U.S. patent application number 17/679675 was filed with the patent office on 2022-06-23 for amino acid sequences directed against il-17a, il-17f and/or il-17a/f and polypeptides comprising the same.
This patent application is currently assigned to Merck Patent GmbH. The applicant listed for this patent is Merck Patent GmbH. Invention is credited to Denis BRUNIQUEL, Laurent CHEVALET, Yolande CHVATCHKO, Joost Alexander KOLKMAN, Olivier LEGER, Amanda E.I. PROUDFOOT, Heidi ROMMELAERE, Michael John Scott SAUNDERS, Ann UNION, Alain VICARI.
Application Number | 20220195031 17/679675 |
Document ID | / |
Family ID | |
Filed Date | 2022-06-23 |
United States Patent
Application |
20220195031 |
Kind Code |
A1 |
ROMMELAERE; Heidi ; et
al. |
June 23, 2022 |
AMINO ACID SEQUENCES DIRECTED AGAINST IL-17A, IL-17F AND/OR
IL-17A/F AND POLYPEPTIDES COMPRISING THE SAME
Abstract
The present disclosure relates to amino acid sequences that are
directed against (as defined herein) any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof, as well as to compounds or
constructs, and in particular proteins and polypeptides, that
comprise or essentially consist of one or more such amino acid
sequences.
Inventors: |
ROMMELAERE; Heidi; (Gent,
BE) ; KOLKMAN; Joost Alexander; (Sint-Martens-Latem,
BE) ; SAUNDERS; Michael John Scott; (Brussels,
BE) ; UNION; Ann; (Aalter, BE) ; CHVATCHKO;
Yolande; (Confignon, CH) ; PROUDFOOT; Amanda
E.I.; (Chens sur Leman, FR) ; VICARI; Alain;
(Neydens, FR) ; BRUNIQUEL; Denis; (Thoiry, FR)
; CHEVALET; Laurent; (Cuvat, FR) ; LEGER;
Olivier; (Saint-Sixt, FR) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Merck Patent GmbH |
Darmstadt |
|
DE |
|
|
Assignee: |
Merck Patent GmbH
Darmstadt
DE
|
Appl. No.: |
17/679675 |
Filed: |
February 24, 2022 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
17036602 |
Sep 29, 2020 |
|
|
|
17679675 |
|
|
|
|
16002135 |
Jun 7, 2018 |
10829552 |
|
|
17036602 |
|
|
|
|
14115549 |
Jun 16, 2014 |
10017568 |
|
|
PCT/EP12/58313 |
May 4, 2012 |
|
|
|
16002135 |
|
|
|
|
61482802 |
May 5, 2011 |
|
|
|
International
Class: |
C07K 16/24 20060101
C07K016/24; A61P 37/06 20060101 A61P037/06 |
Claims
1. A polypeptide comprising a llama-derived, VHH-based domain,
which domain binds to IL-17A.
2. The polypeptide of claim 1, which is linked to one or more
constant domains and a light chain.
3. The polypeptide of claim 2, which in combination with the one or
more constant domains and light chain forms an IgG antibody.
4. The polypeptide of claim 1, which binds to human IL-17A with a
dissociation constant (K.sub.D) of 10.sup.-5-10.sup.-12 moles/liter
or less.
5. The polypeptide of claim 1, wherein the llama-derived, VHH-based
domain comprises an amino acid sequence selected from SEQ ID NOs:
623 to 693 or an amino acid sequence having at least 70% amino acid
identity with a CDR sequence of at least one of the amino acid
sequences of SEQ ID NOs: 623 to 693.
6. The polypeptide of claim 1, wherein the llama-derived, VHH-based
domain comprises an amino acid sequence selected from SEQ ID NO:
623 to 693 or an amino acid sequence having at least 70% amino acid
identity with at least one of SEQ ID NOs: 623 to 693.
7. The polypeptide of claim 6, wherein the llama-derived, VHH-based
domain comprises an amino acid sequence having at least 70% amino
acid identity with SEQ ID NO: 660, SEQ ID NO: 664, or SEQ ID NO:
690.
8. The polypeptide of claim 1, wherein the llama-derived, VHH-based
domain comprises: a first CDR comprising (i) the amino acid
sequence AMG or (ii) an amino acid sequence that has 1 amino acid
difference with the amino acid sequence AMG; and a second CDR
comprising (i) the amino acid sequence AISGSGDDTYYADSVKG or (ii) an
amino acid sequence that has only 1-7 amino acid differences with
the amino acid sequence TABLE-US-00047 AISGSGDDTYYADSVKG.
9. The polypeptide of claim 8, which comprises an
FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 structure, and wherein FR4 comprises
SEQ ID NO: 619.
10. A pharmaceutical composition comprising a polypeptide
comprising a humanized variant of a llama-derived VHH domain linked
to a human variable light chain, and which is configured to
specifically bind to human IL-17A.
11. The pharmaceutical composition of claim 10, which further
comprises a pharmaceutically acceptable excipient.
12. A method of treating systemic lupus erythematosis, rheumatoid
arthritis, osteoarthritis, juvenile chronic arthritis,
spondyloarthropathies, systemic sclerosis, idiopathic inflammatory
myopathies, Sjogren's syndrome, systemic vasculitis, sarcoidosis,
autoimmune hemolytic anemia, autoimmune thrombocytopenia,
thyroiditis, diabetes mellitus, immune-mediated renal disease,
demyelinating diseases of the central and peripheral nervous
systems, multiple sclerosis, idiopathic demyelinating
polyneuropathy, Guillain-Barre syndrome, chronic inflammatory
demyelinating polyneuropathy, hepatobiliary diseases, infectious,
autoimmune chronic active hepatitis, primary biliary cirrhosis,
granulomatous hepatitis, sclerosing cholangitis, inflammatory bowel
disease, gluten-sensitive enteropathy, Whipple's disease,
autoimmune or immune-mediated skin diseases, bullous skin diseases,
erythema multiforme, contact dermatitis, psoriasis, allergic
diseases, asthma, allergic rhinitis, atopic dermatitis, food
hypersensitivity, urticaria, eosinophilic pneumonia, idiopathic
pulmonary fibrosis, hypersensitivity pneumonitis, transplantation
associated diseases, graft rejection, or graft-versus-host-disease,
the method comprising administering to a patient in need thereof an
effective amount of the polypeptide according to claim 1.
13. The method of claim 12, which is a method of treating
psoriasis.
Description
[0001] The present invention relates to amino acid sequences that
are directed against (as defined herein) any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof, as well as to
compounds or constructs, and in particular proteins and
polypeptides, that comprise or essentially consist of one or more
such amino acid sequences (also referred to herein as "amino acid
sequences of the invention", "compounds of the invention", and
"polypeptides of the invention", respectively).
[0002] As further described herein, preferably, the amino acid
sequences of the invention are immunoglobulin single variable
domains ("ISV's"). An immunoglobulin single variable domain is an
amino acid sequence that: [0003] comprises an immunoglobulin fold
or that, under suitable conditions (such as physiological
conditions) is capable of forming an immunoglobulin fold (i.e. by
folding), i.e. so as to form an immunoglobulin variable domain
(such as, for example, a VH, VL or VHH domain);
[0004] and that [0005] forms (or under such suitable conditions is
capable of forming) an immunoglobulin variable domain that
comprises a functional antigen binding activity (in the sense that
it does not require an interaction with another immunoglobulin
variable domain (such as a VH-VL interaction) to form a functional
antigen binding site).
[0006] Amino acid sequences of the invention that are ISV's are
also referred to herein as "ISV's of the invention". Some preferred
examples of immunoglobulin single variable domains suitable for use
in the invention will become clear from the further description
herein, and for example comprise VHH's and/or (other) Nanobodies
(preferred), such as humanized VHH's or camelized VH's, such as
camelized human VH, dAb's and (single) domain antibodies.
[0007] The invention also relates to nucleic acids encoding such
amino acid sequences and polypeptides (also referred to herein as
"nucleic acids of the invention" or "nucleotide sequences of the
invention"); to methods for preparing such amino acid sequences and
polypeptides; to host cells expressing or capable of expressing
such amino acid sequences or polypeptides; to compositions, and in
particular to pharmaceutical compositions, that comprise such amino
acid sequences, polypeptides, nucleic acids and/or host cells; and
to uses of such amino acid sequences or polypeptides, nucleic
acids, host cells and/or compositions, in particular for
prophylactic, therapeutic or diagnostic purposes, such as the
prophylactic, therapeutic or diagnostic purposes mentioned
herein.
[0008] Other aspects, embodiments, advantages and applications of
the invention will become clear from the further description
herein. Several documents are cited throughout the text of this
specification. Each of the documents cited herein (including all
patents, patent applications, scientific publications,
manufacturer's specifications, instructions, etc.), whether supra
or infra, are hereby incorporated by reference in their entirety.
Nothing herein is to be construed as an admission that the
invention is not entitled to antedate such disclosure by virtue of
prior invention.
[0009] Interleukin-17A (IL-17A also referred to as IL-17 in the
literature) is a T-cell derived pro-inflammatory molecule that
stimulates epithelial, endothelial and fibroblastic cells to
produce other inflammatory cytokines and chemokines including IL-6,
IL-8, G-CSF, and MCP-1 [see, Yao, Z. et al., J. Immunol., 122 (12):
5483-5486 (1995); Yao, Z. et al., Immunity, 3 (6): 811-821 (1995);
Fossiez, F., et al., J. Exp. Med., 183 (6): 2593-2603 (1996);
Kennedy, J., et al., J. Interferon Cytokine Res., 16 (8): 611-7
(1996); Cai, X. Y., et al., Immunol. Lett, 62 (1): 51-8 (1998);
Jovanovic, D. V., et al., J. Immunol., 160 (7): 3513-21 (1998);
Laan, M., et al., J. Immunol., 162 (4): 2347-52 (1999); Linden, A.,
et al, Eur Respir J, 15 (5): 973-7 (2000); and Aggarwal, S. and
Gurney, A. L., J Leukoc Biol, 71 (1): 1-8 (2002)]. IL-17A also
synergizes with other cytokines including TNF-.alpha. and
IL-1.beta. to further induce chemokine expression (Chabaud, M., et
al., J. Immunol. 161 (1): 409-14 (1998)). IL-17A exhibits
pleitropic biological activities on various types of cells. IL-17A
also has the ability to induce ICAM-1 surface expression,
proliferation of T cells, and growth and differentiation of CD34+
human progenitors into neutrophils. IL-17A has also been implicated
in bone metabolism, and has been suggested to play an important
role in pathological conditions characterized by the presence of
activated T cells and TNF-.alpha. production such as rheumatoid
arthritis and loosening of bone implants (Van Bezooijen et al., J.
Bone Miner. Res., 14: 1513-1521 [1999]). Activated T cells of
synovial tissue derived from rheumatoid arthritis patients were
found to secrete higher amounts of IL-17A than those derived from
normal individuals or osteoarthritis patients (Chabaud et al.,
Arthritis Rheum., 42: 963-970 [1999]). It was suggested that this
proinflammatory cytokine actively contributes to synovial
inflammation in rheumatoid arthritis. Apart from its
proinflammatory role, IL-17A seems to contribute to the pathology
of rheumatoid arthritis by yet another mechanism. For example,
IL-17A has been shown to induce the expression of osteoclast
differentiation factor (ODF) mRNA in osteoblasts (Kotake et al., J.
Clin. Invest., 103: 1345-1352 [1999]). ODF stimulates
differentiation of progenitor cells into osteoclasts, the cells
involved in bone resorption. Since the level of IL-17A is
significantly increased in synovial fluid of rheumatoid arthritis
patients, it appears that IL-17A induced osteoclast formation plays
a crucial role in bone resorption in rheumatoid arthritis. IL-17A
is also believed to play a key role in certain other autoimmune
disorders such as multiple sclerosis (Matusevicius et al., Mult.
Scler., 5: 101-104 (1999); Kurasawa, K., et al., Arthritis Rheu 43
(1i): 2455-63 (2000)) and psoriasis (Teunissen, M. B., et al., J
Invest Dermatol 1 11 (4): 645-9 (1998); Albanesi, C., et al., J
Invest Dermatol 115 (1): 81-7 (2000); and Homey, B., et al., J.
Immunol. 164 (12: 6621-32 (2000)).
[0010] IL-17A has further been shown, by intracellular signalling,
to stimulate Ca2+ influx and a reduction in [cAMP] in human
macrophages (Jovanovicetal., J. Immunol., 160: 3513 [1998]). IL-17A
induces the activation of NF-KB in fibroblasts, [Yao et al.,
Immunity, 3: 811 (1995), Jovanovic et al., supra], while it induces
the activation of NF-.kappa.B and mitogen-activated protein kinases
in macrophages (Shalom-Barek et al., J. Biol. Chem., 273: 27467
[1998]). Additionally, IL-17A also shares sequence similarity with
mammalian cytokine-like factor 7 that is involved in bone and
cartilage growth.
[0011] Interleukin 17A is now recognized as the prototype member of
an emerging family of cytokines (see review by Gaffen, 2009 Nature
Review Immunology 9:556-567). The large scale sequencing of the
human and other vertebrate genomes has revealed the presence of
additional genes encoding proteins clearly related to IL-17A, thus
defining a new family of cytokines. There are at least 6 members of
the IL-17 family in humans and mice including IL-17B, IL-17C,
IL-17D, IL-17E and IL-17F as well as 6 related receptors IL-17RA,
IL-17RB, IL-17RC (also known as IL-17 RL), IL-17RD and IL-17RF
(Gaffen ibid.). One such IL-17 member (designated as IL-17F) has
been demonstrated to bind to the human IL-17 receptor (IL-17R) (Yao
et al., Cytokine, 9 (11): 794-800 (1997)). Initial characterization
suggests that, like IL-17A, several of these newly identified
molecules have the ability to modulate immune function. The potent
inflammatory actions that have been identified for several of these
factors and the emerging associations with major human diseases
suggest that these proteins may have significant roles in
inflammatory processes and may offer opportunities for therapeutic
intervention.
[0012] The gene encoding human IL-17F is located adjacent to that
encoding IL-17A (Hymowitz, S. G., et al., Embo J, 20 (19): 5332-41
(2001)). IL-17A and IL-17F share about 50% amino acid identity
whereas the other members of the IL-17 family share a more limited
15-27% amino acid identity, suggesting that IL-17A and IL-17F form
a distinct subgroup within the IL-17 family (Starnes et al., J
Immunol, 167 (8): 4137-40 (2001); Aggarwal and Gurney J. Leukoc
Biol, 71 (1): 1-8 (2002)). IL-17F appears to have similar
biological actions as IL-17A, and is able to promote the production
of IL-6, IL-8, and G-CSF from a wide variety of cells. Similar to
IL-17A, it is able to induce cartilage matrix release and inhibit
new cartilage matrix synthesis (see US-2002-0177188-A1 published
Nov. 28, 2002). Thus, like IL-17A, IL-17F may potentially
contribute to the pathology of inflammatory disorders.
[0013] Recently, it has been observed that both IL-17A and IL-17F
are induced in T cells by the action of interleukin 23 (IL-23)
(Aggarwal et al., J. Biol. Chem., 278 (3): 1910-4 (2003)). The
observation that IL-17A and IL-17F share similar chromosomal
localization and significant sequence similarity as well as the
observation that IL-17A and IL-17F appear to be induced with the
same cell population in response to a specific stimuli has lead to
the identification of a new human cytokine that is comprised of a
covalent (via 2 disulfide bonds) heterodimer of IL-17A and IL-17F
(herein designated IL-17A/F), see also WO05/010044, Wright et al.,
J. Biol. Chem., 282: 13447 (2007); Kawaguchi et al., J. Allergy
Clin. Immunol., 114: 1265 (2004); and Kolls, J K et al., Immunity,
21: 467 (2004).
[0014] The amino acid sequences, polypeptides and compositions of
the present invention can generally be used to modulate, and in
particular inhibit and/or prevent, binding of any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof to IL-17RA and/or
IL-17RC complex, and thus to modulate, and in particular inhibit or
prevent, the signalling that is mediated by the binding of any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof to
IL-17RA and/or IL-17RC complex, to modulate the biological pathways
in which the binding of any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof to IL-17RA and/or IL-17RC complex is
involved, and/or to modulate the biological mechanisms, responses
and effects associated with such signalling or these pathways.
Although the stochiometry is not definitely determined of the IL-17
receptor complex, it is believed that IL-17A, IL-17F and IL-17A/F
signal via dimers and/or trimers of IL-17RA and/or IL-17RC (Gaffen
ibid.).
[0015] As such, the amino acid sequences, polypeptides and
compositions of the present invention can be used for the
prevention and treatment (as defined herein) of immune related
diseases and disorders (herein referred to as `immune related
diseases and disorders of the invention`). Generally, the "immune
related diseases and disorders of the invention" can be defined as
diseases and disorders that can be prevented and/or treated,
respectively, by suitably administering to a subject in need
thereof (i.e. having the disease or disorder or at least one
symptom thereof and/or at risk of attracting or developing the
disease or disorder) of either a polypeptide or composition of the
invention (and in particular, of a pharmaceutically active amount
thereof) and/or of a known active principle active against any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof or a
biological pathway or mechanism in which any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof is involved (and in
particular, of a pharmaceutically active amount thereof). Examples
of such immune related diseases and disorders of the invention will
be clear to the skilled person based on the disclosure herein, and
for example include the following diseases and disorders: systemic
lupus erythematosus, rheumatoid arthritis, osteoarthritis, juvenile
chronic arthritis, spondyloarthropathies, systemic sclerosis,
idiopathic inflammatory myopathies, Sjogren's syndrome, systemic
vasculitis, sarcoidosis, autoimmune hemolytic anemia, autoimmune
thrombocytopenia, thyroiditis, diabetes mellitus, immune-mediated
renal disease, demyelinating diseases of the central and peripheral
nervous systems such as multiple sclerosis, idiopathic
demyelinating polyneuropathy or Guillain-Barre syndrome, and
chronic inflammatory demyelinating polyneuropathy, hepatobiliary
diseases such as infectious, autoimmune chronic active hepatitis,
primary biliary cirrhosis, granulomatous hepatitis, and sclerosing
cholangitis, inflammatory bowel disease, gluten-sensitive
enteropathy, and Whipple's disease, autoimmune or immune-mediated
skin diseases including bullous skin diseases, erythema multiforme
and contact dermatitis, psoriasis, allergic diseases such as
asthma, allergic rhinitis, atopic dermatitis, food hypersensitivity
and urticaria, immunologic diseases of the lung such as
eosinophilic pneumonia, idiopathic pulmonary fibrosis and
hypersensitivity pneumonitis, transplantation associated diseases
including graft rejection and graft-versus-host-disease.
[0016] In particular, the amino acid sequences, polypeptides and
compositions of the present invention can be used for the
prevention and treatment of immune related diseases and disorders
of the invention which are characterized by excessive and/or
unwanted signalling mediated by any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof or by the pathway(s) in
which any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof is involved. Examples of such immune related diseases and
disorders of the invention will again be clear to the skilled
person based on the disclosure herein.
[0017] Thus, without being limited thereto, the amino acid
sequences and polypeptides of the invention can for example be used
to prevent and/or to treat all diseases and disorders that are
currently being prevented or treated with active principles that
can modulate any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof-mediated signalling, such as those mentioned
in the prior art cited above. It is also envisaged that the
polypeptides of the invention can be used to prevent and/or to
treat all diseases and disorders for which treatment with such
active principles is currently being developed, has been proposed,
or will be proposed or developed in future. In addition, it is
envisaged that, because of their favourable properties as further
described herein, the polypeptides of the present invention may be
used for the prevention and treatment of other diseases and
disorders than those for which these known active principles are
being used or will be proposed or developed; and/or that the
polypeptides of the present invention may provide new methods and
regimens for treating the diseases and disorders described
herein.
[0018] Other applications and uses of the amino acid sequences and
polypeptides of the invention will become clear to the skilled
person from the further disclosure herein.
[0019] Generally, it is an object of the invention to provide
pharmacologically active agents, as well as compositions comprising
the same, that can be used in the diagnosis, prevention and/or
treatment of immune related diseases and disorders of the invention
and of the further diseases and disorders mentioned herein; and to
provide methods for the diagnosis, prevention and/or treatment of
such diseases and disorders that involve the administration and/or
use of such agents and compositions.
[0020] In particular, it is an object of the invention to provide
such pharmacologically active agents, compositions and/or methods
that have certain advantages compared to the agents, compositions
and/or methods that are currently used and/or known in the art.
These advantages will become clear from the further description
below.
[0021] More in particular, it is an object of the invention to
provide therapeutic proteins that can be used as pharmacologically
active agents, as well as compositions comprising the same, for the
diagnosis, prevention and/or treatment of immune related diseases
and disorders of the invention and of the further diseases and
disorders mentioned herein; and to provide methods for the
diagnosis, prevention and/or treatment of such diseases and
disorders that involve the administration and/or the use of such
therapeutic proteins and compositions.
[0022] Accordingly, it is a specific object of the present
invention to provide amino acid sequences that are directed against
(as defined herein) any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof, in particular against any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof from a warm-blooded
animal, more in particular against any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof from a mammal, and
especially against any of human IL-17A, IL-17F and/or IL-17A/F
including combinations thereof; and to provide proteins and
polypeptides comprising or essentially consisting of at least one
such amino acid sequence.
[0023] In particular, it is a specific object of the present
invention to provide such amino acid sequences and such proteins
and/or polypeptides that are suitable for prophylactic, therapeutic
and/or diagnostic use in a warm-blooded animal, and in particular
in a mammal, and more in particular in a human being.
[0024] More in particular, it is a specific object of the present
invention to provide such amino acid sequences and such proteins
and/or polypeptides that can be used for the prevention, treatment,
alleviation and/or diagnosis of one or more diseases, disorders or
conditions associated with any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof and/or mediated by any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof (such as the
diseases, disorders and conditions mentioned herein) in a
warm-blooded animal, in particular in a mammal, and more in
particular in a human being.
[0025] It is also a specific object of the invention to provide
such amino acid sequences and such proteins and/or polypeptides
that can be used in the preparation of pharmaceutical or veterinary
compositions for the prevention and/or treatment of one or more
diseases, disorders or conditions associated with and/or mediated
by any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof (such as the diseases, disorders and conditions mentioned
herein) in a warm-blooded animal, in particular in a mammal, and
more in particular in a human being.
[0026] In the invention, generally, these objects are achieved by
the use of the amino acid sequences, proteins, polypeptides and
compositions that are described herein. As mentioned, the amino
acid sequences used in the invention are preferably immunoglobulin
single variable domains or "ISV's" as described herein, and the
proteins and polypeptides used in the invention are preferably
proteins and polypeptides that comprise one or more of such
immunoglobulin single variable domains.
[0027] In general, the invention provides amino acid sequences (and
preferably ISV's) that are directed against (as defined herein)
and/or can specifically bind (as defined herein) to any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof; as well as
compounds and constructs, and in particular proteins and
polypeptides, that comprise at least one such amino acid
sequence.
[0028] More in particular, the invention provides amino acid
sequences (and preferably ISV's) that can bind to any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof with an
affinity (suitably measured and/or expressed as a K.sub.D-value
(actual or apparent), a K.sub.A-value (actual or apparent), a
k.sub.on-rate and/or a k.sub.off-rate, or alternatively as an
IC.sub.50 value, as further described herein) that is as defined
herein; as well as compounds and constructs, and in particular
proteins and polypeptides, that comprise at least one such amino
acid sequence.
[0029] In particular, amino acid sequences and polypeptides of the
invention are preferably such that they: [0030] bind to any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof with
a dissociation constant (K.sub.D) of 10.sup.-5 to 10.sup.-12
moles/liter or less, such as 10.sup.-5 to 10.sup.-15 moles/liter
and preferably 10.sup.-7 to 10.sup.-12 moles/liter or less such as
10.sup.-7 to 10.sup.-15 moles/liter and more preferably 10.sup.-8
to 10.sup.-12 moles/liter or 10.sup.-8 to 10.sup.-15 moles/liter
(i.e. with an association constant (K.sub.A) of 10.sup.5 to
10.sup.12 liter/moles or more such as 10.sup.5 to 10.sup.15
liter/moles, and preferably 10.sup.7 to 10.sup.12 liter/moles or
more such as 10.sup.7 to 10.sup.15 liter/and more preferably
10.sup.8 to 10.sup.12 liter/moles or 10.sup.8 to 10.sup.15
liter/moles); and/or such that they: [0031] bind to any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof with a
k.sub.on-rate of between 10.sup.2 M.sup.-1s.sup.-1 to about
10.sup.7 M.sup.-1s.sup.-1, preferably between 10.sup.3
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1, more preferably
between 10.sup.4 M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1,
such as between 10.sup.5 M.sup.-1s.sup.-1 and
10.sup.7M.sup.-1s.sup.-1; and/or such that they: [0032] bind to any
of IL-17A, IL-17F and/or IL-17A/F including combinations thereof
with a k.sub.off rate between 1 s.sup.-1 (t.sub.1/2=0.69 s) and
10.sup.-6 s.sup.-1 (providing a near irreversible complex with a
t.sub.1/2 of multiple days), preferably between 10.sup.-2 s.sup.-1
and 10.sup.-6 s.sup.-1, more preferably between 10.sup.-3 s.sup.-1
and 10.sup.-6 s.sup.-1, such as between 10.sup.-4 s.sup.-1 and
10.sup.-6 s.sup.-1.
[0033] Preferably, a monovalent amino acid sequence of the
invention (or a polypeptide that contains only one amino acid
sequence of the invention) is preferably such that it will bind to
any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof with an affinity less than 500 nM, preferably less than 200
nM, more preferably less than 10 or 1 nM, such as less than 500
pM.
[0034] Some preferred IC50 values for binding of the amino acid
sequences or polypeptides of the invention to any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof will become clear
from the further description and examples herein.
[0035] It is noted that as used herein `can specifically bind to`
and `specifically binds to` are used synonymously and refer to the
ability to specifically bind to the respectively indicated
entity.
[0036] For binding to any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof, an amino acid sequence of the
invention will usually contain within its amino acid sequence one
or more amino acid residues or one or more stretches of amino acid
residues (i.e. with each "stretch" comprising two or amino acid
residues that are adjacent to each other or in close proximity to
each other, i.e. in the primary or tertiary structure of the amino
acid sequence) via which the amino acid sequence of the invention
can bind to any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof, which amino acid residues or stretches of
amino acid residues thus form the "site" for binding to any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof (also
referred to herein as the "antigen binding site").
[0037] The amino acid sequences provided by the invention are
preferably in essentially isolated form (as defined herein), or
form part of a protein or polypeptide of the invention (as defined
herein), which may comprise or essentially consist of one or more
amino acid sequences of the invention and which may optionally
further comprise one or more further amino acid sequences (all
optionally linked via one or more suitable linkers). For example,
and without limitation, the one or more amino acid sequences of the
invention may be used as a binding unit in such a protein or
polypeptide, which may optionally contain one or more further amino
acid sequences that can serve as a binding unit (i.e. against one
or more other targets than any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof), so as to provide a monovalent,
multivalent or multispecific polypeptide of the invention,
respectively, all as described herein. Such a protein or
polypeptide may also be in essentially isolated form (as defined
herein).
[0038] The amino acid sequences and polypeptides of the invention
as such preferably essentially consist of a single amino acid chain
that is not linked via disulphide bridges to any other amino acid
sequence or chain (but that may or may not contain one or more
intramolecular disulphide bridges. For example, it is known that
Nanobodies--as described herein--may sometimes contain a disulphide
bridge between CDR3 and CDR1 or FR2). However, it should be noted
that one or more amino acid sequences of the invention may be
linked to each other and/or to other amino acid sequences (e.g. via
disulphide bridges) to provide peptide constructs that may also be
useful in the invention (for example Fab' fragments, F(ab').sub.2
fragments, ScFv constructs, "diabodies" and other multispecific
constructs. Reference is for example made to the review by Holliger
and Hudson, Nat Biotechnol. 2005 September; 23(9):1126-36).
[0039] Generally, when an amino acid sequence of the invention (or
a compound, construct or polypeptide comprising the same) is
intended for administration to a subject (for example for
therapeutic and/or diagnostic purposes as described herein), it is
preferably either an amino acid sequence that does not occur
naturally in said subject; or, when it does occur naturally in said
subject, in essentially isolated form (as defined herein).
[0040] It will also be clear to the skilled person that for
pharmaceutical use, the amino acid sequences of the invention (as
well as compounds, constructs and polypeptides comprising the same)
are preferably directed against human any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof; whereas for veterinary
purposes, the amino acid sequences and polypeptides of the
invention are preferably directed against any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof from the species to
be treated, or are at least cross-reactive with any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof from the
species to be treated.
[0041] Furthermore, an amino acid sequence of the invention may
optionally, and in addition to the at least one binding site for
binding against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof, contain one or more further binding sites for
binding against other antigens, proteins or targets.
[0042] In the present description and claims, the following terms
are defined as follows: [0043] A) 04G01-like sequences: a
"04G01-like sequence", "04G01-like ISV" or "04G01-like building
block" is defined as an ISV (as described herein) that comprises:
[0044] a) a CDR1 which comprises or essentially consists of either
(i) the amino acid sequence IHVMG or (ii) an amino acid sequence
that has only 3, 2 or 1 amino acid difference(s) (as defined
herein) with the amino acid sequence IHVMG; and/or [0045] b) a CDR2
which comprises or essentially consists of either (i) the amino
acid sequence LIFSGGSADYADSVKG or (ii) an amino acid sequence that
has at least 80%, such as at least 85%, for example at least 90% or
more than 95% sequence identity with the amino acid sequence
LIFSGGSADYADSVKG; or (iii) an amino acid sequence that has only 7,
6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein)
with the amino acid sequence LIFSGGSADYADSVKG; and/or [0046] c) a
CDR3 which comprises or essentially consists of either (i) the
amino acid sequence EIGYYSGGTYYSSEAH or (ii) an amino acid sequence
that has at least 80%, such as at least 85%, for example at least
90% or more than 95% sequence identity with the amino acid sequence
EIGYYSGGTYYSSEAH; or (iii) an amino acid sequence that has only 7,
6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein)
with the amino acid sequence EIGYYSGGTYYSSEAH; in which the
framework sequences present in such an ISV are as further described
herein, and in which CDR1, CDR2 and CDR3 are preferably such that
the 04G01-like ISV has a blocking activity, which can be determined
by any suitable assay known to the person skilled in the art, such
as, for instance, by means of Alphascreen assays (e.g. such as
described herein) or by cell based assays (e.g. such as described
herein). Preferably, the blocking activity is determined by a
HT-1080 cell based assay, for instance, such as described in
Example 9. Preferably, the 04G01-like ISV has a blocking activity
of 0.3 .mu.g/ml IL-17A-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more
preferably, less than 100 nM, 50 nM or even less, such as less than
20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM and/or the 04G01-like ISV has a
blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 250
nM, more preferably, less than 200 nM, 150 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or
even more preferably of less than 35 nM.
[0047] Preferably, in such a 04G01-like sequence, CDR1 and CDR2 are
as defined under a) and b), respectively; or CDR1 and CDR3 are as
defined under a) and c), respectively; or CDR2 and CDR3 are as
defined under b) and c), respectively. More preferably, in such a
04G01-like sequence, CDR1, CDR2 and CDR3 are all as defined under
a), b) and c), respectively. Again, in such an 04G01-like sequence,
CDR1, CDR2 and CDR3 are preferably such that the 04G01-like ISV has
a blocking activity, which can be determined by any suitable assay
known to the person skilled in the art, such as, for instance, by
means of Alphascreen assays (e.g. such as described herein) or by
cell based assays (e.g. such as described herein). Preferably, the
blocking activity is determined by a HT-1080 cell based assay, for
instance, such as described in Example 9. Preferably, the
04G01-like ISV has a blocking activity of 0.3 .mu.g/ml
IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells
with an IC50 of less than 150 nM, more preferably, less than 100
nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9
nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM
and/or the 04G01-like ISV has a blocking activity of 1.5 .mu.g/ml
IL-17A/F-induced IL-6 production in human fibrosarcoma HT-1080
cells with an IC50 of less than 250 nM, more preferably, less than
200 nM, 150 nM or even less, such as less than 100 nM or 80 nM, 75
nM, 70 nM, 60 nM, 50 nM, or 40 nM or even more preferably of less
than 35 nM.
[0048] For example, in such an 04G01-like sequence: CDR1 may
comprise or essentially consist of the amino acid sequence IHVMG
(with CDR2 and CDR3 being as defined under b) and c),
respectively); and/or CDR2 may comprise or essentially consist of
the amino acid sequence LIFSGGSADYADSVKG (with CDR1 and CDR3 being
as defined under a) and c), respectively); and/or CDR3 may comprise
or essentially consist of the amino acid sequence EIGYYSGGTYYSSEAH
(with CDR1 and CDR2 being as defined under a) and b),
respectively). Particularly, when an 04G01-like sequence is
according to this aspect: CDR1 may comprise or essentially consist
of the amino acid sequence IHVMG and CDR2 may comprise or
essentially consist of the amino acid sequence LIFSGGSADYADSVKG
(with CDR3 being as defined under c) above); and/or CDR1 may
comprise or essentially consist of the amino acid sequence IHVMG
and CDR3 may comprise or essentially consist of the amino acid
sequence EIGYYSGGTYYSSEAH (with CDR2 being as defined under b)
above); and/or CDR2 may comprise or essentially consist of the
amino acid sequence LIFSGGSADYADSVKG and CDR3 may comprise or
essentially consist of the amino acid sequence EIGYYSGGTYYSSEAH
(with CDR1 being as defined under a) above). Again, in such
04G01-like sequences, CDR1, CDR2 and CDR3 are preferably such that
the 04G01-like ISV has a blocking activity, which can be determined
by any suitable assay known to the person skilled in the art, such
as, for instance, by means of Alphascreen assays (e.g. such as
described herein) or by cell based assays (e.g. such as described
herein). Preferably, the blocking activity is determined by a
HT-1080 cell based assay, for instance, such as described in
Example 9. Preferably, the 04G01-like ISV has a blocking activity
of 0.3 .mu.g/ml IL-17A-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more
preferably, less than 100 nM, 50 nM or even less, such as less than
20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM and/or the 04G01-like ISV has a
blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 250
nM, more preferably, less than 200 nM, 150 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or
even more preferably of less than 35 nM.
[0049] In a specifically preferred aspect, a "04G01-like sequence",
"04G01-like ISV" or "04G01-like building block" is an ISV that
comprises: [0050] d) a CDR1 which is either (i) the amino acid
sequence IHVMG or (ii) an amino acid sequence that has only 3, 2 or
1 amino acid difference(s) (as defined herein) with the amino acid
sequence IHVMG; and/or [0051] e) a CDR2 which is either (i) the
amino acid sequence LIFSGGSADYADSVKG or (ii) an amino acid sequence
that has at least 80%, such as at least 85%, for example at least
90% or more than 95% sequence identity with the amino acid sequence
LIFSGGSADYADSVKG; or (iii) an amino acid sequence that has only 7,
6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein)
with the amino acid sequence LIFSGGSADYADSVKG; and/or [0052] f) a
CDR3 which is either (i) the amino acid sequence EIGYYSGGTYYSSEAH
or (ii) an amino acid sequence that has at least 80%, such as at
least 85%, for example at least 90% or more than 95% sequence
identity with the amino acid sequence EIGYYSGGTYYSSEAH; or (iii) an
amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid
difference(s) (as defined herein) with the amino acid sequence
EIGYYSGGTYYSSEAH; in which the framework sequences present in such
an ISV are as further described herein, and in which CDR1, CDR2 and
CDR3 are preferably such that the 04G01-like ISV has a blocking
activity, which can be determined by any suitable assay known to
the person skilled in the art, such as, for instance, by means of
Alphascreen assays (e.g. such as described herein) or by cell based
assays (e.g. such as described herein). Preferably, the blocking
activity is determined by a HT-1080 cell based assay, for instance,
such as described in Example 9. Preferably, the 04G01-like ISV has
a blocking activity of 0.3 .mu.g/ml IL-17A-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 150
nM, more preferably, less than 100 nM, 50 nM or even less, such as
less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even
more preferably of less than 5 nM and/or the 04G01-like ISV has a
blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 250
nM, more preferably, less than 200 nM, 150 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or
even more preferably of less than 35 nM.
[0053] Preferably, in a 04G01-like sequence according to this
specifically preferred aspect, CDR1 and CDR2 are as defined under
d) and e), respectively; or CDR1 and CDR3 are as defined under d)
and f), respectively; or CDR2 and CDR3 are as defined under e) and
f), respectively. More preferably, in such a 04G01-like sequence,
CDR1, CDR2 and CDR3 are all as defined under d), e) and f),
respectively. Again, in such an 04G01-like sequence, CDR1, CDR2 and
CDR3 are preferably such that the 04G01-like ISV has a blocking
activity, which can be determined by any suitable assay known to
the person skilled in the art, such as, for instance, by means of
Alphascreen assays (e.g. such as described herein) or by cell based
assays (e.g. such as described herein). Preferably, the blocking
activity is determined by a HT-1080 cell based assay, for instance,
such as described in Example 9.
[0054] Preferably, the 04G01-like ISV has a blocking activity of
0.3 .mu.g/ml IL-17A-induced IL-6 production in human fibrosarcoma
HT-1080 cells with an IC50 of less than 150 nM, more preferably,
less than 100 nM, 50 nM or even less, such as less than 20 nM or 15
nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less
than 5 nM and/or the 04G01-like ISV has a blocking activity of 1.5
.mu.g/ml IL-17A/F-induced IL-6 production in human fibrosarcoma
HT-1080 cells with an IC50 of less than 250 nM, more preferably,
less than 200 nM, 150 nM or even less, such as less than 100 nM or
80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or even more preferably
of less than 35 nM.
[0055] For example, in a 04G01-like sequence according to this
specifically preferred aspect: CDR1 is the amino acid sequence
IHVMG (with CDR2 and CDR3 being as defined under e) and f),
respectively); and/or CDR2 is the amino acid sequence
LIFSGGSADYADSVKG (with CDR1 and CDR3 being as defined under d) and
f), respectively); and/or CDR3 is the amino acid sequence
EIGYYSGGTYYSSEAH (with CDR1 and CDR2 being as defined under d) and
e), respectively). Particularly, when an 04G01-like sequence is
according to this aspect: CDR1 is the amino acid sequence IHVMG and
CDR2 is the amino acid sequence LIFSGGSADYADSVKG (with CDR3 being
as defined under f) above); and/or CDR1 is the amino acid sequence
IHVMG and CDR3 is the amino acid sequence EIGYYSGGTYYSSEAH (with
CDR2 being as defined under e) above); and/or CDR2 is the amino
acid sequence LIFSGGSADYADSVKG and CDR3 is EIGYYSGGTYYSSEAH (with
CDR1 being as defined under d) above). Again, in such 04G01-like
sequences, CDR1, CDR2 and CDR3 are preferably such that the
04G01-like ISV has a blocking activity, which can be determined by
any suitable assay known to the person skilled in the art, such as,
for instance, by means of Alphascreen assays (e.g. such as
described herein) or by cell based assays (e.g. such as described
herein). Preferably, the blocking activity is determined by a
HT-1080 cell based assay, for instance, such as described in
Example 9. Preferably, the 04G01-like ISV has a blocking activity
of 0.3 .mu.g/ml IL-17A-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more
preferably, less than 100 nM, 50 nM or even less, such as less than
20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM and/or the 04G01-like ISV has a
blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 250
nM, more preferably, less than 200 nM, 150 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or
even more preferably of less than 35 nM.
[0056] In a particularly preferred 04G01-like sequence: CDR1 is the
amino acid sequence IHVMG, CDR2 is the amino acid sequence
LIFSGGSADYADSVKG; and CDR3 is the amino acid sequence
EIGYYSGGTYYSSEAH.
[0057] In all the 04G01-like sequence described in this paragraph
A), the framework sequences may be as further described herein.
Preferably, the framework sequences are such that the framework
sequences have at least 80%, such as at least 85%, for example at
least 90%, such as at least 95% sequence identity with the
framework sequences of 04G01 (which, for example, can be determined
by determining the overall degree of sequence identity of a given
sequence with the sequence of 04G01 while disregarding the CDR's in
the calculation). Again, the combination of CDR's and frameworks
present in a given sequence are preferably such that the resulting
04G01-like ISV has a blocking activity, which can be determined by
any suitable assay known to the person skilled in the art, such as,
for instance, by means of Alphascreen assays (e.g. such as
described herein) or by cell based assays (e.g. such as described
herein). Preferably, the blocking activity is determined by a
HT-1080 cell based assay, for instance, such as described in
Example 9.
[0058] Preferably, the 04G01-like ISV has a blocking activity of
0.3 .mu.g/ml IL-17A-induced IL-6 production in human fibrosarcoma
HT-1080 cells with an IC50 of less than 150 nM, more preferably,
less than 100 nM, 50 nM or even less, such as less than 20 nM or 15
nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more preferably of less
than 5 nM and/or the 04G01-like ISV has a blocking activity of 1.5
.mu.g/ml IL-17A/F-induced IL-6 production in human fibrosarcoma
HT-1080 cells with an IC50 of less than 250 nM, more preferably,
less than 200 nM, 150 nM or even less, such as less than 100 nM or
80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or even more preferably
of less than 35 nM.
[0059] In one specific aspect, a 04G01-like sequence is an ISV that
has at least 70%, such at least 80%, for example at least 85%, such
as at least 90% or more than 95% sequence identity with SEQ ID NO:
635. For example, in an 04G01-like sequence according to this
aspect, the CDR's may be according to the specifically preferred
aspect described above, and may in particularly (but without
limitation) be IHVMG (CDR1); LIFSGGSADYADSVKG (CDR2); and
EIGYYSGGTYYSSEAH (CDR3). Again, preferably, the combination of
CDR's and frameworks present in such a 04G01-like ISV are
preferably such that the resulting 04G01-like ISV has a blocking
activity, which can be determined by any suitable assay known to
the person skilled in the art, such as, for instance, by means of
Alphascreen assays (e.g. such as described herein) or by cell based
assays (e.g. such as described herein). Preferably, the blocking
activity is determined by a HT-1080 cell based assay, for instance,
such as described in Example 9. Preferably, the 04G01-like ISV has
a blocking activity of 0.3 .mu.g/ml IL-17A-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 150
nM, more preferably, less than 100 nM, 50 nM or even less, such as
less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even
more preferably of less than 5 nM and/or the 04G01-like ISV has a
blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 250
nM, more preferably, less than 200 nM, 150 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or
even more preferably of less than 35 nM.
[0060] In one particular aspect, any 04G01-like sequence may be a
humanized and/or sequence optimized sequence, as further described
herein. [0061] B) 16A04-like sequences: a "16A04-like sequence",
"16A04-like ISV" or "16A04-like building block" is defined as an
ISV (as described herein) that comprises: [0062] a) a CDR1 which
comprises or essentially consists of either (i) the amino acid
sequence SYVVG or (ii) an amino acid sequence that has only 2 or
(preferably) 1 amino acid difference(s) (as defined herein) with
the amino acid sequence SYVVG; and/or [0063] b) a CDR2 which
comprises or essentially consists of either (i) the amino acid
sequence AISGSGDSIYYAVSEKD or (ii) an amino acid sequence that has
at least 80%, such as at least 85%, for example at least 90% or
more than 95% sequence identity with the amino acid sequence
AISGSGDSIYYAVSEKD; or (iii) an amino acid sequence that has only 7,
6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein)
with the amino acid sequence AISGSGDSIYYAVSEKD; and/or [0064] c) a
CDR3 which comprises or essentially consists of either (i) the
amino acid sequence DQEFGYLRFGRSEY or (ii) an amino acid sequence
that has at least 80%, such as at least 85%, for example at least
90% or more than 95% sequence identity with the amino acid sequence
DQEFGYLRFGRSEY; or (iii) an amino acid sequence that has only 7, 6,
5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with
the amino acid sequence DQEFGYLRFGRSEY; in which the framework
sequences present in such an ISV are as further described herein,
and in which CDR1, CDR2 and CDR3 are preferably such that the
16A04-like ISV has a blocking activity, which can be determined by
any suitable assay known to the person skilled in the art, such as,
for instance, by means of Alphascreen assays (e.g. such as
described herein) or by cell based assays (e.g. such as described
herein). Preferably, the blocking activity is determined by a
HT-1080 cell based assay, such as, for instance, described in
Example 9. Preferably, the 16A04-like ISV has a blocking activity
of 4.5 .mu.g/ml IL-17F-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 300 nM, more
preferably, less than 250 nM or even less, such as less than 200 nM
or 180 nM, 175 nM, 160 nM or even more preferably of less than 150
nM and/or the 16A04-like ISV has a blocking activity of 1.5
.mu.g/ml IL-17A/F-induced IL-6 production in human fibrosarcoma
HT-1080 cells with an IC50 of less than 250 nM, more preferably,
less than 200 nM, 150 nM or even less, such as less than 100 nM or
80 nM, 75 nM, 70 nM, 65 nM, 60 nM, or 55 nM or even more preferably
of less than 50 nM.
