC
AUCAAAGUGCGCGUGAUCGACGUGGACCUGAACGACUAC
AGCAUCACCCUGCAAGUGCGGCUGCCCCUGCUGACCAGAC
UGCUGAACACCCAGAUCUACAAGGUGGACAGCAUCUCCU
ACAACAUCCAGAACCGCGAGUGGUACAUCCCUCUGCCCAG
CCACAUUAUGACCAAGGGCGCCUUUCUGGGCGGAGCCGA
CGUGAAAGAGUGCAUCGAGGCCUUCAGCAGCUACAUCUG
CCCCAGCGACCCUGGCUUCGUGCUGAACCACGAGAUGGA
AAGCUGCCUGAGCGGCAACAUCAGCCAGUGCCCCAGAACC
ACCGUGACCUCCGACAUCGUGCCCAGAUACGCCUUCGUGA
AUGGCGGCGUGGUGGCCAACUGCAUCACCACCACCUGUA
CCUGCAACGGCAUCGGCAACCGGAUCAACCAGCCUCCCGA
UCAGGGCGUGAAGAUUAUCACCCACAAAGAGUGUAACAC
CAUCGGCAUCAACGGCAUGCUGUUCAAUACCAACAAAGA
GGGCACCCUGGCCUUCUACACCCCCGACGAUAUCACCCUG
AACAACUCCGUGGCUCUGGACCCCAUCGACAUCUCCAUCG
AGCUGAACAAGGCCAAGAGCGACCUGGAAGAGUCCAAAG
AGUGGAUCCGGCGGAGCAACCAGAAGCUGGACUCUAUCG
GCAGCUGGCACCAGAGCAGCACCACCAUCAUCGUGAUCCU
GAUUAUGAUGAUUAUCCUGUUCAUCAUCAACAUUACCAU
CAUCACUAUCGCCAUUAAGUACUACCGGAUCCAGAAACG
GAACCGGGUGGACCAGAAUGACAAGCCCUACGUGCUGAC AAACAAG 3' UTR
UGAUAAUAGGCUGGAGCCUCGGUGGCCAUGCUUCUUGCC 13
CCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGCACC
CGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCGG C Corresponding amino
MPISILLIITTMIMASHCQIDITKLQHVGVLVNSPKGMKISQNFE 8 acid sequence
TRYLILSLIPKIEDSNSCGDQQIKQYKRLLDRLIIPLYDGLRLQK
DVIVTNQESNENTDPRTERFFGGVIGTIALGVATSAQITAAVAL
VEAKQARSDIEKLKEAIRDTNKAVQSVQSSVGNLIVAIKSVQD
YVNKEIVPSIARLGCEAAGLQLGIALTQHYSELTNIFGDNIGSL
QEKGIKLQGIASLYRTNITEIFTTSTVDKYDIYDLLFTESIKVRV
IDVDLNDYSITLQVRLPLLTRLLNTQIYKVDSISYNIQNREWYI
PLPSHIMTKGAFLGGADVKECIEAFSSYICPSDPGFVLNHEMES
CLSGNISQCPRTTVTSDIVPRYAFVNGGVVANCITTTCTCNGIG
NRINQPPDQGVKIITHKECNTIGINGMLFNTNKEGTLAFYTPDD
ITLNNSVALDPIDISIELNKAKSDLEESKEWIRRSNQKLDSIGSW
HQSSTTIIVILIMMIILFIINITITTIAIKYYRIQKRNRVDQNDKPYV LTNK PolyAtail 100
nt hPIV3 HN protein SEQ ID NO: 16 consists of from 5' end to 3'
end, 5' UTR SEQ ID NO: 12, mRNA ORF SEQ 16 ID NO: 6, and 3' UTR SEQ
ID NO: 13. Chemistry 1-methylpseudouridinc Cap 7mG(5')ppp(5')NlmpNp
5'UTR GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUA 12 AGAGCCACC
ORF of DNA Construct ATGGAATACTGGAAGCACACCAACCACGGCAAGGACGCCG 3
GCAACGAGCTGGAAACCAGCACAGCCACACACGGCAACAA
GCTGACCAACAAGATCACCTACATCCTGTGGACCATCACCC
TGGTGCTGCTGAGCATCGTGTTCATCATCGTGCTGACCAAT
AGCATCAAGAGCGAGAAGGCCAGAGAGAGCCTGCTGCAGG
ACATCAACAACGAGTTCATGGAAGTGACCGAGAAGATCCA
GGTGGCCAGCGACAACACCAACGACCTGATCCAGAGCGGC
GTGAACACCCGGCTGCTGACCATCCAGAGCCACGTGCAGA
ACTACATCCCCATCAGCCTGACCCAGCAGATCAGCGACCTG
CGGAAGTTCATCAGCGAGATCACCATCCGGAACGACAACC
AGGAAGTGCCCCCCCAGAGAATCACCCACGACGTGGGCAT
CAAGCCCCTGAACCCCGACGATTTCTGGCGGTGTACAAGCG
GCCTGCCCAGCCTGATGAAGACCCCCAAGATCCGGCTGAT
GCCTGGCCCTGGACTGCTGGCCATGCCTACCACAGTGGATG
GCTGTGTGCGGACCCCCAGCCTCGTGATCAACGATCTGATC
TACGCCTACACCAGCAACCTGATCACCCGGGGCTGCCAGG
ATATCGGCAAGAGCTACCAGGTGCTGCAGATCGGCATCAT
CACCGTGAACTCCGACCTGGTGCCCGACCTGAACCCTCGGA
TCAGCCACACCTTCAACATCAACGACAACAGAAAGAGCTG
CAGCCTGGCTCTGCTGAACACCGACGTGTACCAGCTGTGCA
GCACCCCCAAGGTGGACGAGAGAAGCGACTACGCCAGCAG
CGGCATCGAGGATATCGTGCTGGACATCGTGAACTACGAC
GGCAGCATCAGCACCACCCGGTTCAAGAACAACAACATCA
GCTTCGACCAGCCCTACGCCGCCCTGTACCCTTCTGTGGGC
CCTGGCATCTACTACAAGGGCAAGATCATCTTCCTGGGCTA
CGGCGGCCTGGAACACCCCATCAACGAGAACGCCATCTGC
AACACCACCGGCTGCCCTGGCAAGACCCAGAGAGACTGCA
ATCAGGCCAGCCACAGCCCCTGGTTCAGCGACCGCAGAAT
GGTCAACTCTATCATCGTGGTGGACAAGGGCCTGAACAGC
GTGCCCAAGCTGAAAGTGTGGACAATCAGCATGCGCCAGA
ACTACTGGGGCAGCGAGGGCAGACTTCTGCTGCTGGGAAA
CAAGATCTACATCTACACCCGGTCCACCAGCTGGCACAGCA
AACTGCAGCTGGGAATCATCGACATCACCGACTACAGCGA
CATCCGGATCAAGTGGACCTGGCACAACGTGCTGAGCAGA
CCCGGCAACAATGAGTGCCCTTGGGGCCACAGCTGCCCCG
ATGGATGTATCACCGGCGTGTACACCGACGCCTACCCCCTG
AATCCTACCGGCTCCATCGTGTCCAGCGTGATCCTGGACAG
CCAGAAAAGCAGAGTGAACCCCGTGATCACATACAGCACC
GCCACCGAGAGAGTGAACGAACTGGCCATCAGAAACAAGA
CCCTGAGCGCCGGCTACACCACCACAAGCTGCATCACACA
CTACAACAAGGGCTACTGCTTCCACATCGTGGAAATCAACC
ACAAGTCCCTGAACACCTTCCAGCCCATGCTGTTCAAGACC GAGATCCCCAAGAGCTGCTCC ORF
of mRNA AUGGAAUACUGGAAGCACACCAACCACGGCAAGGACGCC 6 Construct
GGCAACGAGCUGGAAACCAGCACAGCCACACACGGCAAC
AAGCUGACCAACAAGAUCACCUACAUCCUGUGGACCAUC