[0065] Preferably, in such a 16A04-like sequence, CDR1 and CDR2 are
as defined under a) and b), respectively; or CDR1 and CDR3 are as
defined under a) and c), respectively; or CDR2 and CDR3 are as
defined under b) and c), respectively. More preferably, in such a
16A04-like sequence, CDR1, CDR2 and CDR3 are all as defined under
a), b) and c), respectively. Again, in such an 16A04-like sequence,
CDR1, CDR2 and CDR3 are preferably such that the 16A04-like ISV has
a blocking activity, which can be determined by any suitable assay
known to the person skilled in the art, such as, for instance, by
means of Alphascreen assays (e.g. such as described herein) or by
cell based assays (e.g. such as described herein). Preferably, the
blocking activity is determined by a HT-1080 cell based assay, such
as, for instance, described in Example 9. Preferably, the
16A04-like ISV has a blocking activity of 4.5 .mu.g/ml
IL-17F-induced IL-6 production in human fibrosarcoma HT-1080 cells
with an IC50 of less than 300 nM, more preferably, less than 250 nM
or even less, such as less than 200 nM or 180 nM, 175 nM, 160 nM or
even more preferably of less than 150 nM and/or the 16A04-like ISV
has a blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6
production in human fibrosarcoma HT-1080 cells with an IC50 of less
than 250 nM, more preferably, less than 200 nM, 150 nM or even
less, such as less than 100 nM or 80 nM, 75 nM, 70 nM, 65 nM, 60
nM, or 55 nM or even more preferably of less than 50 nM.
[0066] For example, in such an 16A04-like sequence: CDR1 may
comprise or essentially consist of the amino acid sequence SYVVG
(with CDR2 and CDR3 being as defined under b) and c),
respectively); and/or CDR2 may comprise or essentially consist of
the amino acid sequence AISGSGDSIYYAVSEKD (with CDR1 and CDR3 being
as defined under a) and c), respectively); and/or CDR3 may comprise
or essentially consist of the amino acid sequence DQEFGYLRFGRSEY
(with CDR1 and CDR2 being as defined under a) and b),
respectively). Particularly, when an 16A04-like sequence is
according to this aspect: CDR1 may comprise or essentially consist
of the amino acid sequence SYVVG and CDR2 may comprise or
essentially consist of the amino acid sequence AISGSGDSIYYAVSEKD
(with CDR3 being as defined under c) above); and/or CDR1 may
comprise or essentially consist of the amino acid sequence SYVVG
and CDR3 may comprise or essentially consist of the amino acid
sequence DQEFGYLRFGRSEY (with CDR2 being as defined under b)
above); and/or CDR2 may comprise or essentially consist of the
amino acid sequence AISGSGDSIYYAVSEKD and CDR3 may comprise or
essentially consist of the amino acid sequence DQEFGYLRFGRSEY (with
CDR1 being as defined under a) above). Again, in such 16A04-like
sequences, CDR1, CDR2 and CDR3 are preferably such that the
16A04-like ISV has a blocking activity, which can be determined by
any suitable assay known to the person skilled in the art, such as,
for instance, by means of Alphascreen assays (e.g. such as
described herein) or by cell based assays (e.g. such as described
herein). Preferably, the blocking activity is determined by a
HT-1080 cell based assay, such as, for instance, described in
Example 9. Preferably, the 16A04-like ISV has a blocking activity
of 4.5 .mu.g/ml IL-17F-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 300 nM, more
preferably, less than 250 nM or even less, such as less than 200 nM
or 180 nM, 175 nM, 160 nM or even more preferably of less than 150
nM and/or the 16A04-like ISV has a blocking activity of 1.5
.mu.g/ml IL-17A/F-induced IL-6 production in human fibrosarcoma
HT-1080 cells with an IC50 of less than 250 nM, more preferably,
less than 200 nM, 150 nM or even less, such as less than 100 nM or
80 nM, 75 nM, 70 nM, 65 nM, 60 nM, or 55 nM or even more preferably
of less than 50 nM.
[0067] In a specifically preferred aspect, a "16A04-like sequence",
"16A04-like ISV" or "16A04-like building block" is an ISV that
comprises: [0068] d) a CDR1 which is either (i) the amino acid
sequence SYVVG or (ii) an amino acid sequence that has only 2 or
(preferably) 1 amino acid difference(s) (as defined herein) with
the amino acid sequence SYVVG; and/or [0069] e) a CDR2 which is
either (i) the amino acid sequence AISGSGDSIYYAVSEKD or (ii) an
amino acid sequence that has at least 80%, such as at least 85%,
for example at least 90% or more than 95% sequence identity with
the amino acid sequence AISGSGDSIYYAVSEKD; or (iii) an amino acid
sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid
difference(s) (as defined herein) with the amino acid sequence
AISGSGDSIYYAVSEKD; and/or [0070] f) a CDR3 which is either (i) the
amino acid sequence DQEFGYLRFGRSEY or (ii) an amino acid sequence
that has at least 80%, such as at least 85%, for example at least
90% or more than 95% sequence identity with the amino acid sequence
DQEFGYLRFGRSEY; or (iii) an amino acid sequence that has only 7, 6,
5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein) with
the amino acid sequence DQEFGYLRFGRSEY; in which the framework
sequences present in such an ISV are as further described herein,
and in which CDR1, CDR2 and CDR3 are preferably such that the
16A04-like ISV has a blocking activity, which can be determined by
any suitable assay known to the person skilled in the art, such as,
for instance, by means of Alphascreen assays (e.g. such as
described herein) or by cell based assays (e.g. such as described
herein). Preferably, the blocking activity is determined by a
HT-1080 cell based assay, such as, for instance, described in
Example 9. Preferably, the 16A04-like ISV has a blocking activity
of 4.5 .mu.g/ml IL-17F-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 300 nM, more
preferably, less than 250 nM or even less, such as less than 200 nM
or 180 nM, 175 nM, 160 nM or even more preferably of less than 150
nM and/or the 16A04-like ISV has a blocking activity of 1.5
.mu.g/ml IL-17A/F-induced IL-6 production in human fibrosarcoma
HT-1080 cells with an IC50 of less than 250 nM, more preferably,
less than 200 nM, 150 nM or even less, such as less than 100 nM or
80 nM, 75 nM, 70 nM, 65 nM, 60 nM, or 55 nM or even more preferably
of less than 50 nM. Preferably, in a 16A04-like sequence according
to this specifically preferred aspect. CDR1 and CDR2 are as defined
under d) and e), respectively; or CDR1 and CDR3 are as defined
under d) and f), respectively; or CDR2 and CDR3 are as defined
under e) and f), respectively. More preferably, in such a
16A04-like sequence, CDR1, CDR2 and CDR3 are all as defined under
d), e) and f), respectively. Again, in such an 16A04-like sequence,
CDR1, CDR2 and CDR3 are preferably such that the 16A04-like ISV has
a blocking activity, which can be determined by any suitable assay
known to the person skilled in the art, such as, for instance, by
means of Alphascreen assays (e.g. such as described herein) or by
cell based assays (e.g. such as described herein). Preferably, the
blocking activity is determined by a HT-1080 cell based assay, such
as, for instance, described in Example 9. Preferably, the
16A04-like ISV has a blocking activity of 4.5 .mu.g/ml
IL-17F-induced IL-6 production in human fibrosarcoma HT-1080 cells
with an IC50 of less than 300 nM, more preferably, less than 250 nM
or even less, such as less than 200 nM or 180 nM, 175 nM, 160 nM or
even more preferably of less than 150 nM and/or the 16A04-like ISV
has a blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6
production in human fibrosarcoma HT-1080 cells with an IC50 of less
than 250 nM, more preferably, less than 200 nM, 150 nM or even
less, such as less than 100 nM or 80 nM, 75 nM, 70 nM, 65 nM, 60
nM, or 55 nM or even more preferably of less than 50 nM.
[0071] For example, in a 16A04-like sequence according to this
specifically preferred aspect: CDR1 is the amino acid sequence
SYVVG (with CDR2 and CDR3 being as defined under e) and f),
respectively); and/or CDR2 is the amino acid sequence
AISGSGDSIYYAVSEKD (with CDR1 and CDR3 being as defined under d) and
f), respectively); and/or CDR3 is the amino acid sequence
DQEFGYLRFGRSEY (with CDR1 and CDR2 being as defined under d) and
e), respectively). Particularly, when an 16A04-like sequence is
according to this aspect: CDR1 is the amino acid sequence SYVVG and
CDR2 is the amino acid sequence AISGSGDSIYYAVSEKD (with CDR3 being
as defined under f) above); and/or CDR1 is the amino acid sequence
SYVVG and CDR3 is the amino acid sequence DQEFGYLRFGRSEY (with CDR2
being as defined under e) above); and/or CDR2 is the amino acid
sequence AISGSGDSIYYAVSEKD and CDR3 is DQEFGYLRFGRSEY (with CDR1
being as defined under d) above). Again, in such 16A04-like
sequences, CDR1, CDR2 and CDR3 are preferably such that the
16A04-like ISV has a blocking activity, which can be determined by
any suitable assay known to the person skilled in the art, such as,
for instance, by means of Alphascreen assays (e.g. such as
described herein) or by cell based assays (e.g. such as described
herein). Preferably, the blocking activity is determined by a
HT-1080 cell based assay, such as, for instance, described in
Example 9. Preferably, the 16A04-like ISV has a blocking activity
of 4.5 .mu.g/ml IL-17F-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 300 nM, more
preferably, less than 250 nM or even less, such as less than 200 nM
or 180 nM, 175 nM, 160 nM or even more preferably of less than 150
nM and/or the I 6A04-like ISV has a blocking activity of 1.5
.mu.g/ml IL-17A/F-induced IL-6 production in human fibrosarcoma
HT-1080 cells with an IC50 of less than 250 nM, more preferably,
less than 200 nM, 150 nM or even less, such as less than 100 nM or
80 nM, 75 nM, 70 nM, 65 nM, 60 nM, or 55 nM or even more preferably
of less than 50 nM.
[0072] In a particularly preferred 16A04-like sequence: CDR1 is the
amino acid sequence SYVVG, CDR2 is the amino acid sequence
AISGSGDSIYYAVSEKD; and CDR3 is the amino acid sequence
DQEFGYLRFGRSEY.
[0073] In all the 16A04-like sequence described in this paragraph
B), the framework sequences may be as further described herein.
Preferably, the framework sequences are such that the framework
sequences have at least 80%, such as at least 85%, for example at
least 90%, such as at least 95% sequence identity with the
framework sequences of 16A04 (which, for example, can be determined
by determining the overall degree of sequence identity of a given
sequence with the sequence of 16A04 while disregarding the CDR's in
the calculation). Again, the combination of CDR's and frameworks
present in a given sequence are preferably such that the resulting
16A04-like ISV has a blocking activity, which can be determined by
any suitable assay known to the person skilled in the art, such as,
for instance, by means of Alphascreen assays (e.g. such as
described herein) or by cell based assays (e.g. such as described
herein). Preferably, the blocking activity is determined by a
HT-1080 cell based assay, such as, for instance, described in
Example 9. Preferably, the 16A04-like ISV has a blocking activity
of 4.5 .mu.g/ml IL-17F-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 300 nM, more
preferably, less than 250 nM or even less, such as less than 200 nM
or 180 nM, 175 nM, 160 nM or even more preferably of less than 150
nM and/or the 16A04-like ISV has a blocking activity of 1.5
.mu.g/ml IL-17A/F-induced IL-6 production in human fibrosarcoma
HT-1080 cells with an IC50 of less than 250 nM, more preferably,
less than 200 nM, 150 nM or even less, such as less than 100 nM or
80 nM, 75 nM, 70 nM, 65 nM, 60 nM, or 55 nM or even more preferably
of less than 50 nM.
[0074] In one specific aspect, a 16A04-like sequence is an ISV that
has at least 70%, such at least 80%, for example at least 85%, such
as at least 90% or more than 95% sequence identity with SEQ ID NO:
648. For example, in an 16A04-like sequence according to this
aspect, the CDR's may be according to the specifically preferred
aspect described above, and may in particularly (but without
limitation) be SYVVG (CDR1); AISGSGDSIYYAVSEKD (CDR2); and
DQEFGYLRFGRSEY (CDR3). Again, preferably, the combination of CDR's
and frameworks present in such a 16A04-like ISV are preferably such
that the resulting 16A04-like ISV has a blocking activity, which
can be determined by any suitable assay known to the person skilled
in the art, such as, for instance, by means of Alphascreen assays
(e.g. such as described herein) or by cell based assays (e.g. such
as described herein). Preferably, the blocking activity is
determined by a HT-1080 cell based assay, such as, for instance,
described in Example 9. Preferably, the 16A04-like ISV has a
blocking activity of 4.5 .mu.g/ml IL-17F-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 300 nM,
more preferably, less than 250 nM or even less, such as less than
200 nM or 180 nM, 175 nM, 160 nM or even more preferably of less
than 150 nM and/or the 16A04-like ISV has a blocking activity of
1.5 .mu.g/ml IL-17A/F-induced IL-6 production in human fibrosarcoma
HT-1080 cells with an IC50 of less than 250 nM, more preferably,
less than 200 nM, 150 nM or even less, such as less than 100 nM or
80 nM, 75 nM, 70 nM, 65 nM, 60 nM, or 55 nM or even more preferably
of less than 50 nM.
[0075] In one particular aspect, any 16A04-like sequence may be a
humanized sequence, as further described herein. [0076] C)
13B03-like sequences: a "13B03-like sequence", "13B03-like ISV" or
"13B03-like building block" is defined as an ISV (as described
herein) that comprises: [0077] a) a CDR1 which comprises or
essentially consists of either (i) the amino acid sequence INWFG or
(ii) an amino acid sequence that has only 3, 2 or 1 amino acid
difference(s) (as defined herein) with the amino acid sequence
INWFG; and/or [0078] b) a CDR2 which comprises or essentially
consists of either (i) the amino acid sequence GIRWSDAYTEYANSVKG or
(ii) an amino acid sequence that has at least 80%, such as at least
85%, for example at least 90% or more than 95% sequence identity
with the amino acid sequence GIRWSDAYTEYANSVKG; or (iii) an amino
acid sequence that has only 7, 6, 5, 4, 3, 2 or I amino acid
difference(s) (as defined herein) with the amino acid sequence
GIRWSDAYTEYANSVKG; and/or [0079] c) a CDR3 which comprises or
essentially consists of either (i) the amino acid sequence
[0080] DLSTVRY or (ii) an amino acid sequence that has at least
80%, such as at least 85%, for example at least 90% or more than
95% sequence identity with the amino acid sequence DLSTVRY; or
(iii) an amino acid sequence that has only 4, 3, 2 or 1 amino acid
difference(s) (as defined herein) with the amino acid sequence
DLSTVRY;
in which the framework sequences present in such an ISV are as
further described herein, and in which CDR1, CDR2 and CDR3 are
preferably such that the 13B03-like ISV has a blocking activity,
which can be determined by any suitable assay known to the person
skilled in the art, such as, for instance, by means of Alphascreen
assays (e.g. such as described herein) or by cell based assays
(e.g. such as described herein). Preferably, the blocking activity
is determined by a HT-1080 cell based assay, for instance, such as
described in Example 9. Preferably, the 13B03-like ISV has a
blocking activity of 0.3 .mu.g/ml IL-17A-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM,
more preferably, less than 100 nM, 50 nM or even less, such as less
than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM, and/or the 13B03-like ISV has a
blocking activity of 4.5 .mu.g/ml IL-17F-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM,
more preferably, less than 300 nM, 250 nM or even less, such as
less than 200 nM or 175 nM, 160 nM, or 155 nM or even more
preferably of less than 150 nM and/or the 13B03-like ISV has a
blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 200
nM, more preferably, less than 150 nM, 125 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or
even more preferably of less than 30 nM. Preferably, in such a
13B03-like sequence, CDR1 and CDR2 are as defined under a) and b),
respectively; or CDR1 and CDR3 are as defined under a) and c),
respectively; or CDR2 and CDR3 are as defined under b) and c),
respectively. More preferably, in such a 13B03-like sequence, CDR1,
CDR2 and CDR3 are all as defined under a), b) and c), respectively.
Again, in such an 13B03-like sequence, CDR1, CDR2 and CDR3 are
preferably such that the 13B03-like ISV has a blocking activity,
which can be determined by any suitable assay known to the person
skilled in the art, such as, for instance, by means of Alphascreen
assays (e.g. such as described herein) or by cell based assays
(e.g. such as described herein). Preferably, the blocking activity
is determined by a HT-1080 cell based assay, for instance, such as
described in Example 9. Preferably, the 13B03-like ISV has a
blocking activity of 0.3 .mu.g/ml IL-17A-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM,
more preferably, less than 100 nM, 50 nM or even less, such as less
than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM, and/or the 13B03-like ISV has a
blocking activity of 4.5 .mu.g/ml IL-17F-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM,
more preferably, less than 300 nM, 250 nM or even less, such as
less than 200 nM or 175 nM, 160 nM, or 155 nM or even more
preferably of less than 150 nM and/or the 13B03-like ISV has a
blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 200
nM, more preferably, less than 150 nM, 125 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or
even more preferably of less than 30 nM.
[0081] For example, in such an 13B03-like sequence: CDR1 may
comprise or essentially consist of the amino acid sequence INWFG
(with CDR2 and CDR3 being as defined under b) and c),
respectively); and/or CDR2 may comprise or essentially consist of
the amino acid sequence GIRWSDAYTEYANSVKG (with CDR1 and CDR3 being
as defined under a) and c), respectively); and/or CDR3 may comprise
or essentially consist of the amino acid sequence DLSTVRY (with
CDR1 and CDR2 being as defined under a) and b), respectively).
Particularly, when an 13B03-like sequence is according to this
aspect: CDR1 may comprise or essentially consist of the amino acid
sequence INWFG and CDR2 may comprise or essentially consist of the
amino acid sequence GIRWSDAYTEYANSVKG (with CDR3 being as defined
under c) above); and/or CDR1 may comprise or essentially consist of
the amino acid sequence INWFG and CDR3 may comprise or essentially
consist of the amino acid sequence DLSTVRY (with CDR2 being as
defined under b) above); and/or CDR2 may comprise or essentially
consist of the amino acid sequence GIRWSDAYTEYANSVKG and CDR3 may
comprise or essentially consist of the amino acid sequence DLSTVRY
(with CDR1 being as defined under a) above). Again, in such
13B03-like sequences, CDR1, CDR2 and CDR3 are preferably such that
the 13B03-like ISV has a blocking activity, which can be determined
by any suitable assay known to the person skilled in the art, such
as, for instance, by means of Alphascreen assays (e.g. such as
described herein) or by cell based assays (e.g. such as described
herein). Preferably, the blocking activity is determined by a
HT-1080 cell based assay, for instance, such as described in
Example 9. Preferably, the 13B03-like ISV has a blocking activity
of 0.3 .mu.g/ml IL-17A-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more
preferably, less than 100 nM, 50 nM or even less, such as less than
20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM, and/or the 13B03-like ISV has a
blocking activity of 4.5 .mu.g/ml IL-17F-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM,
more preferably, less than 300 nM, 250 nM or even less, such as
less than 200 nM or 175 nM, 160 nM, or 155 nM or even more
preferably of less than 150 nM and/or the 13B03-like ISV has a
blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 200
nM, more preferably, less than 150 nM, 125 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or
even more preferably of less than 30 nM.
[0082] In a specifically preferred aspect, a "13B03-like sequence",
"13B03-like ISV" or "13B03-like building block" is an ISV that
comprises: [0083] d) a CDR1 which is either (i) the amino acid
sequence INWFG or (ii) an amino acid sequence that has only 3, 2 or
1 amino acid difference(s) (as defined herein) with the amino acid
sequence INWFG; and/or [0084] e) a CDR2 which is either (i) the
amino acid sequence GIRWSDAYTEYANSVKG or (ii) an amino acid
sequence that has at least 80%, such as at least 85%, for example
at least 90% or more than 95% sequence identity with the amino acid
sequence GIRWSDAYTEYANSVKG; or (iii) an amino acid sequence that
has only 7, 6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined
herein) with the amino acid sequence GIRWSDAYTEYANSVKG; and/or
[0085] f) a CDR3 which is either (i) the amino acid sequence
DLSTVRY or (ii) an amino acid sequence that has at least 80%, such
as at least 85%, for example at least 90% or more than 95% sequence
identity with the amino acid sequence DLSTVRY; or (iii) an amino
acid sequence that has only 4, 3, 2 or 1 amino acid difference(s)
(as defined herein) with the amino acid sequence DLSTVRY; in which
the framework sequences present in such an ISV are as further
described herein, and in which CDR1, CDR2 and CDR3 are preferably
such that the 13B03-like ISV has a blocking activity, which can be
determined by any suitable assay known to the person skilled in the
art, such as, for instance, by means of Alphascreen assays (e.g.
such as described herein) or by cell based assays (e.g. such as
described herein). Preferably, the blocking activity is determined
by a HT-1080 cell based assay, for instance, such as described in
Example 9. Preferably, the 13B03-like ISV has a blocking activity
of 0.3 .mu.g/ml IL-17A-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more
preferably, less than 100 nM, 50 nM or even less, such as less than
20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM, and/or the 13B03-like ISV has a
blocking activity of 4.5 .mu.g/ml IL-17F-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM,
more preferably, less than 300 nM, 250 nM or even less, such as
less than 200 nM or 175 nM, 160 nM, or 155 nM or even more
preferably of less than 150 nM and/or the 13B03-like ISV has a
blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 200
nM, more preferably, less than 150 nM, 125 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or
even more preferably of less than 30 nM. Preferably, in a
13B03-like sequence according to this specifically preferred
aspect, CDR1 and CDR2 are as defined under d) and e), respectively;
or CDR1 and CDR3 are as defined under d) and f), respectively; or
CDR2 and CDR3 are as defined under e) and f), respectively. More
preferably, in such a 13B03-like sequence, CDR1, CDR2 and CDR3 are
all as defined under d), e) and f), respectively. Again, in such an
13B03-like sequence, CDR1, CDR2 and CDR3 are preferably such that
the 13B03-like ISV has a blocking activity, which can be determined
by any suitable assay known to the person skilled in the art, such
as, for instance, by means of Alphascreen assays (e.g. such as
described herein) or by cell based assays (e.g. such as described
herein). Preferably, the blocking activity is determined by a
HT-1080 cell based assay, for instance, such as described in
Example 9. Preferably, the 13B03-like ISV has a blocking activity
of 0.3 .mu.g/ml IL-17A-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more
preferably, less than 100 nM, 50 nM or even less, such as less than
20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM, and/or the 13B03-like ISV has a
blocking activity of 4.5 .mu.g/ml IL-17F-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM,
more preferably, less than 300 nM, 250 nM or even less, such as
less than 200 nM or 175 nM, 160 nM, or 155 nM or even more
preferably of less than 150 nM and/or the 13B03-like ISV has a
blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 200
nM, more preferably, less than 150 nM, 125 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or
even more preferably of less than 30 nM.
[0086] For example, in a 13B03-like sequence according to this
specifically preferred aspect: CDR1 is the amino acid sequence
INWFG (with CDR2 and CDR3 being as defined under e) and f),
respectively); and/or CDR2 is the amino acid sequence
GIRWSDAYTEYANSVKG (with CDR1 and CDR3 being as defined under d) and
f), respectively); and/or CDR3 is the amino acid sequence DLSTVRY
(with CDR1 and CDR2 being as defined under d) and e),
respectively). Particularly, when an 13B03-like sequence is
according to this aspect: CDR1 is the amino acid sequence INWFG and
CDR2 is the amino acid sequence GIRWSDAYTEYANSVKG (with CDR3 being
as defined under f) above); and/or CDR1 is the amino acid sequence
INWFG and CDR3 is the amino acid sequence DLSTVRY (with CDR2 being
as defined under e) above); and/or CDR2 is the amino acid sequence
GIRWSDAYTEYANSVKG and CDR3 is DLSTVRY (with CDR1 being as defined
under d) above). Again, in such 13B03-like sequences, CDR1, CDR2
and CDR3 are preferably such that the 13B03-like ISV has a blocking
activity, which can be determined by any suitable assay known to
the person skilled in the art, such as, for instance, by means of
Alphascreen assays (e.g. such as described herein) or by cell based
assays (e.g. such as described herein). Preferably, the blocking
activity is determined by a HT-1080 cell based assay, for instance,
such as described in Example 9. Preferably, the 13B03-like ISV has
a blocking activity of 0.3 .mu.g/ml IL-17A-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 150
nM, more preferably, less than 100 nM, 50 nM or even less, such as
less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even
more preferably of less than 5 nM, and/or the 13B03-like ISV has a
blocking activity of 4.5 .mu.g/ml IL-17F-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM,
more preferably, less than 300 nM, 250 nM or even less, such as
less than 200 nM or 175 nM, 160 nM, or 155 nM or even more
preferably of less than 150 nM and/or the 13B03-like ISV has a
blocking activity of 1.5 g/ml IL-17A/F-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 200 nM,
more preferably, less than 150 nM, 125 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or
even more preferably of less than 30 nM.
[0087] In a particularly preferred 13B03-like sequence: CDR1 is the
amino acid sequence INWFG, CDR2 is the amino acid sequence
GIRWSDAYTEYANSVKG; and CDR3 is the amino acid sequence DLSTVRY.
[0088] In all the 13B03-like sequence described in this paragraph
C), the framework sequences may be as further described herein.
Preferably, the framework sequences are such that the framework
sequences have at least 80%, such as at least 85%, for example at
least 90%, such as at least 95% sequence identity with the
framework sequences of 13B03 (which, for example, can be determined
by determining the overall degree of sequence identity of a given
sequence with the sequence of 13B03 while disregarding the CDR's in
the calculation). Again, the combination of CDR's and frameworks
present in a given sequence are preferably such that the resulting
13B03-like ISV has a blocking activity, which can be determined by
any suitable assay known to the person skilled in the art, such as,
for instance, by means of Alphascreen assays (e.g. such as
described herein) or by cell based assays (e.g. such as described
herein). Preferably, the blocking activity is determined by a
HT-1080 cell based assay, for instance, such as described in
Example 9. Preferably, the 13B03-like ISV has a blocking activity
of 0.3 .mu.g/ml IL-17A-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more
preferably, less than 100 nM, 50 nM or even less, such as less than
20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM, and/or the 13B03-like ISV has a
blocking activity of 4.5 .mu.g/ml IL-17F-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM,
more preferably, less than 300 nM, 250 nM or even less, such as
less than 200 nM or 175 nM, 160 nM, or 155 nM or even more
preferably of less than 150 nM and/or the 13B03-like ISV has a
blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 200
nM, more preferably, less than 150 nM, 125 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or
even more preferably of less than 30 nM.
[0089] In one specific aspect, a 13B03-like sequence is an ISV that
has at least 70%, such at least 80%, for example at least 85%, such
as at least 90% or more than 95% sequence identity with SEQ ID NO:
662. For example, in an 13B03-like sequence according to this
aspect, the CDR's may be according to the specifically preferred
aspect described above, and may in particularly (but without
limitation) be INWFG (CDR1); GIRWSDAYTEYANSVKG (CDR2); and DLSTVRY
(CDR3). Again, preferably, the combination of CDR's and frameworks
present in such a 13B03-like ISV are preferably such that the
resulting 13B03-like ISV has a blocking activity, which can be
determined by any suitable assay known to the person skilled in the
art, such as, for instance, by means of Alphascreen assays (e.g.
such as described herein) or by cell based assays (e.g. such as
described herein). Preferably, the blocking activity is determined
by a HT-1080 cell based assay, for instance, such as described in
Example 9. Preferably, the 13B03-like ISV has a blocking activity
of 0.3 .mu.g/ml IL-17A-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more
preferably, less than 100 nM, 50 nM or even less, such as less than
20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM, and/or the 13B03-like ISV has a
blocking activity of 4.5 .mu.g/ml IL-17F-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM,
more preferably, less than 300 nM, 250 nM or even less, such as
less than 200 nM or 175 nM, 160 nM, or 155 nM or even more
preferably of less than 150 nM and/or the 13B03-like ISV has a
blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 200
nM, more preferably, less than 150 nM, 125 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, or 40 nM or
even more preferably of less than 30 nM.
[0090] In one particular aspect, any 13B03-like sequence may be a
humanized and/or sequence optimized sequence, as further described
herein.
[0091] In this context, one further embodiment of the invention
concerns also a polypeptide comprising [0092] (i) a CDR2 having the
amino acid sequence GIRWSDAYTEYANSVKG; and/or [0093] (ii) a CDR3
having the amino acid sequence DLSTVRY; wherein the CDR2 and CDR3
sequences (i) and (ii) may in total comprise up to four single
amino acid deletions, insertions and/or substitutions; and
[0094] wherein the polypeptide specifically binds to IL-17A and/or
IL-17F and wherein preferably the polypeptide specifically binds to
IL-17A with a Kd of less than 50 pM and to IL-17F with a Kd of less
than 5 nM.
[0095] Preferably the polypeptide of this embodiment specifically
binds to at least one epitope of IL-17A selected from the amino
acids L74, Y85 and N88 of IL-17A. Preferably the polypeptide of
this embodiment specifically binds to at least three epitopes of
IL-17A, e.g. at least to amino acids L74, Y85 and N88 of IL-17A
(SEQ ID NO: 839).
[0096] Preferred is also a polypeptide comprising [0097] (iii) a
CDR2 having the amino acid sequence GIRWSDAYTEYANSVKG; and/or
[0098] (iv) a CDR3 having the amino acid sequence DLSTVRY; wherein
the CDR2 and CDR3 sequences (i) and (ii) may in total comprise up
to four single amino acid deletions, insertions and/or
substitutions; and
[0099] wherein the polypeptide specifically binds to IL-17A and/or
IL-17F (preferably each with a Kd of less than 5 nM) but not to any
of IL-17B, IL-17C, IL-17D and IL-17E. Preferably, this polypeptide
specifically binds to at least amino acids L74, Y85 and N88 of
IL-17A (SEQ ID NO: 839).Of course also all of the above
polypeptides comprising a CDR2 and/or CDR3 sequences can be used
and are effective for the treatment of a disease as disclosed
herein. [0100] D) 13E02-like sequences: a "13E02-like sequence",
"13E02-like ISV" or "13E02-like building block" is defined as an
ISV (as described herein) that comprises: [0101] a) a CDR1 which
comprises or essentially consists of either (i) the amino acid
sequence AMG or (ii) an amino acid sequence that has 1 amino acid
difference(s) (as defined herein) with the amino acid sequence AMG;
and/or [0102] b) a CDR2 which comprises or essentially consists of
either (i) the amino acid sequence AISGSGDDTYYADSVKG or (ii) an
amino acid sequence that has at least 80%, such as at least 85%,
for example at least 90% or more than 95% sequence identity with
the amino acid sequence AISGSGDDTYYADSVKG; or (iii) an amino acid
sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid
difference(s) (as defined herein) with the amino acid sequence
AISGSGDDTYYADSVKG; and/or [0103] c) a CDR3 which comprises or
essentially consists of either (i) the amino acid sequence
RRGLYYVWDSNDYEN or (ii) an amino acid sequence that has at least
80%, such as at least 85%, for example at least 90% or more than
95% sequence identity with the amino acid sequence RRGLYYVWDSNDYEN;
or (iii) an amino acid sequence that has only 7, 6, 5, 4, 3, 2 or 1
amino acid difference(s) (as defined herein) with the amino acid
sequence RRGLYYVWDSNDYEN; in which the framework sequences present
in such an ISV are as further described herein, and in which CDR1,
CDR2 and CDR3 are preferably such that the 13E02-like ISV has a
blocking activity, which can be determined by any suitable assay
known to the person skilled in the art, such as, for instance, by
means of Alphascreen assays (e.g. such as described herein) or by
cell based assays (e.g. such as described herein). Preferably, the
blocking activity is determined by a HT-1080 cell based assay, for
instance, such as described in Example 9. Preferably, the
13E02-like ISV has a blocking activity of 0.3 .mu.g/ml
IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells
with an IC50 of less than 150 nM, more preferably, less than 100
nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9
nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM,
and/or the 13E02-like ISV has a blocking activity of 4.5 .mu.g/ml
IL-17F-induced IL-6 production in human fibrosarcoma HT-1080 cells
with an IC50 of less than 350 nM, more preferably, less than 250
nM, 200 nM or even less, such as less than 175 nM or 150 nM, 140
nM, or 125 nM or even more preferably of less than 110 nM and/or
the 13E02-like ISV has a blocking activity of 1.5 .mu.g/ml
IL-17A/F-induced IL-6 production in human fibrosarcoma HT-1080
cells with an IC50 of less than 200 nM, more preferably, less than
150 nM, 125 nM or even less, such as less than 100 nM or 80 nM, 75
nM, 70 nM, 60 nM, 50 nM, 40 nM or 30 nM or even more preferably of
less than 25 nM. Preferably, in such a 13E02-like sequence, CDR1
and CDR2 are as defined under a) and b), respectively; or CDR1 and
CDR3 are as defined under a) and c), respectively; or CDR2 and CDR3
are as defined under b) and c), respectively. More preferably, in
such a 13E02-like sequence, CDR1, CDR2 and CDR3 are all as defined
under a), b) and c), respectively. Again, in such an 13E02-like
sequence, CDR1, CDR2 and CDR3 are preferably such that the
13E02-like ISV has a blocking activity, which can be determined by
any suitable assay known to the person skilled in the art, such as,
for instance, by means of Alphascreen assays (e.g. such as
described herein) or by cell based assays (e.g. such as described
herein). Preferably, the blocking activity is determined by a
HT-1080 cell based assay, for instance, such as described in
Example 9. Preferably, the 13E02-like ISV has a blocking activity
of 0.3 .mu.g/ml IL-17A-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more
preferably, less than 100 nM, 50 nM or even less, such as less than
20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM, and/or the 13E02-like ISV has a
blocking activity of 4.5 .mu.g/ml IL-17F-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM,
more preferably, less than 250 nM, 200 nM or even less, such as
less than 175 nM or 150 nM, 140 nM, or 125 nM or even more
preferably of less than 110 nM and/or the 13E02-like ISV has a
blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 200
nM, more preferably, less than 150 nM, 125 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, 40 nM or 30
nM or even more preferably of less than 25 nM.
[0104] For example, in such an 13E02-like sequence: CDR1 may
comprise or essentially consist of the amino acid sequence AMG
(with CDR2 and CDR3 being as defined under b) and c),
respectively); and/or CDR2 may comprise or essentially consist of
the amino acid sequence AISGSGDDTYYADSVKG (with CDR1 and CDR3 being
as defined under a) and c), respectively); and/or CDR3 may comprise
or essentially consist of the amino acid sequence RRGLYYVWDSNDYEN
(with CDR1 and CDR2 being as defined under a) and b),
respectively). Particularly, when an 13E02-like sequence is
according to this aspect: CDR1 may comprise or essentially consist
of the amino acid sequence AMG and CDR2 may comprise or essentially
consist of the amino acid sequence AISGSGDDTYYADSVKG (with CDR3
being as defined under c) above); and/or CDR1 may comprise or
essentially consist of the amino acid sequence AMG and CDR3 may
comprise or essentially consist of the amino acid sequence
RRGLYYVWDSNDYEN (with CDR2 being as defined under b) above); and/or
CDR2 may comprise or essentially consist of the amino acid sequence
AISGSGDDTYYADSVKG and CDR3 may comprise or essentially consist of
the amino acid sequence RRGLYYVWDSNDYEN (with CDR1 being as defined
under a) above). Again, in such 13E02-like sequences, CDR1, CDR2
and CDR3 are preferably such that the 13E02-like ISV has a blocking
activity, which can be determined by any suitable assay known to
the person skilled in the art, such as, for instance, by means of
Alphascreen assays (e.g. such as described herein) or by cell based
assays (e.g. such as described herein). Preferably, the blocking
activity is determined by a HT-1080 cell based assay, for instance,
such as described in Example 9. Preferably, the 13E02-like ISV has
a blocking activity of 0.3 .mu.g/ml IL-17A-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 150
nM, more preferably, less than 100 nM, 50 nM or even less, such as
less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even
more preferably of less than 5 nM, and/or the 13E02-like ISV has a
blocking activity of 4.5 .mu.g/ml IL-17F-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an 1050 of less than 350 nM,
more preferably, less than 250 nM, 200 nM or even less, such as
less than 175 nM or 150 nM, 140 nM, or 125 nM or even more
preferably of less than 110 nM and/or the 13E02-like ISV has a
blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 200
nM, more preferably, less than 150 nM, 125 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, 40 nM or 30
nM or even more preferably of less than 25 nM.
[0105] In a specifically preferred aspect, a "13E02-like sequence",
"13E02-like ISV" or "13E02-like building block" is an ISV that
comprises: [0106] d) a CDR1 which is either (i) the amino acid
sequence AMG or (ii) an amino acid sequence that has only 3, 2 or 1
amino acid difference(s) (as defined herein) with the amino acid
sequence AMG; and/or [0107] e) a CDR2 which is either (i) the amino
acid sequence AISGSGDDTYYADSVKG or (ii) an amino acid sequence that
has at least 80%, such as at least 85%, for example at least 90% or
more than 95% sequence identity with the amino acid sequence
AISGSGDDTYYADSVKG; or (iii) an amino acid sequence that has only 7,
6, 5, 4, 3, 2 or 1 amino acid difference(s) (as defined herein)
with the amino acid sequence AISGSGDDTYYADSVKG; and/or [0108] f) a
CDR3 which is either (i) the amino acid sequence RRGLYYVWDSNDYEN or
(ii) an amino acid sequence that has at least 80%, such as at least
85%, for example at least 90% or more than 95% sequence identity
with the amino acid sequence RRGLYYVWDSNDYEN; or (iii) an amino
acid sequence that has only 7, 6, 5, 4, 3, 2 or 1 amino acid
difference(s) (as defined herein) with the amino acid sequence
RRGLYYVWDSNDYEN; in which the framework sequences present in such
an ISV are as further described herein, and in which CDR1, CDR2 and
CDR3 are preferably such that the 13E02-like ISV has a blocking
activity, which can be determined by any suitable assay known to
the person skilled in the art, such as, for instance, by means of
Alphascreen assays (e.g. such as described herein) or by cell based
assays (e.g. such as described herein). Preferably, the blocking
activity is determined by a HT-1080 cell based assay, for instance,
such as described in Example 9. Preferably, the 13E02-like ISV has
a blocking activity of 0.3 .mu.g/ml IL-17A-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 150
nM, more preferably, less than 100 nM, 50 nM or even less, such as
less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even
more preferably of less than 5 nM, and/or the 13E02-like ISV has a
blocking activity of 4.5 .mu.g/ml IL-17F-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM,
more preferably, less than 250 nM, 200 nM or even less, such as
less than 175 nM or 150 nM, 140 nM, or 125 nM or even more
preferably of less than 110 nM and/or the 13E02-like ISV has a
blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 200
nM, more preferably, less than 150 nM, 125 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, 40 nM or 30
nM or even more preferably of less than 25 nM. Preferably, in a
13E02-like sequence according to this specifically preferred
aspect, CDR1 and CDR2 are as defined under d) and e), respectively;
or CDR1 and CDR3 are as defined under d) and f), respectively; or
CDR2 and CDR3 are as defined under e) and f), respectively. More
preferably, in such a 13E02-like sequence, CDR1, CDR2 and CDR3 are
all as defined under d), e) and f), respectively. Again, in such an
13E02-like sequence, CDR1, CDR2 and CDR3 are preferably such that
the 13E02-like ISV has a blocking activity, which can be determined
by any suitable assay known to the person skilled in the art, such
as, for instance, by means of Alphascreen assays (e.g. such as
described herein) or by cell based assays (e.g. such as described
herein). Preferably, the blocking activity is determined by a
HT-1080 cell based assay, for instance, such as described in
Example 9. Preferably, the 13E02-like ISV has a blocking activity
of 0.3 .mu.g/ml IL-17A-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more
preferably, less than 100 nM, 50 nM or even less, such as less than
20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM, and/or the 13E02-like ISV has a
blocking activity of 4.5 .mu.g/ml IL-17F-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM,
more preferably, less than 250 nM, 200 nM or even less, such as
less than 175 nM or 150 nM, 140 nM, or 125 nM or even more
preferably of less than 110 nM and/or the 13E02-like ISV has a
blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 200
nM, more preferably, less than 150 nM, 125 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, 40 nM or 30
nM or even more preferably of less than 25 nM.
[0109] For example, in a 13E02-like sequence according to this
specifically preferred aspect: CDR1 is the amino acid sequence AMG
(with CDR2 and CDR3 being as defined under e) and f),
respectively); and/or CDR2 is the amino acid sequence
AISGSGDDTYYADSVKG (with CDR1 and CDR3 being as defined under d) and
f), respectively); and/or CDR3 is the amino acid sequence
RRGLYYVWDSNDYEN (with CDR1 and CDR2 being as defined under d) and
e), respectively). Particularly, when an 13E02-like sequence is
according to this aspect: CDR1 is the amino acid sequence AMG and
CDR2 is the amino acid sequence AISGSGDDTYYADSVKG (with CDR3 being
as defined under f) above); and/or CDR1 is the amino acid sequence
AMG and CDR3 is the amino acid sequence RRGLYYVWDSNDYEN (with CDR2
being as defined under e) above); and/or CDR2 is the amino acid
sequence AISGSGDDTYYADSVKG and CDR3 is RRGLYYVWDSNDYEN (with CDR1
being as defined under d) above). Again, in such 13E02-like
sequences, CDR1, CDR2 and CDR3 are preferably such that the
13E02-like ISV has a blocking activity, which can be determined by
any suitable assay known to the person skilled in the art, such as,
for instance, by means of Alphascreen assays (e.g. such as
described herein) or by cell based assays (e.g. such as described
herein). Preferably, the blocking activity is determined by a
HT-1080 cell based assay, for instance, such as described in
Example 9. Preferably, the 13E02-like ISV has a blocking activity
of 0.3 .mu.g/ml IL-17A-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more
preferably, less than 100 nM, 50 nM or even less, such as less than
20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM, and/or the 13E02-like ISV has a
blocking activity of 4.5 .mu.g/ml IL-17F-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM,
more preferably, less than 250 nM, 200 nM or even less, such as
less than 175 nM or 150 nM, 140 nM, or 125 nM or even more
preferably of less than 110 nM and/or the 13E02-like ISV has a
blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 200
nM, more preferably, less than 150 nM, 125 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, 40 nM or 30
nM or even more preferably of less than 25 nM.
[0110] In a particularly preferred 13E02-like sequence: CDR1 is the
amino acid sequence AMG, CDR2 is the amino acid sequence
AISGSGDDTYYADSVKG; and CDR3 is the amino acid sequence
RRGLYYVWDSNDYEN.
[0111] In all the 13E02-like sequence described in this paragraph
D), the framework sequences may be as further described herein.
Preferably, the framework sequences are such that the framework
sequences have at least 80%, such as at least 85%, for example at
least 90%, such as at least 95% sequence identity with the
framework sequences of 13E02 (which, for example, can be determined
by determining the overall degree of sequence identity of a given
sequence with the sequence of 13E02 while disregarding the CDR's in
the calculation). Again, the combination of CDR's and frameworks
present in a given sequence are preferably such that the resulting
13E02-like ISV has a blocking activity, which can be determined by
any suitable assay known to the person skilled in the art, such as,
for instance, by means of Alphascreen assays (e.g. such as
described herein) or by cell based assays (e.g. such as described
herein). Preferably, the blocking activity is determined by a
HT-1080 cell based assay, for instance, such as described in
Example 9. Preferably, the 13E02-like ISV has a blocking activity
of 0.3 .mu.g/ml IL-17A-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more
preferably, less than 100 nM, 50 nM or even less, such as less than
20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM, and/or the 13E02-like ISV has a
blocking activity of 4.5 .mu.g/ml IL-17F-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM,
more preferably, less than 250 nM, 200 nM or even less, such as
less than 175 nM or 150 nM, 140 nM, or 125 nM or even more
preferably of less than 110 nM and/or the 13E02-like ISV has a
blocking activity of 1.5 g/ml IL-17A/F-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 200 nM,
more preferably, less than 150 nM, 125 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, 40 nM or 30
nM or even more preferably of less than 25 nM.
[0112] In one specific aspect, a 13E02-like sequence is an ISV that
has at least 70%, such at least 80%, for example at least 85%, such
as at least 90% or more than 95% sequence identity with SEQ ID NO:
664. For example, in an 13E02-like sequence according to this
aspect, the CDR's may be according to the specifically preferred
aspect described above, and may in particularly (but without
limitation) be AMG (CDR1); AISGSGDDTYYADSVKG (CDR2); and
RRGLYYVWDSNDYEN (CDR3). Again, preferably, the combination of CDR's
and frameworks present in such a 13E02-like ISV are preferably such
that the resulting 13E02-like ISV has a blocking activity, which
can be determined by any suitable assay known to the person skilled
in the art, such as, for instance, by means of Alphascreen assays
(e.g. such as described herein) or by cell based assays (e.g. such
as described herein). Preferably, the blocking activity is
determined by a HT-1080 cell based assay, for instance, such as
described in Example 9. Preferably, the 13E02-like ISV has a
blocking activity of 0.3 .mu.g/ml IL-17A-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM,
more preferably, less than 100 nM, 50 nM or even less, such as less
than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM, and/or the 13E02-like ISV has a
blocking activity of 4.5 .mu.g/ml IL-17F-induced IL-6 production in
human fibrosarcoma HT-1080 cells with an IC50 of less than 350 nM,
more preferably, less than 250 nM, 200 nM or even less, such as
less than 175 nM or 150 nM, 140 nM, or 125 nM or even more
preferably of less than 110 nM and/or the 13E02-like ISV has a
blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6 production
in human fibrosarcoma HT-1080 cells with an IC50 of less than 200
nM, more preferably, less than 150 nM, 125 nM or even less, such as
less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50 nM, 40 nM or 30
nM or even more preferably of less than 25 nM.
[0113] In one particular aspect, any 13E02-like sequence may be a
humanized and/or sequence optimized sequence, as further described
herein.