ACCCUGGUGCUGCUGAGCAUCGUGUUCAUCAUCGUGCUG
ACCAAUAGCAUCAAGAGCGAGAAGGCCAGAGAGAGCCUG
CUGCAGGACAUCAACAACGAGUUCAUGGAAGUGACCGAG
AAGAUCCAGGUGGCCAGCGACAACACCAACGACCUGAUC
CAGAGCGGCGUGAACACCCGGCUGCUGACCAUCCAGAGCC
ACGUGCAGAACUACAUCCCCAUCAGCCUGACCCAGCAGAU
CAGCGACCUGCGGAAGUUCAUCAGCGAGAUCACCAUCCG
GAACGACAACCAGGAAGUGCCCCCCCAGAGAAUCACCCAC
GACGUGGGCAUCAAGCCCCUGAACCCCGACGAUUUCUGG
CGGUGUACAAGCGGCCUGCCCAGCCUGAUGAAGACCCCCA
AGAUCCGGCUGAUGCCUGGCCCUGGACUGCUGGCCAUGC
CUACCACAGUGGAUGGCUGUGUGCGGACCCCCAGCCUCG
UGAUCAACGAUCUGAUCUACGCCUACACCAGCAACCUGA
UCACCCGGGGCUGCCAGGAUAUCGGCAAGAGCUACCAGG
UGCUGCAGAUCGGCAUCAUCACCGUGAACUCCGACCUGG
UGCCCGACCUGAACCCUCGGAUCAGCCACACCUUCAACAU
CAACGACAACAGAAAGAGCUGCAGCCUGGCUCUGCUGAA
CACCGACGUGUACCAGCUGUGCAGCACCCCCAAGGUGGAC
GAGAGAAGCGACUACGCCAGCAGCGGCAUCGAGGAUAUC
GUGCUGGACAUCGUGAACUACGACGGCAGCAUCAGCACC
ACCCGGUUCAAGAACAACAACAUCAGCUUCGACCAGCCCU
ACGCCGCCCUGUACCCUUCUGUGGGCCCUGGCAUCUACUA
CAAGGGCAAGAUCAUCUUCCUGGGCUACGGCGGCCUGGA
ACACCCCAUCAACGAGAACGCCAUCUGCAACACCACCGGC
UGCCCUGGCAAGACCCAGAGAGACUGCAAUCAGGCCAGC
CACAGCCCCUGGUUCAGCGACCGCAGAAUGGUCAACUCU
AUCAUCGUGGUGGACAAGGGCCUGAACAGCGUGCCCAAG
CUGAAAGUGUGGACAAUCAGCAUGCGCCAGAACUACUGG
GGCAGCGAGGGCAGACUUCUGCUGCUGGGAAACAAGAUC
UACAUCUACACCCGGUCCACCAGCUGGCACAGCAAACUGC
AGCUGGGAAUCAUCGACAUCACCGACUACAGCGACAUCC
GGAUCAAGUGGACCUGGCACAACGUGCUGAGCAGACCCG
GCAACAAUGAGUGCCCUUGGGGCCACAGCUGCCCCGAUG
GAUGUAUCACCGGCGUGUACACCGACGCCUACCCCCUGAA
UCCUACCGGCUCCAUCGUGUCCAGCGUGAUCCUGGACAGC
CAGAAAAGCAGAGUGAACCCCGUGAUCACAUACAGCACC
GCCACCGAGAGAGUGAACGAACUGGCCAUCAGAAACAAG
ACCCUGAGCGCCGGCUACACCACCACAAGCUGCAUCACAC
ACUACAACAAGGGCUACUGCUUCCACAUCGUGGAAAUCA
ACCACAAGUCCCUGAACACCUUCCAGCCCAUGCUGUUCAA GACCGAGAUCCCCAAGAGCUGCUCC
3' UTR UGAUAAUAGGCUGGAGCCUCGGUGGCCAUGCUUCUUGCC 13
CCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGCACC
CGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCGG C Corresponding amino
MEYWKHTNHGKDAGNELETSTATHGNKLTNKITYILWTITLV 9 add sequence
LLSIVFIIVLTNSIKSEKARESLLQDINNEFMEVTEKIQVASDNT
NDLIQSGVNTRLLTIQSHVQNYIPTSLTQQISDLRKFTSEITTRND
NQEVPPQRITHDVGIKPLNPDDFWRCTSGLPSLMKTPKIRLMP
GPGLLAMPTTVDGCVRTPSLVINDLIYAYTSNLITRGCQDIGKS
YQVLQIGIITVNSDLVPDLNPRISHTFNINDNRKSCSLALLNTD
VYQLCSTPKVDERSDYASSGIEDIVLDIVNYDGSISTTRFKNNN
ISFDQPYAALYPSVGPGIYYKGKIIFLGYGGLEHPINENAICNTT
GCPGKTQRDCNQASHSPWFSDRRMVNSIIVVDKGLNSVPKLK
VWTISMRQNYWGSEGRLLLLGNKIYIYTRSTSWHSKLQLGIID
ITDYSDIRIKWTWHNVLSRPGNNECPWGHSCPDGCITGVYTD
AYPLNPTGSIVSSVILDSQKSRVNPVITYSTATERVNELAIRNK
TLSAGYTTTSCITHYNKGYCFHIVEINHKSLNTFQPMLFKTEIP KSCS PolyAtail 100
nt
[0556] International Patent Application No. PCT/US2016/58327 is
herein incorporated by reference in its entirety.
[0557] All references, patents and patent applications disclosed
herein are incorporated by reference with respect to the subject
matter for which each is cited, which in some cases may encompass
the entirety of the document.
[0558] The indefinite articles "a" and "an," as used herein in the
specification and in the claims, unless clearly indicated to the
contrary, should be understood to mean "at least one."
[0559] It should also be understood that, unless clearly indicated
to the contrary, in any methods claimed herein that include more
than one step or act, the order of the steps or acts of the method
is not necessarily limited to the order in which the steps or acts
of the method are recited.
[0560] In the claims, as well as in the specification above, all
transitional phrases such as "comprising," "including," "carrying,"
"having," "containing," "involving," "holding," "composed of," and
the like are to be understood to be open-ended, i.e., to mean
including but not limited to. Only the transitional phrases
"consisting of" and "consisting essentially of" shall be closed or
semi-closed transitional phrases, respectively, as set forth in the
United States Patent Office Manual of Patent Examining Procedures,
Section 2111.03.