[0114] In this context, one further embodiment of the invention
concerns also a polypeptide comprising [0115] (i) a CDR2 having the
amino acid sequence AISGSGDDTYYADSVKG; and/or [0116] (ii) a CDR3
having the amino acid sequence RRGLYYVWDANDYEN; wherein the CDR2
and CDR3 sequences (i) and (ii) may in total comprise up to four
single amino acid deletions, insertions and/or substitutions;
and
[0117] wherein the polypeptide specifically binds to IL-17A and/or
IL-17F and wherein preferably the polypeptide specifically binds to
IL-17A with a Kd of less than 50 pM and to IL-17F with a Kd of less
than 5 nM.
[0118] Preferably the polypeptide of this embodiment specifically
binds to at least one epitope of IL-17A selected from the amino
acids L74, Y85 and N88 of IL-17A. Preferably the polypeptide of
this embodiment specifically binds to at least three epitopes of
IL-17A, e.g. at least to amino acids L74, Y85 and N88 of IL-17A
(SEQ ID NO: 839).
[0119] Preferred is also a polypeptide comprising [0120] (iii) a
CDR2 having the amino acid sequence AISGSGDDTYYADSVKG; and/or
[0121] (iv) a CDR3 having the amino acid sequence RRGLYYVWDANDYEN;
wherein the CDR2 and CDR3 sequences (i) and (ii) may in total
comprise up to four single amino acid deletions, insertions and/or
substitutions; and
[0122] wherein the polypeptide specifically binds to IL-17A and/or
IL-17F (preferably each with a Kd of less than 5 nM) but not to any
of IL-17B, IL-17C, IL-17D and IL-17E. Preferably, this polypeptide
specifically binds to at least amino acids L74, Y85 and N88 of
IL-17A (SEQ ID NO: 839).
[0123] Of course also all of the above polypeptides comprising a
CDR2 and/or CDR3 sequences can be used and are effective for the
treatment of a disease as disclosed herein. As mentioned, a
polypeptide of the invention preferably specifically binds to at
least three epitopes of IL-17A and/or IL-17F, e.g. [0124] (i) at
least to amino acids L74, Y85 and N88 of IL-17A (SEQ ID NO: 839);
[0125] (ii) at least to amino acids H54, L74 and Y85 of IL-17A (SEQ
ID NO: 839); and/or [0126] (iii) at least to amino acids R47, R73,
I86 and N89 of IL-17F (SEQ ID NO: 840).
[0127] As further described herein, but without being limited to
any explanation, mechanism of action or hypothesis, in the present
invention, four different classes of amino acid sequences of the
invention have been identified, based on their ability to inhibit
the interaction of IL-17A, IL-17F or IL-17IF with either or both of
the receptors IL-17RA or IL-17RC complex (in particular in the
Alphascreen assay described in Example 5 below). These four classes
of amino acid sequences of the invention are (defined herein as
follows): [0128] "Class 1 amino acid sequence": an amino acid
sequence of the invention (and in particular an ISV as described
herein) that is capable of inhibiting the interaction of IL-17A
with (at least one of, and most preferably both of) the receptors
IL-17RA or IL-17RC of the receptor complex, but that is essentially
not capable of inhibiting the interaction of IL-17A/F interaction
with either of IL-17RA or IL-17RC. Some specific but non-limiting
examples of Class 1 amino acid sequences are given in the further
description herein (see for example Tables 5-8); [0129] "Class 2
amino acid sequence": an amino acid sequence of the invention (and
in particular an ISV as described herein) that is capable of
inhibiting the interaction of both IL-17A and of IL-17A/F with (at
least one of, and most preferably both of) the receptors IL-17RA or
IL-17RC of the receptor complex. Some specific but non-limiting
examples of Class 2 amino acid sequences are given in the further
description herein (see for example Tables 5-8). Some preferred,
but non-limiting examples of Class 2 amino acid sequences of the
invention are the "04G01-like sequences" (as defined herein), with
humanized and/or sequence-optimized variants of 04G01 (see for
example Tables 23 and 24) being particularly preferred; [0130]
"Class 3 amino acid sequence": an amino acid sequence of the
invention (and in particular an ISV as described herein) that is
capable of inhibiting the interaction of IL-17F with (at least one
of, and most preferably both of) the receptors IL-17RA or IL-17RC
of the receptor complex. Class 3 amino acid sequences of the
invention may also be capable of (at least partially) inhibiting
the interaction of IL-17A/F with (at least one of, and most
preferably both of) the receptors IL-17RA or IL-17RC of the
receptor complex. Some specific but non-limiting examples of Class
3 amino acid sequences are given in the further description herein
(see for example Tables 5-8). Some preferred, but non-limiting
examples of Class 3 amino acid sequences of the invention are the
"16A04-like sequences" (as defined herein), with humanized and/or
sequence-optimized variants of 16A04 (such as for example
IL17MS3063, see Table 30) being particularly preferred. In some
preferred, but non-limiting examples, Class 3 amino acid sequences
are directed against and/or bind to R47, R73, I86 and/or N89 of
hIL-17F, including combinations thereof (see for example Table 11);
[0131] "Class 4 amino acid sequence" (also referred to herein as a
"cross-reactive amino acid sequence" and also indicated with an
"X"): an amino acid sequence of the invention (and in particular an
ISV as described herein) that is capable of inhibiting the
interaction of both IL-17A and IL-17F, hence including IL-17A/F,
with (at least one of, and most preferably both of) the receptors
IL-17RA or IL-17RC of the receptor complex. Some preferred, but
non-limiting examples of Class 4 amino acid sequences of the
invention are the "13B03-like sequences" (as defined herein) and
the "13E02-like sequences" (also as defined herein), with humanized
and/or sequence-optimized variants of 13B03 (such as for example
IL17MS3068, see e.g. Table 26) and 13E02 (such as for example
IL17MS3069 and IL17MS3070, see Table 28), respectively, being
particularly preferred. In some preferred, but non-limiting
examples, Class 4 amino acid sequences are directed against and/or
bind to L74, Y85 and/or N88 of hIL-17A (see for example Table
11).
TABLE-US-00001 [0131] TABLE A-0 Overview anti-IL-17 blocking
specificity of Nanobody classes Nanobody Blocking activity .sup.1)
Class Example IL-17A IL-17F IL-17A/F Class 1 YES Essentially NO NO
Class 2 04G01 YES NO YES Class 3 16A04 NO YES Partially YES Class 4
13E02, 13B03 YES YES YES .sup.1) Blocking activity as determined by
IL-17A, IL-17F and IL-17A/F-induced IL-6 production in human
fibrosarcoma HT-1080 cells as described above
[0132] Each of these classes of amino acid sequences of the
invention (and in particular, ISV's belonging to each of these
classes), form further aspects of the invention. Generally, and
although the invention is not limited to the same, (the use as
building blocks of) Class 2 amino acid sequences are more preferred
than Class 1 amino acid sequences, and (the use as building blocks
of) Class 3 and/or Class 4 amino acid sequences are in turn more
preferred than Class 2 amino acid sequences.
[0133] Preferred but non-limiting examples of ISV's of the
invention belonging to each of these Classes are given in the
examples herein.
[0134] Also, as further described herein, one of the advantages of
the invention is that the amino acid sequences of the invention
(and in particular, the ISV's of the invention) can be used as
building blocks to provide the compounds, constructs, proteins and
polypeptides of the invention. In this way, for example and without
limitation, the invention also makes it possible to combine amino
acid sequences of the invention (and in particular ISV's of the
invention) that belong to different Classes into a single compound,
construct, protein or polypeptide of the invention. In particular,
it was shown that combining Class 3 ISV's with Class 4 ISV's into a
single compound, construct, protein or polypeptide of the invention
have unique binding properties (cf. Example 29).
[0135] As further described herein, such compounds, constructs,
proteins or polypeptides of the invention may for example and
without limitation comprise or essentially consist of: [0136] an
amino acid sequence of the invention (and in particular, an ISV of
the invention) and one or more (such as one or two) other groups,
residues, moieties or binding units (as further described herein,
for example a group, residue, moiety or binding unit that increases
the half-life of the amino acid sequence of the invention), which
are linked to each other either directly or preferably via one or
more suitable linkers (as further described herein); [0137] two or
more (such as two or three) amino acid sequences of the invention
(which may be the same or different), and in particular two or more
(such as two or three) ISV's of the invention (which again may be
the same or different), and optionally one or more (such as one or
two) other groups, residues, moieties or binding units (as further
described herein, for example a group, residue, moiety or binding
unit that increases the half-life of the amino acid sequence(s) of
the invention), which are linked to each other either directly or
preferably via one or more suitable linkers (as further described
herein).
[0138] Also, as further described herein, when a compound,
construct, protein or polypeptide of the invention comprises one or
more one or more (such as one or two) other groups, residues,
moieties or binding units, these are preferably (but without
limitation) either (i) one or more other immunoglobulin single
variable domains (for example, directed to a target other than
IL-17A, IL-17F or IL-17A/F, i.e. so as to provide a multispecific
protein or polypeptide of the invention) and/or (ii) a group,
residue, moiety or binding unit that increases the half-life of the
amino acid sequence(s) of the invention, which may for example be a
group, residue, moiety or binding unit that is directed to a serum
protein such as (human) serum albumin (for example, an ISV that is
directed to a serum protein and in particular to serum albumin, or
a peptide that is directed to a serum protein and in particular to
serum albumin, as further described herein).
[0139] Thus, for example and without limitation, such compounds,
constructs, proteins or polypeptides of the invention may comprise
or essentially consist of: [0140] An amino acid sequence of the
invention (and in particular, an ISV of the invention) belonging to
Class 1 (as defined herein), and a group, residue, moiety or
binding unit that increases the half-life of said amino acid
sequence (and preferably an ISV that is directed to a serum protein
and in particular to serum albumin, or a peptide that is directed
to a serum protein and in particular to serum albumin), optionally
suitably linked via one or more suitable linkers. [0141] An amino
acid sequence of the invention (and in particular, an ISV of the
invention) belonging to Class 2 (as defined herein), and a group,
residue, moiety or binding unit that increases the half-life of
said amino acid sequence (and preferably an ISV that is directed to
a serum protein and in particular to serum albumin, or a peptide
that is directed to a serum protein and in particular to serum
albumin), optionally suitably linked via one or more suitable
linkers. [0142] An amino acid sequence of the invention (and in
particular, an ISV of the invention) belonging to Class 3 (as
defined herein), and a group, residue, moiety or binding unit that
increases the half-life of said amino acid sequence (and preferably
an ISV that is directed to a serum protein and in particular to
serum albumin, or a peptide that is directed to a serum protein and
in particular to serum albumin), optionally suitably linked via one
or more suitable linkers. [0143] An amino acid sequence of the
invention (and in particular, an ISV of the invention) belonging to
Class 4 (as defined herein), and a group, residue, moiety or
binding unit that increases the half-life of said amino acid
sequence (and preferably an ISV that is directed to a serum protein
and in particular to serum albumin, or a peptide that is directed
to a serum protein and in particular to serum albumin), optionally
suitably linked via one or more suitable linkers. [0144] Two amino
acid sequences of the invention (and in particular, two ISV's of
the invention) both belonging to Class 1 (as defined herein), and a
group, residue, moiety or binding unit that increases the half-life
of said amino acid sequence (and preferably an ISV that is directed
to a serum protein and in particular to serum albumin, or a peptide
that is directed to a serum protein and in particular to serum
albumin), optionally suitably linked via one or more suitable
linkers. [0145] Two amino acid sequences of the invention (and in
particular, two ISV's of the invention) both belonging to Class 2
(as defined herein), and a group, residue, moiety or binding unit
that increases the half-life of said amino acid sequence (and
preferably an ISV that is directed to a serum protein and in
particular to serum albumin, or a peptide that is directed to a
serum protein and in particular to serum albumin), optionally
suitably linked via one or more suitable linkers. [0146] Two amino
acid sequences of the invention (and in particular, two ISV's of
the invention) both belonging to Class 3 (as defined herein), and a
group, residue, moiety or binding unit that increases the half-life
of said amino acid sequence (and preferably an ISV that is directed
to a serum protein and in particular to serum albumin, or a peptide
that is directed to a serum protein and in particular to serum
albumin), optionally suitably linked via one or more suitable
linkers. [0147] Two amino acid sequences of the invention (and in
particular, two ISV's of the invention) both belonging to Class 4
(as defined herein), and a group, residue, moiety or binding unit
that increases the half-life of said amino acid sequence (and
preferably an ISV that is directed to a serum protein and in
particular to serum albumin, or a peptide that is directed to a
serum protein and in particular to serum albumin), optionally
suitably linked via one or more suitable linkers. [0148] An amino
acid sequence of the invention (and in particular, an ISV of the
invention) belonging to Class 1 (as defined herein), an amino acid
sequence of the invention (and in particular, an ISV of the
invention) belonging to Class 2 (as defined herein), and a group,
residue, moiety or binding unit that increases the half-life of
said amino acid sequence (and preferably an ISV that is directed to
a serum protein and in particular to serum albumin, or a peptide
that is directed to a serum protein and in particular to serum
albumin), optionally suitably linked via one or more suitable
linkers. [0149] An amino acid sequence of the invention (and in
particular, an ISV of the invention) belonging to Class 1 (as
defined herein), an amino acid sequence of the invention (and in
particular, an ISV of the invention) belonging to Class 3 (as
defined herein), and a group, residue, moiety or binding unit that
increases the half-life of said amino acid sequence (and preferably
an ISV that is directed to a serum protein and in particular to
serum albumin, or a peptide that is directed to a serum protein and
in particular to serum albumin), optionally suitably linked via one
or more suitable linkers. [0150] An amino acid sequence of the
invention (and in particular, an ISV of the invention) belonging to
Class 1 (as defined herein), an amino acid sequence of the
invention (and in particular, an ISV of the invention) belonging to
Class 4 (as defined herein), and a group, residue, moiety or
binding unit that increases the half-life of said amino acid
sequence (and preferably an ISV that is directed to a serum protein
and in particular to serum albumin, or a peptide that is directed
to a serum protein and in particular to serum albumin), optionally
suitably linked via one or more suitable linkers. [0151] An amino
acid sequence of the invention (and in particular, an ISV of the
invention) belonging to Class 2 (as defined herein), an amino acid
sequence of the invention (and in particular, an ISV of the
invention) belonging to Class 3 (as defined herein), and a group,
residue, moiety or binding unit that increases the half-life of
said amino acid sequence (and preferably an ISV that is directed to
a serum protein and in particular to serum albumin, or a peptide
that is directed to a serum protein and in particular to serum
albumin), optionally suitably linked via one or more suitable
linkers. [0152] An amino acid sequence of the invention (and in
particular, an ISV of the invention) belonging to Class 2 (as
defined herein), an amino acid sequence of the invention (and in
particular, an ISV of the invention) belonging to Class 4 (as
defined herein), and a group, residue, moiety or binding unit that
increases the half-life of said amino acid sequence (and preferably
an ISV that is directed to a serum protein and in particular to
serum albumin, or a peptide that is directed to a serum protein and
in particular to serum albumin), optionally suitably linked via one
or more suitable linkers. [0153] An amino acid sequence of the
invention (and in particular, an ISV of the invention) belonging to
Class 3 (as defined herein), an amino acid sequence of the
invention (and in particular, an ISV of the invention) belonging to
Class 4 (as defined herein), and a group, residue, moiety or
binding unit that increases the half-life of said amino acid
sequence (and preferably an ISV that is directed to a serum protein
and in particular to serum albumin, or a peptide that is directed
to a serum protein and in particular to serum albumin), optionally
suitably linked via one or more suitable linkers.
[0154] Each of the above compounds, constructs, proteins or
polypeptides of the invention form further aspects of the
invention.
[0155] When one of the compounds, constructs, proteins or
polypeptides of the invention (such as one of the compounds,
constructs, proteins or polypeptides of the invention according to
one of the preceding paragraphs) comprises a Class 2 sequence, it
is preferably a 04G01-like sequence (as defined herein), and more
preferably a humanized and/or sequence-optimized variant of 04G01.
Thus, a further aspect of the invention is a compound, construct,
protein or polypeptide of the invention as described herein (and in
particular, as described in the preceding paragraphs) that
comprises a Class 2 amino acid sequence, wherein said Class 2 amino
acid sequence is a 04G01-like sequence (as defined herein), and
more preferably a humanized and/or sequence-optimized variant of
04G01.
[0156] When one of the compounds, constructs, proteins or
polypeptides of the invention (such as one of the compounds,
constructs, proteins or polypeptides of the invention according to
one of the preceding paragraphs) comprises a Class 3 sequence, it
is preferably a 16A04-like sequence (as defined herein), and more
preferably a humanized and/or sequence-optimized variant of 16A04.
Thus, a further aspect of the invention is a compound, construct,
protein or polypeptide of the invention as described herein (and in
particular, as described in the preceding paragraphs) that
comprises a Class 3 amino acid sequence, wherein said Class 3 amino
acid sequence is a 16A04-like sequence (as defined herein), and
more preferably a humanized and/or sequence-optimized variant of
16A04.
[0157] When one of the compounds, constructs, proteins or
polypeptides of the invention (such as one of the compounds,
constructs, proteins or polypeptides of the invention according to
one of the preceding paragraphs) comprises a Class 4 sequence, it
is preferably a 13B03-like sequence (as defined herein), and more
preferably a humanized and/or sequence-optimized variant of 13B03,
or a 13E02-like sequence (as defined herein), and more preferably a
humanized and/or sequence-optimized variant of 13E02. Thus, a
further aspect of the invention is a compound, construct, protein
or polypeptide of the invention as described herein (and in
particular, as described in the preceding paragraphs) that
comprises a Class 4 amino acid sequence, wherein said Class 4 amino
acid sequence is a 13B03-like sequence (as defined herein), and
more preferably a humanized and/or sequence-optimized variant of
13B03, and/or a 13E02-like sequence (as defined herein), and more
preferably a humanized and/or sequence-optimized variant of
13E02.
[0158] Some preferred, but non-limiting examples of some of these
compounds, constructs, proteins or polypeptides of the invention
are described in the examples below. Based on the disclosure
herein, the skilled person will also be able to provide other such
compounds, constructs, proteins or polypeptides of the invention,
for example by suitably combining one or more suitable amino acid
sequences of the invention (such as those described in the examples
below) with a group, residue, moiety or binding unit that increases
the half-life of said amino acid sequence (such as an ISV or small
peptide that is directed against (human) serum albumin, as further
described herein).
[0159] Particularly preferred are compounds, constructs, proteins
or polypeptides of the invention may comprise or essentially
consist of: [0160] An amino acid sequence of the invention (and in
particular, an ISV of the invention) belonging to Class 3 (as
defined herein), an amino acid sequence of the invention (and in
particular, an ISV of the invention) belonging to Class 4 (as
defined herein), and a group, residue, moiety or binding unit that
increases the half-life of said amino acid sequence (and preferably
an ISV that is directed to a serum protein and in particular to
serum albumin, or a peptide that is directed to a serum protein and
in particular to serum albumin), optionally suitably linked via one
or more suitable linkers. As further described herein, such a
compound, construct, protein or polypeptide of the invention
preferably comprises a "13B03-like sequence" (as defined herein,
and more preferably a humanized and/or sequence-optimized variant
of 13B03) or a "13E02-like sequence" (as defined herein, and more
preferably a humanized and/or sequence-optimized variant of 13E02)
as the Class 4 sequence and a "16A04-like sequence" (as defined
herein, and more preferably a humanized and/or sequence-optimized
variant of 16A04) as the Class 3 sequence. Some specifically
preferred, but non-limiting examples of these compounds,
constructs, proteins or polypeptides of the invention are
IL17MS3084, IL17MS3085, IL17MS3086 and IL17MS3087 (see Example 26
and Table 33). Other examples of such/similar compounds,
constructs, proteins or polypeptides of the invention will be clear
to the skilled person based on the disclosure herein. [0161] Two
amino acid sequences of the invention (and in particular, two ISV's
of the invention) both belonging to Class 4 (as defined herein),
and a group, residue, moiety or binding unit that increases the
half-life of said amino acid sequence (and preferably an ISV that
is directed to a serum protein and in particular to serum albumin,
or a peptide that is directed to a serum protein and in particular
to serum albumin), optionally suitably linked via one or more
suitable linkers. As further described herein, such a compound,
construct, protein or polypeptide of the invention preferably
comprises two "13B03-like sequences" (as defined herein, and more
preferably two humanized and/or sequence-optimized variants of
13B03), which may be the same or different, or two "13E02-like
sequences" (as defined herein, and more preferably a humanized
and/or sequence-optimized variant of 13E02), which again may be the
same or different, with compounds, constructs, proteins or
polypeptides of the invention that comprise or essentially consist
of two "13B03-like sequences" being particularly preferred. A
specifically preferred, but non-limiting example of such a
polypeptide of the invention is IL17MS3079 (see Example 26 and
Table 33). Other examples of such/similar compounds, constructs,
proteins or polypeptides of the invention will be clear to the
skilled person based on the disclosure herein.
[0162] Some specifically preferred but non-limiting compounds,
constructs, proteins or polypeptides of the invention may comprise
or essentially consist of: [0163] Two "13B03-like sequences" (as
defined herein, and more preferably two humanized and/or
sequence-optimized variants of 13B03), which may be the same or
different (and are preferably the same) and one ISV against human
serum albumin or a peptide directed to human serum albumin,
optionally suitably linked via one or more suitable linkers (as
described herein); [0164] A "13B03-like sequence" (as defined
herein, and more preferably a humanized and/or sequence-optimized
variant of 13B03), a "16A04-like sequence" (as defined herein, and
more preferably a humanized and/or sequence-optimized variant of
16A04) and one ISV against human serum albumin or a peptide
directed to human serum albumin, optionally suitably linked via one
or more suitable linkers (as described herein); [0165] A
"13E02-like sequence" (as defined herein, and more preferably a
humanized and/or sequence-optimized variant of 13E02), a
"16A04-like sequence" (as defined herein, and more preferably a
humanized and/or sequence-optimized variant of 16A04) and one ISV
against human serum albumin or a peptide directed to human serum
albumin, optionally suitably linked via one or more suitable
linkers (as described herein).
[0166] Again, some specific but non-limiting examples of such
compounds, constructs, proteins or polypeptides of the invention
are given herein (see for example Table 34) or will be clear to the
skilled person based on the disclosure herein.
[0167] Preferably, the compounds, constructs, proteins or
polypeptides of the invention have a blocking activity, which can
be determined by any suitable assay known to the person skilled in
the art, such as, for instance, by means of Alphascreen assays
(e.g. such as described herein) or by cell based assays (e.g. such
as described herein). Preferably, the blocking activity is
determined by a HT-1080 cell based assay, for instance, such as
described in Example 9.
[0168] In particular, compounds, constructs, proteins or
polypeptides of the invention comprising an amino acid sequence of
the invention (and in particular, an ISV of the invention)
belonging to Class 1 (as defined herein), said compounds,
constructs, proteins or polypeptides preferably have a blocking
activity of 0.3 .mu.g/ml IL-17A-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more
preferably, less than 100 nM, 50 nM or even less, such as less than
20 nM, 18 nM, 16 nM, 15 nM, 14 nM, 13 nM, 12 nM, or 11 nM or even
more preferably of less than 10 nM.
[0169] In particular, compounds, constructs, proteins or
polypeptides of the invention comprising an amino acid sequence of
the invention (and in particular, an ISV of the invention)
belonging to Class 2 (as defined herein), said compounds,
constructs, proteins or polypeptides preferably have a blocking
activity of 0.3 .mu.g/ml IL-17A-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more
preferably, less than 100 nM, 50 nM or even less, such as less than
20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM and/or said compounds, constructs,
proteins or polypeptides have a blocking activity of 1.5 .mu.g/ml
IL-17A/F-induced IL-6 production in human fibrosarcoma HT-1080
cells with an IC50 of less than 250 nM, more preferably, less than
200 nM, 150 nM or even less, such as less than 100 nM or 80 nM, 75
nM, 70 nM, 60 nM, 50 nM, or 40 nM or even more preferably of less
than 35 nM.
[0170] In particular, compounds, constructs, proteins or
polypeptides of the invention comprising an amino acid sequence of
the invention (and in particular, an ISV of the invention)
belonging to Class 3 (as defined herein), said compounds,
constructs, proteins or polypeptides preferably have a blocking
activity of 0.3 .mu.g/ml IL-17A-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more
preferably, less than 100 nM, 50 nM or even less, such as less than
20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM and/or said compounds, constructs,
proteins or polypeptides have a blocking activity of 1.5 .mu.g/ml
IL-17A/F-induced IL-6 production in human fibrosarcoma HT-1080
cells with an IC50 of less than 250 nM, more preferably, less than
200 nM, 150 nM or even less, such as less than 100 nM or 80 nM, 75
nM, 70 nM, 60 nM, 50 nM, or 40 nM or even more preferably of less
than 35 nM.
[0171] In particular, compounds, constructs, proteins or
polypeptides of the invention comprising an amino acid sequence of
the invention (and in particular, an ISV of the invention)
belonging to Class 4 (as defined herein), said compounds,
constructs, proteins or polypeptides preferably have a blocking
activity of 0.3 .mu.g/ml IL-17A-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more
preferably, less than 100 nM, 50 nM or even less, such as less than
20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM, and/or the said compounds,
constructs, proteins or polypeptides have a blocking activity of
4.5 .mu.g/ml IL-17F-induced IL-6 production in human fibrosarcoma
HT-1080 cells with an IC50 of less than 350 nM, more preferably,
less than 250 nM, 200 nM or even less, such as less than 175 nM or
150 nM, 140 nM, or 125 nM or even more preferably of less than 110
nM and/or said compounds, constructs, proteins or polypeptides have
a blocking activity of 1.5 .mu.g/ml IL-17A/F-induced IL-6
production in human fibrosarcoma HT-1080 cells with an IC50 of less
than 200 nM, more preferably, less than 150 nM, 125 nM or even
less, such as less than 100 nM or 80 nM, 75 nM, 70 nM, 60 nM, 50
nM, 40 nM or 30 nM or even more preferably of less than 25 nM.
[0172] It will be appreciated by the person skilled in the art that
the blocking activity of the compounds, constructs, proteins or
polypeptides of the invention, which comprise more than one
(building block of) Class 1, 2, 3 or 4 amino acid sequences, can be
determined according to any of the assays as described above,
wherein said compounds, constructs, proteins or polypeptides of the
invention preferably have a blocking activity similarly to the
blocking activity of each of its constituents, i.e. a blocking
activity similarly to the blocking activity of each of the
(building blocks of) Class 1, 2, 3 or 4 amino acid sequences
comprised in said compounds, constructs, proteins or polypeptides
of the invention. Some specific but non-limiting examples of the
abovementioned preferred compounds, constructs, proteins or
polypeptides of the invention are: [0173] Compounds, constructs,
proteins or polypeptides that have at least 80% sequence identity
(as defined herein) with a sequence selected from the group
consisting of SEQ ID NO:s 623, 624, 625, 626, 627, 628, 629, 630,
631, 632, 633, 634, 635, 636, 637, 638, 639, 640, 641, 642, 643,
644, 645, 646, 647, 648, 649, 650, 651, 652, 653, 654, 655, 656,
657, 658, 659, 660, 661, 662, 663, 664, 665, 666, 667, 668, 669,
670, 671, 672, 673, 674, 675, 676, 677, 678, 679, 680, 681, 682,
683, 684, 685, 686, 687, 688, 689, 690, 691, 692, 693. [0174]
Compounds, constructs, proteins or polypeptides that have at least
85% sequence identity (as defined herein) with a sequence selected
from the group consisting of SEQ ID NO:s 623, 624, 625, 626, 627,
628, 629, 630, 631, 632, 633, 634, 635, 636, 637, 638, 639, 640,
641, 642, 643, 644, 645, 646, 647, 648, 649, 650, 651, 652, 653,
654, 655, 656, 657, 658, 659, 660, 661, 662, 663, 664, 665, 666,
667, 668, 669, 670, 671, 672, 673, 674, 675, 676, 677, 678, 679,
680, 681, 682, 683, 684, 685, 686, 687, 688, 689, 690, 691, 692,
693. [0175] Compounds, constructs, proteins or polypeptides that
have at least 90% sequence identity (as defined herein) with a
sequence selected from the group consisting of SEQ ID NO:s 623,
624, 625, 626, 627, 628, 629, 630, 631, 632, 633, 634, 635, 636,
637, 638, 639, 640, 641, 642, 643, 644, 645, 646, 647, 648, 649,
650, 651, 652, 653, 654, 655, 656, 657, 658, 659, 660, 661, 662,
663, 664, 665, 666, 667, 668, 669, 670, 671, 672, 673, 674, 675,
676, 677, 678, 679, 680, 681, 682, 683, 684, 685, 686, 687, 688,
689, 690, 691, 692, 693. [0176] Compounds, constructs, proteins or
polypeptides that have at least 95% sequence identity (as defined
herein) with a sequence selected from the group consisting of SEQ
ID NO:s 623, 624, 625, 626, 627, 628, 629, 630, 631, 632, 633, 634,
635, 636, 637, 638, 639, 640, 641, 642, 643, 644, 645, 646, 647,
648, 649, 650, 651, 652, 653, 654, 655, 656, 657, 658, 659, 660,
661, 662, 663, 664, 665, 666, 667, 668, 669, 670, 671, 672, 673,
674, 675, 676, 677, 678, 679, 680, 681, 682, 683, 684, 685, 686,
687, 688, 689, 690, 691, 692, 693. [0177] Compounds, constructs,
proteins or polypeptides that consists of two 13B03-like sequences
which may be the same or different in which each 13B03-like
sequence is independently chosen from IL17MS3067 or IL17MS3068, and
further consists of one ISV against human serum albumin or a
peptide directed to human serum albumin (such as Alb-8/Alb-11); all
optionally suitably linked via one or more suitable linkers (as
described herein). A specific preferred but-non-limiting example of
such a polypeptide is IL17MS3079. [0178] Compounds, constructs,
proteins or polypeptides that consists of a 13B03-like sequence
that is independently chosen from IL17MS3067 or IL17MS3068, a
16A04-like sequence that is independently chosen from IL17MS3063
(or IL17MS3063 without the E1D substitution) and one ISV against
human serum albumin or a peptide directed to human serum albumin
(such as Alb-8/Alb-11), optionally suitably linked via one or more
suitable linkers (as described herein). Specific preferred
but-non-limiting examples of such polypeptides are IL17MS3084 and
IL17MS3085. [0179] Compounds, constructs, proteins or polypeptides
that consists of a 13E02-like sequence that is independently chosen
from IL17MS3069 or IL17MS3070, a 16A04-like sequence that is
independently chosen from IL17MS3063 (or IL17MS3063 without the E1D
substitution) and one ISV against human serum albumin or a peptide
directed to human serum albumin (such as Alb-8/Alb-11), optionally
suitably linked via one or more suitable linkers (as described
herein). Specific preferred but-non-limiting examples of such
polypeptides are IL17MS3086, IL17MS3087 and IL17MS3091. [0180]
Compounds, constructs, proteins or polypeptides that have at least
80%, such as at least 85%, preferably at least 90% sequence
identity (as defined herein) with IL17MS3079. Preferably, the
compounds, constructs, proteins or polypeptides that have at least
80%, such as at least 85%, preferably at least 90% sequence
identity (as defined herein) with IL17MS3079 have a blocking
activity, which can be determined by any suitable assay known to
the person skilled in the art, such as, for instance, by means of
Alphascreen assays (e.g. such as described herein) or by cell based
assays (e.g. such as described herein). Preferably, the blocking
activity is determined by a HT-1080 cell based assay, for instance,
such as described in Example 26. Preferably, said compounds,
constructs, proteins or polypeptides that have at least 80%, such
as at least 85%, preferably at least 90% sequence identity (as
defined herein) with IL17MS3079 have a blocking activity of 1 nM
IL-17A-induced IL-6 production in human fibrosarcoma HT-1080 cells
with an IC50 of less than 150 nM, more preferably, less than 100
nM, 50 nM or even less, such as less than 20 nM or 15 nM, 10 nM, 9
nM, 8 nM, 7 nM or 6 nM or even more preferably of less than 5 nM,
such as 4 nM, 3 nM, 2 nM or even less than 1 nM and/or said
compounds, constructs, proteins or polypeptides that have at least
80%, such as at least 85%, preferably at least 90% sequence
identity (as defined herein) with IL17MS3079 have a blocking
activity of 15 nM IL-17F induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 100 nM, more
preferably, less than 75 nM, 50 nM or even less, such as less than
40 nM or 30 nM, 25 nM, 20 nM, 15 nM or even more preferably of less
than 10 nM and/or said compounds, constructs, proteins or
polypeptides that have at least 80%, such as at least 85%,
preferably at least 90% sequence identity (as defined herein) with
IL17MS3079 have a blocking activity of 5 nM IL-17A/F-induced IL-6
production in human fibrosarcoma HT-1080 cells with an IC50 of less
than 150 nM, more preferably, less than 100 nM, 50 nM or even less,
such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM
or even more preferably of less than 5 nM, such as 4 nM, or 3 nM,
or even less than 2 nM. [0181] Compounds, constructs, proteins or
polypeptides that have at least 80%, such as at least 85%,
preferably at least 90% sequence identity (as defined herein) with
IL17MS3084 Preferably, the compounds, constructs, proteins or
polypeptides that have at least 80%, such as at least 85%,
preferably at least 90% sequence identity (as defined herein) with
IL17MS3084 have a blocking activity, which can be determined by any
suitable assay known to the person skilled in the art, such as, for
instance, by means of Alphascreen assays (e.g. such as described
herein) or by cell based assays (e.g. such as described herein).
Preferably, the blocking activity is determined by a HT-1080 cell
based assay, for instance, such as described in Example 26.
Preferably, said compounds, constructs, proteins or polypeptides
that have at least 80%, such as at least 85%, preferably at least
90% sequence identity (as defined herein) with IL17MS3084 have a
blocking activity of 1 nM IL-17A-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more
preferably, less than 100 nM, 50 nM or even less, such as less than
20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM, such as 4 nM, 3 nM, 2 nM or even less
than 1 nM and/or said compounds, constructs, proteins or
polypeptides that have at least 80%, such as at least 85%,
preferably at least 90% sequence identity (as defined herein) with
IL17MS3084 have a blocking activity of 15 nM IL-17F induced IL-6
production in human fibrosarcoma HT-1080 cells with an IC50 of less
than 100 nM, more preferably, less than 75 nM, 50 nM or even less,
such as less than 40 nM or 30 nM, 25 nM, 20 nM, 15 nM or even more
preferably of less than 10 nM and/or said compounds, constructs,
proteins or polypeptides that have at least 80%, such as at least
85%, preferably at least 90% sequence identity (as defined herein)
with IL17MS3084 have a blocking activity of 5 nM IL-17A/F-induced
IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of
less than 150 nM, more preferably, less than 100 nM, 50 nM or even
less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or
6 nM or even more preferably of less than 5 nM, such as 4 nM, or 3
nM, or even less than 2 nM. [0182] Compounds, constructs, proteins
or polypeptides that have at least 80%, such as at least 85%,
preferably at least 90% sequence identity (as defined herein) with
IL17MS3085 . Preferably, the compounds, constructs, proteins or
polypeptides that have at least 80%, such as at least 85%,
preferably at least 90% sequence identity (as defined herein) with
IL17MS3085 have a blocking activity, which can be determined by any
suitable assay known to the person skilled in the art, such as, for
instance, by means of Alphascreen assays (e.g. such as described
herein) or by cell based assays (e.g. such as described herein).
Preferably, the blocking activity is determined by a HT-1080 cell
based assay, for instance, such as described in Example 26.
Preferably, said compounds, constructs, proteins or polypeptides
that have at least 80%, such as at least 85%, preferably at least
90% sequence identity (as defined herein) with IL17MS3085 have a
blocking activity of 1 nM IL-17A-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more
preferably, less than 100 nM, 50 nM or even less, such as less than
20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM, such as 4 nM, 3 nM, 2 nM or even less
than 1 nM and/or said compounds, constructs, proteins or
polypeptides that have at least 80%, such as at least 85%,
preferably at least 90% sequence identity (as defined herein) with
IL17MS3085 have a blocking activity of 15 nM IL-17F induced IL-6
production in human fibrosarcoma HT-1080 cells with an IC50 of less
than 100 nM, more preferably, less than 75 nM, 50 nM or even less,
such as less than 40 nM or 30 nM, 25 nM, 20 nM, 15 nM or even more
preferably of less than 10 nM and/or said compounds, constructs,
proteins or polypeptides that have at least 80%, such as at least
85%, preferably at least 90% sequence identity (as defined herein)
with IL17MS3085 have a blocking activity of 5 nM IL-17A/F-induced
IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of
less than 150 nM, more preferably, less than 100 nM, 50 nM or even
less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or
6 nM or even more preferably of less than 5 nM, such as 4 nM, or 3
nM, or even less than 2 nM. [0183] Compounds, constructs, proteins
or polypeptides that have at least 80%, such as at least 85%,
preferably at least 90% sequence identity (as defined herein) with
IL17MS3086. Preferably, the compounds, constructs, proteins or
polypeptides that have at least 80%, such as at least 85%,
preferably at least 90% sequence identity (as defined herein) with
IL17MS3086 have a blocking activity, which can be determined by any
suitable assay known to the person skilled in the art, such as, for
instance, by means of Alphascreen assays (e.g. such as described
herein), Kinetic Exclusion Assay "KinExA" technology (e.g. such as
described herein) or by cell based assays (e.g. such as described
herein). Preferably, the blocking activity is determined by a
HT-1080 cell based assay, for instance, such as described in
Example 26. Preferably, said compounds, constructs, proteins or
polypeptides that have at least 80%, such as at least 85%,
preferably at least 90% sequence identity (as defined herein) with
IL17MS3086 have a blocking activity of 1 nM IL-17A-induced IL-6
production in human fibrosarcoma HT-1080 cells with an IC50 of less
than 150 nM, more preferably, less than 100 nM, 50 nM or even less,
such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM
or even more preferably of less than 5 nM, such as 4 nM, 3 nM, 2 nM
or even less than 1 nM and/or said compounds, constructs, proteins
or polypeptides that have at least 80%, such as at least 85%,
preferably at least 90% sequence identity (as defined herein) with
IL17MS3086 have a blocking activity of 15 nM IL-17F induced IL-6
production in human fibrosarcoma HT-1080 cells with an IC50 of less
than 100 nM, more preferably, less than 75 nM, 50 nM or even less,
such as less than 40 nM or 30 nM, 25 nM, 20 nM, 15 nM or even more
preferably of less than 10 nM and/or said compounds, constructs,
proteins or polypeptides that have at least 80%, such as at least
85%, preferably at least 90% sequence identity (as defined herein)
with IL17MS3086 have a blocking activity of 5 nM IL-17A/F-induced
IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of
less than 150 nM, more preferably, less than 100 nM, 50 nM or even
less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or
6 nM or even more preferably of less than 5 nM, such as 4 nM, or
even less than 3 nM.
[0184] Also preferably, the binding activity is determined by a
KinExA technology based assay, for instance, such as described in
Example 29. Preferably, said compounds, constructs, proteins or
polypeptides that have at least 80%, such as at least 85%,
preferably at least 90% sequence identity (as defined herein) with
IL17MS3086 (i.e. excluding the tag of IL17MS3091) have a
equilibrium dissociation constant (Kd) in solution with hIL-17A of
less than 50 pM, more preferably, less than 40 pM, 30 pM or even
less, such as less than 20 pM or 15 pM, 10 pM, 9 pM, 8 pM, 7 pM or
6 pM or even more preferably of less than 5 pM, such as 4 pM, 3 pM,
2 pM or even less than 1 pM, such as less than 0.5 pM and/or said
compounds, constructs, proteins or polypeptides that have at least
80%, such as at least 85%, preferably at least 90% sequence
identity (as defined herein) with IL17MS3086 (i.e. excluding the
tag of IL17MS3091) have a equilibrium dissociation constant (Kd) in
solution with hIL-17F of less than 100 pM, more preferably, less
than 80 pM, 60 pM or even less, such as less than 50 pM, 40 pM, 30
pM, 20 pM or 15 pM, 10 pM, 9 pM, 8 pM, 7 pM or 6 pM or even more
preferably of less than 5 pM, such as 4 pM, or 3 pM or even less
than 2 pM, such as less than 1.5 pM. [0185] Compounds, constructs,
proteins or polypeptides that have at least 80%, such as at least
85%, preferably at least 90% sequence identity (as defined herein)
with IL17MS3087. Preferably, the compounds, constructs, proteins or
polypeptides that have at least 80%, such as at least 85%,
preferably at least 90% sequence identity (as defined herein) with
IL17MS3087 have a blocking activity, which can be determined by any
suitable assay known to the person skilled in the art, such as, for
instance, by means of Alphascreen assays (e.g. such as described
herein) or by cell based assays (e.g. such as described herein).
Preferably, the blocking activity is determined by a HT-1080 cell
based assay, for instance, such as described in Example 26.
Preferably, said compounds, constructs, proteins or polypeptides
that have at least 80%, such as at least 85%, preferably at least
90% sequence identity (as defined herein) with IL17MS3087 have a
blocking activity of 1 nM IL-17A-induced IL-6 production in human
fibrosarcoma HT-1080 cells with an IC50 of less than 150 nM, more
preferably, less than 100 nM, 50 nM or even less, such as less than
20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or 6 nM or even more
preferably of less than 5 nM, such as 4 nM, 3 nM, 2 nM or even less
than 1 nM and/or said compounds, constructs, proteins or
polypeptides that have at least 80%, such as at least 85%,
preferably at least 90% sequence identity (as defined herein) with
IL17MS3087 have a blocking activity of 15 nM IL-17F induced IL-6
production in human fibrosarcoma HT-1080 cells with an IC50 of less
than 100 nM, more preferably, less than 75 nM, 50 nM or even less,
such as less than 40 nM or 30 nM, 25 nM, 20 nM, 15 nM or even more
preferably of less than 10 nM and/or said compounds, constructs,
proteins or polypeptides that have at least 80%, such as at least
85%, preferably at least 90% sequence identity (as defined herein)
with IL17MS3087 have a blocking activity of 5 nM IL-17A/F-induced
IL-6 production in human fibrosarcoma HT-1080 cells with an IC50 of
less than 150 nM, more preferably, less than 100 nM, 50 nM or even
less, such as less than 20 nM or 15 nM, 10 nM, 9 nM, 8 nM, 7 nM or
6 nM or even more preferably of less than 5 nM, such as 4 nM, or 3
nM, or even less than 2 nM.
[0186] The efficacy of the amino acid sequences and polypeptides of
the invention, and of compositions comprising the same, can be
tested using any suitable in vitro assay, cell-based assay, in vivo
assay and/or animal model known per se, or any combination thereof,
depending on the specific disease or disorder involved. Suitable
assays and animal models will be clear to the skilled person, and
for example include e.g. AlphaScreen, KinExA and Inhibition of
IL-17A; -F; -A/F-induced IL-6 production in human fibrosarcoma
HT-1080 cells (see experimental part), as well as the assays and
animal models used in the experimental part below and in the prior
art cited herein.
[0187] Also, according to the invention, amino acid sequences and
polypeptides that are directed against any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof from a first species of
warm-blooded animal may or may not show cross-reactivity with any
of IL-17A, IL-17F and/or IL-17A/F including combinations thereof
from one or more other species of warm-blooded animal. For example,
amino acid sequences and polypeptides directed against human any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof may
or may not show cross reactivity with any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof from one or more other
species of primates (such as, without limitation, monkeys from the
genus Macaca (such as, and in particular, cynomolgus monkeys
(Macaca fascicularis) and/or rhesus monkeys (Macaca mulatta) and
baboon (Papio ursinus)) and/or with any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof from one or more species of
animals that are often used in animal models for diseases (for
example mouse, rat, rabbit, pig or dog), and in particular in
animal models for diseases and disorders associated with any of
IL-17A, 1L-17F and/or IL-17A/F including combinations thereof (such
as the species and animal models mentioned herein). In this
respect, it will be clear to the skilled person that such
cross-reactivity, when present, may have advantages from a drug
development point of view, since it allows the amino acid sequences
and polypeptides against any of human IL-17A, IL-17F and/or
IL-17A/F including combinations thereof to be tested in such
disease models.
[0188] More generally, amino acid sequences and polypeptides of the
invention that are cross-reactive with any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof from multiple species of
mammal will usually be advantageous for use in veterinary
applications, since it will allow the same amino acid sequence or
polypeptide to be used across multiple species. Thus, it is also
encompassed within the scope of the invention that amino acid
sequences and polypeptides directed against any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof from one species of
animal (such as amino acid sequences and polypeptides against any
of human IL-17A, IL-17F and/or LL-17A/F including combinations
thereof) can be used in the treatment of another species of animal,
as long as the use of the amino acid sequences and/or polypeptides
provide the desired effects in the species to be treated.
[0189] The present invention is in its broadest sense also not
particularly limited to or defined by a specific antigenic
determinant, epitope, part, domain, subunit or confirmation (where
applicable) of any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof against which the amino acid sequences and
polypeptides of the invention are directed. For example, the amino
acid sequences and polypeptides may or may not be directed against
an "interaction site" (as defined herein). However, it is generally
assumed and preferred that the amino acid sequences and
polypeptides of the invention are preferably directed against an
interaction site (as defined herein), and in particular against an
epitope or similar epitopes on any of IL-17A, IL-17F and/or
IL-17A/F that allows blocking of a biological response by a single
or bi-specific binding unit (see also the different Classes of
indentified binding molecules of the invention in the experimental
part (e.g. Table 1). Thus, in one preferred, but non-limiting
aspect, the amino acid sequences and polypeptides of the invention
are directed against an epitope that allows binding and/or blocking
a biological response to IL-17A, IL-17F and IL-17A/F, and are as
further defined herein. In preferred aspect, a polypeptide of the
invention may contain two or more amino acid sequences of the
invention (and preferably ISV's), wherein at least one amino acid
sequence of the invention (preferably an ISV) is directed against
or binds to the amino acid(s) L74, Y85 and/or N88 of hIL-17A (SEQ
ID NO: 839), and/or wherein at least one amino acid sequence of the
invention (preferably an ISV) is directed against or binds to the
amino acid(s) R47, R73, I86 and/or N89 of hIL-17F (SEQ ID NO: 840),
including combinations thereof.