Sequence CWU 1
1
2511620DNAArtificial SequenceSynthetic Polynucleotide 1atgagctgga
aggtggtgat tatcttcagc ctgctgatta cacctcaaca cggcctgaag 60gagagctacc
tggaagagag ctgctccacc atcaccgagg gctacctgag cgtgctgcgg
120accggctggt acaccaacgt gttcaccctg gaggtgggcg acgtggagaa
cctgacctgc 180agcgacggcc ctagcctgat caagaccgag ctggacctga
ccaagagcgc tctgagagag 240ctgaagaccg tgtccgccga ccagctggcc
agagaggaac agatcgagaa ccctcggcag 300agcagattcg tgctgggcgc
catcgctctg ggagtcgccg ctgccgctgc agtgacagct 360ggagtggcca
ttgctaagac catcagactg gaaagcgagg tgacagccat caacaatgcc
420ctgaagaaga ccaacgaggc cgtgagcacc ctgggcaatg gagtgagagt
gctggccaca 480gccgtgcggg agctgaagga cttcgtgagc aagaacctga
ccagagccat caacaagaac 540aagtgcgaca tcgatgacct gaagatggcc
gtgagcttct cccagttcaa cagacggttc 600ctgaacgtgg tgagacagtt
ctccgacaac gctggaatca cacctgccat tagcctggac 660ctgatgaccg
acgccgagct ggctagagcc gtgcccaaca tgcccaccag cgctggccag
720atcaagctga tgctggagaa cagagccatg gtgcggagaa agggcttcgg
catcctgatt 780ggggtgtatg gaagctccgt gatctacatg gtgcagctgc
ccatcttcgg cgtgatcgac 840acaccctgct ggatcgtgaa ggccgctcct
agctgctccg agaagaaagg aaactatgcc 900tgtctgctga gagaggacca
gggctggtac tgccagaacg ccggaagcac agtgtactat 960cccaacgaga
aggactgcga gaccagaggc gaccacgtgt tctgcgacac cgctgccgga
1020atcaacgtgg ccgagcagag caaggagtgc aacatcaaca tcagcacaac
caactacccc 1080tgcaaggtga gcaccggacg gcaccccatc agcatggtgg
ctctgagccc tctgggcgct 1140ctggtggcct gctataaggg cgtgtcctgt
agcatcggca gcaatcgggt gggcatcatc 1200aagcagctga acaagggatg
ctcctacatc accaaccagg acgccgacac cgtgaccatc 1260gacaacaccg
tgtaccagct gagcaaggtg gagggcgagc agcacgtgat caagggcaga
1320cccgtgagct ccagcttcga ccccatcaag ttccctgagg accagttcaa
cgtggccctg 1380gaccaggtgt ttgagaacat cgagaacagc caggccctgg
tggaccagag caacagaatc 1440ctgtccagcg ctgagaaggg caacaccggc
ttcatcattg tgatcattct gatcgccgtg 1500ctgggcagct ccatgatcct
ggtgagcatc ttcatcatta tcaagaagac caagaaaccc 1560accggagccc
ctcctgagct gagcggcgtg accaacaatg gcttcattcc ccacaactga
162021617DNAArtificial SequenceSynthetic Polynucleotide 2atgcccatca
gcatcctgct gatcatcacc acaatgatca tggccagcca ctgccagatc 60gacatcacca
agctgcagca cgtgggcgtg ctcgtgaaca gccccaaggg catgaagatc
120agccagaact tcgagacacg ctacctgatc ctgagcctga tccccaagat
cgaggacagc 180aacagctgcg gcgaccagca gatcaagcag tacaagcggc
tgctggacag actgatcatc 240cccctgtacg acggcctgcg gctgcagaaa
gacgtgatcg tgaccaacca ggaaagcaac 300gagaacaccg acccccggac
cgagagattc ttcggcggcg tgatcggcac aatcgccctg 360ggagtggcca
caagcgccca gattacagcc gctgtggccc tggtggaagc caagcaggcc
420agaagcgaca tcgagaagct gaaagaggcc atccgggaca ccaacaaggc
cgtgcagagc 480gtgcagtcca gcgtgggcaa tctgatcgtg gccatcaagt
ccgtgcagga ctacgtgaac 540aaagaaatcg tgccctctat cgcccggctg
ggctgtgaag ctgccggact gcagctgggc 600attgccctga cacagcacta
cagcgagctg accaacatct tcggcgacaa catcggcagc 660ctgcaggaaa
agggcattaa gctgcaggga atcgccagcc tgtaccgcac caacatcacc
720gagatcttca ccaccagcac cgtggataag tacgacatct acgacctgct
gttcaccgag 780agcatcaaag tgcgcgtgat cgacgtggac ctgaacgact
acagcatcac cctgcaagtg 840cggctgcccc tgctgaccag actgctgaac
acccagatct acaaggtgga cagcatctcc 900tacaacatcc agaaccgcga
gtggtacatc cctctgccca gccacattat gaccaagggc 960gcctttctgg
gcggagccga cgtgaaagag tgcatcgagg ccttcagcag ctacatctgc
1020cccagcgacc ctggcttcgt gctgaaccac gagatggaaa gctgcctgag
cggcaacatc 1080agccagtgcc ccagaaccac cgtgacctcc gacatcgtgc
ccagatacgc cttcgtgaat 1140ggcggcgtgg tggccaactg catcaccacc
acctgtacct gcaacggcat cggcaaccgg 1200atcaaccagc ctcccgatca
gggcgtgaag attatcaccc acaaagagtg taacaccatc 1260ggcatcaacg
gcatgctgtt caataccaac aaagagggca ccctggcctt ctacaccccc
1320gacgatatca ccctgaacaa ctccgtggct ctggacccca tcgacatctc
catcgagctg 1380aacaaggcca agagcgacct ggaagagtcc aaagagtgga
tccggcggag caaccagaag 1440ctggactcta tcggcagctg gcaccagagc
agcaccacca tcatcgtgat cctgattatg 1500atgattatcc tgttcatcat
caacattacc atcatcacta tcgccattaa gtactaccgg 1560atccagaaac
ggaaccgggt ggaccagaat gacaagccct acgtgctgac aaacaag
161731716DNAArtificial SequenceSynthetic Polynucleotide 3atggaatact
ggaagcacac caaccacggc aaggacgccg gcaacgagct ggaaaccagc 60acagccacac
acggcaacaa gctgaccaac aagatcacct acatcctgtg gaccatcacc
120ctggtgctgc tgagcatcgt gttcatcatc gtgctgacca atagcatcaa
gagcgagaag 180gccagagaga gcctgctgca ggacatcaac aacgagttca
tggaagtgac cgagaagatc 240caggtggcca gcgacaacac caacgacctg
atccagagcg gcgtgaacac ccggctgctg 300accatccaga gccacgtgca
gaactacatc cccatcagcc tgacccagca gatcagcgac 360ctgcggaagt
tcatcagcga gatcaccatc cggaacgaca accaggaagt gcccccccag
420agaatcaccc acgacgtggg catcaagccc ctgaaccccg acgatttctg
gcggtgtaca 480agcggcctgc ccagcctgat gaagaccccc aagatccggc
tgatgcctgg ccctggactg 540ctggccatgc ctaccacagt ggatggctgt
gtgcggaccc ccagcctcgt gatcaacgat 600ctgatctacg cctacaccag
caacctgatc acccggggct gccaggatat cggcaagagc 660taccaggtgc
tgcagatcgg catcatcacc gtgaactccg acctggtgcc cgacctgaac
720cctcggatca gccacacctt caacatcaac gacaacagaa agagctgcag
cctggctctg 780ctgaacaccg acgtgtacca gctgtgcagc acccccaagg
tggacgagag aagcgactac 840gccagcagcg gcatcgagga tatcgtgctg
gacatcgtga actacgacgg cagcatcagc 900accacccggt tcaagaacaa
caacatcagc ttcgaccagc cctacgccgc cctgtaccct 960tctgtgggcc
ctggcatcta ctacaagggc aagatcatct tcctgggcta cggcggcctg
1020gaacacccca tcaacgagaa cgccatctgc aacaccaccg gctgccctgg
caagacccag 1080agagactgca atcaggccag ccacagcccc tggttcagcg
accgcagaat ggtcaactct 1140atcatcgtgg tggacaaggg cctgaacagc
gtgcccaagc tgaaagtgtg gacaatcagc 1200atgcgccaga actactgggg
cagcgagggc agacttctgc tgctgggaaa caagatctac 1260atctacaccc
ggtccaccag ctggcacagc aaactgcagc tgggaatcat cgacatcacc
1320gactacagcg acatccggat caagtggacc tggcacaacg tgctgagcag
acccggcaac 1380aatgagtgcc cttggggcca cagctgcccc gatggatgta
tcaccggcgt gtacaccgac 1440gcctaccccc tgaatcctac cggctccatc
gtgtccagcg tgatcctgga cagccagaaa 1500agcagagtga accccgtgat
cacatacagc accgccaccg agagagtgaa cgaactggcc 1560atcagaaaca
agaccctgag cgccggctac accaccacaa gctgcatcac acactacaac
1620aagggctact gcttccacat cgtggaaatc aaccacaagt ccctgaacac
cttccagccc 1680atgctgttca agaccgagat ccccaagagc tgctcc
171641620RNAArtificial SequenceSynthetic Polynucleotide 4augagcugga
agguggugau uaucuucagc cugcugauua caccucaaca cggccugaag 60gagagcuacc
uggaagagag cugcuccacc aucaccgagg gcuaccugag cgugcugcgg
120accggcuggu acaccaacgu guucacccug gaggugggcg acguggagaa
ccugaccugc 180agcgacggcc cuagccugau caagaccgag cuggaccuga
ccaagagcgc ucugagagag 240cugaagaccg uguccgccga ccagcuggcc
agagaggaac agaucgagaa cccucggcag 300agcagauucg ugcugggcgc
caucgcucug ggagucgccg cugccgcugc agugacagcu 360ggaguggcca
uugcuaagac caucagacug gaaagcgagg ugacagccau caacaaugcc
420cugaagaaga ccaacgaggc cgugagcacc cugggcaaug gagugagagu
gcuggccaca 480gccgugcggg agcugaagga cuucgugagc aagaaccuga
ccagagccau caacaagaac 540aagugcgaca ucgaugaccu gaagauggcc
gugagcuucu cccaguucaa cagacgguuc 600cugaacgugg ugagacaguu
cuccgacaac gcuggaauca caccugccau uagccuggac 660cugaugaccg
acgccgagcu ggcuagagcc gugcccaaca ugcccaccag cgcuggccag
720aucaagcuga ugcuggagaa cagagccaug gugcggagaa agggcuucgg
cauccugauu 780gggguguaug gaagcuccgu gaucuacaug gugcagcugc
ccaucuucgg cgugaucgac 840acacccugcu ggaucgugaa ggccgcuccu
agcugcuccg agaagaaagg aaacuaugcc 900ugucugcuga gagaggacca
gggcugguac ugccagaacg ccggaagcac aguguacuau 960cccaacgaga
aggacugcga gaccagaggc gaccacgugu ucugcgacac cgcugccgga
1020aucaacgugg ccgagcagag caaggagugc aacaucaaca ucagcacaac
caacuacccc 1080ugcaagguga gcaccggacg gcaccccauc agcauggugg
cucugagccc ucugggcgcu 1140cugguggccu gcuauaaggg cguguccugu
agcaucggca gcaaucgggu gggcaucauc 1200aagcagcuga acaagggaug
cuccuacauc accaaccagg acgccgacac cgugaccauc 1260gacaacaccg
uguaccagcu gagcaaggug gagggcgagc agcacgugau caagggcaga
1320cccgugagcu ccagcuucga ccccaucaag uucccugagg accaguucaa
cguggcccug 1380gaccaggugu uugagaacau cgagaacagc caggcccugg
uggaccagag caacagaauc 1440cuguccagcg cugagaaggg caacaccggc
uucaucauug ugaucauucu gaucgccgug 1500cugggcagcu ccaugauccu
ggugagcauc uucaucauua ucaagaagac caagaaaccc 1560accggagccc
cuccugagcu gagcggcgug accaacaaug gcuucauucc ccacaacuga
162051617RNAArtificial SequenceSynthetic Polynucleotide 5augcccauca
gcauccugcu gaucaucacc acaaugauca uggccagcca cugccagauc 60gacaucacca
agcugcagca cgugggcgug cucgugaaca gccccaaggg caugaagauc
120agccagaacu ucgagacacg cuaccugauc cugagccuga uccccaagau
cgaggacagc 180aacagcugcg gcgaccagca gaucaagcag uacaagcggc
ugcuggacag acugaucauc 240ccccuguacg acggccugcg gcugcagaaa
gacgugaucg ugaccaacca ggaaagcaac 300gagaacaccg acccccggac
cgagagauuc uucggcggcg ugaucggcac aaucgcccug 360ggaguggcca
caagcgccca gauuacagcc gcuguggccc ugguggaagc caagcaggcc
420agaagcgaca ucgagaagcu gaaagaggcc auccgggaca ccaacaaggc
cgugcagagc 480gugcagucca gcgugggcaa ucugaucgug gccaucaagu
ccgugcagga cuacgugaac 540aaagaaaucg ugcccucuau cgcccggcug
ggcugugaag cugccggacu gcagcugggc 600auugcccuga cacagcacua
cagcgagcug accaacaucu ucggcgacaa caucggcagc 660cugcaggaaa
agggcauuaa gcugcaggga aucgccagcc uguaccgcac caacaucacc
720gagaucuuca ccaccagcac cguggauaag uacgacaucu acgaccugcu
guucaccgag 780agcaucaaag ugcgcgugau cgacguggac cugaacgacu
acagcaucac ccugcaagug 840cggcugcccc ugcugaccag acugcugaac
acccagaucu acaaggugga cagcaucucc 900uacaacaucc agaaccgcga
gugguacauc ccucugccca gccacauuau gaccaagggc 960gccuuucugg
gcggagccga cgugaaagag ugcaucgagg ccuucagcag cuacaucugc
1020cccagcgacc cuggcuucgu gcugaaccac gagauggaaa gcugccugag
cggcaacauc 1080agccagugcc ccagaaccac cgugaccucc gacaucgugc
ccagauacgc cuucgugaau 1140ggcggcgugg uggccaacug caucaccacc
accuguaccu gcaacggcau cggcaaccgg 1200aucaaccagc cucccgauca
gggcgugaag auuaucaccc acaaagagug uaacaccauc 1260ggcaucaacg
gcaugcuguu caauaccaac aaagagggca cccuggccuu cuacaccccc
1320gacgauauca cccugaacaa cuccguggcu cuggacccca ucgacaucuc
caucgagcug 1380aacaaggcca agagcgaccu ggaagagucc aaagagugga
uccggcggag caaccagaag 1440cuggacucua ucggcagcug gcaccagagc
agcaccacca ucaucgugau ccugauuaug 1500augauuaucc uguucaucau
caacauuacc aucaucacua ucgccauuaa guacuaccgg 1560auccagaaac
ggaaccgggu ggaccagaau gacaagcccu acgugcugac aaacaag
161761716RNAArtificial SequenceSynthetic Polynucleotide 6auggaauacu
ggaagcacac caaccacggc aaggacgccg gcaacgagcu ggaaaccagc 60acagccacac
acggcaacaa gcugaccaac aagaucaccu acauccugug gaccaucacc
120cuggugcugc ugagcaucgu guucaucauc gugcugacca auagcaucaa