[0190] Accordingly, the present invention relates to an amino acid
sequence according to the invention, wherein the amino acid
sequence is directed against and/or that can specifically bind to
human IL-17 A and IL-17A/F (Class 2), wherein the amino acid
sequence binds to a L74A, a Y85A and/or a H54A IL-17A mutant with
significantly reduced affinity as compared to binding to the
wildtype IL-17A sequence.
[0191] Accordingly, the present invention relates to an amino acid
sequence according to the invention, wherein said amino acid
sequence is directed against and/or that can specifically bind to
human IL-17A, IL-17F and IL-17A/F (Class 4), wherein the amino acid
sequence binds to a L74A, a Y85A and/or a N88A IL-17A mutant with
significantly reduced affinity as compared to binding to the
wildtype IL-17A sequence.
[0192] Accordingly, the present invention relates to an amino acid
sequence according to the invention, wherein said amino acid
sequence is directed against and/or that can specifically bind to
human IL17F and wherein the amino acid sequence binds to a R47A or
R73A or I86A or N89A IL-17F mutant with significantly reduced
affinity as compared to binding to the wildtype IL-17F
sequence.
[0193] In this regard, as used herein "significantly reduced
affinity" means an affinity which is lower than the reference
affinity. Preferably "significantly reduced affinity" means that
the affinity is lower by a factor of at least 1.1, 1.2, 1.3, 1.4,
1.5, 2, 3, 5, 10, 20, 30, 40, 50 or by a factor of at least 100
compared to the reference affinity as indicated.
[0194] As further described herein, a polypeptide of the invention
may contain two or more amino acid sequences of the invention (and
preferably ISV's) that are directed against any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof. Generally, such
polypeptides will bind to any of IL-17A, IL-17F and/or LL-17A/F
including combinations thereof with increased avidity compared to a
single amino acid sequence of the invention (for instance, as
determined by KinExA technology as described in Example 22). Such a
polypeptide may, for example, comprise two amino acid sequences of
the invention that are directed against the same antigenic
determinant, epitope, part, domain, subunit or confirmation (where
applicable) of any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof (which may or may not be an interaction site);
or comprise at least one "first" amino acid sequence of the
invention that is directed against a first same antigenic
determinant, epitope, part, domain, subunit or confirmation (where
applicable) of any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof (which may or may not be an interaction site);
and at least one "second" amino acid sequence of the invention that
is directed against a second antigenic determinant, epitope, part,
domain, subunit or confirmation (where applicable) different from
the first (and which again may or may not be an interaction site).
Preferably, in such "biparatopic" polypeptides of the invention, at
least one amino acid sequence of the invention is directed against
an interaction site (as defined herein), although the invention in
its broadest sense is not limited thereto.
[0195] Also, when the target is part of a binding pair (i.e. as
herein described a receptor-ligand binding pair), the amino acid
sequences and polypeptides may be such that they compete with the
cognate binding partner (e.g. the ligand, receptor or other binding
partner, as applicable) for binding to the target, and/or such that
they (fully or partially) neutralize binding of the binding partner
to the target.
[0196] It is also within the scope of the invention that, where
applicable, an amino acid sequence of the invention can bind to two
or more antigenic determinants, epitopes, parts, domains, subunits
or confirmations of any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof. In such a case, the antigenic determinants,
epitopes, parts, domains or subunits of any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof to which the amino
acid sequences and/or polypeptides of the invention bind may be
essentially the same (for example, if any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof contains repeated
structural motifs or occurs in a multimeric form) or may be
different (and in the latter case, the amino acid sequences and
polypeptides of the invention may bind to such different antigenic
determinants, epitopes, parts, domains, subunits of any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof with an
affinity and/or specificity which may be the same or
different).
[0197] It is also expected that the amino acid sequences and
polypeptides of the invention will generally bind to all naturally
occurring or synthetic analogs, variants, mutants, alleles, parts
and fragments of any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof; or at least to those analogs, variants,
mutants, alleles, parts and fragments of any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof that contain one or
more antigenic determinants or epitopes that are essentially the
same as the antigenic determinant(s) or epitope(s) to which the
amino acid sequences and polypeptides of the invention bind in any
of IL-17A, IL-17F and/or IL-17A/F including combinations thereof
(e.g. in wild-type any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof). Again, in such a case, the amino acid
sequences and polypeptides of the invention may bind to such
analogs, variants, mutants, alleles, parts and fragments with an
affinity and/or specificity that are the same as, or that are
different from (i.e. higher than or lower than), the affinity and
specificity with which the amino acid sequences of the invention
bind to (wild-type) any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof. It is also included within the scope of the
invention that the amino acid sequences and polypeptides of the
invention bind to some analogs, variants, mutants, alleles, parts
and fragments of any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof, but not to others.
[0198] Also, as will be clear to the skilled person, proteins or
polypeptides that contain two or more amino acid sequences (and
preferably ISV's) directed against any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof may bind with higher
avidity to any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof than the corresponding monomeric amino acid
sequence(s). For example, and without limitation, proteins or
polypeptides that contain two or more amino acid sequences directed
against different epitopes of any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof may (and usually will) bind with
higher avidity than each of the different monomers, and proteins or
polypeptides that contain two or more amino acid sequences directed
against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof may (and usually will) bind also with higher
avidity to a multimer of any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof.
[0199] Generally, amino acid sequences and polypeptides of the
invention will at least bind to those forms of any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof (including
monomeric, multimeric and associated forms) that are the most
relevant from a biological and/or therapeutic point of view, as
will be clear to the skilled person.
[0200] It is also within the scope of the invention to use parts,
fragments, analogs, mutants, variants, alleles and/or derivatives
of the amino acid sequences and polypeptides of the invention,
and/or to use proteins or polypeptides comprising or essentially
consisting of one or more of such parts, fragments, analogs,
mutants, variants, alleles and/or derivatives, as long as these are
suitable for the uses envisaged herein. Such parts, fragments,
analogs, mutants, variants, alleles and/or derivatives will usually
contain (at least part of) a functional antigen-binding site for
binding against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof; and more preferably will be capable of
specific binding to any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof, and even more preferably capable of binding
to any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof with an affinity (suitably measured and/or expressed as a
K.sub.D-value (actual or apparent), a K.sub.A-value (actual or
apparent), a k.sub.on-rate and/or a k.sub.off-rate, or
alternatively as an IC.sub.50 value, as further described herein)
that is as defined herein. Some non-limiting examples of such
parts, fragments, analogs, mutants, variants, alleles, derivatives,
proteins and/or polypeptides will become clear from the further
description herein. Additional fragments or polypeptides of the
invention may also be provided by suitably combining (i.e. by
linking or genetic fusion) one or more (smaller) parts or fragments
as described herein. When the amino acid sequence of the invention
is an ISV, such a part, fragment, analog, mutant, variant, allele
and/or derivative may be a part, fragment, analog, mutant, variant,
allele and/or derivative of such an ISV.
[0201] In one specific, but non-limiting aspect of the invention,
which will be further described herein, such analogs, mutants,
variants, alleles, derivatives have an increased half-life in serum
(as further described herein) compared to the amino acid sequence
from which they have been derived. For example, an amino acid
sequence of the invention may be linked (chemically or otherwise)
to one or more groups or moieties that extend the half-life (such
as PEG), so as to provide a derivative of an amino acid sequence of
the invention with increased half-life.
[0202] In one specific, but non-limiting aspect, the amino acid
sequence of the invention may be an amino acid sequence that
comprises an immunoglobulin fold or may be an amino acid sequence
that, under suitable conditions (such as physiological conditions)
is capable of forming an immunoglobulin fold (i.e. by folding).
Reference is inter alia made to the review by Halaby et al., J.
(1999) Protein Eng. 12, 563-71. Preferably, when properly folded so
as to form an immunoglobulin fold, such an amino acid sequence is
capable of specific binding (as defined herein) to any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof; and more
preferably capable of binding to any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof with an affinity (suitably
measured and/or expressed as a K.sub.D-value (actual or apparent),
a K.sub.A-value (actual or apparent), a k.sub.on-rate and/or a
k.sub.off-rate, or alternatively as an IC.sub.50 value, as further
described herein) that is as defined herein. Also, parts,
fragments, analogs, mutants, variants, alleles and/or derivatives
of such amino acid sequences are preferably such that they comprise
an immunoglobulin fold or are capable for forming, under suitable
conditions, an immunoglobulin fold.
[0203] In particular, but without limitation, the amino acid
sequences of the invention may be amino acid sequences that
essentially consist of 4 framework regions (FR1 to FR4
respectively) and 3 complementarity determining regions (CDR1 to
CDR3 respectively); or any suitable fragment of such an amino acid
sequence (which will then usually contain at least some of the
amino acid residues that form at least one of the CDR's, as further
described herein).
[0204] The amino acid sequences of the invention may in particular
be an immunoglobulin sequence or a suitable fragment thereof, and
more in particular be an immunoglobulin variable domain sequence or
a suitable fragment thereof, such as light chain variable domain
sequence (e.g. a V.sub.L-sequence) or a suitable fragment thereof;
or a heavy chain variable domain sequence (e.g. a V.sub.H-sequence)
or a suitable fragment thereof. When the amino acid sequence of the
invention is a heavy chain variable domain sequence, it may be a
heavy chain variable domain sequence that is derived from a
conventional four-chain antibody (such as, without limitation, a
V.sub.H sequence that is derived from a human antibody) or be a
so-called V.sub.HH-sequence (as defined herein) that is derived
from a so-called "heavy chain antibody" (as defined herein).
[0205] However, it should be noted that the invention is not
limited as to the origin of the amino acid sequence (or ISV) of the
invention (or of the nucleotide sequence of the invention used to
express it), or as to the way that the amino acid sequence or
nucleotide sequence of the invention is (or has been) generated or
obtained. Thus, the amino acid sequences of the invention may be
naturally occurring amino acid sequences (from any suitable
species) or synthetic or semi-synthetic amino acid sequences. In a
specific but non-limiting aspect of the invention, the amino acid
sequence is a naturally occurring immunoglobulin sequence (from any
suitable species) or a synthetic or semi-synthetic immunoglobulin
sequence, including but not limited to "humanized" (as defined
herein) immunoglobulin sequences (such as partially or fully
humanized mouse or rabbit immunoglobulin sequences, and in
particular partially or fully humanized V.sub.HH sequences or
Nanobodies), "camelized" (as defined herein) immunoglobulin
sequences, as well as immunoglobulin sequences that have been
obtained by techniques such as affinity maturation (for example,
starting from synthetic, random or naturally occurring
immunoglobulin sequences), CDR grafting, veneering, combining
fragments derived from different immunoglobulin sequences, PCR
assembly using overlapping primers, and similar techniques for
engineering immunoglobulin sequences well known to the skilled
person; or any suitable combination of any of the foregoing.
Reference is for example made to the standard handbooks, as well as
to the further description and prior art mentioned herein.
[0206] Similarly, the nucleotide sequences of the invention may be
naturally occurring nucleotide sequences or synthetic or
semi-synthetic sequences, and may for example be sequences that are
isolated by PCR from a suitable naturally occurring template (e.g.
DNA or RNA isolated from a cell), nucleotide sequences that have
been isolated from a library (and in particular, an expression
library), nucleotide sequences that have been prepared by
introducing mutations into a naturally occurring nucleotide
sequence (using any suitable technique known per se, such as
mismatch PCR), nucleotide sequence that have been prepared by PCR
using overlapping primers, or nucleotide sequences that have been
prepared using techniques for DNA synthesis known per se.
[0207] As mentioned, the amino acid sequences of the invention are
preferably immunoglobulin single variable domains (ISV's), by which
is meant an immunoglobulin variable domain that comprises a
functional antigen binding (in the sense that it does not require
an interaction with another immunoglobulin variable domain--such as
a VH-VL interaction--to form a functional antigen binding
site).
[0208] The amino acid sequence of the invention may in particular
be a domain antibody (or an amino acid sequence that is suitable
for use as a domain antibody), a single domain antibody (or an
amino acid sequence that is suitable for use as a single domain
antibody), a "dAb" (or an amino acid sequence that is suitable for
use as a dAb) or a Nanobody.TM. (as defined herein, and including
but not limited to a V.sub.HH sequence); other single variable
domains, or any suitable fragment of any one thereof. For a general
description of (single) domain antibodies, reference is also made
to the prior art cited above, as well as to EP 0 368 684. For the
term "dAb's", reference is for example made to Ward et al. (Nature
1989 Oct. 12; 341 (6242): 544-6), to Holt et al., Trends
Biotechnol., 2003, 21(11):484-490; as well as to for example WO
06/030220, WO 06/003388 and other published patent applications of
Domantis Ltd. It should also be noted that, although less preferred
in the context of the present invention because they are not of
mammalian origin, single domain antibodies or single variable
domains can be derived from certain species of shark (for example,
the so-called "IgNAR domains", see for example WO 05/18629).
[0209] In particular, the amino acid sequence of the invention may
be a Nanobody.RTM. (as defined herein) or a suitable fragment
thereof. [Note: Nanobody.RTM., Nanobodies.RTM. and Nanoclone.RTM.
are registered trademarks of Ablynx N.V.] Such Nanobodies directed
against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof will also be referred to herein as "Nanobodies
of the invention".
[0210] For a general description of Nanobodies, reference is made
to the further description below, as well as to the prior art cited
herein. In this respect, it should however be noted that this
description and the prior art mainly described Nanobodies of the
so-called "V.sub.H3 class" (i.e. Nanobodies with a high degree of
sequence homology to human germline sequences of the V.sub.H3 class
such as DP-47, DP-51 or DP-29), which Nanobodies form a preferred
aspect of this invention. It should however be noted that the
invention in its broadest sense generally covers any type of
Nanobody directed against any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof, and for example also covers the
Nanobodies belonging to the so-called "V.sub.H4 class" (i.e.
Nanobodies with a high degree of sequence homology to human
germline sequences of the V.sub.H4 class such as DP-78), as for
example described in WO 07/118670.
[0211] Generally, Nanobodies (in particular V.sub.HH sequences and
partially humanized Nanobodies) can in particular be characterized
by the presence of one or more "Hallmark residues" (as described
herein) in one or more of the framework sequences (again as further
described herein).
[0212] Thus, generally, a Nanobody can be defined as an amino acid
sequence with the (general) structure [0213]
FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 in which FR1 to FR4 refer to
framework regions 1 to 4, respectively, and in which CDR1 to CDR3
refer to the complementarity determining regions 1 to 3,
respectively, and in which one or more of the Hallmark residues are
as further defined herein.
[0214] In particular, a Nanobody can be an amino acid sequence with
the (general) structure [0215] FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 in
which FR1 to FR4 refer to framework regions 1 to 4, respectively,
and in which CDR1 to CDR3 refer to the complementarity determining
regions 1 to 3, respectively, and in which the framework sequences
are as further defined herein.
[0216] More in particular, a Nanobody can be an amino acid sequence
with the (general) structure [0217] FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4
in which FR1 to FR4 refer to framework regions 1 to 4,
respectively, and in which CDR1 to CDR3 refer to the
complementarity determining regions 1 to 3, respectively, and in
which: [0218] i) preferably one or more of the amino acid residues
at positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and 108 according
to the Kabat numbering are chosen from the Hallmark residues
mentioned in Table B-2 below; and in which: [0219] ii) said amino
acid sequence has at least 80% amino acid identity with at least
one of the amino acid sequences of SEQ ID NOs: 1 to 22, in which
for the purposes of determining the degree of amino acid identity,
the amino acid residues that form the CDR sequences (indicated with
X in the sequences of SEQ ID NOs: 1 to 22) are disregarded.
[0220] In these Nanobodies, the CDR sequences are generally as
further defined herein. Thus, the invention also relates to such
Nanobodies that can bind to (as defined herein) and/or are directed
against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof, to suitable fragments thereof, as well as to
polypeptides that comprise or essentially consist of one or more of
such Nanobodies and/or suitable fragments.
[0221] SEQ ID NOs: 623 to 693 (see Table A-1) give the amino acid
sequences of a number of V.sub.HH sequences that have been raised
against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof.
TABLE-US-00002 TABLE A-1 Preferred VHH sequences or Nanobody
sequences (also referred herein as a sequence with a particular
name or SEQ ID NO: X, wherein X is a number referring to the
relevant amino acid sequence): SEQ ID NO: X, Name Properties
wherein X= Amino acid sequence 01D02 Anti-IL-17A 623
EVQLVESGGGLVQAGGSLRLSCAASGLSFSS YALGWFRQAPGKERDFVAAINWSGDNTHY
ADSVKGRFTISRDNAKNTVSLQMNSLKPED TAVYYCAAQLGYESGYSLTYDYDYWGQGT QVTVSS
01G03 Anti-IL-17A 624 EVQLVESGGGLVQAGGSLRLSCAASERTISN
YDMGWFRQAPGKERELIAADISWSALNTNY ADSVKGRFTISRDNAICNMVYLQMNNLKPE
DTAVYYCAARRSGYASFDNWGQGTQVTVS S 02E03 Anti-IL-17A 625
EVQLVESGGGLVQPGGSLRLSCAASGFTFSS YAMSWARQAPGEGLEWVSDINSGGTRTTY
ADSVKGRFTISRDNAKNTLYLQMNSLKPED TAVYVCAKLSVFRSQLGGKYYGGDYENRG
QGTQVTVSS 03B08 Anti-IL-17A 626 EVQLVESGGGLVQAGGSLRLSCAASGFTFD
DYAIGWFRQAPGKEREGVSCISSSDGSIYYA DSVKGRFTISSDNAKNTVYLQMNSLKPEDT
AVYHCARFGRTGWAEECVDYDYWGQGTQ VTVSS 03E05 Anti-IL-17A 627
EVQLVESGGGLVQAGGSLRLSCAASGVTFD DYSIGWFRQAPGKEREGVSCISSSDGIPYYSD
FVKGRFTTSIDNAKNTVYLQMNSLKPEDTA VYYCAAGFGRLCAEFDSWGQGTQVTVSS 01D06
Anti-IL-17A 628 EVQLVESGGGLVQAGGSLRLSCAADGRTFS and IL-17A/F
TYGMTWFRQVPGKEREFVAHIPRSTYSPYY ANSVKGRFTIARDDAKSTVYLQMNSLKPED
TAVYYCAVFTGGTYYVPTAYDYWGQGTQV TVSS 02A08 Anti-IL-17A 629
EVQLVESGGGVVQPGGSLRLSCADSERSFSF and IL-17A/F
NAMGWFRQAPGKEREFVAAISATGDDTYY ADSVKGRFAISRDTARNTVYLQMNSLKPED
TAVYYCGARVNFDGTVSYTNDYAYWGQGT QVTVSS 02A10 Anti-IL-17A 630
EVQLVESGGGLVQPGGSLRLSCAASGFALG and IL-17A/F
YYAIGWFRQAPGKEREGVSCDSSSDGRTYY GDSVKGRFTISTDSAKNTVYLQMNSLKPED
TAVYYCATCTDFEYDYWGQGTQVTVSS 04B09 Anti-IL-17A 631
EVQLVESGGGLVQPGGSLRLSCAASGFTLG and IL-17A/F
YYAIGWFRQAPGKEREGVSCDSSSDGDTYY ANSVKGRFTISTDNGKNTVYLQMNSLKPED
TAVYYCATCTDWNYDYWGQGTQVTVSS 03C07 Anti-IL-17A 632
EVQLVESGGGLVQAGGSLRLSCAASGFTFD and IL-17A/F
DYAIGWFRQAPGKEREAVSCFSSSDGSIYYA DSVKGRFTISSDNAKNTVYLQMNSLKPEDT
AVYYCAGGGGSYYYTQLNYCYDMDYWGK GTQVTVSS 04A02 Anti-IL-17A 633
EVQLVESGGGLVQPGGSLRLSCAASRNINIIN and IL-17A/F
YMAWYRQAPGNQRELVAAMTSDATTEYA DSVKGRFTISRDIPENTVYLQMNSLKPEDTA
VYYCNAKGIWDYLGRRDFGDYWGQGTQV TVSS 04B10 Anti-IL-17A 634
EVQLVESGGGLVQAGGSQSLSCVASGTIVNI and IL-17A/F
NVMGWYRQAPGKQRELVALITSGGGTTYG DSVKGRFTISIDNAKNTVILQMNSLEAEDTA
VYYCAAEIGYYSGGTYFSSEAHWGQGTQVT VSS 04G01 Anti-IL-17A 635
EVQLVESGGGLVQAGGSQRLSCTASGTIVNI and IL-17A/F
HVMGWYRQAPGKQRELVALIFSGGSADYA DSVKGRFTISRDNAKNTVYLEMNSLKAEDT
AVYYCAAEIGYYSGGTYYSSEAHWGQGTQ VTVSS 04F09 Anti-IL-17A 636
EVQLVESGGGLVQPGGSLRLSCAASGRTFST and IL-17A/F
HAMGWERQAPGKERDEVAAIRWSDGSSFY ADSVKGRFTISRDNAKNAVYLQSNSLKSED
TAVYVCYADVEGPTALHKYWGRGTQVTVS S 09D10 Anti-IL-17A 637
EVQLVESGGGLVQAGGSLSLSCAASGSVFRI and IL-17A/F
DVMRWHRQAPGKQREFLASIASGGTTNYA DSVKGRFTISRDNAKNTVYLQMNSLKPEDT
AVYYCGANAESGPYTYWGLGTQVTVSS 09G10 Anti-IL-17A 638
EVQLVESGGGLVQAGGSLRLSCAASDSVET and 1L-17A/F
AKAVGWYRQPPGLQREWVAIITSGGKTNYA DSSVKGRFFVSVDKVKNTVTLQMNSLKPED 11A06
Anti-IL-17A 639 TAVYYCYAQWMGRDYWGQGTQVTVSS and IL-17A/F
EVQLVESGGGLVQPGESLRLSCKASGFSLDY YALGWFRQAPGKEREGISCITSSDASAYYTD
SVKGRFTISRDNSKNTVYLQMNSLKTEDTAI YYCAAALLTCSSYYDAYTYWGQGTQVTVS S
06E11 Anti-IL-17F 640 EVQLVESGGGLVQAGGSLRLSCPVSGRAFS
RGRLGWERQAPGKEREEVAVAHWSGAITSY ADSVKGRFTFSRDNAKNTMNLQMNSLKPE
DTAVYYCAADSETSGNWVYWGQGTQVTVS S 07B09 Anti-IL-17F 641
EVQLVESGGGLVQAGGSLRLSCGASGGTFS SYATGWFRQAPGKEREFVAVLRWSDGHTA
YADSVKGRFTISRDGAKNTMYLQMSSLKPE DTAIYYCTTATRPGEWDYWGQGTQVTVSS 24G10
Anti-IL-17F 642 EVQLVESGGGLVQAGGSLRLSCGAAGGTFS
SYATGWFRQAPGKEREFVAVFRWSDSHTA YADSVKGRFTISRDGAKNTLYLQMSSLKPE
DTAIYYCTTATRPGEWDYWGQGTQVTVSS 07B11 Anti-IL-17F 643
EVQLVESGGGLVQAGGSLRLSCVASGRAFS SYVMGWFRQAPGMEREFVALIRWSDGITGY
VDSVKGRFTISRDNAKNTVYLQMNSLKPED TAVYYCAAAVRPGDYDYWGQGTQVTVSS 08A08
Anti-IL-17F 644 EVQLVESGGGLVQAGGSLRLSCAASGRTFR
PYRMGWERRAPGICAREFVTLISWSSGRTSY ADSVKGRFTISRDSAKNAVYLQMDNLKPED
TAVYFCAVDLSGDAVYDSWGQGTQVTVSS 08B07 Anti-IL-17F 645
EVQLVESGGGLVQPGGSLRLSCAASGRDFR VICNVGWIRQAPGKQRELVATITVGGSTNYA
DSAKGRFTISRDNAICNTVYLQMSSLKPEDT AVYYCNAVATVTDYTGTYSDGFWGQGTQV TVSS
08H01 Anti-IL-17F 646 EVQLVESGGGLVQAGGSLRLSCGASGGTFS
SYATGWFRQAPGKEREFVAVLRWSDSHTA YADSVEGRFTISRDGAKNTVYLQMSSLKPE
DTAIYYCTTGTRPGEWHYWGQGTQVTVSS 12A09 Anti-IL-17F 647
EVQLVESGGGLVQPGGSLRLSCAASGFTFSS YRMAWVRQAPGKGLEWVSSTSTGGEMTNY
ADSVKGRFTISRDNAKNTLHLQMNSLKPED TALYYCAAGTSAGHWSTGGQGTQVTVSS 16A04
Anti-IL-17F 648 EVQLVESGGGLVQAGGSLRLSCAASGRTFSS
YVVGWFRQAPGKEREF1GAISGSGDSIYYAV SEICDRFTISRDNGKNTLYLQMSSLKAEDTA
VYYCTADQEFGYLRFGRSEYWGQGTQVTV SS 24B08 Anti-IL-17F 649
EVQLVESGGGLVQAGGSLRLSCAVSGGTFS TYKMGWFRQAPGKEREIVARISTNGPTAYA
EFVKGRFTVSRENTKNTVYLQMNSLNIEDT AVYYCAAGYDSLFAGYDYWGQGTQVTVSS
EVQLVESGGGLVQAGGSLRLSCAASGFTFD 01A01 Cross-reactive: 650
DYDIGWERQAPGKEREGVSCETSSDGRTFY Anti-IL-17A,
ADSVKGRFTVSADNAKNTVYLQMNSLEPED IL-17F and IL-
TAVYFCAAVNTFDESAYAAFACYDVVRWG 17A/F QGTQVTVSS 09B09 Cross-reactive:
651 EMQLVESGGGLVQPGGSLRLSCAASGFTFSS Anti-IL-17A,
YWMYWARQAPGKGLEWISALAPGGDDEY IL-17F and IL-
YADSVNGRFTISRDNAENSLYLQMNSLKSE 17A/F DTAVYYCAKDHNVGYRTGEYDYGGQGTQ
VTVSS 09E11 Cross-reactive: 652 EVQLVESGGGLVQPGGSLRLSCAASGFTFSS
Anti-IL-17A, YWMYWVRQAPGKGLEWISALAPGGDNRY IL-17F and IL-
YADSVNGRFTISRDNAENSLYLQMNSLKSE 17A/F DTAVYYCAKDHNVGYRTGEYDYGGQGTQ
VTVSS 10A04 Cross-reactive: 653 EVQLVESGGGLVQPGGSLRLSCAASGFTFSS
Anti-IL-17A, YWMYWVRQAPGKGLEWISALAPGGGNRY IL-17F and IL-
YAESVNGRFTISRDNAKNSLYLQMNSLKSE 17A/F DTAVYYCAKDHNVGYRTGEYDYGGQGTQ
VTVSS 10A05 Cross-reactive: 654 EVQLVESGGGLVQPGGSLRLSCAASGFTFSN
Anti-IL-17A, YWMYWVRQAPGKGLEWISALAPGGDNRY IL-17F and IL-
YADSVNGRFTISRDNAENSLYLQMNSLKSE 17A/F DTAVYYCAKDHNVGYRTGEYDYGGQGTQ
VTVSS 10D11 Cross-reactive: 655 EVQLVESGGGLVQAGGSLRLSCAASGFTFSS
Anti-IL-17A, YWMYWVRQAPGKGLEWISALAPGGEHRY IL-17F and IL-
YADSVNGRFTISRDNAKNSLYLQMNSLKSE 17A/F DTAVYYCAKDHNVGYRTGEYDYGGQGTQ
VTVSS 10F02 Cross-reactive: 656 EVQLVESGGGLVQPGGSLRLSCAASGFTESS
Anti-IL-17A, YWMYWVRQAPGKGLEWISALAPGGGNAY IL-17F and IL-
YADSVNGRFTISRDNAENLLYLQMNSLKSE 17A/F DTAVYYCAKDHNVGYRTGEYDYGGQGTQ
VTVSS 11A02 Cross-reactive: 657 EVQLVESGGGLVQAGGSLRLSCAASGVIFRL
Anti-IL-17A, NAMGWYRAAPGKQRELVAIIINGGSTNYAD IL-17F and IL-
SVKGRFTISRDSAKNAVYLQMNSLKPEDTA 17A/F VYYCYYNIPGDVYWGQGTQVTVSS 11A07
Cross-reactive: 658 EVQLVESGGGLVQAGGSLRLSCAAPGVIFRL Anti-IL-17A,
NAMGWYRAAPGKQRELVAIIANGGSTNYA IL-17F and IL-
DSVKGRFTISRDSAKNAVYLQMNSLKPEDT 17A/F AVYYCYYNIPGDVYWGQGTRVTVSS
11C08 Cross-reactive: 659 EVQLVESGGGLVQAGGSLRLSCAASGVIFRL
Anti-IL-17A, NAMGWYRAAPGKQRELVAIIVNGGSTNYA IL-17F and IL-
DSVKGRFTISRDSAKNAVYLQMNSLKPEDT 17A/F AVYYCYYNIPGDVYWGQGTQVTVSS
11C09 Cross-reactive: 660 EVQLVESGGGLVQAGGSLRLSCAASGVIFRL
Anti-IL-17A, NAMGWYRAAPGKQRELVAIIVNGGSTNYA IL-17F and IL-
DSVKGRFFISRDSAKNAVYLQMDSLKPEDT 17A/F AVYYCYYNIPGDVYWGQGTQVTVSS
12H11 Cross-reactive: 661 EVQLVESGGGLVQPGGSLRLSCAASGVIFRL
Anti-IL-17A, NAMGWYRAAPGKQRELVAIIVNGGSTNYA IL-17F and IL-
DSVKGRFTISRDNAKNAVYLQMNSLKPEDT 17A/F AVYYCYYNIPGDVYWGQGTQVTVSS
13E303 Cross-reactive: 662 EVQLVESGGGSVQAGDSLRLSCAASGRANSI
Anti-IL-17A, NWEGWERQTPGKEREFVAGIRWSDAYTEY IL-17F and IL-
ANSVKGRFTISRDNAKNTVDLQMDSLKPED 17A/F TAVYYCVLDLSTVRYWGQGTQVTVSS
13D05 Cross-reactive: 663 EVQLVESGGGSVQAGDSLRLSCAASGRANSI
Anti-IL-17A, NWFGWFRQTPGKEREFVAGIRWTDAYTEY IL-17F and IL-
AASVKGRFTISRDNAKNTVGLQMDSLKPED 17A/F TAVYYCVLDLSTVRYWGQGSQVTVSS
13E02 Cross-reactive: 664 EVQLVESGGGLVQAGGSLRLSCAASGRTYD
Anti-IL-17A, AMGWLRQAPGKEREFVAAISGSGDDTYYA IL-17F and IL-
DSVKGRFTISKDNAGITMYLQMNSLKPEDT 17A/F AVYYCATRRGLYYVWDSNDYENWGQGTQ
VTVSS 01D08 Cross-reactive: 665 EVQLVESGGGLVQAGGSLRLSCAASGRTYY
Anti-IL-17A, AMGWLRQAPGKEREFVAAISGSGDDTYYA IL-17F and IL-
DSVKGRFTISKDNAGITMYLEMNSLKPEDTA 17A/F VYYCATRRGRYYVWDSNDYENWGQGTQV
TVSS 13E07 Cross-reactive: 666 EVQLVESGGGLVQAGGSLRLSCAASGRTYY
Anti-IL-17A, AMGWLRQAPGKEREFVAAISGSGDDTYYA
IL-17F and IL- DSVKGRFTISKDNAGITMYLQMNSLKPEDT 17A/F
AVYYCATRRGLYYVWDSNDYENWGQGTQ VTVSS 13G06 Cross-reactive: 667
EVQLVESGGGLVQAGGSLRLSCAASGRTYH Anti-IL-17A,
AMGWLRQAPGKEREFVAAVSGSGDDTYYA IL-17F and IL-
DSVKGRFTISKDNAGITMYLQMNSLKPEDT 17A/F AVYYCATRRGLYYVWDSNDYENWGQGTQ
VTVSS 13H05 Cross-reactive: 668 EVQLVESGGGLVQAGGSLRLSCAASGRTYD
Anti-IL-17A, AMGWFRQAPGKEREFVAAISGSGEDTYYAD IL-17F and IL-
SVKGRFTCSKDNAKDTMYLQMNSLKPEDT 17A/F AVYYCATRRGLYFITDSNDYENWGQGTQV
TVSS 13E05 Cross-reactive: 669 EVQLVESGGGKVQAGDSLTLSCVASGGTFS
Anti-IL-17A, NYAAWFRQAPGKDRRELVVSIFRTGSITYTA IL-17F and IL-
DSVKGRFTASRVNTKNTVYLQMNSLKPEDT 17A/F AVYYCASAYNPGVGYDYWGQGTQVTVSS
17B03 Cross-reactive: 670 EVQLVESGGGLVQAGGSLRLSCEASGGTFS
Anti-IL-17A, NYAAWFRQGPGKGRELVVSIFRSGTITYTAD IL-17F and IL-
SVKGRFFASRVNTKNTVYLQMNSLKPEDTG 17A/F IYYCASAYNPGIGYDYWGQGTQVTVSS
17D08 Cross-reactive: 671 EVQLVESGGGLVQAGDSLTLSCVASGGTFS
Anti-IL-17A, NYAAWFRQAPGKDRRELVVSIFRTGSITYTA IL-17F and IL-
DSVKGRFTASRVNTKNTVYLQMNSLKPEDT 17A/F AVYYCASAYNPGVGYDYWGQGTQVTVSS
17E05 Cross-reactive: 672 EVQLVESGGGLVQAGDSLRLSCEASGGTFS
Anti-IL-17A, NYAAWFRQGPGKGRELVVSIFRSGTITYTAD IL-17F and IL-
SVKGRFTASRVNTKNTVYLQMNSLKPEDTG 17A/F IYYCASAYNPGIGYDYWGQGTQVTVSS
17G08 Cross-reactive: 673 EVQLVESGGGLVQPGGSLRLSCEASGGTFSN
Anti-IL-17A, YAAWFRQGPGKGRELVVSIFRSGTITYTADS IL-17F and IL-
VKGRFTASRVNTKNTVYLQMNSLKPEDTGI 17A/F YYCASAYNPGIGYDYWGQGTQVTVSS
17H04 Cross-reactive: 674 EVQLVESGGGLVQAGDSLRLSCVASGGTFS
Anti-IL-17A, NYAAWFRQAPGKGRELILSIFRSGSITYTADS IL-17F and IL-
VKGRFTGSRVNTKNTAYLQMNNLKPEDTA 17A/F VYYCASAYNPGIGYDYWGQGTQVTVSS
17H07 Cross-reactive: 675 EVQLVESGGGLVQAGDSLTLSCVASGGTFS
Anti-IL-17A, NYAAWFRQAPGKDRRELVVSIFRTGSITYTA IL-17F and IL-
DSVKGRFTASRVNTKNTVYLQMNSLKPEDT 17A/F AVYYCASAYNPGVGYDYWGQGTQVTVSS
01C09 Cross-reactive: 676 EVQLVKSGGGLVQAGGSLKLSCAASGRTFT
Anti-IL-17A, TYPMGWFRQAPGKEREFVGAISMSGEDTIY IL-17F and IL-
ATSVKGRFTISRDDARNTVTLHMTSLKPEDT 17A/F AVYYCAARTSYNGRYDYIDDYSYWGQGTQ
VTVSS 01F10 Cross-reactive: 677 EVQLVESGGGLVQAGGSLRLSCAASGRTFT
Anti-IL-17A, TYPMGWFRQAPGKEREFVAAISMSGEDAAY IL-17F and IL-
ATSVKGRFTISRDNARNTVYLHMTTLKPED 17A/F TAVYYCAARTSYNGIYDYIDDYSYWGQGT
QVTVSS 02D02 Cross-reactive: 678 EVQLVESGGGLVQAGGSLKLSCARSGRTFT
Anti-IL-17A, TYPMGWFRQAPGKEREFVAAISMSGDDTAY IL-17F and IL-
ATFVKGRFTIVRDDDKNTVYLHMTSLKPED 17A/F TAVYYCAARTSYSGTYDYIDDYSYWGQGT
QVTVSS 13A08 Cross-reactive: 679 EVQLVESRGRLVQAGGSLRLSCAASGRTFTS
Anti-IL-17A, YPMGWFRQAPGKEREFVAAISMSGDDAAY IL-17F and IL-
ADFVRGRFTISRDDARNTVYLHMTSLKPED 17A/F TAVYYCAARTSYDGTYDYIDDYSYWGQGT
QVTVSS 13B05 Cross-reactive: 680 EVQLVESGGRLVQAGGSLRLSCAASGRTFTS
Anti-IL-17A, YPMGWFRQAPGKEREFVAAISMSGDDTAYT IL-17F and IL-
DFVRGRFTISRDDARNTVYLHMTSLKPEDT 17A/F AVYYCAARTSYDGTYDYIDDYSYWGQGTQ
VTVSS 13C06 Cross-reactive: 681 EVQLVESGGRLVQAGGSLRLSCAASGRTFTS
Anti-IL-17A, YPMGWFRQAPGKEREFVAAISMSGDDAAY IL-17F and IL-
ADFVRGRFTISRDDARNTVYLHMTSLKPED 17A/F TAVYYCAARTSYDGTYDYIDDYSYWGQGT
QVTVSS 13E01 Cross-reactive: 682 EVQLVESEGGLVQAGGSLRLSCARSGHAFT
Anti-IL-17A, SYPMGWFRQAPGKEREFVAAISMSGDDTIY IL-17F and IL-
RDFVKGRFTISRDNARNTVYLHMTSLKPED 17A/F TAVYYCAARTSYDGRYDYIDDYSYWGQGT
QVTVSS 13E03 Cross-reactive: 683 EVQLVESGGGLVQAGGSLRLSCAASGRTFT
Anti-IL-17A, TYPMGWFRQAPGKEREFVAAISMSGDDTAY IL-17F and IL-
ATFVKGRFTISRDSARNTVYLHMTRLKPEDT 17A/F AVYSCAARTSYDGRYDYIDDYSDWGQGTQ
VTVSS 13E08 Cross-reactive: 684 EVQLVESRGGLVQAGGSLRLSCAGSGRTLY
Anti-IL-17A, SYPMGWFRQAPGKEREFVAAISMSGDDTAV IL-17F and IL-
ATFVKGRFTISRDNARNTVYLHMTSLKPEDT 17A/F AVYHCAARTSYSGRYDYIDDYSYWGQGTQ
VTVSS 13G04 Cross-reactive: 685 EVQLVESGGGLVQAGGSLRLSCAASGRTLY
Anti-IL-17A, SYPMGWFRQAPGKEREFVAAISMSGDDTAV IL-17F and IL-
ATFVKGRFTISRDNARNTVYLHMSSLKPEDT 17A/F AVYHCAARTSYSGRYDYIDDYSYWGQGTQ
VTVSS 13G05 Cross-reactive: 686 EVQLVESGGGLVQAGGSLELSCARSGRTFTT
Anti-IL-17A, YPMGWFRQAPGKEREFVAAISMSGDDTAY IL-17F and IL-
ATFVKGRFTFSRDDDKNTVYLHMTSLKPED 17A/F TAVYYCAARTSYSGMYDYIHDYSYWGQGT
QVTVSS 13G08 Cross-reactive: 687 EVQLVESGGGLVQAGGSLRLSCAASGRTFFS
Anti-IL-17A, YPMGWFRQAPGKEREFVAAISMSGDDSAYR IL-17F and IL-
DFVKGRFTISRDNARDTVYLHMTSLKPEDT 17A/F AIYYCAARTSYNGRYDYIDDYSYWGQGTQ
VTVSS 13H03 Cross-reactive: 688 EVQLVESGGGLVQAGGSLRLSCAASGRTFT
Anti-IL-17A, TYPMGWFRQAPGKEREFVAAISMSGDDTAY IL-17F and IL-
ATFVKGRFTISRDNARNTVYLHMTRLKPED 17A/F TAVYSCAARTSYDGRYDYIDDYSDWGQGT
QVTVSS 17C01 Cross-reactive: 689 EVQLVESGGRLVQAGGSLRLPCAASGRTFTS
Anti-IL-17A, YPMGWFRQAPGKEREFVAAISMSGDDAAY IL-17F and IL-
ADFVRGRFTISRDDARNTVYLHMTSLKPED 17A/F TAVYYCAARTSYDGTYDYIDDYSYWGQGT
QVTVSS 15A08 Cross-reactive: 690 EVQLVESGGGLVQPGGSLRLSCAASGFTLD
Anti-IL-17A, YYAIGWFRQAPGKEREGVSCVSSSDGRTAY IL-17F and IL-
ADSVKGRFTISRDNAKNTVYLQMNSLKPED 17A/F TAVYYCATVMEYGLGCTTDVLDAWGQGTL
VTVSS 13G02 Cross-reactive: 691 EVQLVESRGGLVQAGGSLRLSCAASGGTFS
Anti-IL-17A, VFAMRWFRQAPGKEREFVAGISWTGGTTY IL-17F and IL-
YADSVKGRFTMSADNAKNTVYLQMNSLKP 17A/F EDTAVYYCAVDVGGGSDRYLGQGTQVTVS S
17E02 Cross-reactive: 692 EVQLVESRGGLVQAGGSLRLSCAASGGTFS
Anti-IL-17A, VFAMRWFRQAPGKEREFVAGISWTGGTTY IL-17F and IL-
YADSVKGRFTMSADNAKINTVYLQMNSLKP 17A/F EDTAVYYCAVDVGGGSDRYLGQGTQVTVS
S 18B05 Cross-reactive: 693 EVQLVKSGGGLVQPGGSLRLSCAASGGTFS
Anti-IL-17A, LFAMGWFREAPGKEREFVAAIRWSDGSSYY IL-17F and IL-
ADSVKGRFTISRDNAKNAVHLQSNSLKSED 17A/F
TAVYYCYADVQGGLHRYWGQGTQVTVSS
[0222] In particular, the invention in some specific aspects
provides: [0223] amino acid sequences (and in particular, ISV's)
that are directed against (as defined herein) any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof and that have at
least 80%, preferably at least 85%, such as 90% or 95% or more
sequence identity with at least one of the amino acid sequences of
SEQ ID NOs: 623 to 693 (see Table A-1). These amino acid sequences
may further be such that they neutralize binding of the cognate
ligand to any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof; and/or compete with the cognate ligand for
binding to any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof; and/or are directed against an interaction
site (as defined herein) on any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof (such as the ligand binding site);
[0224] amino acid sequences (and in particular, ISV's) that
cross-block (as defined herein) the binding of at least one of the
amino acid sequences of SEQ ID NOs: 623 to 693 (see Table A-1) to
any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof and/or that compete with at least one of the amino acid
sequences of SEQ ID NOs: 623 to 693 (see Table A-1) for binding to
any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof. Again, these amino acid sequences may further be such that
they neutralize binding of the cognate ligand to any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof; and/or
compete with the cognate ligand for binding to any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof; and/or are
directed against an interaction site (as defined herein) on any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof (such
as the ligand binding site); which amino acid sequences (or ISV's)
may be as further described herein (and may for example be
Nanobodies); as well as polypeptides of the invention that comprise
one or more of such amino acid sequences (which may be as further
described herein, and may for example be bispecific and/or
biparatopic polypeptides as described herein), and nucleic acid
sequences that encode such amino acid sequences and polypeptides.
Such amino acid sequences and polypeptides do not include any
naturally occurring ligands.
[0225] In some other specific aspects, the invention provides:
[0226] amino acid sequences (and in particular, ISV's) of the
invention that are specific for any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof compared to IL-17B, IL-17C,
IL-17D, and/or IL-17E; which amino acid sequences of the invention
may be as further described herein (and may for example be
Nanobodies); as well as polypeptides of the invention that comprise
one or more of such amino acid sequences (which may be as further
described herein, and may for example be bispecific and/or
biparatopic polypeptides as described herein), and nucleic acid
sequences that encode such amino acid sequences and polypeptides.
Such amino acid sequences and polypeptides do not include any
naturally occurring ligands.
[0227] Accordingly, some particularly preferred Nanobodies of the
invention are Nanobodies which can bind (as further defined herein)
to and/or are directed against to any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof and which: [0228] i) have
at least 80% amino acid identity with at least one of the amino
acid sequences of SEQ ID NOs: 623 to 693 (see Table A-1), in which
for the purposes of determining the degree of amino acid identity,
the amino acid residues that form the CDR sequences are
disregarded. In this respect, reference is also made to Table B-1,
which lists the framework 1 sequences (SEQ ID NOs: 126 to 196),
framework 2 sequences (SEQ ID NOs: 268 to 338) framework 3
sequences (SEQ ID NOs: 410 to 480) and framework 4 sequences (SEQ
ID NOs: 552 to 622) of the Nanobodies of SEQ ID NOs: 623 to 693
(see Table A-1) (with respect to the amino acid residues at
positions 1 to 4 and 27 to 30 of the framework 1 sequences,
reference is also made to the comments made below. Thus, for
determining the degree of amino acid identity, these residues are
preferably disregarded); and in which: [0229] ii) preferably one or
more of the amino acid residues at positions 11, 37, 44, 45, 47,
83, 84, 103, 104 and 108 according to the Kabat numbering are
chosen from the Hallmark residues mentioned in Table B-2 below.
[0230] In these Nanobodies, the CDR sequences are generally as
further defined herein.