gagcgagaag 180gccagagaga gccugcugca ggacaucaac aacgaguuca
uggaagugac cgagaagauc 240cagguggcca gcgacaacac caacgaccug
auccagagcg gcgugaacac ccggcugcug 300accauccaga gccacgugca
gaacuacauc cccaucagcc ugacccagca gaucagcgac 360cugcggaagu
ucaucagcga gaucaccauc cggaacgaca accaggaagu gcccccccag
420agaaucaccc acgacguggg caucaagccc cugaaccccg acgauuucug
gcgguguaca 480agcggccugc ccagccugau gaagaccccc aagauccggc
ugaugccugg cccuggacug 540cuggccaugc cuaccacagu ggauggcugu
gugcggaccc ccagccucgu gaucaacgau 600cugaucuacg ccuacaccag
caaccugauc acccggggcu gccaggauau cggcaagagc 660uaccaggugc
ugcagaucgg caucaucacc gugaacuccg accuggugcc cgaccugaac
720ccucggauca gccacaccuu caacaucaac gacaacagaa agagcugcag
ccuggcucug 780cugaacaccg acguguacca gcugugcagc acccccaagg
uggacgagag aagcgacuac 840gccagcagcg gcaucgagga uaucgugcug
gacaucguga acuacgacgg cagcaucagc 900accacccggu ucaagaacaa
caacaucagc uucgaccagc ccuacgccgc ccuguacccu 960ucugugggcc
cuggcaucua cuacaagggc aagaucaucu uccugggcua cggcggccug
1020gaacacccca ucaacgagaa cgccaucugc aacaccaccg gcugcccugg
caagacccag 1080agagacugca aucaggccag ccacagcccc ugguucagcg
accgcagaau ggucaacucu 1140aucaucgugg uggacaaggg ccugaacagc
gugcccaagc ugaaagugug gacaaucagc 1200augcgccaga acuacugggg
cagcgagggc agacuucugc ugcugggaaa caagaucuac 1260aucuacaccc
gguccaccag cuggcacagc aaacugcagc ugggaaucau cgacaucacc
1320gacuacagcg acauccggau caaguggacc uggcacaacg ugcugagcag
acccggcaac 1380aaugagugcc cuuggggcca cagcugcccc gauggaugua
ucaccggcgu guacaccgac 1440gccuaccccc ugaauccuac cggcuccauc
guguccagcg ugauccugga cagccagaaa 1500agcagaguga accccgugau
cacauacagc accgccaccg agagagugaa cgaacuggcc 1560aucagaaaca
agacccugag cgccggcuac accaccacaa gcugcaucac acacuacaac
1620aagggcuacu gcuuccacau cguggaaauc aaccacaagu cccugaacac
cuuccagccc 1680augcuguuca agaccgagau ccccaagagc ugcucc
17167539PRTArtificial SequenceSynthetic Polypeptide 7Met Ser Trp
Lys Val Val Ile Ile Phe Ser Leu Leu Ile Thr Pro Gln1 5 10 15His Gly
Leu Lys Glu Ser Tyr Leu Glu Glu Ser Cys Ser Thr Ile Thr 20 25 30Glu
Gly Tyr Leu Ser Val Leu Arg Thr Gly Trp Tyr Thr Asn Val Phe 35 40
45Thr Leu Glu Val Gly Asp Val Glu Asn Leu Thr Cys Ser Asp Gly Pro
50 55 60Ser Leu Ile Lys Thr Glu Leu Asp Leu Thr Lys Ser Ala Leu Arg
Glu65 70 75 80Leu Lys Thr Val Ser Ala Asp Gln Leu Ala Arg Glu Glu
Gln Ile Glu 85 90 95Asn Pro Arg Gln Ser Arg Phe Val Leu Gly Ala Ile
Ala Leu Gly Val 100 105 110Ala Ala Ala Ala Ala Val Thr Ala Gly Val
Ala Ile Ala Lys Thr Ile 115 120 125Arg Leu Glu Ser Glu Val Thr Ala
Ile Asn Asn Ala Leu Lys Lys Thr 130 135 140Asn Glu Ala Val Ser Thr
Leu Gly Asn Gly Val Arg Val Leu Ala Thr145 150 155 160Ala Val Arg
Glu Leu Lys Asp Phe Val Ser Lys Asn Leu Thr Arg Ala 165 170 175Ile
Asn Lys Asn Lys Cys Asp Ile Asp Asp Leu Lys Met Ala Val Ser 180 185
190Phe Ser Gln Phe Asn Arg Arg Phe Leu Asn Val Val Arg Gln Phe Ser
195 200 205Asp Asn Ala Gly Ile Thr Pro Ala Ile Ser Leu Asp Leu Met
Thr Asp 210 215 220Ala Glu Leu Ala Arg Ala Val Pro Asn Met Pro Thr
Ser Ala Gly Gln225 230 235 240Ile Lys Leu Met Leu Glu Asn Arg Ala
Met Val Arg Arg Lys Gly Phe 245 250 255Gly Ile Leu Ile Gly Val Tyr
Gly Ser Ser Val Ile Tyr Met Val Gln 260 265 270Leu Pro Ile Phe Gly
Val Ile Asp Thr Pro Cys Trp Ile Val Lys Ala 275 280 285Ala Pro Ser
Cys Ser Glu Lys Lys Gly Asn Tyr Ala Cys Leu Leu Arg 290 295 300Glu
Asp Gln Gly Trp Tyr Cys Gln Asn Ala Gly Ser Thr Val Tyr Tyr305 310
315 320Pro Asn Glu Lys Asp Cys Glu Thr Arg Gly Asp His Val Phe Cys
Asp 325 330 335Thr Ala Ala Gly Ile Asn Val Ala Glu Gln Ser Lys Glu
Cys Asn Ile 340 345 350Asn Ile Ser Thr Thr Asn Tyr Pro Cys Lys Val
Ser Thr Gly Arg His 355 360 365Pro Ile Ser Met Val Ala Leu Ser Pro
Leu Gly Ala Leu Val Ala Cys 370 375 380Tyr Lys Gly Val Ser Cys Ser
Ile Gly Ser Asn Arg Val Gly Ile Ile385 390 395 400Lys Gln Leu Asn
Lys Gly Cys Ser Tyr Ile Thr Asn Gln Asp Ala Asp 405 410 415Thr Val
Thr Ile Asp Asn Thr Val Tyr Gln Leu Ser Lys Val Glu Gly 420 425
430Glu Gln His Val Ile Lys Gly Arg Pro Val Ser Ser Ser Phe Asp Pro
435 440 445Ile Lys Phe Pro Glu Asp Gln Phe Asn Val Ala Leu Asp Gln
Val Phe 450 455 460Glu Asn Ile Glu Asn Ser Gln Ala Leu Val Asp Gln
Ser Asn Arg Ile465 470 475 480Leu Ser Ser Ala Glu Lys Gly Asn Thr
Gly Phe Ile Ile Val Ile Ile 485 490 495Leu Ile Ala Val Leu Gly Ser
Ser Met Ile Leu Val Ser Ile Phe Ile 500 505 510Ile Ile Lys Lys Thr
Lys Lys Pro Thr Gly Ala Pro Pro Glu Leu Ser 515 520 525Gly Val Thr
Asn Asn Gly Phe Ile Pro His Asn 530 5358539PRTArtificial
SequenceSynthetic Polypeptide 8Met Pro Ile Ser Ile Leu Leu Ile Ile
Thr Thr Met Ile Met Ala Ser1 5 10 15His Cys Gln Ile Asp Ile Thr Lys
Leu Gln His Val Gly Val Leu Val 20 25 30Asn Ser Pro Lys Gly Met Lys
Ile Ser Gln Asn Phe Glu Thr Arg Tyr 35 40 45Leu Ile Leu Ser Leu Ile
Pro Lys Ile Glu Asp Ser Asn Ser Cys Gly 50 55 60Asp Gln Gln Ile Lys
Gln Tyr Lys Arg Leu Leu Asp Arg Leu Ile Ile65 70 75 80Pro Leu Tyr
Asp Gly Leu Arg Leu Gln Lys Asp Val Ile Val Thr Asn 85 90 95Gln Glu
Ser Asn Glu Asn Thr Asp Pro Arg Thr Glu Arg Phe Phe Gly 100 105
110Gly Val Ile Gly Thr Ile Ala Leu Gly Val Ala Thr Ser Ala Gln Ile