[0231] Again, such Nanobodies may be derived in any suitable manner
and from any suitable source, and may for example be naturally
occurring V.sub.HH sequences (i.e. from a suitable species of
Camelid) or synthetic or semi-synthetic amino acid sequences,
including but not limited to "humanized" (as defined herein)
Nanobodies, "camelized" (as defined herein) immunoglobulin
sequences (and in particular camelized heavy chain variable domain
sequences), as well as Nanobodies that have been obtained by
techniques such as affinity maturation (for example, starting from
synthetic, random or naturally occurring immunoglobulin sequences),
CDR grafting, veneering, combining fragments derived from different
immunoglobulin sequences, PCR assembly using overlapping primers,
and similar techniques for engineering immunoglobulin sequences
well known to the skilled person; or any suitable combination of
any of the foregoing as further described herein. Also, when a
Nanobody comprises a V.sub.HH sequence, said Nanobody may be
suitably humanized, as further described herein, so as to provide
one or more further (partially or fully) humanized Nanobodies of
the invention. Similarly, when a Nanobody comprises a synthetic or
semi-synthetic sequence (such as a partially humanized sequence),
said Nanobody may optionally be further suitably humanized, again
as described herein, again so as to provide one or more further
(partially or fully) humanized Nanobodies of the invention.
[0232] In particular, humanized Nanobodies may be amino acid
sequences that are as generally defined for Nanobodies in the
previous paragraphs, but in which at least one amino acid residue
is present (and in particular, in at least one of the framework
residues) that is and/or that corresponds to a humanizing
substitution (as defined herein). Some preferred, but non-limiting
humanizing substitutions (and suitable combinations thereof) will
become clear to the skilled person based on the disclosure herein.
In addition, or alternatively, other potentially useful humanizing
substitutions can be ascertained by comparing the sequence of the
framework regions of a naturally occurring V.sub.HH sequence with
the corresponding framework sequence of one or more closely related
human V.sub.H sequences, after which one or more of the potentially
useful humanizing substitutions (or combinations thereof) thus
determined can be introduced into said V.sub.HH sequence (in any
manner known per se, as further described herein) and the resulting
humanized V.sub.HH sequences can be tested for affinity for the
target, for stability, for ease and level of expression, and/or for
other desired properties. In this way, by means of a limited degree
of trial and error, other suitable humanizing substitutions (or
suitable combinations thereof) can be determined by the skilled
person based on the disclosure herein. Also, based on the
foregoing, (the framework regions of) a Nanobody may be partially
humanized or fully humanized.
[0233] Thus, some other preferred Nanobodies of the invention are
Nanobodies which can bind (as further defined herein) to any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof and
which: [0234] i) are a humanized variant of one of the amino acid
sequences of SEQ ID NOs: 623 to 693 (see Table A-1); and/or [0235]
ii) have at least 80% amino acid identity with at least one of the
amino acid sequences of SEQ ID NOs: 623 to 693 (see Table A-1), in
which for the purposes of determining the degree of amino acid
identity, the amino acid residues that form the CDR sequences are
disregarded; and in which: [0236] i) preferably one or more of the
amino acid residues at positions 11, 37, 44, 45, 47, 83, 84, 103,
104 and 108 according to the Kabat numbering are chosen from the
Hallmark residues mentioned in Table B-2 below.
[0237] According to another specific aspect of the invention, the
invention provides a number of stretches of amino acid residues
(i.e. small peptides) that are particularly suited for binding to
any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof. These stretches of amino acid residues may be present in,
and/or may be incorporated into, an amino acid sequence of the
invention, in particular in such a way that they form (part of) the
antigen binding site of an amino acid sequence of the invention. As
these stretches of amino acid residues were first generated as CDR
sequences of heavy chain antibodies or V.sub.HH sequences that were
raised against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof (or may be based on and/or derived from such
CDR sequences, as further described herein), they will also
generally be referred to herein as "CDR sequences" (i.e. as CDR1
sequences, CDR2 sequences and CDR3 sequences, respectively). It
should however be noted that the invention in its broadest sense is
not limited to a specific structural role or function that these
stretches of amino acid residues may have in an amino acid sequence
of the invention, as long as these stretches of amino acid residues
allow the amino acid sequence of the invention to bind to any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof.
Thus, generally, the invention in its broadest sense comprises any
amino acid sequence that is capable of binding to any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof and that
comprises one or more CDR sequences as described herein, and in
particular a suitable combination of two or more such CDR
sequences, that are suitably linked to each other via one or more
further amino acid sequences, such that the entire amino acid
sequence forms a binding domain and/or binding unit that is capable
of binding to any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof. It should however also be noted that the
presence of only one of such CDR sequence in an amino acid sequence
of the invention may by itself already be sufficient to provide an
amino acid sequence of the invention that is capable of binding to
any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof; reference is for example again made to the so-called
"Expedite fragments" described in WO 03/050531 or subsequent
filings.
[0238] Thus, in another specific, but non-limiting aspect, the
amino acid sequence (or ISV) of the invention may be an amino acid
sequence that comprises at least one amino acid sequence that is
chosen from the group consisting of the CDR1 sequences, CDR2
sequences and CDR3 sequences that are described herein (or any
suitable combination thereof). In particular, an amino acid
sequence of the invention may be an amino acid sequence that
comprises at least one antigen binding site, wherein said antigen
binding site comprises at least one amino acid sequence that is
chosen from the group consisting of the CDR1 sequences, CDR2
sequences and CDR3 sequences that are described herein (or any
suitable combination thereof).
[0239] Generally, in this aspect of the invention, the amino acid
sequence (or ISV) of the invention may be any amino acid sequence
that comprises at least one stretch of amino acid residues, in
which said stretch of amino acid residues has an amino acid
sequence that corresponds to the sequence of at least one of the
CDR sequences described herein. Such an amino acid sequence may or
may not comprise an immunoglobulin fold. For example, and without
limitation, such an amino acid sequence may be a suitable fragment
of an immunoglobulin sequence that comprises at least one such CDR
sequence, but that is not large enough to form a (complete)
immunoglobulin fold (reference is for example again made to the
"Expedite fragments" described in WO 03/050531). Alternatively,
such an amino acid sequence may be a suitable "protein scaffold"
that comprises least one stretch of amino acid residues that
corresponds to such a CDR sequence (i.e. as part of its antigen
binding site). Suitable scaffolds for presenting amino acid
sequences will be clear to the skilled person, and for example
comprise, without limitation, to binding scaffolds based on or
derived from immunoglobulins (i.e. other than the immunoglobulin
sequences already described herein), protein scaffolds derived from
protein A domains (such as Affibodies.TM.), tendamistat,
fibronectin, lipocalin, CTLA-4, T-cell receptors, designed ankyrin
repeats, avimers and PDZ domains (Binz et al., Nat. Biotech 2005,
23:1257), and binding moieties based on DNA or RNA including but
not limited to DNA or RNA aptamers (Ulrich et al., Comb Chem High
Throughput Screen 2006 9(8):619-32).
[0240] Again, any amino acid sequence (or ISV) of the invention
that comprises one or more of these CDR sequences is preferably
such that it can specifically bind (as defined herein) to any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof, and
more in particular such that it can bind to any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof with an affinity
(suitably measured and/or expressed as a K.sub.D-value (actual or
apparent), a K.sub.A-value (actual or apparent), a k.sub.on-rate
and/or a k.sub.off-rate, or alternatively as an IC.sub.50 value, as
further described herein), that is as defined herein.
[0241] More in particular, the amino acid sequences according to
this aspect of the invention may be any amino acid sequence (or
ISV) that comprises at least one antigen binding site, wherein said
antigen binding site comprises at least two amino acid sequences
that are chosen from the group consisting of the CDR1 sequences
described herein, the CDR2 sequences described herein and the CDR3
sequences described herein, such that (i) when the first amino acid
sequence is chosen from the CDR1 sequences described herein, the
second amino acid sequence is chosen from the CDR2 sequences
described herein or the CDR3 sequences described herein; (ii) when
the first amino acid sequence is chosen from the CDR2 sequences
described herein, the second amino acid sequence is chosen from the
CDR1 sequences described herein or the CDR3 sequences described
herein; or (iii) when the first amino acid sequence is chosen from
the CDR3 sequences described herein, the second amino acid sequence
is chosen from the CDR1 sequences described herein or the CDR3
sequences described herein.
[0242] Even more in particular, the amino acid sequences of the
invention may be amino acid sequences (or ISV's) that comprise at
least one antigen binding site, wherein said antigen binding site
comprises at least three amino acid sequences that are chosen from
the group consisting of the CDR1 sequences described herein, the
CDR2 sequences described herein and the CDR3 sequences described
herein, such that the first amino acid sequence is chosen from the
CDR1 sequences described herein, the second amino acid sequence is
chosen from the CDR2 sequences described herein, and the third
amino acid sequence is chosen from the CDR3 sequences described
herein. Preferred combinations of CDR1, CDR2 and CDR3 sequences
will become clear from the further description herein. As will be
clear to the skilled person, such an amino acid sequence is
preferably an immunoglobulin sequence (as further described
herein), but it may for example also be any other amino acid
sequence that comprises a suitable scaffold for presenting said CDR
sequences.
[0243] Thus, in one specific, but non-limiting aspect, the
invention relates to an amino acid sequence (and in particular, an
ISV) directed against any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof, that comprises one or more
stretches of amino acid residues chosen from the group consisting
of: [0244] a) the amino acid sequences of SEQ ID NOs: 197 to 267;
[0245] b) amino acid sequences that have at least 80% amino acid
identity with at least one of the amino acid sequences of SEQ ID
NOs: 197 to 267; [0246] c) amino acid sequences that have 3, 2, or
1 amino acid difference with at least one of the amino acid
sequences of SEQ ID NOs: 197 to 267; [0247] d) the amino acid
sequences of SEQ ID NOs: 339 to 409; [0248] e) amino acid sequences
that have at least 80% amino acid identity with at least one of the
amino acid sequences of SEQ ID NOs: 339 to 409; [0249] f) amino
acid sequences that have 3, 2, or 1 amino acid difference with at
least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
[0250] g) the amino acid sequences of SEQ ID NOs: 481 to 551;
[0251] h) amino acid sequences that have at least 80% amino acid
identity with at least one of the amino acid sequences of SEQ ID
NOs: 481 to 551; [0252] i) amino acid sequences that have 3, 2, or
1 amino acid difference with at least one of the amino acid
sequences of SEQ ID NOs: 481 to 551; or any suitable combination
thereof.
[0253] When an amino acid sequence (or ISV) of the invention
contains one or more amino acid sequences according to b) and/or
c): [0254] i) any amino acid substitution in such an amino acid
sequence according to b) and/or c) is preferably, and compared to
the corresponding amino acid sequence according to a), a
conservative amino acid substitution, (as defined herein); and/or
[0255] ii) the amino acid sequence according to b) and/or c)
preferably only contains amino acid substitutions, and no amino
acid deletions or insertions, compared to the corresponding amino
acid sequence according to a); and/or [0256] iii) the amino acid
sequence according to b) and/or c) may be an amino acid sequence
that is derived from an amino acid sequence according to a) by
means of affinity maturation using one or more techniques of
affinity maturation known per se.
[0257] Similarly, when an amino acid sequence of the invention
contains one or more amino acid sequences according to e) and/or
f): [0258] i) any amino acid substitution in such an amino acid
sequence according to e) and/or f) is preferably, and compared to
the corresponding amino acid sequence according to d), a
conservative amino acid substitution, (as defined herein); and/or
[0259] ii) the amino acid sequence according to e) and/or f)
preferably only contains amino acid substitutions, and no amino
acid deletions or insertions, compared to the corresponding amino
acid sequence according to d); and/or [0260] iii) the amino acid
sequence according to e) and/or f) may be an amino acid sequence
that is derived from an amino acid sequence according to d) by
means of affinity maturation using one or more techniques of
affinity maturation known per se.
[0261] Also, similarly, when an amino acid sequence of the
invention contains one or more amino acid sequences according to h)
and/or i): [0262] i) any amino acid substitution in such an amino
acid sequence according to h) and/or i) is preferably, and compared
to the corresponding amino acid sequence according to g), a
conservative amino acid substitution, (as defined herein); and/or
[0263] ii) the amino acid sequence according to h) and/or i)
preferably only contains amino acid substitutions, and no amino
acid deletions or insertions, compared to the corresponding amino
acid sequence according to g); and/or [0264] iii) the amino acid
sequence according to h) and/or i) may be an amino acid sequence
that is derived from an amino acid sequence according to g) by
means of affinity maturation using one or more techniques of
affinity maturation known per se.
[0265] It should be understood that the last preceding paragraphs
also generally apply to any amino acid sequences of the invention
that comprise one or more amino acid sequences according to b), c),
e), f), h) or i), respectively.
[0266] In this specific aspect, the amino acid sequence (or ISV)
preferably comprises one or more stretches of amino acid residues
chosen from the group consisting of: [0267] i) the amino acid
sequences of SEQ ID NOs: 197 to 267; [0268] ii) the amino acid
sequences of SEQ ID NOs: 339 to 409; and [0269] iii) the amino acid
sequences of SEQ ID NOs: 481 to 551; or any suitable combination
thereof.
[0270] Also, preferably, in such an amino acid sequence, at least
one of said stretches of amino acid residues forms part of the
antigen binding site for binding against any of IL-17A, IL-17F
and/or IL-17A/F, including combinations thereof.
[0271] In a more specific, but again non-limiting aspect, the
invention relates to an amino acid sequence (or ISV) directed
against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof, that comprises two or more stretches of amino
acid residues chosen from the group consisting of: [0272] a) the
amino acid sequences of SEQ ID NOs: 197 to 267; [0273] b) amino
acid sequences that have at least 80% amino acid identity with at
least one of the amino acid sequences of SEQ ID NOs: 197 to 267;
[0274] c) amino acid sequences that have 3, 2, or 1 amino acid
difference with at least one of the amino acid sequences of SEQ ID
NOs: 197 to 267; [0275] d) the amino acid sequences of SEQ ID NOs:
339 to 409; [0276] e) amino acid sequences that have at least 80%
amino acid identity with at least one of the amino acid sequences
of SEQ ID NOs: 339 to 409; [0277] f) amino acid sequences that have
3, 2, or 1 amino acid difference with at least one of the amino
acid sequences of SEQ ID NOs: 339 to 409; [0278] g) die amino acid
sequences of SEQ ID NOs: 481 to 551; [0279] h) amino acid sequences
that have at least 80% amino acid identity with at least one of the
amino acid sequences of SEQ ID NOs: 481 to 551; [0280] i) amino
acid sequences that have 3, 2, or 1 amino acid difference with at
least one of the amino acid sequences of SEQ ID NOs: 481 to 551;
such that (i) when the first stretch of amino acid residues
corresponds to one of the amino acid sequences according to a), b)
or c), the second stretch of amino acid residues corresponds to one
of the amino acid sequences according to d), e), f), g), h) or i);
(ii) when the first stretch of amino acid residues corresponds to
one of the amino acid sequences according to d), e) or f), the
second stretch of amino acid residues corresponds to one of the
amino acid sequences according to a), b), c), g), h) or i); or
(iii) when the first stretch of amino acid residues corresponds to
one of the amino acid sequences according to g), h) or i), the
second stretch of amino acid residues corresponds to one of the
amino acid sequences according to a), b), c), d), e) or f).
[0281] In this specific aspect, the amino acid sequence preferably
comprises two or more stretches of amino acid residues chosen from
the group consisting of: [0282] i) the amino acid sequences of SEQ
ID NOs: 197 to 267; [0283] ii) the amino acid sequences of SEQ ID
NOs: 339 to 409; and [0284] iii) the amino acid sequences of SEQ ID
NOs: 481 to 551; such that, (i) when the first stretch of amino
acid residues corresponds to one of the amino acid sequences of SEQ
ID NOs: 197 to 267, the second stretch of amino acid residues
corresponds to one of the amino acid sequences of SEQ ID NOs: 339
to 409 or of SEQ ID NOs: 481 to 551; (ii) when the first stretch of
amino acid residues corresponds to one of the amino acid sequences
of SEQ ID NOs: 339 to 409, the second stretch of amino acid
residues corresponds to one of the amino acid sequences of SEQ ID
NOs: 197 to 267 or of SEQ ID NOs: 481 to 551; or (iii) when the
first stretch of amino acid residues corresponds to one of the
amino acid sequences of SEQ ID NOs: 481 to 551, the second stretch
of amino acid residues corresponds to one of the amino acid
sequences of SEQ ID NOs: 197 to 267 or of SEQ ID NOs: 339 to
409.
[0285] Also, in such an amino acid sequence, the at least two
stretches of amino acid residues again preferably form part of the
antigen binding site for binding against any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof.
[0286] In an even more specific, but non-limiting aspect, the
invention relates to an amino acid sequence (or ISV) directed
against any of IL-I 7A, IL-17F and/or IL-17A/F including
combinations thereof, that comprises three or more stretches of
amino acid residues, in which the first stretch of amino acid
residues is chosen from the group consisting of: [0287] a) the
amino acid sequences of SEQ ID NOs: 197 to 267; [0288] b) amino
acid sequences that have at least 80% amino acid identity with at
least one of the amino acid sequences of SEQ ID NOs: 197 to 267;
[0289] c) amino acid sequences that have 3, 2, or 1 amino acid
difference with at least one of the amino acid sequences of SEQ ID
NOs: 197 to 267; the second stretch of amino acid residues is
chosen from the group consisting of: [0290] d) the amino acid
sequences of SEQ ID NOs: 339 to 409; [0291] e) amino acid sequences
that have at least 80% amino acid identity with at least one of the
amino acid sequences of SEQ ID NOs: 339 to 409; [0292] f) amino
acid sequences that have 3, 2, or 1 amino acid difference with at
least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
and the third stretch of amino acid residues is chosen from the
group consisting of: [0293] g) the amino acid sequences of SEQ ID
NOs: 481 to 551; [0294] h) amino acid sequences that have at least
80% amino acid identity with at least one of the amino acid
sequences of SEQ ID NOs: 481 to 551; [0295] i) amino acid sequences
that have 3, 2, or 1 amino acid difference with at least one of the
amino acid sequences of SEQ ID NOs: 481 to 551.
[0296] Preferably, in this specific aspect, the first stretch of
amino acid residues is chosen from the group consisting of the
amino acid sequences of SEQ ID NOs: 197 to 267; the second stretch
of amino acid residues is chosen from the group consisting of the
amino acid sequences of SEQ ID NOs: 339 to 409; and the third
stretch of amino acid residues is chosen from the group consisting
of the amino acid sequences of SEQ ID NOs: 481 to 551.
[0297] Again, preferably, in such an amino acid sequence, the at
least three stretches of amino acid residues forms part of the
antigen binding site for binding against any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof.
[0298] Preferred combinations of such stretches of amino acid
sequences will become clear from the further disclosure herein.
[0299] Preferably, in such amino acid sequences the CDR sequences
have at least 70% amino acid identity, preferably at least 80%
amino acid identity, more preferably at least 90% amino acid
identity, such as 95% amino acid identity or more or even
essentially 100% amino acid identity with the CDR sequences of at
least one of the amino acid sequences of SEQ ID NOs: 623 to 693
(see Table A-1). This degree of amino acid identity can for example
be determined by determining the degree of amino acid identity (in
a manner described herein) between said amino acid sequence and one
or more of the sequences of SEQ ID NOs: 623 to 693 (see Table A-1),
in which the amino acid residues that form the framework regions
are disregarded. Also, such amino acid sequences of the invention
can be as further described herein.
[0300] Also, such amino acid sequences are preferably such that
they can specifically bind (as defined herein) to any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof; and more in
particular bind to any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof with an affinity (suitably measured and/or
expressed as a K.sub.D-value (actual or apparent), a K.sub.A-value
(actual or apparent), a k.sub.on-rate and/or a k.sub.off-rate, or
alternatively as an IC.sub.50 value, as further described herein)
that is as defined herein.
[0301] When the amino acid sequence (or ISV) of the invention
essentially consists of 4 framework regions (FR1 to FR4,
respectively) and 3 complementarity determining regions (CDR1 to
CDR3, respectively), the amino acid sequence of the invention is
preferably such that: [0302] CDR1 is chosen from the group
consisting of: [0303] a) the amino acid sequences of SEQ ID NOs:
197 to 267; [0304] b) amino acid sequences that have at least 80%
amino acid identity with at least one of the amino acid sequences
of SEQ ID NOs: 197 to 267; [0305] c) amino acid sequences that have
3, 2, or 1 amino acid difference with at least one of the amino
acid sequences of SEQ ID NOs: 197 to 267; and/or [0306] CDR2 is
chosen from the group consisting of: [0307] d) the amino acid
sequences of SEQ ID NOs: 339 to 409; [0308] e) amino acid sequences
that have at least 80% amino acid identity with at least one of the
amino acid sequences of SEQ ID NOs: 339 to 409; [0309] f) amino
acid sequences that have 3, 2, or 1 amino acid difference with at
least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
and/or [0310] CDR3 is chosen from the group consisting of: [0311]
g) the amino acid sequences of SEQ ID NOs: 481 to 551; [0312] h)
amino acid sequences that have at least 80% amino acid identity
with at least one of the amino acid sequences of SEQ ID NOs: 481 to
551; [0313] i) amino acid sequences that have 3, 2, or 1 amino acid
difference with at least one of the amino acid sequences of SEQ ID
NOs: 481 to 551.
[0314] In particular, such an amino acid sequence (or ISV) of the
invention may be such that CDR1 is chosen from the group consisting
of the amino acid sequences of SEQ ID NOs: 197 to 267; and/or CDR2
is chosen from the group consisting of the amino acid sequences of
SEQ ID NOs: 339 to 409; and/or CDR3 is chosen from the group
consisting of the amino acid sequences of SEQ ID NOs: 481 to
551.
[0315] In particular, when the amino acid sequence (or ISV) of the
invention essentially consists of 4 framework regions (FR1 to FR4,
respectively) and 3 complementarity determining regions (CDR1 to
CDR3, respectively), the amino acid sequence of the invention is
preferably such that: [0316] CDR1 is chosen from the group
consisting of: [0317] a) the amino acid sequences of SEQ ID NOs:
197 to 267; [0318] b) amino acid sequences that have at least 80%
amino acid identity with at least one of the amino acid sequences
of SEQ ID NOs: 197 to 267; [0319] c) amino acid sequences that have
3, 2, or 1 amino acid difference with at least one of the amino
acid sequences of SEQ ID NOs: 197 to 267; and [0320] CDR2 is chosen
from the group consisting of: [0321] d) the amino acid sequences of
SEQ ID NOs: 339 to 409; [0322] e) amino acid sequences that have at
least 80% amino acid identity with at least one of the amino acid
sequences of SEQ ID NOs: 339 to 409; [0323] f) amino acid sequences
that have 3, 2, or 1 amino acid difference with at least one of the
amino acid sequences of SEQ ID NOs: 339 to 409; and [0324] CDR3 is
chosen from the group consisting of: [0325] g) the amino acid
sequences of SEQ ID NOs: 481 to 551; [0326] h) amino acid sequences
that have at least 80% amino acid identity with at least one of the
amino acid sequences of SEQ ID NOs: 481 to 551; [0327] i) amino
acid sequences that have 3, 2, or 1 amino acid difference with at
least one of the amino acid sequences of SEQ ID NOs: 481 to 551; or
any suitable fragment of such an amino acid sequence
[0328] In particular, such an amino acid sequence (or ISV) of the
invention may be such that CDR1 is chosen from the group consisting
of the amino acid sequences of SEQ ID NOs: 197 to 267; and CDR2 is
chosen from the group consisting of the amino acid sequences of SEQ
ID NOs: 339 to 409; and CDR3 is chosen from the group consisting of
the amino acid sequences of SEQ ID NOs: 481 to 551.
[0329] Again, preferred combinations of CDR sequences will become
clear from the further description herein.
[0330] Also, such amino acid sequences are preferably such that
they can specifically bind (as defined herein) to any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof; and more in
particular bind to any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof with an affinity (suitably measured and/or
expressed as a K.sub.D-value (actual or apparent), a K.sub.A-value
(actual or apparent), a k.sub.on-rate and/or a k.sub.off-rate, or
alternatively as an IC.sub.50 value, as further described herein)
that is as defined herein.
[0331] In one preferred, but non-limiting aspect, the invention
relates to an amino acid sequence (or ISV) that essentially
consists of 4 framework regions (FR1 to FR4, respectively) and 3
complementarity determining regions (CDR1 to CDR3, respectively),
in which the CDR sequences of said amino acid sequence have at
least 70% amino acid identity, preferably at least 80% amino acid
identity, more preferably at least 90% amino acid identity, such as
95% amino acid identity or more or even essentially 100% amino acid
identity with the CDR sequences of at least one of the amino acid
sequences of SEQ ID NOs: 623 to 693 (see Table A-1). This degree of
amino acid identity can for example be determined by determining
the degree of amino acid identity (in a manner described herein)
between said amino acid sequence and one or more of the sequences
of SEQ ID NOs: 623 to 693 (see Table A-1), in which the amino acid
residues that form the framework regions are disregarded. Such
amino acid sequences of the invention can be as further described
herein.
[0332] In such an amino acid sequence of the invention, the
framework sequences may be any suitable framework sequences, and
examples of suitable framework sequences will be clear to the
skilled person, for example on the basis the standard handbooks and
the further disclosure and prior art mentioned herein.
[0333] The framework sequences are preferably (a suitable
combination of) immunoglobulin framework sequences or framework
sequences that have been derived from immunoglobulin framework
sequences (for example, by humanization or camelization). For
example, the framework sequences may be framework sequences derived
from a light chain variable domain (e.g. a V.sub.L-sequence) and/or
from a heavy chain variable domain (e.g. a V.sub.H-sequence). In
one particularly preferred aspect, the framework sequences are
either framework sequences that have been derived from a
V.sub.HH-sequence (in which said framework sequences may optionally
have been partially or fully humanized) or are conventional V.sub.H
sequences that have been camelized (as defined herein).
[0334] The framework sequences are preferably such that the amino
acid sequence (or ISV) of the invention is a domain antibody (or an
amino acid sequence that is suitable for use as a domain antibody);
is a single domain antibody (or an amino acid sequence that is
suitable for use as a single domain antibody); is a "dAb" (or an
amino acid sequence that is suitable for use as a dAb); or is a
Nanobody (including but not limited to V.sub.HH sequence). Again,
suitable framework sequences will be clear to the skilled person,
for example on the basis the standard handbooks and the further
disclosure and prior art mentioned herein.
[0335] In particular, the framework sequences present in the amino
acid sequences of the invention may contain one or more of Hallmark
residues (as defined herein), such that the amino acid sequence of
the invention is a Nanobody. Some preferred, but non-limiting
examples of (suitable combinations of) such framework sequences
will become clear from the further disclosure herein.
[0336] Again, as generally described herein for the amino acid
sequences of the invention, it is also possible to use suitable
fragments (or combinations of fragments) of any of the foregoing,
such as fragments that contain one or more CDR sequences, suitably
flanked by and/or linked via one or more framework sequences (for
example, in the same order as these CDR's and framework sequences
may occur in the full-sized immunoglobulin sequence from which the
fragment has been derived). Such fragments may also again be such
that they comprise or can form an immunoglobulin fold, or
alternatively be such that they do not comprise or cannot form an
immunoglobulin fold.
[0337] In one specific aspect, such a fragment comprises a single
CDR sequence as described herein (and in particular a CDR3
sequence), that is flanked on each side by (part of) a framework
sequence (and in particular, part of the framework sequence(s)
that, in the immunoglobulin sequence from which the fragment is
derived, are adjacent to said CDR sequence. For example, a CDR3
sequence may be preceded by (part of) a FR3 sequence and followed
by (part of) a FR4 sequence). Such a fragment may also contain a
disulphide bridge, and in particular a disulphide bridge that links
the two framework regions that precede and follow the CDR sequence,
respectively (for the purpose of forming such a disulphide bridge,
cysteine residues that naturally occur in said framework regions
may be used, or alternatively cysteine residues may be
synthetically added to or introduced into said framework regions).
For a further description of these "Expedite fragments", reference
is again made to WO 03/050531, as well as WO2008/068280 (see also
PCT/EP2009/054533).
[0338] In another aspect, the invention relates to a compound or
construct, and in particular a protein or polypeptide (also
referred to herein as a "compound of the invention" or "polypeptide
of the invention", respectively) that comprises or essentially
consists of one or more amino acid sequences (or ISV's) of the
invention (or suitable fragments thereof), and optionally further
comprises one or more other groups, residues, moieties or binding
units. As will become clear to the skilled person from the further
disclosure herein, such further groups, residues, moieties, binding
units or amino acid sequences may or may not provide further
functionality to the amino acid sequence of the invention (and/or
to the compound or construct in which it is present) and may or may
not modify the properties of the amino acid sequence of the
invention.
[0339] For example, such further groups, residues, moieties or
binding units may be one or more additional amino acid sequences,
such that the compound or construct is a (fusion) protein or
(fusion) polypeptide. In a preferred but non-limiting aspect, said
one or more other groups, residues, moieties or binding units are
immunoglobulin sequences. Even more preferably, said one or more
other groups, residues, moieties or binding units are chosen from
the group consisting of domain antibodies, amino acid sequences
that are suitable for use as a domain antibody, single domain
antibodies, amino acid sequences that are suitable for use as a
single domain antibody, "dAb"'s, amino acid sequences that are
suitable for use as a dAb, or Nanobodies.
[0340] Alternatively, such groups, residues, moieties or binding
units may for example be chemical groups, residues, moieties, which
may or may not by themselves be biologically and/or
pharmacologically active. For example, and without limitation, such
groups may be linked to the one or more amino acid sequences of the
invention so as to provide a "derivative" of an amino acid sequence
or polypeptide of the invention, as further described herein.
[0341] Also within the scope of the present invention are compounds
or constructs, that comprises or essentially consists of one or
more derivatives as described herein, and optionally further
comprises one or more other groups, residues, moieties or binding
units, optionally linked via one or more linkers. Preferably, said
one or more other groups, residues, moieties or binding units are
amino acid sequences.
[0342] In the compounds or constructs described above, the one or
more amino acid sequences of the invention and the one or more
groups, residues, moieties or binding units may be linked directly
to each other and/or via one or more suitable linkers or spacers.
For example, when the one or more groups, residues, moieties or
binding units are amino acid sequences, the linkers may also be
amino acid sequences, so that the resulting compound or construct
is a fusion (protein) or fusion (polypeptide).
[0343] As will be clear from the further description above and
herein, this means that the amino acid sequences (or ISV's) of the
invention can be used as "building blocks" to form polypeptides of
the invention, i.e. by suitably combining them with each other, one
or more with other amino acid sequences of the invention and/or
with one or more other groups, residues, moieties or binding units,
in order to form compounds or constructs as described herein (such
as, without limitations, the biparatopic. bi/multivalent and
bi/multispecific polypeptides of the invention described herein)
which combine within one molecule one or more desired properties or
biological functions.
[0344] The compounds or polypeptides of the invention can generally
be prepared by a method which comprises at least one step of
suitably linking the one or more amino acid sequences (or ISV's) of
the invention to the one or more further groups, residues, moieties
or binding units, optionally via the one or more suitable linkers,
so as to provide the compound or polypeptide of the invention.
Polypeptides of the invention can also be prepared by a method
which generally comprises at least the steps of providing a nucleic
acid that encodes a polypeptide of the invention, expressing said
nucleic acid in a suitable manner, and recovering the expressed
polypeptide of the invention. Such methods can be performed in a
manner known per se, which will be clear to the skilled person, for
example on the basis of the methods and techniques further
described herein.
[0345] The process of designing/selecting and/or preparing a
compound or polypeptide of the invention, starting from an amino
acid sequence (or ISV) of the invention, is also referred to herein
as "formatting" said amino acid sequence of the invention; and an
amino acid of the invention that is made part of a compound or
polypeptide of the invention is said to be "formatted" or to be "in
the format of" said compound or polypeptide of the invention.
Examples of ways in which an amino acid sequence of the invention
can be formatted and examples of such formats will be clear to the
skilled person based on the disclosure herein; and such formatted
amino acid sequences form a further aspect of the invention.
[0346] In one specific aspect of the invention, a compound of the
invention or a polypeptide of the invention may have an increased
half-life, compared to the corresponding amino acid sequence of the
invention. Some preferred, but non-limiting examples of such
compounds and polypeptides will become clear to the skilled person
based on the further disclosure herein, and for example comprise
amino acid sequences or polypeptides of the invention that have
been chemically modified to increase the half-life thereof (for
example, by means of pegylation); amino acid sequences of the
invention that comprise at least one additional binding site for
binding to a serum protein (such as serum albumin); or polypeptides
of the invention that comprise at least one amino acid sequence of
the invention that is linked to at least one moiety (and in
particular at least one amino acid sequence) that increases the
half-life of the amino acid sequence of the invention. Examples of
polypeptides of the invention that comprise such half-life
extending moieties or amino acid sequences will become clear to the
skilled person based on the further disclosure herein; and for
example include, without limitation, polypeptides in which the one
or more amino acid sequences of the invention are suitable linked
to one or more serum proteins or fragments thereof (such as (human)
serum albumin or suitable fragments thereof) or to one or more
binding units that can bind to serum proteins (such as, for
example, domain antibodies, amino acid sequences that are suitable
for use as a domain antibody, single domain antibodies, amino acid
sequences that are suitable for use as a single domain antibody,
"dAb"'s, amino acid sequences that are suitable for use as a dAb,
or Nanobodies that can bind to serum proteins such as serum albumin
(such as human serum albumin), serum immunoglobulins such as IgG,
or transferrine; reference is made to the further description and
references mentioned herein); polypeptides in which an amino acid
sequence of the invention is linked to an Fc portion (such as a
human Fc) or a suitable part or fragment thereof; or polypeptides
in which the one or more amino acid sequences of the invention are
suitable linked to one or more small proteins or peptides that can
bind to serum proteins.
[0347] For example, a compound of the invention or a polypeptide of
the invention may comprise one or more amino acid sequences of the
invention (which may be as further described herein; and when two
or more amino acid sequences of the invention are present, they may
be the same or different) and one or more (usually only one, which
may be a tandem repeat in case of a serum-albumin binding peptide)
serum albumin binding peptides or serum albumin binding domains
(and optionally one or more other groups, residues, moieties or
binding units as further described herein). In such compounds or
polypeptides of the invention, the "serum albumin binding peptide
or binding domain" may be any suitable serum-albumin binding
peptide or binding domain capable of increasing the half-life of
the construct (compared to the same construct without the
serum-albumin binding peptide or binding domain), and may in
particular be serum albumin binding peptides as described in WO
2008/068280 by applicant (and in particular WO 2009/127691 and the
non-prepublished U.S. application 61/301,819, both by applicant),
or a serum-albumin binding immunoglobulin single variable domain
(such as a serum-albumin binding Nanobody; for example Alb-1 or a
humanized version of Alb-1 such as Alb-8, for which reference is
for example made to WO 06/122787). Also Alb11 can be used. In one
embodiment Alb11 has the amino acid sequence SEQ ID NO 841 or SEQ
ID NO 842.
[0348] With respect to half-life, it should be noted that in the
invention, and by using the various half-life extending techniques
described herein (for example, by suitably choosing a serum-albumin
binding peptide according to WO 2008/068280, WO 2009/127691 and/or
the non-prepublished U.S. application 61/301,819), the half-life of
a construct or polypeptide of the invention can (and preferably is)
suitably "tailored" for the intended (therapeutic and/or
diagnostic) application and/or to obtain the best balance between
the desired therapeutic and/or pharmacological effect and possible
undesired side-effects.
[0349] Generally, the compounds or polypeptides of the invention
with increased half-life preferably have a half-life that is at
least 1.5 times, preferably at least 2 times, such as at least 5
times, for example at least 10 times or more than 20 times, greater
than the half-life of the corresponding amino acid sequence of the
invention per se. For example, the compounds or polypeptides of the
invention with increased half-life may have a half-life that is
increased with more than 1 hours, preferably more than 2 hours,
more preferably more than 6 hours, such as more than 12 hours, or
even more than 24, 48 or 72 hours, compared to the corresponding
amino acid sequence of the invention per se.
[0350] In a preferred, but non-limiting aspect of the invention,
such compounds or polypeptides of the invention have a serum
half-life that is increased with more than 1 hours, preferably more
than 2 hours, more preferably more than 6 hours, such as more than
12 hours, or even more than 24, 48 or 72 hours, compared to the
corresponding amino acid sequence of the invention per se.
[0351] In another preferred, but non-limiting aspect of the
invention, such compounds or polypeptides of the invention exhibit
a serum half-life in human of at least about 12 hours, preferably
at least 24 hours, more preferably at least 48 hours, even more
preferably at least 72 hours or more. For example, compounds or
polypeptides of the invention may have a half-life of at least 5
days (such as about 5 to 10 days), preferably at least 9 days (such
as about 9 to 14 days), more preferably at least about 10 days
(such as about 10 to 15 days), or at least about 11 days (such as
about 11 to 16 days), more preferably at least about 12 days (such
as about 12 to 18 days or more), or more than 14 days (such as
about 14 to 19 days).
[0352] FIG. 6 and SEQ ID NOs: 710 to 759 as well as FIG. 8 and SEQ
ID NOs: 826 to 837 give some preferred, but non-limiting examples
of polypeptides of the invention, and each of these forms a further
aspect of the present invention. All of these polypeptides contain
an albumin-binding Nanobody (Alb-8, which is also referred to
herein as Alb-11) according to WO 06/122787 in order to provide
increase half-life. The polypeptides from FIG. 8 and SEQ ID NOs:
826 to 837 are based on humanized and/or sequenced-optimized amino
acid sequences of the invention as building blocks. Based on the
further disclosure herein, the skilled person will be able to
provide other compounds, constructs and/or polypeptides of the
invention, based on the same or other building blocks described
herein, and/or comprising another moiety, binding domain, binding
unit or peptide for providing increased half-life.
[0353] In another aspect, the invention relates to a nucleic acid
that encodes an amino acid sequence (or ISV) of the invention or a
polypeptide of the invention (or a suitable fragment thereof). Such
a nucleic acid will also be referred to herein as a "nucleic acid
of the invention" and may for example be in the form of a genetic
construct, as further described herein. In a further preferred
aspect, the amino acid of the invention (or ISV) is considered a
building block.
[0354] In another aspect, the invention relates to a host or host
cell that expresses (or that under suitable circumstances is
capable of expressing) an amino acid sequence of the invention
and/or a polypeptide of the invention; and/or that contains a
nucleic acid of the invention. Some preferred but non-limiting
examples of such hosts or host cells will become clear from the
further description herein.
[0355] The invention further relates to a product or composition
containing or comprising at least one amino acid sequence (or ISV)
of the invention, at least one polypeptide of the invention (or a
suitable fragment thereof) and/or at least one nucleic acid of the
invention, and optionally one or more further components of such
compositions known per se, i.e. depending on the intended use of
the composition. Such a product or composition may for example be a
pharmaceutical composition (as described herein), a veterinary
composition or a product or composition for diagnostic use (as also
described herein). Some preferred but non-limiting examples of such
products or compositions will become clear from the further
description herein.
[0356] The invention also relates to the use of an amino acid
sequence (or ISV), Nanobody or polypeptide of the invention, or of
a composition comprising the same, in (methods or compositions for)
modulating any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof, either in vitro (e.g. in an in vitro or
cellular assay) or in vivo (e.g. in an a single cell or in a
multicellular organism, and in particular in a mammal, and more in
particular in a human being, such as in a human being that is at
risk of or suffers from immune related diseases and disorders of
the invention).
[0357] The invention also relates to methods for modulating IL-17A,
IL-17F and/or IL-17A/F including combinations thereof, either in
vitro (e.g. in an in vitro or cellular assay) or in vivo (e.g. in
an a single cell or multicellular organism, and in particular in a
mammal, and more in particular in a human being, such as in a human
being that is at risk of or suffers from a immune related diseases
and disorders of the invention), which method comprises at least
the step of contacting IL-17A, IL-17F and/or IL-17A/F including
combinations thereof with at least one amino acid sequence (or
ISV), Nanobody or polypeptide of the invention, or with a
composition comprising the same, in a manner and in an amount
suitable to modulate IL-17A, IL-17F and/or IL-17A/F including
combinations thereof, with at least one amino acid sequence (or
ISV), Nanobody or polypeptide of the invention.
[0358] The invention also relates to the use of an one amino acid
sequence (or ISV), Nanobody or polypeptide of the invention in the
preparation of a composition (such as, without limitation, a
pharmaceutical composition or preparation as further described
herein) for modulating IL-17A, IL-17F and/or IL-17A/F including
combinations thereof, either in vitro (e.g. in an in vitro or
cellular assay) or in vivo (e.g. in an a single cell or
multicellular organism, and in particular in a mammal, and more in
particular in a human being, such as in a human being that is at
risk of or suffers from the immune related diseases and disorders
of the invention).
[0359] In the context of the present invention, "modulating" or "to
modulate" generally means either reducing or inhibiting the
activity of, or alternatively increasing the activity of, IL-17A,
IL-17F and/or IL-17A/F including combinations thereof, as measured
using a suitable in vitro, cellular or in vivo assay (such as those
mentioned herein). In particular, "modulating" or "to modulate" may
mean either reducing or inhibiting the activity of, or
alternatively increasing the activity of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof, as measured using a
suitable in vitro, cellular or in vivo assay (such as those
mentioned herein), by at least 1%, preferably at least 5%, such as
at least 10% or at least 25%, for example by at least 50%, at least
60%, at least 70%, at least 80%, or 90% or more, compared to
activity of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof in the same assay under the same conditions but without the
presence of the amino acid sequence, Nanobody or polypeptide of the
invention.
[0360] As will be clear to the skilled person, "modulating" may
also involve effecting a change (which may either be an increase or
a descrease) in affinity, avidity, specificity and/or selectivity
of any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof for one or more of its targets, ligands or substrates;
and/or effecting a change (which may either be an increase or a
decrease) in the sensitivity of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof for one or more conditions in the
medium or surroundings in which IL-17A, IL-17F and/or IL-17A/F
including combinations thereof is present (such as pH, ion
strength, the presence of co-factors, etc.), compared to the same
conditions but without the presence of the amino acid sequence (or
ISV), Nanobody or polypeptide of the invention. As will be clear to
the skilled person, this may again be determined in any suitable
manner and/or using any suitable assay known per se, such as the
assays described herein or in the prior art cited herein.
[0361] "Modulating" may also mean effecting a change (i.e. an
activity as an agonist or as an antagonist, respectively) with
respect to one or more biological or physiological mechanisms,
effects, responses, functions, pathways or activities in which
IL-17A, IL-17F and/or IL-17A/F including combinations thereof (or
in which its substrate(s), ligand(s) or pathway(s) are involved,
such as its signalling pathway or metabolic pathway and their
associated biological or physiological effects) is involved. Again,
as will be clear to the skilled person, such an action as an
agonist or an antagonist may be determined in any suitable manner
and/or using any suitable (in vitro and usually cellular or in
assay) assay known per se, such as the assays described herein or
in the prior art cited herein. In particular, an action as an
agonist or antagonist may be such that an intended biological or
physiological activity is increased or decreased, respectively, by
at least 1%, preferably at least 5%, such as at least 10% or at
least 25%, for example by at least 50%, at least 60%, at least 70%,
at least 80%, or 90% or more, compared to the biological or
physiological activity in the same assay under the same conditions
but without the presence of the amino acid sequence (or ISV),
Nanobody or polypeptide of the invention.
[0362] Modulating may for example involve reducing or inhibiting
the binding of any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof to one of its substrates or ligands and/or
competing with a natural ligand, substrate for binding to any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof.
Modulating may also involve activating any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof or the mechanism or pathway
in which it is involved. Modulating may be reversible or
irreversible, but for pharmaceutical and pharmacological purposes
will usually be in a reversible manner.
[0363] The invention further relates to methods for preparing or
generating the amino acid sequences (or ISV), polypeptides, nucleic
acids, host cells, products and compositions described herein. Some
preferred but non-limiting examples of such methods will become
clear from the further description herein.
[0364] Generally, these methods may comprise the steps of: [0365]
a) providing a set, collection or library of amino acid sequences;
and [0366] b) screening said set, collection or library of amino
acid sequences for amino acid sequences that can bind to and/or
have affinity for any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof; and [0367] c) isolating the amino acid
sequence(s) that can bind to and/or have affinity for any of
IL-17A, 1L-17F and/or IL-17A/F including combinations thereof.
[0368] In such a method, the set, collection or library of amino
acid sequences may be any suitable set, collection or library of
amino acid sequences. For example, the set, collection or library
of amino acid sequences may be a set, collection or library of
immunoglobulin sequences (as described herein), such as a naive
set, collection or library of immunoglobulin sequences; a synthetic
or semi-synthetic set, collection or library of immunoglobulin
sequences; and/or a set, collection or library of immunoglobulin
sequences that have been subjected to affinity maturation.
[0369] Also, in such a method, the set, collection or library of
amino acid sequences may be a set, collection or library of heavy
chain variable domains (such as V.sub.H domains or V.sub.HH
domains) or of light chain variable domains. For example, the set,
collection or library of amino acid sequences may be a set,
collection or library of domain antibodies or single domain
antibodies or ISVs, or may be a set, collection or library of amino
acid sequences that are capable of functioning as a domain antibody
or single domain antibody or ISV.
[0370] In a preferred aspect of this method, the set, collection or
library of amino acid sequences may be an immune set, collection or
library of immunoglobulin sequences, for example derived from a
mammal that has been suitably immunized with any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof or with a suitable
antigenic determinant based thereon or derived therefrom, such as
an antigenic part, fragment, region, domain, loop or other epitope
thereof. In one particular aspect, said antigenic determinant may
be an extracellular part, region, domain, loop or other
extracellular epitope(s).
[0371] In the above methods, the set, collection or library of
amino acid sequences may be displayed on a phage, phagemid,
ribosome or suitable micro-organism (such as yeast), such as to
facilitate screening. Suitable methods, techniques and host
organisms for displaying and screening (a set, collection or
library of) amino acid sequences will be clear to the person
skilled in the art, for example on the basis of the further
disclosure herein. Reference is also made to the review by
Hoogenboom in Nature Biotechnology, 23, 9, 1105-1116 (2005).
[0372] In another aspect, the method for generating amino acid
sequences comprises at least the steps of: [0373] a) providing a
collection or sample of cells expressing amino acid sequences;
[0374] b) screening said collection or sample of cells for cells
that express an amino acid sequence that can bind to and/or have
affinity for any of 1L-17A, IL-17F and/or IL-17A/F including
combinations thereof; and [0375] c) either (i) isolating said amino
acid sequence; or (ii) isolating from said cell a nucleic acid
sequence that encodes said amino acid sequence, followed by
expressing said amino acid sequence.
[0376] For example, when the desired amino acid sequence is an
immunoglobulin sequence, the collection or sample of cells may for
example be a collection or sample of B-cells. Also, in this method,
the sample of cells may be derived from a mammal that has been
suitably immunized with any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof or with a suitable antigenic
determinant based thereon or derived therefrom, such as an
antigenic part, fragment, region, domain, loop or other epitope
thereof. In one particular aspect, said antigenic determinant may
be an extracellular part, region, domain, loop or other
extracellular epitope(s).
[0377] The above method may be performed in any suitable manner, as
will be clear to the skilled person. Reference is for example made
to EP 0 542 810, WO 05/19824, WO 04/051268 and WO 04/106377. The
screening of step b) is preferably performed using a flow cytometry
technique such as FACS. For this, reference is for example made to
Lieby et al., Blood, Vol. 97, No. 12, 3820 (2001).
[0378] In another aspect, the method for generating an amino acid
sequence directed against any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof may comprise at least the steps of:
[0379] a) providing a set, collection or library of nucleic acid
sequences encoding amino acid sequences; [0380] b) screening said
set, collection or library of nucleic acid sequences for nucleic
acid sequences that encode an amino acid sequence that can bind to
and/or has affinity for any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof; and [0381] c) isolating said
nucleic acid sequence, followed by expressing said amino acid
sequence.
[0382] In such a method, the set, collection or library of nucleic
acid sequences encoding amino acid sequences may for example be a
set, collection or library of nucleic acid sequences encoding a
naive set, collection or library of immunoglobulin sequences; a
set, collection or library of nucleic acid sequences encoding a
synthetic or semi-synthetic set, collection or library of
immunoglobulin sequences; and/or a set, collection or library of
nucleic acid sequences encoding a set, collection or library of
immunoglobulin sequences that have been subjected to affinity
maturation.
[0383] Also, in such a method, the set, collection or library of
nucleic acid sequences may encode a set, collection or library of
heavy chain variable domains (such as V.sub.H domains or V.sub.HH
domains) or of light chain variable domains. For example, the set,
collection or library of nucleic acid sequences may encode a set,
collection or library of domain antibodies or single domain
antibodies, or a set, collection or library of amino acid sequences
that are capable of functioning as a domain antibody or single
domain antibody.
[0384] In a preferred aspect of this method, the set, collection or
library of nucleic acid sequences may be an immune set, collection
or library of nucleic acid sequences, for example derived from a
mammal that has been suitably immunized with any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof or with a suitable
antigenic determinant based thereon or derived therefrom, such as
an antigenic part, fragment, region, domain, loop or other epitope
thereof. In one particular aspect, said antigenic determinant may
be an extracellular part, region, domain, loop or other
extracellular epitope(s).
[0385] The set, collection or library of nucleic acid sequences may
for example encode an immune set, collection or library of heavy
chain variable domains or of light chain variable domains. In one
specific aspect, the set, collection or library of nucleotide
sequences may encode a set, collection or library of V.sub.HH
sequences.
[0386] In the above methods, the set, collection or library of
nucleotide sequences may be displayed on a phage, phagemid,
ribosome or suitable micro-organism (such as yeast), such as to
facilitate screening. Suitable methods, techniques and host
organisms for displaying and screening (a set, collection or
library of) nucleotide sequences encoding amino acid sequences will
be clear to the person skilled in the art, for example on the basis
of the further disclosure herein. Reference is also made to the
review by Hoogenboom in Nature Biotechnology, 23, 9, 1105-1116
(2005).
[0387] In another aspect, the method for generating an amino acid
sequence directed against any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof may comprise at least the steps of:
[0388] a) providing a set, collection or library of nucleic acid
sequences encoding amino acid sequences; [0389] b) screening said
set, collection or library of nucleic acid sequences for nucleic
acid sequences that encode an amino acid sequence that can bind to
and/or has affinity for any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof and that is cross-blocked or is
cross blocking a Nanobody of the invention, e.g. SEQ ID NO: 623 to
693 (Table A-1), or a humanized Nanobody of the invention, or a
polypeptide or construct of the invention; and [0390] c) isolating
said nucleic acid sequence, followed by expressing said amino acid
sequence.
[0391] The invention also relates to amino acid sequences that are
obtained by the above methods, or alternatively by a method that
comprises one of the above methods and in addition at least the
steps of determining the nucleotide sequence or amino acid sequence
of said immunoglobulin sequence; and of expressing or synthesizing
said amino acid sequence in a manner known per se, such as by
expression in a suitable host cell or host organism or by chemical
synthesis.
[0392] Also, following the steps above, one or more amino acid
sequences of the invention may be suitably humanized (or
alternatively camelized); and/or the amino acid sequence(s) thus
obtained may be linked to each other or to one or more other
suitable amino acid sequences (optionally via one or more suitable
linkers) so as to provide a polypeptide of the invention. Also, a
nucleic acid sequence encoding an amino acid sequence of the
invention may be suitably humanized (or alternatively camelized)
and suitably expressed; and/or one or more nucleic acid sequences
encoding an amino acid sequence of the invention may be linked to
each other or to one or more nucleic acid sequences that encode
other suitable amino acid sequences (optionally via nucleotide
sequences that encode one or more suitable linkers), after which
the nucleotide sequence thus obtained may be suitably expressed so
as to provide a polypeptide of the invention.
[0393] The invention further relates to applications and uses of
the amino acid sequences, compounds, constructs, polypeptides,
nucleic acids, host cells, products and compositions described
herein, as well as to methods for the prevention and/or treatment
for diseases and disorders associated with any of IL-17A, 1L-17F
and/or IL-17A/F including combinations thereof. Some preferred but
non-limiting applications and uses will become clear from the
further description herein.
[0394] The invention also relates to the amino acid sequences,
compounds, constructs, polypeptides, nucleic acids, host cells,
products and compositions described herein for use in therapy.
[0395] In particular, the invention also relates to the amino acid
sequences, compounds, constructs, polypeptides, nucleic acids, host
cells, products and compositions described herein for use in
therapy of a disease or disorder that can be prevented or treated
by administering, to a subject in need thereof, of (a
pharmaceutically effective amount of) an amino acid sequence,
compound, construct or polypeptide as described herein.
[0396] More in particular, the invention relates to the amino acid
sequences, compounds, constructs, polypeptides, nucleic acids, host
cells, products and compositions described herein for use in
therapy of immune related diseases and disorders of the
invention.
[0397] Other aspects, embodiments, advantages and applications of
the invention will also become clear from the further description
herein, in which the invention will be described and discussed in
more detail with reference to the Nanobodies of the invention and
polypeptides of the invention comprising the same, which form some
of the preferred aspects of the invention.
[0398] As will become clear from the further description herein,
Nanobodies generally offer certain advantages (outlined herein)
compared to "dAb's" or similar (single) domain antibodies or
immunoglobulin sequences, which advantages are also provided by the
Nanobodies of the invention. However, it will be clear to the
skilled person that the more general aspects of the teaching below
can also be applied (either directly or analogously) to other amino
acid sequences of the invention.
DETAILED DESCIPTION OF THE INVENTION
[0399] In the present description, examples and claims: [0400] a)
Unless indicated or defined otherwise, all terms used have their
usual meaning in the art, which will be clear to the skilled
person. Reference is for example made to the standard handbooks
mentioned in paragraph a) on page 46 of WO 08/020079. [0401] b)
Unless indicated otherwise, the terms "immunoglobulin sequence",
"sequence", "nucleotide sequence" and "nucleic acid" are as
described in paragraph b) on page 46 of WO 08/020079. [0402] c)
Unless indicated otherwise, all methods, steps, techniques and
manipulations that are not specifically described in detail can be
performed and have been performed in a manner known per se, as will
be clear to the skilled person. Reference is for example again made
to the standard handbooks and the general background art mentioned
herein and to the further references cited therein; as well as to
for example the following reviews Presta, Adv. Drug Deliv. Rev.
2006, 58 (5-6): 640-56; Levin and Weiss, Mol. Biosyst. 2006, 2(1):
49-57; Irving et al., J. Immunol. Methods, 2001, 248(1-2), 31-45;
Schmitz et al., Placenta, 2000, 21 Suppl. A, S106-12, Gonzales et
al., Tumour Biol., 2005, 26(1), 31-43, which describe techniques
for protein engineering, such as affinity maturation and other
techniques for improving the specificity and other desired
properties of proteins such as immunoglobulins. [0403] d) Amino
acid residues will be indicated according to the standard
three-letter or one-letter amino acid code. Reference is made to
Table A-2 on page 48 of the International application WO 08/020079
of Ablynx N.V. entitled "Amino acid sequences directed against
IL-6R and polypeptides comprising the same for the treatment of
diseases and disorders associated with Il-6 mediated signalling".
[0404] e) For the purposes of comparing two or more nucleotide
sequences, the percentage of "sequence identity" between a first
nucleotide sequence and a second nucleotide sequence may be
calculated or determined as described in paragraph e) on page 49 of
WO 08/020079 (incorporated herein by reference), such as by
dividing [the number of nucleotides in the first nucleotide
sequence that are identical to the nucleotides at the corresponding
positions in the second nucleotide sequence] by [the total number
of nucleotides in the first nucleotide sequence] and multiplying by
[100%], in which each deletion, insertion, substitution or addition
of a nucleotide in the second nucleotide sequence--compared to the
first nucleotide sequence--is considered as a difference at a
single nucleotide (position); or using a suitable computer
algorithm or technique, again as described in paragraph e) on pages
49 of WO 08/020079 (incorporated herein by reference). [0405] f)
For the purposes of comparing two or more amino acid sequences, the
percentage of "sequence identity" between a first amino acid
sequence and a second amino acid sequence (also referred to herein
as "amino acid identity") may be calculated or determined as
described in paragraph f) on pages 49 and 50 of WO 08/020079
(incorporated herein by reference), such as by dividing [the number
of amino acid residues in the first amino acid sequence that are
identical to the amino acid residues at the corresponding positions
in the second amino acid sequence] by [the total number of amino
acid residues in the first amino acid sequence] and multiplying by
[100%], in which each deletion, insertion, substitution or addition
of an amino acid residue in the second amino acid
sequence--compared to the first amino acid sequence--is considered
as a difference at a single amino acid residue (position), i.e. as
an "amino acid difference" as defined herein; or using a suitable
computer algorithm or technique, again as described in paragraph f)
on pages 49 and 50 of WO 08/020079 (incorporated herein by
reference).
[0406] Also, in determining the degree of sequence identity between
two amino acid sequences, the skilled person may take into account
so-called "conservative" amino acid substitutions, as described on
page 50 of WO 08/020079.
[0407] Any amino acid substitutions applied to the polypeptides
described herein may also be based on the analysis of the
frequencies of amino acid variations between homologous proteins of
different species developed by Schulz et al., Principles of Protein
Structure, Springer-Verlag, 1978, on the analyses of structure
forming potentials developed by Chou and Fasman, Biochemistry 13:
211, 1974 and Adv. Enzymol., 47: 45-149, 1978, and on the analysis
of hydrophobicity patterns in proteins developed by Eisenberg et
al., Proc. Nad. Acad Sci. USA 81: 140-144, 1984; Kyte &
Doolittle; J Molec. Biol. 157: 105-132, 198 1, and Goldman et al.,
Ann. Rev. Biophys. Chem. 15: 321-353, 1986, all incorporated herein
in their entirety by reference. Information on the primary,
secondary and tertiary structure of Nanobodies is given in the
description herein and in the general background art cited above.
Also, for this purpose, the crystal structure of a V.sub.HH domain
from a llama is for example given by Desmyter et al., Nature
Structural Biology, Vol. 3, 9, 803 (1996); Spinelli et al., Natural
Structural Biology (1996); 3, 752-757; and Decanniere et al.,
Structure, Vol. 7, 4, 361 (1999). Further information about some of
the amino acid residues that in conventional V.sub.H domains form
the V.sub.H/V.sub.L interface and potential camelizing
substitutions on these positions can be found in the prior art
cited above. [0408] g) Amino acid sequences and nucleic acid
sequences are said to be "exactly the same" if they have 100%
sequence identity (as defined herein) over their entire length.
[0409] h) When comparing two amino acid sequences, the term "amino
acid difference" refers to an insertion, deletion or substitution
of a single amino acid residue on a position of the first sequence,
compared to the second sequence; it being understood that two amino
acid sequences can contain one, two or more such amino acid
differences. [0410] i) When a nucleotide sequence or amino acid
sequence is said to "comprise" another nucleotide sequence or amino
acid sequence, respectively, or to "essentially consist of" another
nucleotide sequence or amino acid sequence, this has the meaning
given in paragraph i) on pages 51-52 of WO 08/020079. [0411] j) The
term "in essentially isolated form" has the meaning given to it in
paragraph j) on pages 52 and 53 of WO 08/020079. [0412] k) The
terms "domain" and "binding domain" have the meanings given to it
in paragraph k) on page 53 of WO 08/020079. [0413] l) The terms
"antigenic determinant" and "epitope", which may also be used
interchangeably herein, have the meanings given to it in paragraph
1) on page 53 of WO 08/020079. An epitope in the context of the
present invention includes any peptide or peptide-derivative
determinant capable of specific binding to an amino acid sequence
of the invention. An epitope may comprise any suitable number of
amino acids, in any suitable position (with respect to the linear
sequence of IL17A and/or ILI 7F and/or IL17A/F), orientation (with
respect to folded IL17A and/or IL17F and/or IL17A/F), or a fragment
thereof, amino acid composition (and consequently, at least in
part, charge). Thus, for example, an epitope may be composed of
about 3-10 amino acids, typically 3-8 amino acids, in one or more
contiguous or noncontiguous locations with respect to the primary
sequence of IL17A and/or IL17F and/or IL17A/F (for instance an
epitope may consist essentially of 2, 3, 4, 5, 6, 7, or 8 amino
acid residues distributed in 1, 2, 3, 4, or 5 noncontiguous
locations in CD38). Alternatively, for example, an epitope may be
considered to be defined by a region of about 5-40 contiguous amino
acid residues (e.g., about 7-30 amino acid residues, about 5-20
amino acid residues, or about 3-15 amino acid residues) in IL17A
and/or IL17F and/or IL17A/F (solely or in combination with a
portion of an adjacent CD38 domain). In some epitopes it may be the
case that just one amino acid residue or only a few amino acid
residues are critical to CDR or CDR(s) recognition (and thereby
most important to binding to IL17A and/or IL17F and/or IL17A/F, for
antigen affinity and avidity). As such, an epitope may be
characterized on the basis of one or more of such critical
residues, with the recognition that other residues may also make
some lesser contribution to the epitope. In the case of an epitope
defined by a region of amino acids, it may be that one or more
amino acids in the region make only a minor contribution or even
negligible contribution to antibody binding, such that the residue
may be subject to substitution with an appropriate different
residue without resulting in "a loss" of the epitope to at least
some amino acid sequences of the invention specific for it. [0414]
m) As further described in paragraph m) on page 53 of WO 08/020079,
an amino acid sequence (such as a Nanobody, an antibody, a
polypeptide of the invention, or generally an antigen binding
protein or polypeptide or a fragment thereof) that can
(specifically) bind to, that has affinity for and/or that has
specificity for a specific antigenic determinant, epitope, antigen
or protein (or for at least one part, fragment or epitope thereof)
is said to be "against" or "directed against" said antigenic
determinant, epitope, antigen or protein. [0415] n) The term
"specificity" has the meaning given to it in paragraph n) on pages
53-56 of WO 08/020079; and as mentioned therein refers to the
number of different types of antigens or antigenic determinants to
which a particular antigen-binding molecule or antigen-binding
protein (such as a Nanobody or a polypeptide of the invention)
molecule can bind. Such binding properties in the context of the
amino acid sequences of the present invention is sometimes referred
to as "binding specifically" throughout the present document.
Wherever the term "binding specifically" occurs in the present
document it denotes binding properties of an amino acid sequence of
the present invention which binding to a target exhibits such
specifity as explained in this paragraph. The specificity of an
antigen-binding protein can be determined based on affinity and/or
avidity, as described on pages 53-56 of WO 08/020079 (incorporated
herein by reference), which also describes some preferred
techniques for measuring binding between an antigen-binding
molecule (such as a Nanobody or polypeptide of the invention) and
the pertinent antigen. Typically, antigen-binding proteins (such as
the amino acid sequences, Nanobodies and/or polypeptides of the
invention) will bind to their antigen with a dissociation constant
(K.sub.D) of 10.sup.-5 to 10.sup.-12 moles/liter or less, and
preferably 10.sup.-7 to 10.sup.-12 moles/liter or less and more
preferably 10.sup.-8 to 10.sup.-12 moles/liter (i.e. with an
association constant (K.sub.A) of 10.sup.5 to 10.sup.12 liter/moles
or more, and preferably 10.sup.7 to 10.sup.12 liter/moles or more
and more preferably 10.sup.8 to 10.sup.12 liter/moles). Any K.sub.D
value greater than 10.sup.4 mol/liter (or any K.sub.A value lower
than 10.sup.4 M.sup.-1) liters/mol is generally considered to
indicate non-specific binding. Preferably, a monovalent
immunoglobulin sequence of the invention will bind to the desired
antigen with an affinity less than 500 nM, preferably less than 200
nM, more preferably less than 10 nM, such as less than 500 pM.
Specific binding of an antigen-binding protein to an antigen or
antigenic determinant can be determined in any suitable manner
known per se, including, for example, Scatchard analysis and/or
competitive binding assays, such as radioimmunoassays (RIA), enzyme
immunoassays (EIA) and sandwich competition assays, and the
different variants thereof known per se in the art; as well as the
other techniques mentioned herein. As will be clear to the skilled
person, and as described on pages 53-56 of WO 08/020079, the
dissociation constant may be the actual or apparent dissociation
constant. Methods for determining the dissociation constant will be
clear to the skilled person, and for example include the techniques
mentioned on pages 53-56 of WO 08/020079. [0416] o) The half-life
of an amino acid sequence, compound or polypeptide of the invention
can generally be defined as described in paragraph o) on page 57 of
WO 08/020079 and as mentioned therein refers to the time taken for
the serum concentration of the amino acid sequence, compound or
polypeptide to be reduced by 50%, in vivo, for example due to
degradation of the sequence or compound and/or clearance or
sequestration of the sequence or compound by natural mechanisms.
The in vivo half-life of an amino acid sequence, compound or
polypeptide of the invention can be determined in any manner known
per se, such as by pharmacokinetic analysis. Suitable techniques
will be clear to the person skilled in the art, and may for example
generally be as described in paragraph o) on page 57 of WO
08/020079. As also mentioned in paragraph o) on page 57 of WO
08/020079, the half-life can be expressed using parameters such as
the t1/2-alpha, t1/2-beta and the area under the curve (AUC).
Reference is for example made to the Experimental Part below, as
well as to the standard handbooks, such as Kenneth, A et al:
Chemical Stability of Pharmaceuticals: A Handbook for Pharmacists
and Peters et al, Pharmacokinete analysis: A Practical Approach
(1996). Reference is also made to "Pharmacokinetics", M Gibaldi
& D Perron, published by Marcel Dekker, 2nd Rev. edition
(1982). The terms "increase in half-life" or "increased half-life"
as also as defined in paragraph o) on page 57 of WO 08/020079 and
in particular refer to an increase in the t1/2-beta, either with or
without an increase in the t1/2-alpha and/or the AUC or both.
[0417] p) In the context of the present invention, "modulating" or
"to modulate" generally means either reducing or inhibiting the
activity of, or alternatively increasing the activity of, a target
or antigen, as measured using a suitable in vitro, cellular or in
vivo assay. In particular, "modulating" or "to modulate" may mean
either reducing or inhibiting the activity of, or alternatively
increasing a (relevant or intended) biological activity of, a
target or antigen, as measured using a suitable in vitro, cellular
or in vivo assay (which will usually depend on the target or
antigen involved), by at least 1%, preferably at least 5%, such as
at least 10% or at least 25%, for example by at least 50%, at least
60%, at least 70%, at least 80%, or 90% or more, compared to
activity of the target or antigen in the same assay under the same
conditions but without the presence of the construct of the
invention.
[0418] As will be clear to the skilled person, "modulating" may
also involve effecting a change (which may either be an increase or
a decrease) in affinity, avidity, specificity and/or selectivity of
a target or antigen for one or more of its ligands, binding
partners, partners for association into a homomultimeric or
heteromultimeric form, or substrates; and/or effecting a change
(which may either be an increase or a decrease) in the sensitivity
of the target or antigen for one or more conditions in the medium
or surroundings in which the target or antigen is present (such as
pH, ion strength, the presence of co-factors, etc.), compared to
the same conditions but without the presence of the construct of
the invention. As will be clear to the skilled person, this may
again be determined in any suitable manner and/or using any
suitable assay known per se, depending on the target or antigen
involved.
[0419] "Modulating" may also mean effecting a change (i.e. an
activity as an agonist, as an antagonist or as a reverse agonist,
respectively, depending on the target or antigen and the desired
biological or physiological effect) with respect to one or more
biological or physiological mechanisms, effects, responses,
functions, pathways or activities in which the target or antigen
(or in which its substrate(s), ligand(s) or pathway(s) are
involved, such as its signalling pathway or metabolic pathway and
their associated biological or physiological effects) is involved.
Again, as will be clear to the skilled person, such an action as an
agonist or an antagonist may be determined in any suitable manner
and/or using any suitable (in vitro and usually cellular or in
assay) assay known per se, depending on the target or antigen
involved. In particular, an action as an agonist or antagonist may
be such that an intended biological or physiological activity is
increased or decreased, respectively, by at least 1%, preferably at
least 5%, such as at least 10% or at least 25%, for example by at
least 50%, at least 60%, at least 70%, at least 80%, or 90% or
more, compared to the biological or physiological activity in the
same assay under the same conditions but without the presence of
the construct of the invention.
[0420] Modulating may for example also involve allosteric
modulation of the target or antigen; and/or reducing or inhibiting
the binding of the target or antigen to one of its substrates or
ligands and/or competing with a natural ligand, substrate for
binding to the target or antigen. Modulating may also involve
activating the target or antigen or the mechanism or pathway in
which it is involved. Modulating may for example also involve
effecting a change in respect of the folding or confirmation of the
target or antigen, or in respect of the ability of the target or
antigen to fold, to change its confirmation (for example, upon
binding of a ligand), to associate with other (sub)units, or to
disassociate. Modulating may for example also involve effecting a
change in the ability of the target or antigen to transport other
compounds or to serve as a channel for other compounds (such as
ions).
[0421] Modulating may be reversible or irreversible, but for
pharmaceutical and pharmacological purposes will usually be in a
reversible manner. [0422] q) In respect of a target or antigen, the
term "interaction site" on the target or antigen means a site,
epitope, antigenic determinant, part, domain or stretch of amino
acid residues on the target or antigen that is a site for binding
to a ligand, receptor or other binding partner, a catalytic site, a
cleavage site, a site for allosteric interaction, a site involved
in multimerisation (such as homomerization or heterodimerization)
of the target or antigen; or any other site, epitope, antigenic
determinant, part, domain or stretch of amino acid residues on the
target or antigen that is involved in a biological action or
mechanism of the target or antigen. More generally, an "interaction
site" can be any site, epitope, antigenic determinant, part, domain
or stretch of amino acid residues on the target or antigen to which
an amino acid sequence or polypeptide of the invention can bind
such that the target or antigen (and/or any pathway, interaction,
signalling, biological mechanism or biological effect in which the
target or antigen is involved) is modulated (as defined herein).
[0423] r) An amino acid sequence or polypeptide is said to be
"specific for" a first target or antigen compared to a second
target or antigen when is binds to the first antigen with an
affinity (as described above, and suitably expressed as a K.sub.D
value, K.sub.A value, K.sub.off rate and/or K.sub.on rate) that is
at least 10 times, such as at least 100 times, and preferably at
least 1000 times, and up to 10,000 times or more better than the
affinity with which said amino acid sequence or polypeptide binds
to the second target or polypeptide. For example, the first antigen
may bind to the target or antigen with a K.sub.D value that is at
least 10 times less, such as at least 100 times less, and
preferably at least 1000 times less, such as 10,000 times less or
even less than that, than the K.sub.D with which said amino acid
sequence or polypeptide binds to the second target or polypeptide.
Preferably, when an amino acid sequence or polypeptide is "specific
for" a first target or antigen compared to a second target or
antigen, it is directed against (as defined herein) said first
target or antigen, but not directed against said second target or
antigen. [0424] s) The terms "cross-block", "cross-blocked" and
"cross-blocking" are used interchangeably herein to mean the
ability of an amino acid sequence or other binding agents (such as
a Nanobody, polypeptide or compound or construct of the invention)
to interfere with the binding of other amino acid sequences or
binding agents of the invention to a given target. The extend to
which an amino acid sequence or other binding agents of the
invention is able to interfere with the binding of another to the
target, and therefore whether it can be said to cross-block
according to the invention, can be determined using competition
binding assays. One particularly suitable quantitative
cross-blocking assay uses a Biacore machine which can measure the
extent of interactions using surface plasmon resonance technology.
Another suitable quantitative cross-blocking assay uses an
ELISA-based approach to measure competition between amino acid
sequences or other binding agents in terms of their binding to the
target.
[0425] The following generally describes a suitable Biacore assay
for determining whether an amino acid sequence or other binding
agent cross-blocks or is capable of cross-blocking according to the
invention. It will be appreciated that the assay can be used with
any of the amino acid sequences or other binding agents described
herein. The Biacore machine (for example the Biacore 3000) is
operated in line with the manufacturer's recommendations. Thus in
one cross-blocking assay, the target protein is coupled to a CM5
Biacore chip using standard amine coupling chemistry to generate a
surface that is coated with the target. Typically 200-800 resonance
units of the target would be coupled to the chip (an amount that
gives easily measurable levels of binding but that is readily
saturable by the concentrations of test reagent being used). Two
test amino acid sequences (termed A* and B*) to be assessed for
their ability to cross-block each other are mixed at a one to one
molar ratio of binding sites in a suitable buffer to create the
test mixture. When calculating the concentrations on a binding site
basis the molecular weight of an amino acid sequence is assumed to
be the total molecular weight of the amino acid sequence divided by
the number of target binding sites on that amino acid sequence. The
concentration of each amino acid sequence in the test mix should be
high enough to readily saturate the binding sites for that amino
acid sequence on the target molecules captured on the Biacore chip.
The amino acid sequences in the mixture are at the same molar
concentration (on a binding basis) and that concentration would
typically be between 1.00 and 1.5 micromolar (on a binding site
basis). Separate solutions containing A* alone and B* alone are
also prepared. A* and B* in these solutions should be in the same
buffer and at the same concentration as in the test mix. The test
mixture is passed over the target-coated Biacore chip and the total
amount of binding recorded. The chip is then treated in such a way
as to remove the bound amino acid sequences without damaging the
chip-bound target. Typically this is done by treating the chip with
30 mM HCl for 60 seconds. The solution of A* alone is then passed
over the target-coated surface and the amount of binding recorded.
The chip is again treated to remove all of the bound amino acid
sequences without damaging the chip-bound target. The solution of
B* alone is then passed over the target-coated surface and the
amount of binding recorded. The maximum theoretical binding of the
mixture of A* and B* is next calculated, and is the sum of the
binding of each amino acid sequence when passed over the target
surface alone. If the actual recorded binding of the mixture is
less than this theoretical maximum then the two amino acid
sequences are cross-blocking each other. Thus, in general, a
cross-blocking amino acid sequence or other binding agent according
to the invention is one which will bind to the target in the above
Biacore cross-blocking assay such that, during the assay and in the
presence of a second amino acid sequence or other binding agent of
the invention, the recorded binding is between 80% and 0.1% (e.g.
80% to 4%) of the maximum theoretical binding, specifically between
75% and 0.1% (e.g. 75% to 4%) of the maximum theoretical binding,
and more specifically between 70% and 0.1% (e.g. 70% to 4%) of
maximum theoretical binding (as just defined above) of the two
amino acid sequences or binding agents in combination. The Biacore
assay described above is a primary assay used to determine if amino
acid sequences or other binding agents cross-block each other
according to the invention. On rare occasions particular amino acid
sequences or other binding agents may not bind to target coupled
via amine chemistry to a CMS Biacore chip (this usually occurs when
the relevant binding site on target is masked or destroyed by the
coupling to the chip). In such cases cross-blocking can be
determined using a tagged version of the target, for example a
N-terminal His-tagged version. In this particular format, an
anti-His amino acid sequence would be coupled to the Biacore chip
and then the His-tagged target would be passed over the surface of
the chip and captured by the anti-His amino acid sequence. The
cross blocking analysis would be carried out essentially as
described above, except that after each chip regeneration cycle,
new His-tagged target would be loaded back onto the anti-His amino
acid sequence coated surface. In addition to the example given
using N-terminal His-tagged target, C-terminal His-tagged target
could alternatively be used. Furthermore, various other tags and
tag binding protein combinations that are known in the art could be
used for such a cross-blocking analysis (e.g. HA tag with anti-HA
antibodies; FLAG tag with anti-FLAG antibodies; biotin tag with
streptavidin).
[0426] The following generally describes an ELISA assay for
determining whether an amino acid sequence or other binding agent
directed against a target cross-blocks or is capable of
cross-blocking as defined herein. It will be appreciated that the
assay can be used with any of the amino acid sequences (or other
binding agents such as polypeptides of the invention) described
herein. The general principal of the assay is to have an amino acid
sequence or binding agent that is directed against the target
coated onto the wells of an ELISA plate. An excess amount of a
second, potentially cross-blocking, anti-target amino acid sequence
is added in solution (i.e. not bound to the ELISA plate). A limited
amount of the target is then added to the wells. The coated amino
acid sequence and the amino acid sequence in solution compete for
binding of the limited number of target molecules. The plate is
washed to remove excess target that has not been bound by the
coated amino acid sequence and to also remove the second, solution
phase amino acid sequence as well as any complexes formed between
the second, solution phase amino acid sequence and target. The
amount of bound target is then measured using a reagent that is
appropriate to detect the target. An amino acid sequence in
solution that is able to cross-block the coated amino acid sequence
will be able to cause a decrease in the number of target molecules
that the coated amino acid sequence can bind relative to the number
of target molecules that the coated amino acid sequence can bind in
the absence of the second, solution phase, amino acid sequence. In
the instance where the first amino acid sequence, e.g. an Ab-X, is
chosen to be the immobilized amino acid sequence, it is coated onto
the wells of the ELISA plate, after which the plates are blocked
with a suitable blocking solution to minimize non-specific binding
of reagents that are subsequently added. An excess amount of the
second amino acid sequence, i.e. Ab-Y, is then added to the ELISA
plate such that the moles of Ab-Y target binding sites per well are
at least 10 fold higher than the moles of Ab-X target binding sites
that were used, per well, during the coating of the ELISA plate.
Target is then added such that the moles of target added per well
are at least 25-fold lower than the moles of Ab-X target binding
sites that were used for coating each well. Following a suitable
incubation period the ELISA plate is washed and a reagent for
detecting the target is added to measure the amount of target
specifically bound by the coated anti[target amino acid sequence
(in this case Ab-X). The background signal for the assay is defined
as the signal obtained in wells with the coated amino acid sequence
(in this case Ab-X), second solution phase amino acid sequence (in
this case Ab-Y), target buffer only (i.e. without target) and
target detection reagents. The positive control signal for the
assay is defined as the signal obtained in wells with the coated
amino acid sequence (in this case Ab-X), second solution phase
amino acid sequence buffer only (i.e. without second solution phase
amino acid sequence), target and target detection reagents. The
ELISA assay may be run in such a manner so as to have the positive
control signal be at least 6 times the background signal. To avoid
any artefacts (e.g. significantly different affinities between Ab-X
and Ab-Y for the target) resulting from the choice of which amino
acid sequence to use as the coating amino acid sequence and which
to use as the second (competitor) amino acid sequence, the
cross-blocking assay may to be run in two formats: 1) format 1 is
where Ab-X is the amino acid sequence that is coated onto the ELISA
plate and Ab-Y is the competitor amino acid sequence that is in
solution and 2) format 2 is where Ab-Y is the amino acid sequence
that is coated onto the ELISA plate and Ab-X is the competitor
amino acid sequence that is in solution. Ab-X and Ab-Y are defined
as cross-blocking if, either in format 1 or in format 2, the
solution phase anti-target amino acid sequence is able to cause a
reduction of between 60% and 100%, specifically between 70% and
100%, and more specifically between 80% and 100%, of the target
detection signal {i.e. the amount of target bound by the coated
amino acid sequence) as compared to the target detection signal
obtained in the absence of the solution phase anti- target amino
acid sequence (i.e. the positive control wells). [0427] t) An amino
acid sequence is said to be "cross-reactive" for two different
antigens or antigenic determinants (such as serum albumin from two
different species of mammal, such as human serum albumin and cyno
serum albumin) if it is specific for (as defined herein) both these
different antigens or antigenic determinants. [0428] u) By binding
that is "essentially independent of the pH" is generally meant
herein that the association constant (K.sub.A) of the amino acid
sequence with respect to the serum protein (such as serum albumin)
at the pH value(s) that occur in a cell of an animal or human body
(as further described herein) is at least 5%, such as at least 10%,
preferably at least 25%, more preferably at least 50%, even more
preferably at least 60%, such as even more preferably at least 70%,
such as at least 80% or 90% or more (or even more than 100%, such
as more than 110%, more than 120% or even 130% or more, or even
more than 150%, or even more than 200%) of the association constant
(K.sub.A) of the amino acid sequence with respect to the same serum
protein at the pH value(s) that occur outside said cell.
Alternatively, by binding that is "essentially independent of the
pH" is generally meant herein that the k.sub.off rate (measured by
Biacore) of the amino acid sequence with respect to the serum
protein (such as serum albumin) at the pH value(s) that occur in a
cell of an animal or human body (as e.g. further described herein,
e.g. pH around 5.5, e.g. 5.3 to 5.7) is at least 5%, such as at
least 10%, preferably at least 25%, more preferably at least 50%,
even more preferably at least 60%, such as even more preferably at
least 70%, such as at least 80% or 90% or more (or even more than
100%, such as more than 110%, more than 120% or even 130% or more,
or even more than 150%, or even more than 200%) of the k.sub.off
rate of the amino acid sequence with respect to the same serum
protein at the pH value(s) that occur outside said cell, e.g. pH
7.2 to 7.4. By "the pH value(s) that occur in a cell of an animal
or human body" is meant the pH value(s) that may occur inside a
cell, and in particular inside a cell that is involved in the
recycling of the serum protein. In particular, by "the pH value(s)
that occur in a cell of an animal or human body" is meant the pH
value(s) that may occur inside a (sub)cellular compartment or
vesicle that is involved in recycling of the serum protein (e.g. as
a result of pinocytosis, endocytosis, transcytosis, exocytosis and
phagocytosis or a similar mechanism of uptake or internalization
into said cell), such as an endosome, lysosome or pinosome. [0429]
v) As further described herein, the total number of amino acid
residues in a Nanobody can be in the region of 110-120, is
preferably 112-115, and is most preferably 113. It should however
be noted that parts, fragments, analogs or derivatives (as further
described herein) of a Nanobody are not particularly limited as to
their length and/or size, as long as such parts, fragments, analogs
or derivatives meet the further requirements outlined herein and
are also preferably suitable for the purposes described herein;
[0430] w) As further described in paragraph q) on pages 58 and 59
of WO 08/020079 (incorporated herein by reference), the amino acid
residues of a Nanobody are numbered according to the general
numbering for V.sub.H domains given by Kabat et al. ("Sequence of
proteins of immunological interest", US Public Health Services, NIH
Bethesda, Md., Publication No. 91), as applied to V.sub.HH domains
from Camelids in the article of Riechmann and Muyldermans, J.
Immunol. Methods 2000 Jun. 23; 240 (1-2): 185-195 (see for example
FIG. 2 of this publication), and accordingly FR1 of a Nanobody
comprises the amino acid residues at positions 1-30, CDR1 of a
Nanobody comprises the amino acid residues at positions 31-35, FR2
of a Nanobody comprises the amino acids at positions 36-49, CDR2 of
a Nanobody comprises the amino acid residues at positions 50-65,
FR3 of a Nanobody comprises the amino acid residues at positions
66-94, CDR3 of a Nanobody comprises the amino acid residues at
positions 95-102, and FR4 of a Nanobody comprises the amino acid
residues at positions 103-113. [0431] x) The Figures, Sequence
Listing and the Experimental Part/Examples are only given to
further illustrate the invention and should not be interpreted or
construed as limiting the scope of the invention and/or of the
appended claims in any way, unless explicitly indicated otherwise
herein.
[0432] For a general description of heavy chain antibodies and the
variable domains thereof, reference is inter alia made to the prior
art cited herein, as well as to the prior art mentioned on page 59
of WO 08/020079 and to the list of references mentioned on pages
41-43 of the International application WO 06/040153, which prior
art and references are incorporated herein by reference.
[0433] In accordance with the terminology used in the art (see the
above references), the variable domains present in naturally
occurring heavy chain antibodies will also be referred to as
"V.sub.HH domains", in order to distinguish them from the heavy
chain variable domains that are present in conventional 4-chain
antibodies (which will be referred to hereinbelow as "V.sub.H
domains") and from the light chain variable domains that are
present in conventional 4-chain antibodies (which will be referred
to hereinbelow as "V.sub.L domains").
[0434] As mentioned in the prior art referred to above, V.sub.HH
domains have a number of unique structural characteristics and
functional properties which make isolated V.sub.HH domains (as well
as Nanobodies based thereon, which share these structural
characteristics and functional properties with the naturally
occurring V.sub.HH domains) and proteins containing the same highly
advantageous for use as functional antigen-binding domains or
proteins. In particular, and without being limited thereto,
V.sub.HH domains (which have been "designed" by nature to
functionally bind to an antigen without the presence of, and
without any interaction with, a light chain variable domain) and
Nanobodies can function as a single, relatively small, functional
antigen-binding structural unit, domain or protein. This
distinguishes the V.sub.HH domains from the V.sub.H and V.sub.L
domains of conventional 4-chain antibodies, which by themselves are
generally not suited for practical application as single
antigen-binding proteins or domains, but need to be combined in
some form or another to provide a functional antigen-binding unit
(as in for example conventional antibody fragments such as Fab
fragments; in ScFv's fragments, which consist of a V.sub.H domain
covalently linked to a V.sub.L domain).
[0435] Because of these unique properties, the use of V.sub.HH
domains and Nanobodies as single antigen-binding proteins or as
antigen-binding domains (i.e. as part of a larger protein or
polypeptide) offers a number of significant advantages over the use
of conventional V.sub.H and V.sub.L domains, scFv's or conventional
antibody fragments (such as Fab- or F(ab').sub.2-fragments),
including the advantages that are listed on pages 60 and 61 of WO
08/020079.
[0436] In a specific and preferred aspect, the invention provides
Nanobodies against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof, and in particular Nanobodies against any of
IL-17A, IL-17F and/or 1L-17A/F including combinations thereof from
a warm-blooded animal, and more in particular Nanobodies against
any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof from a mammal, and especially Nanobodies against human any
of IL-17A, IL-17F and/or IL-17A/F including combinations thereof;
as well as proteins and/or polypeptides comprising at least one
such Nanobody.
[0437] In particular, the invention provides Nanobodies against any
of IL-17A, IL-17F and/or IL-17A/F including combinations thereof,
and proteins and/or polypeptides comprising the same, that have
improved therapeutic and/or pharmacological properties and/or other
advantageous properties (such as, for example, improved ease of
preparation and/or reduced costs of goods), compared to
conventional antibodies against any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof or fragments thereof,
compared to constructs that could be based on such conventional
antibodies or antibody fragments (such as Fab' fragments,
F(ab').sub.2 fragments, ScFv constructs, "diabodies" and other
multispecific constructs (see for example the review by Holliger
and Hudson, Nat Biotechnol. 2005 September; 23(9):1126-36)), and
also compared to the so-called "dAb's" or similar (single) domain
antibodies that may be derived from variable domains of
conventional antibodies. These improved and advantageous properties
will become clear from the further description herein, and for
example include, without limitation, one or more of: [0438]
increased affinity and/or avidity for any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof, either in a monovalent
format, in a multivalent format (for example in a bivalent format)
and/or in a multispecific format (for example one of the
multispecific formats described hereinbelow); [0439] better
suitability for formatting in a multivalent format (for example in
a bivalent format); [0440] better suitability for formatting in a
multispecific format (for example one of the multispecific formats
described hereinbelow); [0441] improved suitability or
susceptibility for "humanizing" substitutions (as defined herein);
[0442] less immunogenicity, either in a monovalent format, in a
multivalent format (for example in a bivalent format) and/or in a
multispecific format (for example one of the multispecific formats
described hereinbelow); [0443] increased stability, either in a
monovalent format, in a multivalent format (for example in a
bivalent format) and/or in a multispecific format (for example one
of the multispecific formats described hereinbelow); [0444]
increased specificity towards any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof, either in a monovalent format, in a
multivalent format (for example in a bivalent format) and/or in a
multispecific format (for example one of the multispecific formats
described hereinbelow); [0445] decreased or where desired increased
cross-reactivity with any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof from different species; and/or
[0446] one or more other improved properties desirable for
pharmaceutical use (including prophylactic use and/or therapeutic
use) and/or for diagnostic use (including but not limited to use
for imaging purposes), either in a monovalent format, in a
multivalent format (for example in a bivalent format) and/or in a
multispecific format (for example one of the multispecific formats
described hereinbelow).
[0447] As generally described herein for the amino acid sequences
of the invention, the Nanobodies of the invention are preferably in
essentially isolated form (as defined herein), or form part of a
protein or polypeptide of the invention (as defined herein), which
may comprise or essentially consist of one or more Nanobodies of
the invention and which may optionally further comprise one or more
further amino acid sequences (all optionally linked via one or more
suitable linkers). For example, and without limitation, the one or
more amino acid sequences (or ISV's) of the invention may be used
as a binding unit in such a protein or polypeptide, which may
optionally contain one or more further amino acid sequences (or
ISV's) that can serve as a binding unit (i.e. against one or more
other targets than any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof), so as to provide a monovalent, multivalent
or multispecific polypeptide of the invention, respectively, all as
described herein. In particular, such a protein or polypeptide may
comprise or essentially consist of one or more Nanobodies (or
ISV's) of the invention and optionally one or more (other)
Nanobodies (ISV's), i.e. directed against other targets than any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof, all
optionally linked via one or more suitable linkers, so as to
provide a monovalent, multivalent or multispecific Nanobody
construct, respectively, as further described herein. Such proteins
or polypeptides may also be in essentially isolated form (as
defined herein).
[0448] In a Nanobody (or ISV) of the invention, the binding site
for binding against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof is preferably formed by the CDR sequences.
Optionally, a Nanobody (or ISV) of the invention may also, and in
addition to the at least one binding site for binding against any
of IL-17A, IL-17F and/or IL-17A/F including combinations thereof,
contain one or more further binding sites for binding against other
antigens, proteins or targets. For methods and positions for
introducing such second binding sites, reference is for example
made to Keck and Huston, Biophysical Journal, 71, October 1996,
2002-2011; EP 0 640 130; and WO 06/07260.
[0449] As generally described herein for the amino acid sequences
of the invention, when a Nanobody (or ISV) of the invention (or a
polypeptide of the invention comprising the same) is intended for
administration to a subject (for example for therapeutic and/or
diagnostic purposes as described herein), it is preferably directed
against any of human IL-17A, IL-17F and/or IL-17A/F including
combinations thereof; whereas for veterinary purposes, it is
preferably directed against any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof from the species to be treated.
Also, as with the amino acid sequences of the invention, a Nanobody
(or ISV) of the invention may or may not be cross-reactive (i.e.
directed against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof from two or more species of mammal, such as
against any of human IL-17A, IL-17F and/or IL-17A/F including
combinations thereof and any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof from at least one of the species of
mammal mentioned herein).
[0450] Also, again as generally described herein for the amino acid
sequences of the invention, the Nanobodies (or ISV's) of the
invention may generally be directed against any antigenic
determinant, epitope, part, domain, subunit or confirmation (where
applicable) of any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof. However, it is generally assumed and
preferred that the Nanobodies (or ISV's) of the invention (and
polypeptides comprising the same) are directed against the epitopes
of the invention such as described herein.
[0451] As already described herein, the amino acid sequence and
structure of a Nanobody (or ISV) can be considered--without however
being limited thereto--to be comprised of four framework regions or
"FR's" (or sometimes also referred to as "FW's"), which are
referred to in the art and herein as "Framework region 1" or "FR1";
as "Framework region 2" or "FR2"; as "Framework region 3" or "FR3";
and as "Framework region 4" or "FR4", respectively; which framework
regions are interrupted by three complementary determining regions
or "CDR's", which are referred to in the art as "Complementarity
Determining Region 1" or "CDR1"; as "Complementarity Determining
Region 2" or "CDR2"; and as "Complementarity Determining Region 3"
or "CDR3", respectively. Some preferred framework sequences and
CDR's (and combinations thereof) that are present in the Nanobodies
(or ISV's) of the invention are as described herein. Other suitable
CDR sequences can be obtained by the methods described herein.