115 120 125Thr Ala Ala Val Ala Leu Val Glu Ala Lys Gln Ala Arg Ser
Asp Ile 130 135 140Glu Lys Leu Lys Glu Ala Ile Arg Asp Thr Asn Lys
Ala Val Gln Ser145 150 155 160Val Gln Ser Ser Val Gly Asn Leu Ile
Val Ala Ile Lys Ser Val Gln 165 170 175Asp Tyr Val Asn Lys Glu Ile
Val Pro Ser Ile Ala Arg Leu Gly Cys 180 185 190Glu Ala Ala Gly Leu
Gln Leu Gly Ile Ala Leu Thr Gln His Tyr Ser 195 200 205Glu Leu Thr
Asn Ile Phe Gly Asp Asn Ile Gly Ser Leu Gln Glu Lys 210 215 220Gly
Ile Lys Leu Gln Gly Ile Ala Ser Leu Tyr Arg
Thr Asn Ile Thr225 230 235 240Glu Ile Phe Thr Thr Ser Thr Val Asp
Lys Tyr Asp Ile Tyr Asp Leu 245 250 255Leu Phe Thr Glu Ser Ile Lys
Val Arg Val Ile Asp Val Asp Leu Asn 260 265 270Asp Tyr Ser Ile Thr
Leu Gln Val Arg Leu Pro Leu Leu Thr Arg Leu 275 280 285Leu Asn Thr
Gln Ile Tyr Lys Val Asp Ser Ile Ser Tyr Asn Ile Gln 290 295 300Asn
Arg Glu Trp Tyr Ile Pro Leu Pro Ser His Ile Met Thr Lys Gly305 310
315 320Ala Phe Leu Gly Gly Ala Asp Val Lys Glu Cys Ile Glu Ala Phe
Ser 325 330 335Ser Tyr Ile Cys Pro Ser Asp Pro Gly Phe Val Leu Asn
His Glu Met 340 345 350Glu Ser Cys Leu Ser Gly Asn Ile Ser Gln Cys
Pro Arg Thr Thr Val 355 360 365Thr Ser Asp Ile Val Pro Arg Tyr Ala
Phe Val Asn Gly Gly Val Val 370 375 380Ala Asn Cys Ile Thr Thr Thr
Cys Thr Cys Asn Gly Ile Gly Asn Arg385 390 395 400Ile Asn Gln Pro
Pro Asp Gln Gly Val Lys Ile Ile Thr His Lys Glu 405 410 415Cys Asn
Thr Ile Gly Ile Asn Gly Met Leu Phe Asn Thr Asn Lys Glu 420 425
430Gly Thr Leu Ala Phe Tyr Thr Pro Asp Asp Ile Thr Leu Asn Asn Ser
435 440 445Val Ala Leu Asp Pro Ile Asp Ile Ser Ile Glu Leu Asn Lys
Ala Lys 450 455 460Ser Asp Leu Glu Glu Ser Lys Glu Trp Ile Arg Arg
Ser Asn Gln Lys465 470 475 480Leu Asp Ser Ile Gly Ser Trp His Gln
Ser Ser Thr Thr Ile Ile Val 485 490 495Ile Leu Ile Met Met Ile Ile
Leu Phe Ile Ile Asn Ile Thr Ile Ile 500 505 510Thr Ile Ala Ile Lys
Tyr Tyr Arg Ile Gln Lys Arg Asn Arg Val Asp 515 520 525Gln Asn Asp
Lys Pro Tyr Val Leu Thr Asn Lys 530 5359572PRTArtificial
SequenceSynthetic Polypeptide 9Met Glu Tyr Trp Lys His Thr Asn His
Gly Lys Asp Ala Gly Asn Glu1 5 10 15Leu Glu Thr Ser Thr Ala Thr His
Gly Asn Lys Leu Thr Asn Lys Ile 20 25 30Thr Tyr Ile Leu Trp Thr Ile
Thr Leu Val Leu Leu Ser Ile Val Phe 35 40 45Ile Ile Val Leu Thr Asn
Ser Ile Lys Ser Glu Lys Ala Arg Glu Ser 50 55 60Leu Leu Gln Asp Ile
Asn Asn Glu Phe Met Glu Val Thr Glu Lys Ile65 70 75 80Gln Val Ala
Ser Asp Asn Thr Asn Asp Leu Ile Gln Ser Gly Val Asn 85 90 95Thr Arg
Leu Leu Thr Ile Gln Ser His Val Gln Asn Tyr Ile Pro Ile 100 105
110Ser Leu Thr Gln Gln Ile Ser Asp Leu Arg Lys Phe Ile Ser Glu Ile
115 120 125Thr Ile Arg Asn Asp Asn Gln Glu Val Pro Pro Gln Arg Ile
Thr His 130 135 140Asp Val Gly Ile Lys Pro Leu Asn Pro Asp Asp Phe
Trp Arg Cys Thr145 150 155 160Ser Gly Leu Pro Ser Leu Met Lys Thr
Pro Lys Ile Arg Leu Met Pro 165 170 175Gly Pro Gly Leu Leu Ala Met
Pro Thr Thr Val Asp Gly Cys Val Arg 180 185 190Thr Pro Ser Leu Val
Ile Asn Asp Leu Ile Tyr Ala Tyr Thr Ser Asn 195 200 205Leu Ile Thr
Arg Gly Cys Gln Asp Ile Gly Lys Ser Tyr Gln Val Leu 210 215 220Gln
Ile Gly Ile Ile Thr Val Asn Ser Asp Leu Val Pro Asp Leu Asn225 230
235 240Pro Arg Ile Ser His Thr Phe Asn Ile Asn Asp Asn Arg Lys Ser
Cys 245 250 255Ser Leu Ala Leu Leu Asn Thr Asp Val Tyr Gln Leu Cys
Ser Thr Pro 260 265 270Lys Val Asp Glu Arg Ser Asp Tyr Ala Ser Ser
Gly Ile Glu Asp Ile 275 280 285Val Leu Asp Ile Val Asn Tyr Asp Gly
Ser Ile Ser Thr Thr Arg Phe 290 295 300Lys Asn Asn Asn Ile Ser Phe
Asp Gln Pro Tyr Ala Ala Leu Tyr Pro305 310 315 320Ser Val Gly Pro
Gly Ile Tyr Tyr Lys Gly Lys Ile Ile Phe Leu Gly 325 330 335Tyr Gly
Gly Leu Glu His Pro Ile Asn Glu Asn Ala Ile Cys Asn Thr 340 345
350Thr Gly Cys Pro Gly Lys Thr Gln Arg Asp Cys Asn Gln Ala Ser His
355 360 365Ser Pro Trp Phe Ser Asp Arg Arg Met Val Asn Ser Ile Ile
Val Val 370 375 380Asp Lys Gly Leu Asn Ser Val Pro Lys Leu Lys Val
Trp Thr Ile Ser385 390 395 400Met Arg Gln Asn Tyr Trp Gly Ser Glu
Gly Arg Leu Leu Leu Leu Gly 405 410 415Asn Lys Ile Tyr Ile Tyr Thr
Arg Ser Thr Ser Trp His Ser Lys Leu 420 425 430Gln Leu Gly Ile Ile
Asp Ile Thr Asp Tyr Ser Asp Ile Arg Ile Lys 435 440 445Trp Thr Trp
His Asn Val Leu Ser Arg Pro Gly Asn Asn Glu Cys Pro 450 455 460Trp
Gly His Ser Cys Pro Asp Gly Cys Ile Thr Gly Val Tyr Thr Asp465 470
475 480Ala Tyr Pro Leu Asn Pro Thr Gly Ser Ile Val Ser Ser Val Ile
Leu 485 490 495Asp Ser Gln Lys Ser Arg Val Asn Pro Val Ile Thr Tyr
Ser Thr Ala 500 505 510Thr Glu Arg Val Asn Glu Leu Ala Ile Arg Asn
Lys Thr Leu Ser Ala 515 520 525Gly Tyr Thr Thr Thr Ser Cys Ile Thr
His Tyr Asn Lys Gly Tyr Cys 530 535 540Phe His Ile Val Glu Ile Asn
His Lys Ser Leu Asn Thr Phe Gln Pro545 550 555 560Met Leu Phe Lys
Thr Glu Ile Pro Lys Ser Cys Ser 565 57010506PRTArtificial
SequenceSynthetic Polypeptide 10Met Ala Gln Val Ile Asn Thr Asn Ser
Leu Ser Leu Leu Thr Gln Asn1 5 10 15Asn Leu Asn Lys Ser Gln Ser Ala
Leu Gly Thr Ala Ile Glu Arg Leu 20 25 30Ser Ser Gly Leu Arg Ile Asn
Ser Ala Lys Asp Asp Ala Ala Gly Gln 35 40 45Ala Ile Ala Asn Arg Phe
Thr Ala Asn Ile Lys Gly Leu Thr Gln Ala 50 55 60Ser Arg Asn Ala Asn