[0452] According to a non-limiting but preferred aspect of the
invention, (the CDR sequences present in) the Nanobodies (or ISV's)
of the invention are such that: [0453] the Nanobodies (or ISV's)
can bind to any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof with a dissociation constant (K.sub.D) of
10.sup.-5 to 10.sup.-12 moles/liter or less, and preferably
10.sup.-7 to 10.sup.-12 moles/liter or less and more preferably
10.sup.-8 to 10.sup.-12 moles/liter (i.e. with an association
constant (K.sub.A) of 10.sup.5 to 10.sup.12 liter/moles or more,
and preferably 10.sup.7 to 10.sup.12 liter/moles or more and more
preferably 10.sup.8 to 10.sup.12 liter/moles); and/or such that:
[0454] the Nanobodies (or ISV's) can bind to any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof with a k.sub.on-rate
of between 10.sup.2 M.sup.-1s.sup.-1 to about 10.sup.7
M.sup.-1s.sup.-1, preferably between 10.sup.3 M.sup.-1s.sup.-1 and
10.sup.7 M.sup.-1s.sup.-1, more preferably between 10.sup.4
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1, such as between
10.sup.5 M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1; and/or
such that they: [0455] the Nanobodies (or ISV's) can bind to any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof with
a k.sub.off rate between 1 s.sup.-1 (t.sub.1/2=0.69 s) and
10.sup.-6 s.sup.-1 (providing a near irreversible complex with a
t.sub.1/2 of multiple days), preferably between 10.sup.-2 s.sup.-1
and 10.sup.-6 s.sup.-1, more preferably between 10.sup.-3 s.sup.-1
and 10.sup.-6 s.sup.-1, such as between 10.sup.-4 s.sup.-1 and
10.sup.-6 s.sup.-1.
[0456] Preferably, (the CDR sequences present in) the Nanobodies
(or ISV's) of the invention are such that: a monovalent Nanobody
(or ISV) of the invention (or a polypeptide that contains only one
Nanobody (or ISV) of the invention) is preferably such that it will
bind to any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof with an affinity less than 500 nM, preferably
less than 200 nM, more preferably less than 10 nM, such as less
than 500 pM.
[0457] The affinity of the Nanobody (or ISV) of the invention
against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof can be determined in a manner known per se,
for example using the general techniques for measuring K.sub.D.
K.sub.A, k.sub.off or k.sub.on mentioned herein, as well as some of
the specific assays described herein.
[0458] Some preferred IC50 values for binding of the Nanobodies (or
ISV's) of the invention (and of polypeptides comprising the same)
to any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof will become clear from the further description and examples
herein.
[0459] In a preferred but non-limiting aspect, the invention
relates to a Nanobody (or ISV) (as defined herein) against any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof,
which consists of 4 framework regions (FR1 to FR4 respectively) and
3 complementarity determining regions (CDR1 to CDR3 respectively),
in which: [0460] CDR1 is chosen from the group consisting of:
[0461] a) the amino acid sequences of SEQ ID NOs: 197 to 267;
[0462] b) amino acid sequences that have at least 80% amino acid
identity with at least one of the amino acid sequences of SEQ ID
NOs: 197 to 267; [0463] c) amino acid sequences that have 3, 2, or
1 amino acid difference with at least one of the amino acid
sequences of SEQ ID NOs: 197 to 267; and/or [0464] CDR2 is chosen
from the group consisting of: [0465] d) the amino acid sequences of
SEQ ID NOs: 339 to 409; [0466] e) amino acid sequences that have at
least 80% amino acid identity with at least one of the amino acid
sequences of SEQ ID NOs: 339 to 409; [0467] f) amino acid sequences
that have 3, 2, or 1 amino acid difference with at least one of the
amino acid sequences of SEQ ID NOs: 339 to 409; and/or [0468] CDR3
is chosen from the group consisting of: [0469] g) the amino acid
sequences of SEQ ID NOs: 481 to 551, [0470] h) amino acid sequences
that have at least 80% amino acid identity with at least one of the
amino acid sequences of SEQ ID NOs: 481 to 551; [0471] i) amino
acid sequences that have 3, 2, or 1 amino acid difference with at
least one of the amino acid sequences of SEQ ID NOs: 481 to 551; or
any suitable fragment of such an amino acid sequence.
[0472] In particular, according to this preferred but non-limiting
aspect, the invention relates to a Nanobody (or ISV) (as defined
herein) against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof, which consists of 4 framework regions (FR1 to
FR4 respectively) and 3 complementarity determining regions (CDR1
to CDR3 respectively), in which: [0473] CDR1 is chosen from the
group consisting of: [0474] a) the amino acid sequences of SEQ ID
NOs: 197 to 267; [0475] b) amino acid sequences that have at least
80% amino acid identity with at least one of the amino acid
sequences of SEQ ID NOs: 197 to 267; [0476] c) amino acid sequences
that have 3, 2, or 1 amino acid difference with at least one of the
amino acid sequences of SEQ ID NOs: 197 to 267; and [0477] CDR2 is
chosen from the group consisting of: [0478] d) the amino acid
sequences of SEQ ID NOs: 339 to 409; [0479] e) amino acid sequences
that have at least 80% amino acid identity with at least one of the
amino acid sequences of SEQ ID NOs: 339 to 409; [0480] f) amino
acid sequences that have 3, 2, or 1 amino acid difference with at
least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
and [0481] CDR3 is chosen from the group consisting of: [0482] g)
the amino acid sequences of SEQ ID NOs: 481 to 551; [0483] h) amino
acid sequences that have at least 80% amino acid identity with at
least one of the amino acid sequences of SEQ ID NOs: 481 to 551;
[0484] i) amino acid sequences that have 3, 2, or 1 amino acid
difference with at least one of the amino acid sequences of SEQ ID
NOs: 481 to 551; or any suitable fragment of such an amino acid
sequences.
[0485] As generally mentioned herein for the amino acid sequences
of the invention, when a
[0486] Nanobody (or ISV) of the invention contains one or more CDR1
sequences according to b) and/or c): [0487] i) any amino acid
substitution in such a CDR according to b) and/or c) is preferably,
and compared to the corresponding CDR according to a), a
conservative amino acid substitution (as defined herein); and/or
[0488] ii) the CDR according to b) and/or c) preferably only
contains amino acid substitutions, and no amino acid deletions or
insertions, compared to the corresponding CDR according to a);
and/or [0489] iii) the CDR according to b) and/or c) may be a CDR
that is derived from a CDR according to a) by means of affinity
maturation using one or more techniques of affinity maturation
known per se.
[0490] Similarly, when a Nanobody (or ISV) of the invention
contains one or more CDR2 sequences according to e) and/or f):
[0491] i) any amino acid substitution in such a CDR according to e)
and/or f) is preferably, and compared to the corresponding CDR
according to d), a conservative amino acid substitution (as defined
herein); and/or [0492] ii) the CDR according to e) and/or f)
preferably only contains amino acid substitutions, and no amino
acid deletions or insertions, compared to the corresponding CDR
according to d); and/or [0493] iii) the CDR according to e) and/or
f) may be a CDR that is derived from a CDR according to d) by means
of affinity maturation using one or more techniques of affinity
maturation known per se.
[0494] Also, similarly, when a Nanobody (or ISV) of the invention
contains one or more CDR3 sequences according to h) and/or i):
[0495] i) any amino acid substitution in such a CDR according to h)
and/or i) is preferably, and compared to the corresponding CDR
according to g), a conservative amino acid substitution (as defined
herein); and/or [0496] ii) the CDR according to h) and/or i)
preferably only contains amino acid substitutions, and no amino
acid deletions or insertions, compared to the corresponding CDR
according to g); and/or [0497] iii) the CDR according to h) and/or
i) may be a CDR that is derived from a CDR according to g) by means
of affinity maturation using one or more techniques of affinity
maturation known per se.
[0498] It should be understood that the last three paragraphs
generally apply to any Nanobody (or ISV) of the invention that
comprises one or more CDR1 sequences, CDR2 sequences and/or CDR3
sequences according to b), c), e), f), h) or i), respectively.
[0499] Of the Nanobodies (or ISV's) of the invention, Nanobodies
(or ISV's) comprising one or more of the CDR's explicitly listed
above are particularly preferred; Nanobodies (or ISV's) comprising
two or more of the CDR's explicitly listed above are more
particularly preferred; and Nanobodies (or ISV's) comprising three
of the CDR's explicitly listed above are most particularly
preferred.
[0500] Some particularly preferred, but non-limiting combinations
of CDR sequences, as well as preferred combinations of CDR
sequences and framework sequences, are mentioned in Table B-1
below, which lists the CDR sequences and framework sequences that
are present in a number of preferred (but non-limiting) Nanobodies
(or ISV's) of the invention. As will be clear to the skilled
person, a combination of CDR1, CDR2 and CDR3 sequences that occur
in the same clone (i.e. CDR1, CDR2 and CDR3 sequences that are
mentioned on the same line in Table B-1) will usually be preferred
(although the invention in its broadest sense is not limited
thereto, and also comprises other suitable combinations of the CDR
sequences mentioned in Table B-1). Also, a combination of CDR
sequences and framework sequences that occur in the same clone
(i.e. CDR sequences and framework sequences that are mentioned on
the same line, e.g. same row, in Table B-1) will usually be
preferred (although the invention in its broadest sense is not
limited thereto, and also comprises other suitable combinations of
the CDR sequences and framework sequences mentioned in Table B-1,
e.g. from different rows, as well as combinations of such CDR
sequences and other suitable framework sequences, e.g. as further
described herein).
[0501] Also, in the Nanobodies (or ISV's) of the invention that
comprise any of the combinations of CDR's mentioned in Table B-1,
each CDR can be replaced by a CDR chosen from the group consisting
of amino acid sequences that have at least 80%, preferably at least
90%, more preferably at least 95%, even more preferably at least
99% sequence identity (as defined herein) with the mentioned CDR's;
in which: [0502] i) any amino acid substitution in such a CDR is
preferably, and compared to the corresponding CDR sequence
mentioned in Table B-1, a conservative amino acid substitution (as
defined herein); and/or [0503] ii) any such CDR sequence preferably
only contains amino acid substitutions, and no amino acid deletions
or insertions, compared to the corresponding CDR sequence mentioned
in Table B-1; and/or [0504] iii) any such CDR sequence is a CDR
that is derived by means of a technique for affinity maturation
known per se, and in particular starting from the corresponding CDR
sequence mentioned in Table B-1.
[0505] However, as will be clear to the skilled person, the
(combinations of) CDR sequences, as well as (the combinations of)
CDR sequences and framework sequences mentioned in Table B-1 will
generally be preferred.
TABLE-US-00003 TABLE B-1 Preferred combinations of CDR sequences,
preferreD combinations of framework sequences, and preferred
combinations of framework and CDR sequences. ("ID" refers to the
SEQ ID NO as used herein) ID FR1 ID CDR1 ID FR2 ID CDR2 ID FR3 ID
CDR3 ID FR4 01D02 126 EVQLVESGGGL 197 SYALG 268 WFRQAPG 339
AINWSGDNTHYA 410 RFTISRDNAKNTVS 481 QLGYESGYS 552 WGQGTQV
VQAGGSLRLSC KERDFVA DSVKG LQMNSLKPEDTAV LTYDYDY TVSS AASGLSFS YYCAA
01G03 127 EVQLVESGGGL 198 NYDMG 269 WFRQAPG 340 ADISWSALNTNY 411
RFTISRDNAKNMV 482 RRSGYASFD 553 WGQGTQV VQAGGSLRLSC KERELIA ADSVKG
YLQMNNLKPEDTA N TVSS AASERTIS VYYCAA 02E03 128 EVQLVESGGGL 199
SYAMS 270 WARQAPG 341 DINSGGTRTTYAD 412 RFTISRDNAKNTLY 483
LSVFRSQLG 554 RGQGTQV VQPGGSLRLSC EGLEWVS SVKG LQMNSLKPEDTAV
GKYYGGDY TVSS AASGFTFS YVCAK EN 03B08 129 EVQLVESGGGL 200 DYAIG 271
WFRQAPG 342 CISSSDGSIYYADS 413 RFTISSDNAKNTVY 484 FGRTGWAEE 555
WGQGTQV VQAGGSLRLSC KEREGVS VKG LQMNSLKPEDTAV CVDYDY TVSS AASGFTFD
YHCAR 03E05 130 EVQLVESGGGL 201 DYSIG 272 WFRQAPG 343
CISSSDGIPYYSDF 414 RFTTSIDNAKNTVY 485 GFGRLCAEF 556 WGQGTQV
VQAGGSLRLSC KEREGVS VKG LQMNSLKPEDTAV DS TVSS AASGVTFD YYCAA 01D06
131 EVQLVESGGGL 202 TYGMT 273 WFRQVPG 344 HIPRSTYSPYYAN 413
RFTIARDDAKSTVY 486 FTGGTYYVP 557 WGQGTQV VQAGGSLRLSC KEREFVA SVKG
LQMNSLKPEDTAV TAYDY TVSS AADGRTFS YYCAV 02A08 132 EVQLVESGGG 203
FNAMG 274 WFRQAPG 345 AISATGDDTYYA 416 RFAISRDTARNTVY 487 RVNFDGTVS
558 WGQGTQV VVQPGGSLRLS KEREFVA DSVKG LQMNSLKPEDTAV YTNDYAY TVSS
CADSERSFS YYCGA 02A10 133 EVQLVESGGGL 204 YYAIG 275 WFRQAPG 346
CDSSSDGRTYYG 417 RFTISTDSAKNTVY 488 CTDFEYDY 559 WGQGTQV
VQPGGSLRLSC KEREGVS DSVKG LQMNSLKPEDTAV TVSS AASGFALG YYCAT 04B09
134 EVQLVESGGGL 205 YYAIG 276 WFRQAPG 347 CDSSSDGDTYYA 418
RFTISTDNGKNTVY 489 CTDWNYDY 560 WGQGTQV VQPGGSLRLSC KEREGVS NSVKG
LQMNSLKPEDTAV TVSS AASGFTLG YYCAT 03C07 135 EVQLVESGGGL 206 DYAIG
277 WFRQAPG 348 CFSSSDGSIYYAD 419 RFTISSDNAKNTVY 490 GGGSYYYTQ 561
WGKGTQV VQAGGSLRLSC KEREAVS SVKG LQMNSLKPEDTAV LNYCYDMD TVSS
AASGFTFD YYCAG Y 04A02 136 EVQLVESGGGL 207 INYMA 278 WYRQAPG 349
AMTSDATTEYAD 420 RFTISRDIPENTVYL 491 KGIWDYLGR 562 WGQGTQV
VQPGGSLRLSC NQRELVA SVKG QMNSLKPEDTAVY RDFGDY TVSS AASRNINI YCNA
04B10 137 EVQLVESGGGL 208 INVMG 279 WYRQAPG 350 LITSGGGTTYGDS 421
RFTISEDNAKNTVIL 492 EIGYYSGGT 563 WGQGTQV VQAGGSQSLSC KQRELVA VKG
QMNSLEAEDTAVY YFSSEAH TVSS VASGTIVN YCAA 04G01 138 EVQLVESGGGL 209
IHVMG 280 WYRQAPG 351 LIFSGGSADYADS 422 RFTISRDNAKNTVY 493
EIGYYSGGT 564 WGQGTQV VQAGGSQRLSC KQRELVA VKG LEMNSLKAEDTAV YYSSEAH
TVSS TASGTIVN YYCAA 04F09 139 EVQLVESGGGL 210 THAMG 281 WFRQAPG 352
AIRWSDGSSFYAD 423 RFTISRDNAKNAVY 494 DVEGPTALH 565 WGRGTQV
VQPGGSLRLSC KERDFVA SVKG LQSNSLKSEDTAVY KY TVSS AASGRTFS VCYA 09D10
140 EVQLVESGGGL 211 IDVMR 282 WHRQAPG 353 SIASGGTTNYADS 424
RFTISRDNAKNTVY 495 NAESGPYTY 566 WGLGTQV VQAGGSLSLSC KQREFLA VKG
LQMNSLKPEDTAV TVSS AASGSVFR YYCGA 09G10 141 EVQLVESGGGL 212 AKAVG
283 WYRQPPG 354 IITSGGKTNYADS 425 RFTVSVDKVKNTV 496 QWMGRDY 567
WGQGTQV VQAGGSLRLSC LQREWVA SVKG TLQMNSLKPEDTA TVSS AASDSVFT VYYCYA
11A06 142 EVQLVESGGGL 213 YYALG 284 WFRQAPG 355 CITSSDASAYYTD 426
RFTISRDNSKNTVY 497 ALLTCSSYY 568 WGQGTQV VQPGESLRLSC KEREGIS SVKG
LQMNSLKTEDTAIY DAYTY TVSS KASGFSLD YCAA 06E11 143 EVQLVESGGGL 214
RGRLG 285 WFRQAPG 356 VAHWSGAITSYA 427 RPTFSRDNAKNTM 498 DSETSGNWV
569 WGQGTQV VQAGGSLRLSC KEREFVA DSVKG NLQMNSLKPEDTA Y TVSS PVSGRAFS
VYYCAA 07B09 144 EVQLVESGGGL 215 SYATG 286 WFRQAPG 357 VLRWSDGHTAYA
428 RFTISRDGAKNTMY 499 ATRPGEWDY 570 WGQGTQV VQAGGSLRLSC KEREFVA
DSVKG LQMSSLKPEDTAIY TVSS GASGGTFS YCTT 24G10 145 EVQLVESGGGL 216
SYATG 287 WFRQAPG 358 VFRWSDSHTAYA 429 RFTISRDGAKNTLY 500 ATRPGEWDY
571 WGQGTQV VQAGGSLRLSC KEREFVA DSVKG LQMSSLKPEDTAIY TVSS GAAGGTFS
YCTT 07B11 146 EVQLVESGGGL 217 SYVMG 288 WFRQAPG 359 LIRWSDGITGYVD
430 RFTISRDNAKNTVY 501 AVRPGDYDY 572 WGQGTQV VQAGGSLRLSC MEREFVA
SVKG LQMNSLKPEDTAV TVSS VASGRAFS YYCAA 08A08 147 EVQLVESGGGL 218
PYRMG 289 WFRRAPG 360 LISWSSGRTSYAD 431 RFTISRDSAKNAVY 502
DLSGDAVYD 573 WGQGTQV VQAGGSLRLSC KAREFVT SVKG LQMDNLKPEDTAV S TVSS
AASGRTFR YFCAV 08B07 148 EVQLVESGGGL 219 VKNVG 290 WTRQAPGK 361
TITVGGSTNYADS 432 RFTISRDNAKNTVY 503 VATVTDYTG 574 WGQGTQV
VQPGGSLRLSC QRELVA AKG LQMSSLKPEDTAV TYSDGF TVSS AASGRDFR YYCNA
08H01 149 EVQLVESGGGL 220 SYATG 291 WFRQAPG 362 VLRWSDSHTAYA 433
RFTISRDGAKNTVY 504 GTRPGEWHY 575 WGQGTQV VQAGGSLRLSC KEREFVA DSVEG
LQMSSLKPEDTAIY TVSS GASGGTFS YCTT 12A09 150 EVQLVESGGGL 221 SYRMA
292 WVRQAPG 363 STSTGGEMTNYA 434 RFTISRDNAKNTLH 505 GTSAGHWST 576
GGQGTQV VQPGGSLRLSC KGLEWVS DSVKG LQMNSLKPEDTAL TVSS AASGFTFS YYCAA
16A04 151 EVQLVESGGGL 222 SYVVG 293 WFRQAPG 364 AISGSGDSIYYAV 435
RFTISRDNGKNTLY 506 DQEFGYLRF 577 WGQGTQV VQAGGSLRLSC KEREFIG SEKD
LQMSSLKAEDTAV GRSEY TVSS AASGRTFS YYCTA 24B08 152 EVQLVESGGGL 223
TYKMG 294 WFRQAPG 365 RISTNGPTAYAEF 436 RFTVSRENTKNTVY 507
GYDSLFAGY 578 WGQGTQV VQAGGSLRLSC KEREIVA VKG LQMNSLNIEDTAVY DY
TVSS AVSGGTFS YCAA 01A01 153 EVQLVESGGGL 224 DYDIG 295 WFRQAPG 366
CFTSSDGRTFYAD 437 RFTVSADNAKNTV 508 VNTFDESAY 579 WGQGTQV
VQAGGSLRLSC KEREGVS SVKG YLQMNSLEPEDTA AAFACYDVV AASGFTFD VYFCAA R
09B09 154 EMQLVESGGG 225 SYWMY 296 WARQAPG 367 ALAPGGDDEYYA 438
RFTISRDNAENSLY 509 DHNVGYRT 580 GGQGTQV LVQPGGSLRLS KGLEWIS DSVNG
LQMNSLKSEDTAV GEYDY TVSS CAASGFTFS YYCAK 09E11 155 EVQLVESGGGL 226
SYWMY 297 WVRQAPG 368 ALAPGGDNRYYA 439 RFTISRDNAENSLY 510 DHNVGYRT
581 GGQGTQV VQPGGSLRLSC KGLEWTS DSVNG LQMNSLKSEDTAV GEYDY TVSS
AASGFTFS YYCAK 10A04 156 EVQLVESGGGL 227 SYWMY 298 WVRQAPG 369
ALAPGGGNRYYA 440 RFTISRDNAKNSLY 511 DHNVGYRT 582 GGQGTQV
VQPGGSLRLSC KGLEWIS ESVNG LQMNSLKSEDTAV GEYDY TVSS AASGFTFS YYCAK
10A05 157 EVQLVESGGGL 228 NYWMY 299 WVRQAPG 370 ALAPGGDNRYYA 441
RFTISRDNAENSLY 512 DHNVGYRT 583 GGQGTQV VQPGGSLRLSC KGLEWIS DSVNG
LQMNSLKSEDTAV GEYDY TVSS AASGFTFS YYCAK 10D11 158 EVQLVESGGGL 229
SYWMY 300 WVRQAPG 371 ALAPGGEHRYYA 442 RFTISRDNAKNSLY 513 DHNVGYRT
584 GGQGTQV VQAGGSLRLSC KGLEWIS DSVNG LQMNSLKSEDTAV GEYDY TVSS
AASGFTFS YYCAK 10F02 159 EVQLVESGGGL 230 SYWMY 301 WVRQAPG 372
ALAPGGGNAYYA 443 RFTISRDNAENLLY 514 DHNVGYRT 585 GGQGTQV
VQPGGSLRLSC KGLEWIS DSVNG LQMNSLKSEDTAV GEYDY TVSS AASGFTFS YYCAK
11A02 160 EVQLVESGGGL 231 LNAMG 302 WYRAAPG 373 IIINGGSTNYADSV 444
RFTISRDSAKNAVY 515 NIPGDVY 586 WGQGTQV VQAGGSLRLSC KQRELVA KG
LQMNSLKPEDTAV TVSS AASGVIFR YYCYY 11A07 161 EVQLVESGGGL 232 LNAMG
303 WYRAAPG 374 IIANGGSTNYADS 445 RFTISRDSAKNAVY 516 NIPGDVY 587
WGQGTRV VQAGGSLRLSC KQRELVA VKG LQMNSLKPEDTAV TVSS AAPGVIFR YYCYY
11C08 162 EVQLVESGGGL 233 LNAMG 304 WYRAAPG 375 IIVNGGSTNYADS 446
RFTISRDSAKNAVY 517 NIPGDVY 588 WGQGTQV VQAGGSLRLSC KQRELVA VKG
LQMNSLKPEDTAV TVSS AASGVIFR YYCYY 11C09 163 EVQLVESGGGL 234 LNAMG
305 WYRAAPG 376 IIVNGGSTNYADS 447 RFTISRDSAKNAVY 518 NIPGDVY 589
WGQGTQV VQAGGSLRLSC KQRELVA VKG LQMDSLKPEDTAV TVSS AASGVIFR YYCYY
12H11 164 EVQLVESGGGL 235 LNAMG 306 WYRAAPG 377 IIVNGGSTNYADS 448
RFTISRDNAKNAVY 519 NIPGDVY 590 WGQGTQV VQPGGSLRLSC KQRELVA VKG
LQMNSLKPEDTAV TVSS AASGVIFR YYCYY 13B03 165 EVQLVESGGGS 236 INWFG
307 WFRQTPG 378 GIRWSDAYTEYA 449 RFTISRDNAKNTVD 520 DLSTVRY 591
WGQGTQV VQAGDSLRLSC KEREFVA NSVKG LQMDSLKPEDTAV TVSS AASGRANS YYCYL
13D05 166 EVQLVESGGGS 237 INWFG 308 WFRQTPG 379 GIRWTDAYTEYA 450
RFTISRDNAKNTVG 521 DLSTVRY 592 WGQGSQV VQAGDSLRLSC KEREFVA ASVKG
LQMDSLKPEDTAV TVSS AASGRANS YYCVL 13E02 167 EVQLVESGGGL 238 AMG 309
WLRQAPG 380 AISGSGDDTYYA 451 RFTISKDNAGITMY 522 RRGLYYVW 593
WGQGTQV VQAGGSLRLSC KEREFVA DSVKG LQMNSLKPEDTAV DSNDYEN TVSS
AASGRTYD YYCAT 01D08 168 EVQLVESGGGL 239 AMG 310 WLRQAPG 381
AISGSGDDTYYA 452 RFTISKDNAGITMY 523 RRGRYYVW 594 WGQGTQV
VQAGGSLRLSC KEREFVA DSVKG LEMNSLKPEDTAV DSNDYEN TVSS AASGRTYY YYCAT
13E07 169 EVQLVESGGGL 240 AMG 311 WLRQAPG 382 AISGSGDDTYYA 453
RFTISKDNAGITMY 524 RRGLYYVW 595 WGQGTQV VQAGGSLRLSC KEREFVA DSVKG
LQMNSLKPEDTAV DSNDYEN TVSS AASGRTYY YYCAT 13G06 170 EVQLVESGGGL 241
AMG 312 WLRQAPG 383 AVSGSGDDTYYA 454 RFTISKDNAGITMY 525 RRGLYYVW
596 WGQGTQV VQAGGSLRLSC KEREFVA DSVKG LQMNSLKPEDTAV DSNDYEN TVSS
AASGRTYH YYCAT 13H05 171 EVQLVESGGGL 242 AMG 313 WFRQAPG 384
AISGSGEDTYYAD 455 RFTCSKDNAKDTM 526 RRGLYFITD 597 WGQGTQV
VQAGGSLRLSC KEREFVA SVKG YLQMNSLKPEDTA SNDYEN TVSS AASGRTYD VYYCAT
13E05 172 EVQLVESGGG 243 NYAA 314 WFRQAPG 385 VSIFRTGSITYTAD 456
RFTASRVNTKNTV 527 AYNPGVGY 598 WGQGTQV KVQAGDSLTLS KDRRELV SVKG
YLQMNSLKPEDTA DY TVSS CVASGGTFS VYYCAS 17B03 173 EVQLVESGGGL 244
NYAA 315 WFRQGPG 386 SIFRSGTITYTADS 457 RFTASRVNTKNTV 528 AYNPGIGYD
599 WGQGTQV VQAGGSLRLSC KGRELVV VKG YLQMNSLKPEDTGI Y TVSS EASGGTFS
YYCAS 17D08 174 EVQLVESGGGL 245 NYAA 316 WFRQAPG 387 VSIFRTGSITYTAD
458 RFTASRVNTKNTV 529 AYNPGVGY 600 WGQGTQV
VQAGDSLTLSC KDRRELV SVKG YLQMNSLKPEDTA DY TVSS VASGGTFS VYYCAS
17E05 175 EVQLVESGGGL 246 NYAA 317 WFRQGPG 388 SIFRSGTITYTADS 459
RFTASRVNTKNTV 530 AYNPGIGYD 601 WGQGTQV VQAGDSLRLSC KGRELVV VKG
YLQMNSLKPEDTGI Y TVSS EASGGTFS YYCAS 17G08 176 EVQLVESGGGL 247 NYAA
318 WFRQGPG 389 SIFRSGTITYTADS 460 RFTASRVNTKNTV 531 AYNPGIGYD 602
WGQGTQV VQPGGSLRLSC KGRELVV VKG YLQMNSLKPEDTGI Y TVSS EASGGTFS
YYCAS 17H04 177 EVQLVESGGGL 248 NYAA 319 WFRQAPG 390 SIFRSGSITYTADS
461 RFTGSRVNTKNTA 532 AYNPGIGYD 603 WGQGTQV VQAGDSLRLSC KGRELEL VKG
YLQMNNLKPEDTA Y TVSS VASGGTFS VYYCAS 17H07 178 EVQLVESGGGL 249 NYAA
320 WFRQAPG 391 VSIFRTGSITYTAD 462 RFTASRVNTKNTV 533 AYNPGVGY 604
WGQGTQV VQAGDSLTLSC KDRRELV SVKG YLQMNSLKPEDTA DY TVSS VASGGTFS
VYYCAS 01C09 179 EVQLVKSGGG 250 TYPMG 321 WFRQAPG 392 AISMSGEDTIYAT
463 RFTISRDDARNTVT 534 RTSYNGRYD 605 WGQGTQV LVQAGGSLKLS KEREFVG
SVKG LHMTSLKPEDTAV YIDDYSY TVSS CAASGRTFT YYCAA 01F10 180
EVQLVESGGGL 251 TYPMG 322 WFRQAPG 393 AISMSGEDAAYA 464
RFTISRDNARNTVY 535 RTSYNGIYD 606 WGQGTQV VQAGGSLRLSC KEREFVA TSVKG
LHMTTLKPEDTAV YIDDYSY TVSS AASGRTFT YYCAA 02D02 181 EVQLVESGGGL 252
TYPMG 323 WFRQAPG 394 AISMSGDDTAYA 465 RFTIVRDDDKNTVY 536 RTSYSGTYD
607 WGQGTQV VQAGGSLKLSC KEREFVA TFVKG LHMTSLKPEDTAV YIDDYSY TVSS
ARSGRTFT YYCAA 13A08 182 EVQLVESRGRL 253 SYPMG 324 WFRQAPG 395
AISMSGDDAAYA 466 RFTISRDDARNTVY 537 RTSYDGTYD 608 WGQGTQV
VQAGGSLRLSC KEREFVA DFVRG LHMTSLKPEDTAV YIDDYSY TVSS AASGRTFT YYCAA
13B05 183 EVQLVESGGRL 254 SYPMG 325 WFRQAPG 396 AISMSGDDTAYT 467
RFTISRDDARNTVY 538 RTSYDGTYD 609 WGQGTQV VQAGGSLRLSC KEREFVA DFVRG
LHMTSLKPEDTAV YIDDYSY TVSS AASGRTFT YYCAA 13C06 184 EVQLVESGGRL 255
SYPMG 236 WFRQAPG 397 AISMSGDDAAYA 468 RFTISRDDARNTVY 539 RTSYDGTYD
610 WGQGTQV VQAGGSLRLSC KEREFVA DFVRG LHMTSLKPEDTAV YIDDYSY TVSS
AASGRTFT YYCAA 13E01 185 EVQLVESEGGL 256 SYPMG 327 WFRQAPG 398
AISMSGDDTIYRD 469 RFTISRDNARNTVY 540 RTSYDGRYD 611 WGQGTQV
VQAGGSLRLSC KEREFVA FVKG LHMTSLKPEDTAV YIDDYSY TVSS ARSGHAFT YYCAA
13E03 186 EVQLVESGGGL 257 TYPMG 328 WFRQAPG 399 AISMSGDDTAYA 470
RFTISRDSARNTVY 541 RTSYDGRYD 612 WGQGTQV VQAGGSLRLSC KEREFVA TFVKG
LHMTRLKPEDTAV YIDPYSD TVSS AASGRTFT YSCAA 13E08 187 EVQLVESRGGL 258
SYPMG 329 WFRQAPG 400 AISMSGDDTAVA 471 RFTISRDNARNTVY 542 RTSYSGRYD
613 WGQGTQV VQAGGSLRLSC KEREFVA TFVKG LHMTSLKPEDTAV YIDDYSY TVSS
AGSGRTLY YHCAA 13G04 188 EVQLVESGGGL 259 SYPMG 330 WFRQAPG 401
AISMSGDDTAVA 472 RFTISRDNARNTVY 543 RTSYSGRYD 614 WGQGTQV
VQAGGSLRLSC KEREFVA TFVKG LHMSSLKPEDTAV YIDDYSY TVSS AASGRTLY YHCAA
13G05 189 EVQLVESGGGL 260 TYPMG 331 WFRQAPG 402 AISMSGDDTAYA 473
RFTFSRDDDKNTVY 544 RTSYSGMYD 615 WGQGTQV VQAGGSLELSC KEREFVA TFVKG
LHMTSLKPEDTAV YIHDYSY TVSS ARSGRTFT YYCAA 13G08 190 EVQLVESGGGL 261
SYPMG 332 WFRQAPG 403 AISMSGDDSAYR 474 RFTISRDNARDTVY 545 RTSYNGRYD
616 WGQGTQV VQAGGSLRLSC KEREFVA DFVKG LHMTSLKPEDTAIY YIDDYSY TVSS
AASGRTFF YCAA 13H03 191 EVQLVESGGGL 262 TYPMG 333 WFRQAPG 404
AISMSGDDTAYA 475 RFTISRDNARNTVY 546 RTSYDGRYD 617 WGQGTQV
VQAGGSLRLSC KEREFVA TFVKG LHMTRLKPEDTAV YIDDYSD TVSS AASGRTFT YSCAA
17C01 192 EVQLVESGGRL 263 SYPMG 334 WFRQAPG 405 AISMSGDDAAYA 476
RFTISRDDARNTVY 547 RTSYDGTYD 618 WGQGTQV VQAGGSLRLPC KEREFVA DFVRG
LHMTSLKPEDTAV YIDDYSY TVSS AASGRTFT YYCAA 15A08 193 EVQLVESGGGL 264
YYAIG 335 WFRQAPG 406 CVSSSDGRTAYA 477 RFTISRDNAKNTVY 548 VMEYGLGCT
619 WGQGTLV VQPGGSLRLSC KEREGVS DSVKG LQMNSLKPEDTAV TDVLDA TVSS
AASGFTLD YYCAT 13G02 194 EVQLVESRGGL 265 VFAMR 336 WFRQAPG 407
GISWTGGTTYYA 478 RFTMSADNAKNTV 549 DVGGGSDRY 620 LGQGTQV
VQAGGSLRLSC KEREFVA DSVKG YLQMNSLKPEDTA TVSS AASGGTFS VYYCAV 17E02
195 EVQLVESRGGL 266 VFAMR 337 WFRQAPG 408 GISWTGGTTYYA 479
RFTMSADNAKNTV 550 DVGGGSDRY 621 LGQGTQV VQAGGSLRLSC KEREFVA DSVKG
YLQMNSLKPEDTA TVSS AASGGTFS VYYCAV 18B05 196 EVQLVKSGGG 267 LFAMG
338 WFREAPG 409 AIRWSDGSSYYA 480 RFTISRDNAKNAVH 551 DVQGGLHR 622
WGQGTQV LVQPGGSLRLS KEREFVA DSVKG LQSNSLKSEDTAVY Y TVSS CAASGGTFS
YCYA
[0506] Thus, in the Nanobodies (or ISV's) of the invention, at
least one of the CDR1, CDR2 and CDR3 sequences present is suitably
chosen from the group consisting of the CDR1, CDR2 and CDR3
sequences, respectively, listed in Table B-1; or from the group of
CDR1, CDR2 and CDR3 sequences, respectively, that have at least
80%, preferably at least 90%, more preferably at least 95%, even
more preferably at least 99% "sequence identity" (as defined
herein) with at least one of the CDR1, CDR2 and CDR3 sequences,
respectively, listed in Table B-1; and/or from the group consisting
of the CDR1, CDR2 and CDR3 sequences, respectively, that have 3, 2
or only 1 "amino acid difference(s)" (as defined herein) with at
least one of the CDR1, CDR2 and CDR3 sequences, respectively,
listed in Table B-1.
[0507] In this context, by "suitably chosen" is meant that, as
applicable, a CDR1 sequence is chosen from suitable CDR1 sequences
(i.e. as defined herein), a CDR2 sequence is chosen from suitable
CDR2 sequences (i.e. as defined herein), and a CDR3 sequence is
chosen from suitable CDR3 sequences (i.e. as defined herein),
respectively. More in particular, the CDR sequences are preferably
chosen such that the Nanobodies (or ISV's) of the invention bind to
any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof with an affinity (suitably measured and/or expressed as a
K.sub.D-value (actual or apparent), a K.sub.A-value (actual or
apparent), a k.sub.on-rate and/or a k.sub.off-rate, or
alternatively as an IC.sub.50 value, as further described herein)
that is as defined herein.
[0508] In particular, in the Nanobodies (or ISV's) of the
invention, at least the CDR3 sequence present is suitably chosen
from the group consisting of the CDR3 sequences listed in Table B-1
or from the group of CDR3 sequences that have at least 80%,
preferably at least 90%, more preferably at least 95%, even more
preferably at least 99% sequence identity with at least one of the
CDR3 sequences listed in Table B-1; and/or from the group
consisting of the CDR3 sequences that have 3, 2 or only 1 amino
acid difference(s) with at least one of the CDR3 sequences listed
in Table B-1.
[0509] Preferably, in the Nanobodies (or ISV's) of the invention,
at least two of the CDR1, CDR2 and CDR3 sequences present are
suitably chosen from the group consisting of the CDR1, CDR2 and
CDR3 sequences, respectively, listed in Table B-1 or from the group
consisting of CDR1, CDR2 and CDR3 sequences, respectively, that
have at least 80%, preferably at least 90%, more preferably at
least 95%, even more preferably at least 99% sequence identity with
at least one of the CDR1, CDR2 and CDR3 sequences, respectively,
listed in Table B-1; and/or from the group consisting of the CDR1,
CDR2 and CDR3 sequences, respectively, that have 3, 2 or only 1
"amino acid difference(s)" with at least one of the CDR1, CDR2 and
CDR3 sequences, respectively, listed in Table B-1.
[0510] In particular, in the Nanobodies (or ISV's) of the
invention, at least the CDR3 sequence present is suitably chosen
from the group consisting of the CDR3 sequences listed in Table B-1
or from the group of CDR3 sequences that have at least 80%,
preferably at least 90%, more preferably at least 95%, even more
preferably at least 99% sequence identity with at least one of the
CDR3 sequences listed in Table B-1, respectively; and at least one
of the CDR1 and CDR2 sequences present is suitably chosen from the
group consisting of the CDR1 and CDR2 sequences, respectively,
listed in Table B-1 or from the group of CDR1 and CDR2 sequences,
respectively, that have at least 80%, preferably at least 90%, more
preferably at least 95%, even more preferably at least 99% sequence
identity with at least one of the CDR1 and CDR2 sequences,
respectively, listed in Table B-1; and/or from the group consisting
of the CDR1 and CDR2 sequences, respectively, that have 3, 2 or
only 1 amino acid difference(s) with at least one of the CDR1 and
CDR2 sequences, respectively, listed in Table B-1.
[0511] Most preferably, in the Nanobodies (or ISV's) of the
invention, all three CDR1, CDR2 and CDR3 sequences present are
suitably chosen from the group consisting of the CDR1, CDR2 and
CDR3 sequences, respectively, listed in Table B-1 or from the group
of CDR1, CDR2 and CDR3 sequences, respectively, that have at least
80%, preferably at least 90%, more preferably at least 95%, even
more preferably at least 99% sequence identity with at least one of
the CDR1, CDR2 and CDR3 sequences, respectively, listed in Table
B-1; and/or from the group consisting of the CDR1, CDR2 and CDR3
sequences, respectively, that have 3, 2 or only 1 amino acid
difference(s) with at least one of the CDR1, CDR2 and CDR3
sequences, respectively, listed in Table B-1.
[0512] Even more preferably, in the Nanobodies (or ISV's) of the
invention, at least one of the CDR1, CDR2 and CDR3 sequences
present is suitably chosen from the group consisting of the CDR1,
CDR2 and CDR3 sequences, respectively, listed in Table B-1.
Preferably, in this aspect, at least one or preferably both of the
other two CDR sequences present are suitably chosen from CDR
sequences that have at least 80%, preferably at least 90%, more
preferably at least 95%, even more preferably at least 99% sequence
identity with at least one of the corresponding CDR sequences,
respectively, listed in Table B-1; and/or from the group consisting
of the CDR sequences that have 3, 2 or only 1 amino acid
difference(s) with at least one of the corresponding sequences,
respectively, listed in Table B-1.
[0513] In particular, in the Nanobodies (or ISV's) of the
invention, at least the CDR3 sequence present is suitably chosen
from the group consisting of the CDR3 listed in Table B-1.
Preferably, in this aspect, at least one and preferably both of the
CDR1 and CDR2 sequences present are suitably chosen from the groups
of CDR1 and CDR2 sequences, respectively, that have at least 80%,
preferably at least 90%, more preferably at least 95%, even more
preferably at least 99% sequence identity with the CDR1 and CDR2
sequences, respectively, listed in Table B-1; and/or from the group
consisting of the CDR1 and CDR2 sequences, respectively, that have
3, 2 or only 1 amino acid difference(s) with at least one of the
CDR1 and CDR2 sequences, respectively, listed in Table B-1.
[0514] Even more preferably, in the Nanobodies (or ISV's) of the
invention, at least two of the CDR1, CDR2 and CDR3 sequences
present are suitably chosen from the group consisting of the CDR1,
CDR2 and CDR3 sequences, respectively, listed in Table B-1.
Preferably, in this aspect, the remaining CDR sequence present is
suitably chosen from the group of CDR sequences that have at least
80%, preferably at least 90%, more preferably at least 95%, even
more preferably at least 99% sequence identity with at least one of
the corresponding CDR sequences listed in Table B-1; and/or from
the group consisting of CDR sequences that have 3, 2 or only 1
amino acid difference(s) with at least one of the corresponding
sequences listed in Table B-1.
[0515] In particular, in the Nanobodies (or ISV's) of the
invention, at least the CDR3 sequence is suitably chosen from the
group consisting of the CDR3 sequences listed in Table B-1, and
either the CDR1 sequence or the CDR2 sequence is suitably chosen
from the group consisting of the CDR1 and CDR2 sequences,
respectively, listed in Table B-1. Preferably, in this aspect, the
remaining CDR sequence present is suitably chosen from the group of
CDR sequences that have at least 80%, preferably at least 90%, more
preferably at least 95%, even more preferably at least 99% sequence
identity with at least one of the corresponding CDR sequences
listed in Table B-1; and/or from the group consisting of CDR
sequences that have 3, 2 or only 1 amino acid difference(s) with
the corresponding CDR sequences listed in Table B-1.
[0516] Even more preferably, in the Nanobodies (or ISV's) of the
invention, each of the CDR1, CDR2 and CDR3 sequences present are
suitably chosen from the group consisting of the CDR1, CDR2 and
CDR3 sequences, respectively, listed in Table B-1.
[0517] Also, generally, the combinations of CDR's listed in Table
B-1 (i.e. those mentioned on the same line, e.g. row, in Table B-1)
are preferred. Thus, it is generally preferred that, when a CDR in
a Nanobody (or ISV) of the invention is a CDR sequence mentioned in
Table B-1 or is suitably chosen from the group of CDR sequences
that have at least 80%, preferably at least 90%, more preferably at
least 95%, even more preferably at least 99% sequence identity with
a CDR sequence listed in Table B-1; and/or from the group
consisting of CDR sequences that have 3, 2 or only 1 amino acid
difference(s) with a CDR sequence listed in Table B-1, that at
least one and preferably both of the other CDR's are suitably
chosen from the CDR sequences that belong to the same combination
in Table B-1 (i.e. mentioned on the same line, e.g. row, in Table
B-1) or are suitably chosen from the group of CDR sequences that
have at least 80%, preferably at least 90%, more preferably at
least 95%, even more preferably at least 99% sequence identity with
the CDR sequence(s) belonging to the same combination and/or from
the group consisting of CDR sequences that have 3, 2 or only 1
amino acid difference(s) with the CDR sequence(s) belonging to the
same combination. The other preferences indicated in the above
paragraphs also apply to the combinations of CDR's mentioned in
Table B-1.
[0518] Thus, by means of non-limiting examples, a Nanobody (or ISV)
of the invention can for example comprise a CDR1 sequence that has
more than 80% sequence identity with one of the CDR1 sequences
mentioned in Table B-1, a CDR2 sequence that has 3, 2 or 1 amino
acid difference with one of the CDR2 sequences mentioned in Table
B-1 (but belonging to a different combination, e.g. from at least
one different row), and a CDR3 sequence.
[0519] Some preferred Nanobodies (or ISV's) of the invention may
for example comprise: (1) a CDR1 sequence that has more than 80%
sequence identity with one of the CDR1 sequences mentioned in Table
B-1; a CDR2 sequence that has 3, 2 or 1 amino acid difference with
one of the CDR2 sequences mentioned in Table B-1 (but belonging to
a different combination, e.g. from at least one different row); and
a CDR3 sequence that has more than 80% sequence identity with one
of the CDR3 sequences mentioned in Table B-1 (but belonging to a
different combination); or (2) a CDR I sequence that has more than
80% sequence identity with one of the CDR1 sequences mentioned in
Table B-1; a CDR2 sequence, and one of the CDR3 sequences listed in
Table B-1; or (3) a CDR1 sequence; a CDR2 sequence that has more
than 80% sequence identity with one of the CDR2 sequence listed in
Table B-1; and a CDR3 sequence that has 3, 2 or 1 amino acid
differences with the CDR3 sequence mentioned in Table B-1 that
belongs to the same combination as the CDR2 sequence.