Asp Gly Ile Ser Ile Ala Gln Thr Thr Glu Gly65 70 75 80Ala Leu Asn
Glu Ile Asn Asn Asn Leu Gln Arg Val Arg Glu Leu Ala 85 90 95Val Gln
Ser Ala Asn Gly Thr Asn Ser Gln Ser Asp Leu Asp Ser Ile 100 105
110Gln Ala Glu Ile Thr Gln Arg Leu Asn Glu Ile Asp Arg Val Ser Gly
115 120 125Gln Thr Gln Phe Asn Gly Val Lys Val Leu Ala Gln Asp Asn
Thr Leu 130 135 140Thr Ile Gln Val Gly Ala Asn Asp Gly Glu Thr Ile
Asp Ile Asp Leu145 150 155 160Lys Glu Ile Ser Ser Lys Thr Leu Gly
Leu Asp Lys Leu Asn Val Gln 165 170 175Asp Ala Tyr Thr Pro Lys Glu
Thr Ala Val Thr Val Asp Lys Thr Thr 180 185 190Tyr Lys Asn Gly Thr
Asp Pro Ile Thr Ala Gln Ser Asn Thr Asp Ile 195 200 205Gln Thr Ala
Ile Gly Gly Gly Ala Thr Gly Val Thr Gly Ala Asp Ile 210 215 220Lys
Phe Lys Asp Gly Gln Tyr Tyr Leu Asp Val Lys Gly Gly Ala Ser225 230
235 240Ala Gly Val Tyr Lys Ala Thr Tyr Asp Glu Thr Thr Lys Lys Val
Asn 245 250 255Ile Asp Thr Thr Asp Lys Thr Pro Leu Ala Thr Ala Glu
Ala Thr Ala 260 265 270Ile Arg Gly Thr Ala Thr Ile Thr His Asn Gln
Ile Ala Glu Val Thr 275 280 285Lys Glu Gly Val Asp Thr Thr Thr Val
Ala Ala Gln Leu Ala Ala Ala 290 295 300Gly Val Thr Gly Ala Asp Lys
Asp Asn Thr Ser Leu Val Lys Leu Ser305 310 315 320Phe Glu Asp Lys
Asn Gly Lys Val Ile Asp Gly Gly Tyr Ala Val Lys 325 330 335Met Gly
Asp Asp Phe Tyr Ala Ala Thr Tyr Asp Glu Lys Thr Gly Ala 340 345
350Ile Thr Ala Lys Thr Thr Thr Tyr Thr Asp Gly Thr Gly Val Ala Gln
355 360 365Thr Gly Ala Val Lys Phe Gly Gly Ala Asn Gly Lys Ser Glu
Val Val 370 375 380Thr Ala Thr Asp Gly Lys Thr Tyr Leu Ala Ser Asp
Leu Asp Lys His385 390 395 400Asn Phe Arg Thr Gly Gly Glu Leu Lys
Glu Val Asn Thr Asp Lys Thr 405 410 415Glu Asn Pro Leu Gln Lys Ile
Asp Ala Ala Leu Ala Gln Val Asp Thr 420 425 430Leu Arg Ser Asp Leu
Gly Ala Val Gln Asn Arg Phe Asn Ser Ala Ile 435 440 445Thr Asn Leu
Gly Asn Thr Val Asn Asn Leu Ser Ser Ala Arg Ser Arg 450 455 460Ile
Glu Asp Ser Asp Tyr Ala Thr Glu Val Ser Asn Met Ser Arg Ala465 470
475 480Gln Ile Leu Gln Gln Ala Gly Thr Ser Val Leu Ala Gln Ala Asn
Gln 485 490 495Val Pro Gln Asn Val Leu Ser Leu Leu Arg 500
5051113PRTArtificial SequenceSynthetic Polypeptide 11Leu Gln Arg
Val Arg Glu Leu Ala Val Gln Ser Ala Asn1 5 101247RNAArtificial
SequenceSynthetic Polynucleotide 12gggaaauaag agagaaaaga agaguaagaa
gaaauauaag agccacc 4713119RNAArtificial SequenceSynthetic
Polynucleotide 13ugauaauagg cuggagccuc gguggccaug cuucuugccc
cuugggccuc cccccagccc 60cuccuccccu uccugcaccc guacccccgu ggucuuugaa
uaaagucuga gugggcggc 119141786RNAArtificial SequenceSynthetic
Polynucleotide 14gggaaauaag agagaaaaga agaguaagaa gaaauauaag
agccaccaug agcuggaagg 60uggugauuau cuucagccug cugauuacac cucaacacgg
ccugaaggag agcuaccugg 120aagagagcug cuccaccauc accgagggcu
accugagcgu gcugcggacc ggcugguaca 180ccaacguguu cacccuggag
gugggcgacg uggagaaccu gaccugcagc gacggcccua 240gccugaucaa
gaccgagcug gaccugacca agagcgcucu gagagagcug aagaccgugu
300ccgccgacca gcuggccaga gaggaacaga ucgagaaccc ucggcagagc
agauucgugc 360ugggcgccau cgcucuggga gucgccgcug ccgcugcagu
gacagcugga guggccauug 420cuaagaccau cagacuggaa agcgagguga
cagccaucaa caaugcccug aagaagacca 480acgaggccgu gagcacccug
ggcaauggag ugagagugcu ggccacagcc gugcgggagc 540ugaaggacuu
cgugagcaag aaccugacca gagccaucaa caagaacaag ugcgacaucg
600augaccugaa gauggccgug agcuucuccc aguucaacag acgguuccug
aacgugguga 660gacaguucuc cgacaacgcu ggaaucacac cugccauuag
ccuggaccug augaccgacg 720ccgagcuggc uagagccgug cccaacaugc
ccaccagcgc uggccagauc aagcugaugc 780uggagaacag agccauggug
cggagaaagg gcuucggcau ccugauuggg guguauggaa 840gcuccgugau
cuacauggug cagcugccca ucuucggcgu gaucgacaca cccugcugga
900ucgugaaggc cgcuccuagc ugcuccgaga agaaaggaaa cuaugccugu
cugcugagag 960aggaccaggg cugguacugc cagaacgccg gaagcacagu
guacuauccc aacgagaagg 1020acugcgagac cagaggcgac cacguguucu
gcgacaccgc ugccggaauc aacguggccg 1080agcagagcaa ggagugcaac
aucaacauca gcacaaccaa cuaccccugc aaggugagca 1140ccggacggca
ccccaucagc augguggcuc ugagcccucu gggcgcucug guggccugcu
1200auaagggcgu guccuguagc aucggcagca aucggguggg caucaucaag
cagcugaaca 1260agggaugcuc cuacaucacc aaccaggacg ccgacaccgu
gaccaucgac aacaccgugu 1320accagcugag caagguggag ggcgagcagc
acgugaucaa gggcagaccc gugagcucca 1380gcuucgaccc caucaaguuc
ccugaggacc aguucaacgu ggcccuggac cagguguuug 1440agaacaucga
gaacagccag gcccuggugg accagagcaa cagaauccug uccagcgcug
1500agaagggcaa caccggcuuc aucauuguga ucauucugau cgccgugcug
ggcagcucca 1560ugauccuggu gagcaucuuc aucauuauca agaagaccaa
gaaacccacc ggagccccuc 1620cugagcugag cggcgugacc aacaauggcu
ucauucccca caacugauga uaauaggcug 1680gagccucggu ggccaugcuu
cuugccccuu gggccucccc ccagccccuc cuccccuucc 1740ugcacccgua
cccccguggu cuuugaauaa agucugagug ggcggc 1786151783RNAArtificial
SequenceSynthetic Polynucleotide 15gggaaauaag agagaaaaga agaguaagaa
gaaauauaag agccaccaug cccaucagca 60uccugcugau caucaccaca augaucaugg
ccagccacug ccagaucgac aucaccaagc 120ugcagcacgu gggcgugcuc
gugaacagcc ccaagggcau gaagaucagc cagaacuucg 180agacacgcua
ccugauccug agccugaucc ccaagaucga ggacagcaac agcugcggcg
240accagcagau caagcaguac aagcggcugc uggacagacu gaucaucccc
cuguacgacg 300gccugcggcu gcagaaagac gugaucguga ccaaccagga
aagcaacgag aacaccgacc 360cccggaccga gagauucuuc ggcggcguga
ucggcacaau cgcccuggga guggccacaa 420gcgcccagau uacagccgcu
guggcccugg uggaagccaa gcaggccaga agcgacaucg 480agaagcugaa
agaggccauc cgggacacca acaaggccgu gcagagcgug caguccagcg
540ugggcaaucu gaucguggcc aucaaguccg ugcaggacua cgugaacaaa
gaaaucgugc 600ccucuaucgc ccggcugggc ugugaagcug ccggacugca
gcugggcauu gcccugacac 660agcacuacag cgagcugacc aacaucuucg
gcgacaacau cggcagccug caggaaaagg 720gcauuaagcu gcagggaauc
gccagccugu accgcaccaa caucaccgag aucuucacca 780ccagcaccgu
ggauaaguac gacaucuacg accugcuguu caccgagagc aucaaagugc
840gcgugaucga cguggaccug aacgacuaca gcaucacccu gcaagugcgg
cugccccugc 900ugaccagacu gcugaacacc cagaucuaca agguggacag
caucuccuac aacauccaga 960accgcgagug guacaucccu cugcccagcc
acauuaugac caagggcgcc uuucugggcg 1020gagccgacgu gaaagagugc
aucgaggccu ucagcagcua caucugcccc agcgacccug 1080gcuucgugcu
gaaccacgag auggaaagcu gccugagcgg caacaucagc cagugcccca
1140gaaccaccgu gaccuccgac aucgugccca gauacgccuu cgugaauggc
ggcguggugg 1200ccaacugcau caccaccacc uguaccugca acggcaucgg
caaccggauc aaccagccuc 1260ccgaucaggg cgugaagauu aucacccaca
aagaguguaa caccaucggc aucaacggca 1320ugcuguucaa uaccaacaaa
gagggcaccc uggccuucua cacccccgac gauaucaccc 1380ugaacaacuc
cguggcucug gaccccaucg acaucuccau cgagcugaac aaggccaaga
1440gcgaccugga agaguccaaa gaguggaucc ggcggagcaa ccagaagcug
gacucuaucg 1500gcagcuggca ccagagcagc accaccauca ucgugauccu
gauuaugaug auuauccugu 1560ucaucaucaa cauuaccauc aucacuaucg
ccauuaagua cuaccggauc cagaaacgga 1620accgggugga ccagaaugac
aagcccuacg ugcugacaaa caagugauaa uaggcuggag 1680ccucgguggc
caugcuucuu gccccuuggg ccucccccca gccccuccuc cccuuccugc
1740acccguaccc ccguggucuu ugaauaaagu cugagugggc ggc
1783161882RNAArtificial SequenceSynthetic Polynucleotide
16gggaaauaag agagaaaaga agaguaagaa gaaauauaag agccaccaug gaauacugga
60agcacaccaa ccacggcaag gacgccggca acgagcugga aaccagcaca gccacacacg
120gcaacaagcu gaccaacaag aucaccuaca uccuguggac caucacccug
gugcugcuga 180gcaucguguu caucaucgug cugaccaaua gcaucaagag
cgagaaggcc agagagagcc 240ugcugcagga caucaacaac gaguucaugg
aagugaccga gaagauccag guggccagcg 300acaacaccaa cgaccugauc
cagagcggcg ugaacacccg gcugcugacc auccagagcc 360acgugcagaa
cuacaucccc aucagccuga cccagcagau cagcgaccug cggaaguuca
420ucagcgagau caccauccgg aacgacaacc aggaagugcc cccccagaga
aucacccacg 480acgugggcau caagccccug aaccccgacg auuucuggcg
guguacaagc ggccugccca 540gccugaugaa gacccccaag auccggcuga
ugccuggccc uggacugcug gccaugccua 600ccacagugga uggcugugug
cggaccccca gccucgugau caacgaucug aucuacgccu 660acaccagcaa
ccugaucacc cggggcugcc aggauaucgg caagagcuac caggugcugc
720agaucggcau caucaccgug aacuccgacc uggugcccga ccugaacccu
cggaucagcc 780acaccuucaa caucaacgac aacagaaaga gcugcagccu
ggcucugcug aacaccgacg 840uguaccagcu gugcagcacc cccaaggugg
acgagagaag cgacuacgcc agcagcggca 900ucgaggauau cgugcuggac
aucgugaacu acgacggcag caucagcacc acccgguuca 960agaacaacaa
caucagcuuc gaccagcccu acgccgcccu guacccuucu gugggcccug
1020gcaucuacua caagggcaag aucaucuucc ugggcuacgg cggccuggaa
caccccauca 1080acgagaacgc caucugcaac accaccggcu gcccuggcaa
gacccagaga gacugcaauc 1140aggccagcca cagccccugg uucagcgacc
gcagaauggu caacucuauc aucguggugg 1200acaagggccu gaacagcgug
cccaagcuga aaguguggac aaucagcaug cgccagaacu 1260acuggggcag
cgagggcaga cuucugcugc ugggaaacaa gaucuacauc uacacccggu
1320ccaccagcug gcacagcaaa cugcagcugg gaaucaucga caucaccgac
uacagcgaca 1380uccggaucaa guggaccugg cacaacgugc ugagcagacc
cggcaacaau gagugcccuu 1440ggggccacag cugccccgau ggauguauca
ccggcgugua caccgacgcc uacccccuga 1500auccuaccgg cuccaucgug
uccagcguga uccuggacag ccagaaaagc agagugaacc 1560ccgugaucac
auacagcacc gccaccgaga gagugaacga acuggccauc agaaacaaga
1620cccugagcgc cggcuacacc accacaagcu gcaucacaca cuacaacaag
ggcuacugcu 1680uccacaucgu ggaaaucaac cacaaguccc ugaacaccuu
ccagcccaug cuguucaaga 1740ccgagauccc caagagcugc uccugauaau
aggcuggagc cucgguggcc augcuucuug 1800ccccuugggc cuccccccag
ccccuccucc ccuuccugca cccguacccc cguggucuuu 1860gaauaaaguc
ugagugggcg gc 18821730PRTArtificial SequenceSynthetic Polypeptide
17Met Asp Ser Lys Gly Ser Ser Gln Lys Gly Ser Arg Leu Leu Leu Leu1
5 10 15Leu Val Val Ser Asn Leu Leu Leu Pro Gln Gly Val Val Gly 20
25 301818PRTArtificial SequenceSynthetic Polypeptide 18Met Asp Trp
Thr Trp Ile Leu Phe Leu Val Ala Ala Ala Thr Arg Val1 5 10 15His
Ser1920PRTArtificial SequenceSynthetic
Polypeptide 19Met Glu Thr Pro Ala Gln Leu Leu Phe Leu Leu Leu Leu
Trp Leu Pro1 5 10 15Asp Thr Thr Gly 202024PRTArtificial
SequenceSynthetic Polypeptide 20Met Leu Gly Ser Asn Ser Gly Gln Arg
Val Val Phe Thr Ile Leu Leu1 5 10 15Leu Leu Val Ala Pro Ala Tyr Ser
202117PRTArtificial SequenceSynthetic Polypeptide 21Met Lys Cys Leu
Leu Tyr Leu Ala Phe Leu Phe Ile Gly Val Asn Cys1 5 10
15Ala2215PRTArtificial SequenceSynthetic Polypeptide 22Met Trp Leu
Val Ser Leu Ala Ile Val Thr Ala Cys Ala Gly Ala1 5 10
15239RNAArtificial SequenceSynthetic Polynucleotide 23ccrccaugg
92411RNAArtificial SequenceSynthetic Polynucleotide 24gggauccuac c
11259RNAArtificial SequenceSynthetic Polynucleotide 25uuauuuaww
9
* * * * *