[0520] In this context, the person skilled in the art will
appreciate that the "same combination" refers to a combination of
CDR1, CDR2 and CDR3 which are depicted on the same row (or line) in
Table B-1, and that a "different combination" refers to a
combination of CDR1, CDR2 and CDR3, of which at least one CDR is
not depicted on the same row (or line) in Table B-1 as at least one
other CDR.
[0521] Some particularly preferred Nanobodies (or ISV's) of the
invention may for example comprise: (1) a CDR1 sequence that has
more than 80% sequence identity with one of the CDR1 sequences
mentioned in Table B-1; a CDR2 sequence that has 3, 2 or 1 amino
acid difference with the CDR2 sequence mentioned in Table B-1 that
belongs to the same combination; and a CDR3 sequence that has more
than 80% sequence identity with the CDR3 sequence mentioned in
Table B-1 that belongs to the same combination; (2) a CDR1
sequence; a CDR 2 listed in Table B-1 and a CDR3 sequence listed in
Table B-1 (in which the CDR2 sequence and CDR3 sequence may belong
to different combinations).
[0522] Some even more preferred Nanobodies (or ISV's) of the
invention may for example comprise: (1) a CDR1 sequence that has
more than 80% sequence identity with one of the CDR1 sequences
mentioned in Table B-1; the CDR2 sequence listed in Table B-1 that
belongs to the same combination; and a CDR3 sequence mentioned in
Table B-1 that belongs to a different combination; or (2) a CDR1
sequence mentioned in Table B-1; a CDR2 sequence that has 3, 2 or 1
amino acid differences with the CDR2 sequence mentioned in Table
B-1 that belongs to the same combination; and a CDR3 sequence that
has more than 80% sequence identity with the CDR3 sequence listed
in Table B-1 that belongs to the same or a different
combination.
[0523] Particularly preferred Nanobodies (or ISV's) of the
invention may for example comprise a CDR1 sequence mentioned in
Table B-1, a CDR2 sequence that has more than 80% sequence identity
with the CDR2 sequence mentioned in Table B-1 that belongs to the
same combination; and the CDR3 sequence mentioned in Table B-1 that
belongs to the same combination.
[0524] In the most preferred Nanobodies (or ISV's) of the
invention, the CDR1, CDR2 and CDR3 sequences present are suitably
chosen from one of the combinations of CDR1, CDR2 and CDR3
sequences, respectively, listed in Table B-1.
[0525] According to another preferred, but non-limiting aspect of
the invention (a) CDR1 has a length of between 1 and 12 amino acid
residues, and usually between 2 and 9 amino acid residues, such as
5, 6 or 7 amino acid residues; and/or (b) CDR2 has a length of
between 13 and 24 amino acid residues, and usually between 15 and
21 amino acid residues, such as 16 and 17 amino acid residues;
and/or (c) CDR3 has a length of between 2 and 35 amino acid
residues, and usually between 3 and 30 amino acid residues, such as
between 6 and 23 amino acid residues.
[0526] In another preferred, but non-limiting aspect, the invention
relates to a Nanobody (or ISV) in which the CDR sequences (as
defined herein) have more than 80%, preferably more than 90%, more
preferably more than 95%, such as 99% or more sequence identity (as
defined herein) with the CDR sequences of at least one of the amino
acid sequences of SEQ ID NOs: 623 to 693 (see Table A-1).
[0527] Generally, Nanobodies (or ISV's) with the above CDR
sequences may be as further described herein, and preferably have
framework sequences that are also as further described herein,
Thus, for example and as mentioned herein, such Nanobodies (or
ISV's) may be naturally occurring Nanobodies (or ISV's) (from any
suitable species), naturally occurring V.sub.HH sequences (i.e.
from a suitable species of Camelid) or synthetic or semi-synthetic
amino acid sequences or Nanobodies (or ISV's), including but not
limited to partially humanized Nanobodies (or ISV's) or V.sub.HH
sequences, fully humanized Nanobodies (or ISV's) or V.sub.HH
sequences, camelized heavy chain variable domain sequences, as well
as Nanobodies (or ISV's) that have been obtained by the techniques
mentioned herein.
[0528] Thus, in one specific, but non-limiting aspect, the
invention relates to a humanized Nanobody (or ISV), which consists
of 4 framework regions (FR1 to FR4 respectively) and 3
complementarity determining regions (CDR1 to CDR3 respectively), in
which CDR1 to CDR3 are as defined herein and in which said
humanized Nanobody (or ISV) comprises at least one humanizing
substitution (as defined herein), and in particular at least one
humanizing substitution in at least one of its framework sequences
(as defined herein).
[0529] In another preferred, but non-limiting aspect, the invention
relates to a Nanobody (or ISV) in which the CDR sequences have at
least 70% amino acid identity, preferably at least 80% amino acid
identity, more preferably at least 90% amino acid identity, such as
95% amino acid identity or more or even essentially 100% amino acid
identity with the CDR sequences of at least one of the amino acid
sequences of SEQ ID NOs: 623 to 693 (see Table A-1). This degree of
amino acid identity can for example be determined by determining
the degree of amino acid identity (in a manner described herein)
between said Nanobody (or ISV) and one or more of the sequences of
SEQ ID NOs: 623 to 693 (see Table A-1), in which the amino acid
residues that form the framework regions are disregarded. Such
Nanobodies (or ISV's) can be as further described herein.
[0530] In another preferred, but non-limiting aspect, the invention
relates to a Nanobody (or ISV) with an amino acid sequence that is
chosen from the group consisting of SEQ ID NOs: 623 to 693 (see
Table A-1) or from the group consisting of from amino acid
sequences that have more than 80%, preferably more than 90%, more
preferably more than 95%, such as 99% or more sequence identity (as
defined herein) with at least one of the amino acid sequences of
SEQ ID NOs: 623 to 693 (see Table A-1).
[0531] It will be clear to the skilled person that the Nanobodies
(or ISV's) that are mentioned herein as "preferred" (or "more
preferred", "even more preferred", etc.) are also preferred (or
more preferred, or even more preferred, etc.) for use in the
polypeptides described herein. Thus, polypeptides that comprise or
essentially consist of one or more "preferred" Nanobodies (or
ISV's) of the invention will generally be preferred, and
polypeptides that comprise or essentially consist of one or more
"more preferred" Nanobodies (or ISV's) of the invention will
generally be more preferred, etc.
[0532] Generally, proteins or polypeptides that comprise or
essentially consist of a single Nanobody (or ISV) (such as a single
Nanobody (or ISV) of the invention) will be referred to herein as
"monovalent" proteins or polypeptides or as "monovalent
constructs". Proteins and polypeptides that comprise or essentially
consist of two or more Nanobodies (or ISV's) (such as at least two
Nanobodies (or ISV's) of the invention or at least one Nanobody (or
ISV) of the invention and at least one other Nanobody (or ISV))
will be referred to herein as "multivalent" proteins or
polypeptides or as "multivalent constructs", and these may provide
certain advantages compared to the corresponding monovalent
Nanobodies (or ISV's) of the invention. Some non-limiting examples
of such multivalent constructs will become clear from the further
description herein.
[0533] According to one specific, but non-limiting aspect, a
polypeptide of the invention comprises or essentially consists of
at least two Nanobodies (or ISV's) of the invention, such as two or
three Nanobodies (or ISV's) of the invention. As further described
herein, such multivalent constructs can provide certain advantages
compared to a protein or polypeptide comprising or essentially
consisting of a single Nanobody (or ISV) of the invention, such as
a much improved avidity for any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof. Such multivalent constructs will be
clear to the skilled person based on the disclosure herein.
[0534] According to another specific, but non-limiting aspect, a
polypeptide of the invention comprises or essentially consists of
at least one Nanobody (or ISV) of the invention and at least one
other binding unit (i.e. directed against another epitope, antigen,
target, protein or polypeptide), which is preferably also a
Nanobody (or ISV). Such proteins or polypeptides are also referred
to herein as "multispecific" proteins or polypeptides or as
`multispecific constructs", and these may provide certain
advantages compared to the corresponding monovalent Nanobodies (or
ISV's) of the invention (as will become clear from the further
discussion herein of some preferred, but-nonlimiting multispecific
constructs). Such multispecific constructs will be clear to the
skilled person based on the disclosure herein.
[0535] According to yet another specific, but non-limiting aspect,
a polypeptide of the invention comprises or essentially consists of
at least one Nanobody (or ISV) of the invention, optionally one or
more further Nanobodies (or ISV's), and at least one other amino
acid sequence (such as a protein or polypeptide) that confers at
least one desired property to the Nanobody (or ISV) of the
invention and/or to the resulting fusion protein. Again, such
fusion proteins may provide certain advantages compared to the
corresponding monovalent Nanobodies (or ISV's) of the invention.
Some non-limiting examples of such amino acid sequences and of such
fusion constructs will become clear from the further description
herein.
[0536] It is also possible to combine two or more of the above
aspects, for example to provide a trivalent bispecific construct
comprising two Nanobodies (or ISV's) of the invention and one other
Nanobody (or ISV), and optionally one or more other amino acid
sequences. Further non-limiting examples of such constructs, as
well as some constructs that are particularly preferred within the
context of the present invention, will become clear from the
further description herein.
[0537] In the above constructs, the one or more Nanobodies (or
ISV's) and/or other amino acid sequences may be directly linked to
each other and/or suitably linked to each other via one or more
linker sequences. Some suitable but non-limiting examples of such
linkers will become clear from the further description herein.
[0538] In one specific aspect of the invention, a Nanobody (or ISV)
of the invention or a compound, construct or polypeptide of the
invention comprising at least one Nanobody (or ISV) of the
invention may have an increased half-life, compared to the
corresponding amino acid sequence of the invention. Some preferred,
but non-limiting examples of such Nanobodies (or ISV's), compounds
and polypeptides will become clear to the skilled person based on
the further disclosure herein, and for example comprise Nanobodies
(or ISV's) sequences or polypeptides of the invention that have
been chemically modified to increase the half-life thereof (for
example, by means of pegylation); amino acid sequences of the
invention that comprise at least one additional binding site for
binding to a serum protein (such as serum albumin, see for example
EP 0 368 684 B1, page 4); or polypeptides of the invention that
comprise at least one Nanobody (or ISV) of the invention that is
linked to at least one moiety (and in particular at least one amino
acid sequence) that increases the half-life of the Nanobody (or
ISV) of the invention. Examples of polypeptides of the invention
that comprise such half-life extending moieties or amino acid
sequences will become clear to the skilled person based on the
further disclosure herein; and for example include, without
limitation, polypeptides in which the one or more Nanobodies (or
ISV's) of the invention are suitable linked to one or more serum
proteins or fragments thereof (such as serum albumin or suitable
fragments thereof) or to one or more binding units that can bind to
serum proteins (such as, for example, Nanobodies (or ISV's) or
(single) domain antibodies that can bind to serum proteins such as
serum albumin, serum immunoglobulins such as IgG, or transferrin);
polypeptides in which a Nanobody (or ISV) of the invention is
linked to an Fc portion (such as a human Fc) or a suitable part or
fragment thereof; or polypeptides in which the one or more
Nanobodies (or ISV's) of the invention are suitable linked to one
or more small proteins or peptides that can bind to serum proteins
(such as, without limitation, the proteins and peptides described
in WO 91/01743, WO 01/45746, WO 02/076489 and to the US provisional
application of Ablynx N.V. entitled "Peptides capable of binding to
serum proteins" of Ablynx N.V. filed on Dec. 5, 2006 (see also
PCT/EP/2007/063348).
[0539] Again, as will be clear to the skilled person, such
Nanobodies (or ISV's), compounds, constructs or polypeptides may
contain one or more additional groups, residues, moieties or
binding units, such as one or more further amino acid sequences and
in particular one or more additional Nanobodies (or ISV's) (i.e.
not directed against any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof), so as to provide a tri- of
multispecific Nanobody (or ISV) construct.
[0540] Generally, the Nanobodies (or ISV's) of the invention (or
compounds, constructs or polypeptides comprising the same) with
increased half-life preferably have a half-life that is at least
1.5 times, preferably at least 2 times, such as at least 5 times,
for example at least 10 times or more than 20 times, greater than
the half-life of the corresponding amino acid sequence of the
invention per se. For example, the Nanobodies (or ISV's),
compounds, constructs or polypeptides of the invention with
increased half-life may have a half-life that is increased with
more than 1 hours, preferably more than 2 hours, more preferably
more than 6 hours, such as more than 12 hours, or even more than
24, 48 or 72 hours, compared to the corresponding amino acid
sequence of the invention per se.
[0541] In a preferred, but non-limiting aspect of the invention,
such Nanobodies (or ISV's), compound, constructs or polypeptides of
the invention exhibit a serum half-life in human of at least about
12 hours, preferably at least 24 hours, more preferably at least 48
hours, even more preferably at least 72 hours or more. For example,
compounds or polypeptides of the invention may have a half-life of
at least 5 days (such as about 5 to 10 days), preferably at least 9
days (such as about 9 to 14 days), more preferably at least about
10 days (such as about 10 to 15 days), or at least about 11 days
(such as about 11 to 16 days), more preferably at least about 12
days (such as about 12 to 18 days or more), or more than 14 days
(such as about 14 to 19 days).
[0542] In another one aspect of the invention, a polypeptide of the
invention comprises one or more (such as two or preferably one)
Nanobodies (or ISV's) of the invention linked (optionally via one
or more suitable linker sequences) to one or more (such as two and
preferably one) amino acid sequences that allow the resulting
polypeptide of the invention to cross the blood brain barrier. In
particular, said one or more amino acid sequences that allow the
resulting polypeptides of the invention to cross the blood brain
barrier may be one or more (such as two and preferably one)
Nanobodies (or ISV's), such as the Nanobodies (or ISV's) described
in WO 02/057445, of which FC44 (SEQ ID NO: 189 of WO 06/040153) and
FC5 (SEQ ID NO: 190 of WO 06/040154) are preferred examples.
[0543] In particular, polypeptides comprising one or more
Nanobodies (or ISV's) of the invention are preferably such that
they: [0544] bind to any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof with a dissociation constant
(K.sub.D) of 10.sup.-5 to 10.sup.-12 moles/liter or less, and
preferably 10.sup.-7 to 10.sup.-12 moles/liter or less and more
preferably 10.sup.-8 to 10.sup.-12 moles/liter (i.e. with an
association constant (K.sub.A) of 10.sup.5 to 10.sup.12 liter/moles
or more, and preferably 10.sup.7 to 10.sup.12 liter/moles or more
and more preferably 10.sup.8 to 10.sup.12 liter/moles); and/or such
that they: [0545] bind to any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof with a k.sub.on-rate of between
10.sup.2 M.sup.-1s.sup.-1 to about 10.sup.7 M.sup.-1s.sup.-1,
preferably between 10.sup.3 M.sup.-1s.sup.-1 and 10.sup.7
M.sup.-1s.sup.-1, more preferably between 10.sup.4 M.sup.-1s.sup.-1
and 10.sup.7 M.sup.-1s.sup.-1, such as between 10.sup.5
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1; and/or such that
they: [0546] bind to any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof with a k.sub.off rate between 1
s.sup.-1 (t.sub.1/2=0.69 s) and 10.sup.-6 s.sup.-1 (providing a
near irreversible complex with a t.sub.1/2 of multiple days),
preferably between 10.sup.-2 s.sup.-1 and 10.sup.-6 s.sup.-1, more
preferably between 10.sup.-3 s.sup.-1 and 10.sup.-6 s.sup.-1, such
as between 10.sup.-4 s.sup.-1 and 10.sup.-6 s.sup.-1.
[0547] Preferably, a polypeptide that contains only one amino acid
sequence of the invention is preferably such that it will bind to
any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof with an affinity less than 500 nM, preferably less than 200
nM, more preferably less than 10 nM, more preferably less than 1
nM, such as less than 500 pM. In this respect, it will be clear to
the skilled person that a polypeptide that contains two or more
Nanobodies (or ISV's) of the invention may bind to any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof with an
increased avidity, compared to a polypeptide that contains only one
amino acid sequence of the invention.
[0548] Some preferred IC.sub.50 values for binding of the amino
acid sequences or polypeptides of the invention to any of 1L-17A,
IL-17F and/or IL-17A/F including combinations thereof will become
clear from the further description and examples herein.
[0549] Another aspect of this invention relates to a nucleic acid
that encodes an amino acid sequence of the invention (such as a
Nanobody (or ISV) of the invention) or a polypeptide of the
invention comprising the same. Again, as generally described herein
for the nucleic acids of the invention, such a nucleic acid may be
in the form of a genetic construct, as defined herein.
[0550] In another aspect, the invention relates to host or host
cell that expresses or that is capable of expressing an amino acid
sequence (such as a Nanobody (or ISV)) of the invention and/or a
polypeptide of the invention comprising the same; and/or that
contains a nucleic acid of the invention. Some preferred but
non-limiting examples of such hosts or host cells will become clear
from the further description herein.
[0551] Another aspect of the invention relates to a product or
composition containing or comprising at least one amino acid
sequence of the invention, at least one polypeptide of the
invention and/or at least one nucleic acid of the invention, and
optionally one or more further components of such compositions
known per se, i.e. depending on the intended use of the
composition. Such a product or composition may for example be a
pharmaceutical composition (as described herein), a veterinary
composition or a product or composition for diagnostic use (as also
described herein). Some preferred but non-limiting examples of such
products or compositions will become clear from the further
description herein.
[0552] The invention further relates to methods for preparing or
generating the amino acid sequences, compounds, constructs,
polypeptides, nucleic acids, host cells, products and compositions
described herein. Some preferred but non-limiting examples of such
methods will become clear from the further description herein.
[0553] The invention further relates to applications and uses of
the amino acid sequences, compounds, constructs, polypeptides,
nucleic acids, host cells, products and compositions described
herein, as well as to methods for the prevention and/or treatment
for diseases and disorders associated with any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof. Some preferred but
non-limiting applications and uses will become clear from the
further description herein.
[0554] Other aspects, embodiments, advantages and applications of
the invention will also become clear from the further description
hereinbelow.
[0555] Generally, it should be noted that the term Nanobody (or
ISV) as used herein in its broadest sense is not limited to a
specific biological source or to a specific method of preparation.
For example, as will be discussed in more detail below, the
Nanobodies (or ISV's) of the invention can generally be obtained by
any of the techniques (1) to (8) mentioned on pages 61 and 62 of WO
08/020079, or any other suitable technique known per se. One
preferred class of Nanobodies (or ISV's) corresponds to the
V.sub.HH domains of naturally occurring heavy chain antibodies
directed against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof. As further described herein, such V.sub.HH
sequences can generally be generated or obtained by suitably
immunizing a species of Camelid with any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof (i.e. so as to raise an
immune response and/or heavy chain antibodies directed against any
of IL-17A, IL-17F and/or IL-17A/F including combinations thereof),
by obtaining a suitable biological sample from said Camelid (such
as a blood sample, serum sample or sample of B-cells), and by
generating V.sub.HH sequences directed against any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof, starting
from said sample, using any suitable technique known per se. Such
techniques will be clear to the skilled person and/or are further
described herein.
[0556] Alternatively, such naturally occurring V.sub.HH domains
against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof, can be obtained from naive libraries of
Camelid V.sub.HH sequences, for example by screening such a library
using any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof, or at least one part, fragment, antigenic determinant or
epitope thereof using one or more screening techniques known per
se. Such libraries and techniques are for example described in WO
99/37681, WO 01/90190, WO 03/025020 and WO 03/035694.
Alternatively, improved synthetic or semi-synthetic libraries
derived from naive V.sub.HH libraries may be used, such as V.sub.HH
libraries obtained from naive V.sub.HH libraries by techniques such
as random mutagenesis and/or CDR shuffling, as for example
described in WO 00/43507.
[0557] Thus, in another aspect, the invention relates to a method
for generating Nanobodies (or ISV's), that are directed against any
of IL-17A, IL-17F and/or IL-17A/F including combinations thereof.
In one aspect, said method at least comprises the steps of: [0558]
a) providing a set, collection or library of Nanobody (or ISV)
sequences; and [0559] b) screening said set, collection or library
of Nanobody (or ISV) sequences for Nanobody (or ISV) sequences that
can bind to and/or have affinity for any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof; and [0560] c) isolating
the Nanobody (or ISV) or Nanobodies (or ISV's) that can bind to
and/or have affinity for any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof.
[0561] In such a method, the set, collection or library of Nanobody
(or ISV) sequences may be a naive set, collection or library of
Nanobody (or ISV) sequences; a synthetic or semi-synthetic set,
collection or library of Nanobody (or ISV) sequences; and/or a set,
collection or library of Nanobody (or ISV) sequences that have been
subjected to affinity maturation.
[0562] In a preferred aspect of this method, the set, collection or
library of Nanobody (or ISV) sequences may be an immune set,
collection or library of Nanobody (or ISV) sequences, and in
particular an immune set, collection or library of V.sub.HH
sequences, that have been derived from a species of Camelid that
has been suitably immunized with any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof or with a suitable
antigenic determinant based thereon or derived therefrom, such as
an antigenic part, fragment, region, domain, loop or other epitope
thereof. In one particular aspect, said antigenic determinant may
be an extracellular part, region, domain, loop or other
extracellular epitope(s).
[0563] In the above methods, the set, collection or library of
Nanobody (or ISV) or V.sub.HH sequences may be displayed on a
phage, phagemid, ribosome or suitable micro-organism (such as
yeast), such as to facilitate screening. Suitable methods,
techniques and host organisms for displaying and screening (a set,
collection or library of) Nanobody (or ISV) sequences will be clear
to the person skilled in the art, for example on the basis of the
further disclosure herein. Reference is also made to WO 03/054016
and to the review by Hoogenboom in Nature Biotechnology, 23, 9,
1105-1116 (2005).
[0564] In another aspect, the method for generating Nanobody (or
ISV) sequences comprises at least the steps of: [0565] a) providing
a collection or sample of cells derived from a species of Camelid
that express immunoglobulin sequences; [0566] b) screening said
collection or sample of cells for (i) cells that express an
immunoglobulin sequence that can bind to and/or have affinity for
any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof; and (ii) cells that express heavy chain antibodies, in
which substeps (i) and (ii) can be performed essentially as a
single screening step or in any suitable order as two separate
screening steps, so as to provide at least one cell that expresses
a heavy chain antibody that can bind to and/or has affinity for any
of IL-17A, IL-17F and/or IL-17A/F including combinations thereof;
and [0567] c) either (i) isolating from said cell the V.sub.HH
sequence present in said heavy chain antibody; or (ii) isolating
from said cell a nucleic acid sequence that encodes the V.sub.HH
sequence present in said heavy chain antibody, followed by
expressing said V.sub.HH domain.
[0568] In the method according to this aspect, the collection or
sample of cells may for example be a collection or sample of
B-cells. Also, in this method, the sample of cells may be derived
from a Camelid that has been suitably immunized with any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof or a suitable
antigenic determinant based thereon or derived therefrom, such as
an antigenic part, fragment, region, domain, loop or other epitope
thereof. In one particular aspect, said antigenic determinant may
be an extracellular part, region, domain, loop or other
extracellular epitope(s).
[0569] The above method may be performed in any suitable manner, as
will be clear to the skilled person. Reference is for example made
to EP 0 542 810, WO 05/19824, WO 04/051268 and WO 04/106377. The
screening of step b) is preferably performed using a flow cytometry
technique such as FACS. For this, reference is for example made to
Lieby et al., Blood, Vol. 97, No. 12, 3820. Particular reference is
made to the so-called "Nanoclone.TM." technique described in
International application WO 06/079372 by Ablynx N.V.
[0570] In another aspect, the method for generating an amino acid
sequence directed against any of IL-17A, IL-17F and/or IL-l7A/F
including combinations thereof may comprise at least the steps of:
[0571] a) providing a set, collection or library of nucleic acid
sequences encoding heavy chain antibodies or Nanobody (or ISV)
sequences; [0572] b) screening said set, collection or library of
nucleic acid sequences for nucleic acid sequences that encode a
heavy chain antibody or a Nanobody (or ISV) sequence that can bind
to and/or has affinity for any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof; and [0573] c) isolating said
nucleic acid sequence, followed by expressing the V.sub.HH sequence
present in said heavy chain antibody or by expressing said Nanobody
(or ISV) sequence, respectively.
[0574] In such a method, the set, collection or library of nucleic
acid sequences encoding heavy chain antibodies or Nanobody (or ISV)
sequences may for example be a set, collection or library of
nucleic acid sequences encoding a naive set, collection or library
of heavy chain antibodies or V.sub.HH sequences; a set, collection
or library of nucleic acid sequences encoding a synthetic or
semi-synthetic set, collection or library of Nanobody (or ISV)
sequences; and/or a set, collection or library of nucleic acid
sequences encoding a set, collection or library of Nanobody (or
ISV) sequences that have been subjected to affinity maturation.
[0575] In a preferred aspect of this method, the set, collection or
library of nucleic acid sequences may be an immune set, collection
or library of nucleic acid sequences encoding heavy chain
antibodies or V.sub.HH sequences derived from a Camelid that has
been suitably immunized with any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof or with a suitable antigenic
determinant based thereon or derived therefrom, such as an
antigenic part, fragment, region, domain, loop or other epitope
thereof. In one particular aspect, said antigenic determinant may
be an extracellular part, region, domain, loop or other
extracellular epitope(s).
[0576] In the above methods, the set, collection or library of
nucleotide sequences may be displayed on a phage, phagemid,
ribosome or suitable micro-organism (such as yeast), such as to
facilitate screening. Suitable methods, techniques and host
organisms for displaying and screening (a set, collection or
library of) nucleotide sequences encoding amino acid sequences will
be clear to the person skilled in the art, for example on the basis
of the further disclosure herein. Reference is also made to WO
03/054016 and to the review by Hoogenboom in Nature Biotechnology,
23, 9, 1105-1116 (2005).
[0577] As will be clear to the skilled person, the screening step
of the methods described herein can also be performed as a
selection step. Accordingly the term "screening" as used in the
present description can comprise selection, screening or any
suitable combination of selection and/or screening techniques.
Also, when a set, collection or library of sequences is used, it
may contain any suitable number of sequences, such as 1, 2, 3 or
about 5, 10, 50, 100, 500, 1000, 5000, 10.sup.4, 10.sup.5,
10.sup.6, 10.sup.7, 10.sup.8 or more sequences.
[0578] Also, one or more or all of the sequences in the above set,
collection or library of amino acid sequences may be obtained or
defined by rational, or semi-empirical approaches such as computer
modeling techniques or biostatics or datamining techniques.
[0579] Furthermore, such a set, collection or library can comprise
one, two or more sequences that are variants from one another (e.g.
with designed point mutations or with randomized positions),
compromise multiple sequences derived from a diverse set of
naturally diversified sequences (e.g. an immune library)), or any
other source of diverse sequences (as described for example in
Hoogenboom et al, Nat Biotechnol 23:1105, 2005 and Binz et al, Nat
Biotechnol 2005, 23:1247). Such set, collection or library of
sequences can be displayed on the surface of a phage particle, a
ribosome, a bacterium, a yeast cell, a mammalian cell, and linked
to the nucleotide sequence encoding the amino acid sequence within
these carriers. This makes such set, collection or library amenable
to selection procedures to isolate the desired amino acid sequences
of the invention. More generally, when a sequence is displayed on a
suitable host or host cell, it is also possible (and customary) to
first isolate from said host or host cell a nucleotide sequence
that encodes the desired sequence, and then to obtain the desired
sequence by suitably expressing said nucleotide sequence in a
suitable host organism. Again, this can be performed in any
suitable manner known per se, as will be clear to the skilled
person.
[0580] Yet another technique for obtaining V.sub.HH sequences or
Nanobody (or ISV) sequences directed against any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof involves suitably
immunizing a transgenic mammal that is capable of expressing heavy
chain antibodies (i.e. so as to raise an immune response and/or
heavy chain antibodies directed against any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof), obtaining a
suitable biological sample from said transgenic mammal that
contains (nucleic acid sequences encoding) said V.sub.HH sequences
or Nanobody (or ISV) sequences (such as a blood sample, serum
sample or sample of B-cells), and then generating V.sub.HH
sequences directed against any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof, starting from said sample, using
any suitable technique known per se (such as any of the methods
described herein or a hybridoma technique). For example, for this
purpose, the heavy chain antibody-expressing mice and the further
methods and techniques described in WO 02/085945, WO 04/049794 and
WO 06/008548 and Janssens et al., Proc. Natl. Acad. Sci. USA. 2006
Oct. 10; 103(41):15130-5 can be used. For example, such heavy chain
antibody expressing mice can express heavy chain antibodies with
any suitable (single) variable domain, such as (single) variable
domains from natural sources (e.g. human (single) variable domains,
Camelid (single) variable domains or shark (single) variable
domains), as well as for example synthetic or semi-synthetic
(single) variable domains.
[0581] The invention also relates to the V.sub.HH sequences or
Nanobody (or ISV) sequences that are obtained by the above methods,
or alternatively by a method that comprises the one of the above
methods and in addition at least the steps of determining the
nucleotide sequence or amino acid sequence of said V.sub.HH
sequence or Nanobody (or ISV) sequence; and of expressing or
synthesizing said V.sub.HH sequence or Nanobody (or ISV) sequence
in a manner known per se, such as by expression in a suitable host
cell or host organism or by chemical synthesis.
[0582] As mentioned herein, a particularly preferred class of
Nanobodies (or ISV's) of the invention comprises Nanobodies (or
ISV's) with an amino acid sequence that corresponds to the amino
acid sequence of a naturally occurring V.sub.HH domain, but that
has been "humanized", i.e. by replacing one or more amino acid
residues in the amino acid sequence of said naturally occurring
V.sub.HH sequence (and in particular in the framework sequences) by
one or more of the amino acid residues that occur at the
corresponding position(s) in a V.sub.H domain from a conventional
4-chain antibody from a human being (e.g. indicated above), as
further described on, and using the techniques mentioned on, page
63 of WO 08/020079. Another particularly preferred class of
Nanobodies (or ISV's) of the invention comprises Nanobodies (or
ISV's) with an amino acid sequence that corresponds to the amino
acid sequence of a naturally occurring V.sub.H domain, but that has
been "camelized", i.e. by replacing one or more amino acid residues
in the amino acid sequence of a naturally occurring V.sub.H domain
from a conventional 4-chain antibody by one or more of the amino
acid residues that occur at the corresponding position(s) in a
V.sub.HH domain of a heavy chain antibody, as further described on,
and using the techniques mentioned on, page 63 of WO 08/020079.
[0583] Other suitable methods and techniques for obtaining the
Nanobodies (or ISV's) of the invention and/or nucleic acids
encoding the same, starting from naturally occurring V.sub.H
sequences or preferably V.sub.HH sequences, will be clear from the
skilled person, and may for example include the techniques that are
mentioned on page 64 of WO 08/00279. As mentioned herein,
Nanobodies (or ISV's) may in particular be characterized by the
presence of one or more "Hallmark residues" (as described herein)
in one or more of the framework sequences.
[0584] Generally, immunoglobulin single variable domains (in
particular V.sub.HH sequences and sequence optimized immunoglobulin
single variable domains) can in particular be characterized by the
presence of one or more "Hallmark residues" (as described herein)
in one or more of the framework sequences (again as further
described herein).
[0585] Thus, generally, an immunoglobulin single variable domain
can be defined as an amino acid sequence with the (general)
structure [0586] FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 in which FR1 to FR4
refer to framework regions 1 to 4, respectively, and in which CDR1
to CDR3 refer to the complementarity determining regions 1 to 3,
respectively.
[0587] In a preferred aspect, the invention provides polypeptides
comprising at least an immunoglobulin single variable domain that
is an amino acid sequence with the (general) structure [0588]
FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 in which FR1 to FR4 refer to
framework regions 1 to 4, respectively, and in which CDR1 to CDR3
refer to the complementarity determining regions 1 to 3,
respectively, and in which: [0589] i) at least one of the amino
acid residues at positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and
108 according to the Kabat numbering are chosen from the Hallmark
residues mentioned in Table B-2 below; and in which: [0590] ii)
said amino acid sequence has at least 80%, more preferably 90%,
even more preferably 95% amino acid identity with at least one of
the immunoglobulin single variable domains as shown in WO
2009/138519 (see SEQ ID NO:s 1 to 125 herein, or in WO
2009/138519), in which for the purposes of determining the degree
of amino acid identity, the amino acid residues that form the CDR
sequences (indicated with X in the sequences) are disregarded: and
in which: [0591] iii) the CDR sequences are generally as further
defined herein (e.g. the CDR1, CDR2 and CDR3 in a combination as
provided in Table (B-2), note that the CDR definitions are
calculated according to the Kabat numbering system).
TABLE-US-00004 [0591] TABLE B-2 Hallmark Residues in VHHs Position
Human V.sub.H3 Hallmark Residues 11 L, V; L, S, V, M, W, F, T, Q,
E, A, R, G, K, predominantly L Y, N, P, I; preferably L 37 V, I, F;
F.sup.(1), Y, V, L, A, H, S, I, W, C, N, G, usually V D, T, P,
preferably F.sup.(1) or Y 44.sup.(8) G E.sup.(3), Q.sup.(3),
G.sup.(2), D, A, K, R, L, P, S, V, H, T, N, W, M, I; preferably
G.sup.(2), E.sup.(3) or Q.sup.(3); most preferably G.sup.(2) or
Q.sup.(3) 45.sup.(8) L L.sup.(2), R.sup.(3), P, H, F, G, Q, S, E,
T, Y, C, I, D, V; preferably L.sup.(2) or R.sup.(3) 47.sup.(8) W, Y
F.sup.(1), L.sup.(1) or W.sup.(2) G, I, S, A, V, M, R, Y, E, P, T,
C, H, K, Q, N, D; preferably W.sup.(2), L.sup.(1) or F.sup.(1) 83 R
or K; R, K.sup.(5), T, E.sup.(5), Q, N, S, I, V, G, M, L, usually R
A, D, Y, H; preferably K or R; most preferably K 84 A, T, D;
P.sup.(5), S, H, L, A, V, I, T, F, D, R, Y, N, Q, predominantly A
G, E; preferably P 103 W W.sup.(4), R.sup.(6), G, S, K, A, M, Y, L,
F, T, N, V, Q, P.sup.(6), E, C; preferably W 104 G G, A, S, T, D,
P, N, E, C, L; preferably G 108 L, M or T; Q, L.sup.(7), R, P, E,
K, S, T, M, A, H; predominantly L preferably Q or L.sup.(7) Notes:
.sup.(1)In particular, but not exclusively, in combination with
KERE or KQRE at positions 43-46. .sup.(2)Usually as GLEW at
positions 44-47. .sup.(3)Usually as KERE or KQRE at positions
43-46, e.g. as KEREL, KEREF, KQREL, KQREF, KEREG, KQREW or KQREG at
positions 43-47. Alternatively, also sequences such as TERE (for
example TEREL), TQRE (for example TQREL), KECE (for example KECEL
or KECER), KQCE (for example KQCEL), RERE (for example REREG), RQRE
(for example RQREL, RQREF or RQREW), QERE (for example QEREG),
QQRE, (for example QQREW, QQREL or QQREF), KGRE (for example
KGREG), KDRE (for example KDREV) are possible. Some other possible,
but less preferred sequences include for example DECKL and NVCEL.
.sup.(4)With both GLEW at positions 44-47 and KERE or KQRE at
positions 43-46. .sup.(5)Often as KP or EP at positions 83-84 of
naturally occurring V.sub.HH domains. .sup.(6)In particular, but
not exclusively, in combination with GLEW at positions 44-47.
.sup.(7)With the proviso that when positions 44-47 are GLEW,
position 108 is always Q in (non-humanized) V sequences that also
contain a W at 103. .sup.(8)The GLEW group also contains GLEW-like
sequences at positions 44-47, such as for example GVEW, EPEW, GLER,
DQEW, DLEW, GIEW, ELEW, GPEW, EWLP, GPER, GLER and ELEW.
Again, such immunoglobulin single variable domains may be derived
in any suitable manner and from any suitable source, and may for
example he naturally occurring V .sub.HH sequences (i.e. from a
suitable species of Camelid, e.g. llama) or synthetic or semi
synthetic VHs or VLs (e.g. from human). Such immunoglobulin single
variable domains may include "humanized" or otherwise "sequence
optimized" VHHs, "camelized" immunoglobulin sequences (and in
particular camelized heavy chain variable domain sequences, i.e.
camelized VHs), as well as human VHs, human VLs, camelid VHHs that
have been altered by techniques such as affinity maturation (for
example, starting from synthetic, random or naturally occurring
immunoglobulin sequences), CDR grafting, veneering, combining
fragments derived from different immunoglobulin sequences, PCR
assembly using overlapping primers, and similar techniques for
engineering immunoglobulin sequences well known to the skilled
person; or any suitable combination of any of the foregoing as
further described herein.
[0592] In another preferred, but non-limiting aspect, the invention
relates to a Nanobody (or ISV) as described above, in which the CDR
sequences have at least 70% amino acid identity, preferably at
least 80% amino acid identity, more preferably at least 90% amino
acid identity, such as 95% amino acid identity or more or even
essentially 100% amino acid identity with the CDR sequences of at
least one of the amino acid sequences of SEQ ID NOs: 623 to 693
(see Table A-1). This degree of amino acid identity can for example
be determined by determining the degree of amino acid identity (in
a manner described herein) between said Nanobody (or ISV) and one
or more of the sequences of SEQ ID NOs: 623 to 693 (see Table A-1),
in which the amino acid residues that form the framework regions
are disregarded. Such Nanobodies (or ISV's) can can be as further
described herein.
[0593] As already mentioned herein, another preferred but
non-limiting aspect of the invention relates to a Nanobody (or ISV)
with an amino acid sequence that is chosen from the group
consisting of SEQ ID NOs: 623 to 693 (see Table A-1) or from the
group consisting of from amino acid sequences that have more than
80%, preferably more than 90%, more preferably more than 95%, such
as 99% or more sequence identity (as defined herein) with at least
one of the amino acid sequences of SEQ ID NOs: 623 to 693 (see
Table A-1).
[0594] Also, in the above Nanobodies (or ISV's): [0595] i) any
amino acid substitution (when it is not a humanizing substitution
as defined herein) is preferably, and compared to the corresponding
amino acid sequence of SEQ ID NOs: 623 to 693 (see Table A-1), a
conservative amino acid substitution, (as defined herein); and/or:
[0596] ii) its amino acid sequence preferably contains either only
amino acid substitutions, or otherwise preferably no more than 5,
preferably no more than 3, and more preferably only 1 or 2 amino
acid deletions or insertions, compared to the corresponding amino
acid sequence of SEQ ID NOs: 623 to 693 (see Table A-1); and/or
[0597] iii) the CDR's may be CDR's that are derived by means of
affinity maturation, for example starting from the CDR's of to the
corresponding amino acid sequence of SEQ ID NOs: 623 to 693 (see
Table A-1).
[0598] Preferably, the CDR sequences and FR sequences in the
Nanobodies (or ISV's) of the invention are such that the Nanobodies
(or ISV's) of the invention (and polypeptides of the invention
comprising the same): [0599] bind to any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof with a dissociation
constant (K.sub.D) of 10.sup.-5 to 10.sup.-12 moles/liter or less,
and preferably 10.sup.-7 to 10.sup.-12 moles/liter or less and more
preferably 10.sup.-8 to 10.sup.-12 moles/liter (i.e. with an
association constant (K.sub.A) of 10.sup.5 to 10.sup.12 liter/moles
or more, and preferably 10.sup.7 to 10.sup.12 liter/moles or more
and more preferably 10.sup.8 to 10.sup.12 liter/moles); and/or such
that they: [0600] bind to any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof with a k.sub.on-rate of between
10.sup.2 M.sup.-1s.sup.-1 to about 10.sup.7 M.sup.-1s.sup.-1,
preferably between 10.sup.3 M.sup.-1s.sup.-1 and 10.sup.7
M.sup.-1s.sup.-1, more preferably between 10.sup.4 M.sup.-1s.sup.-1
and 10.sup.7 M.sup.-1s.sup.-1, such as between 10.sup.5
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1; and/or such that
they: [0601] bind to any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof with a k.sub.off rate between 1
s.sup.-1 (t.sub.1/2=0.69 s) and 10.sup.-6 s.sup.-1 (providing a
near irreversible complex with a t.sub.1/2 of multiple days),
preferably between 10.sup.-2 s.sup.-1 and 10.sup.-6 s.sup.-1, more
preferably between 10.sup.-3 s.sup.-1 and 10.sup.-6 s.sup.-1, such
as between 10.sup.-4 s.sup.-1 and 10.sup.-6 s.sup.-1.
[0602] Preferably, CDR sequences and FR sequences present in the
Nanobodies (or ISV's) of the invention are such that the Nanobodies
(or ISV's) of the invention will bind to any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof with an affinity
less than 500 nM, preferably less than 200 nM, more preferably less
than 10 nM, such as less than 500 pM.
[0603] According to one non-limiting aspect of the invention, a
Nanobody (or ISV) may be as defined herein, but with the proviso
that it has at least "one amino acid difference" (as defined
herein) in at least one of the framework regions compared to the
corresponding framework region of a naturally occurring human
V.sub.H domain, and in particular compared to the corresponding
framework region of DP-47. More specifically, according to one
non-limiting aspect of the invention, a Nanobody (or ISV) may be as
defined herein, but with the proviso that it has at least "one
amino acid difference" (as defined herein) at at least one of the
Hallmark residues (including those at positions 108, 103 and/or 45)
compared to the corresponding framework region of a naturally
occurring human V.sub.H domain, and in particular compared to the
corresponding framework region of DP-47. Usually, a Nanobody (or
ISV) will have at least one such amino acid difference with a
naturally occurring V.sub.H domain in at least one of FR2 and/or
FR4, and in particular at at least one of the Hallmark residues in
FR2 and/or FR4 (again, including those at positions 108, 103 and/or
45).
[0604] Also, a humanized Nanobody (or ISV) of the invention may be
as defined herein, but with the proviso that it has at least "one
amino acid difference" (as defined herein) in at least one of the
framework regions compared to the corresponding framework region of
a naturally occurring V.sub.HH domain. More specifically, according
to one non-limiting aspect of the invention, a humanized Nanobody
(or ISV) may be as defined herein, but with the proviso that it has
at least "one amino acid difference" (as defined herein) at at
least one of the Hallmark residues (including those at positions
108, 103 and/or 45) compared to the corresponding framework region
of a naturally occurring V.sub.HH domain. Usually, a humanized
Nanobody (or ISV) will have at least one such amino acid difference
with a naturally occurring V.sub.HH domain in at least one of FR2
and/or FR4, and in particular at at least one of the Hallmark
residues in FR2 and/or FR4 (again, including those at positions
108, 103 and/or 45).
[0605] As will be clear from the disclosure herein, it is also
within the scope of the invention to use natural or synthetic
analogs, mutants, variants, alleles, homologs and orthologs (herein
collectively referred to as "analogs") of the Nanobodies (or ISV's)
of the invention as defined herein, and in particular analogs of
the Nanobodies (or ISV's) of SEQ ID NOs 623 to 693 (see Table A-1).
Thus, according to one aspect of the invention, the term "Nanobody
(or ISV) of the invention" in its broadest sense also covers such
analogs.
[0606] Generally, in such analogs, one or more amino acid residues
may have been replaced, deleted and/or added, compared to the
Nanobodies (or ISV's) of the invention as defined herein. Such
substitutions, insertions or deletions may be made in one or more
of the framework regions and/or in one or more of the CDR's. When
such substitutions, insertions or deletions are made in one or more
of the framework regions, they may be made at one or more of the
Hallmark residues and/or at one or more of the other positions in
the framework residues, although substitutions, insertions or
deletions at the Hallmark residues are generally less preferred
(unless these are suitable humanizing substitutions as described
herein).
[0607] By means of non-limiting examples, a substitution may for
example be a conservative substitution (as described herein) and/or
an amino acid residue may be replaced by another amino acid residue
that naturally occurs at the same position in another V.sub.HH
domain (see Tables B-4 to B-7 for some non-limiting examples of
such substitutions), although the invention is generally not
limited thereto. Thus, any one or more substitutions, deletions or
insertions, or any combination thereof, that either improve the
properties of the Nanobody (or ISV) of the invention or that at
least do not detract too much from the desired properties or from
the balance or combination of desired properties of the Nanobody
(or ISV) of the invention (i.e. to the extent that the Nanobody (or
ISV) is no longer suited for its intended use) are included within
the scope of the invention. A skilled person will generally be able
to determine and select suitable substitutions, deletions or
insertions, or suitable combinations of thereof, based on the
disclosure herein and optionally after a limited degree of routine
experimentation, which may for example involve introducing a
limited number of possible substitutions and determining their
influence on the properties of the Nanobodies (or ISV's) thus
obtained.
[0608] For example, and depending on the host organism used to
express the Nanobody (or ISV) or polypeptide of the invention, such
deletions and/or substitutions may be designed in such a way that
one or more sites for post-translational modification (such as one
or more glycosylation sites) are removed, as will be within the
ability of the person skilled in the art. Alternatively,
substitutions or insertions may be designed so as to introduce one
or more sites for attachment of functional groups (as described
herein), for example to allow site-specific pegylation (again as
described herein).
[0609] As can be seen from the data on the V.sub.HH entropy and
V.sub.HH variability given in Tables B-4 to B-7 above, some amino
acid residues in the framework regions are more conserved than
others. Generally, although the invention in its broadest sense is
not limited thereto, any substitutions, deletions or insertions are
preferably made at positions that are less conserved. Also,
generally, amino acid substitutions are preferred over amino acid
deletions or insertions.
[0610] The analogs are preferably such that they can bind to any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof with
an affinity (suitably measured and/or expressed as a K.sub.D-value
(actual or apparent), a K.sub.A-value (actual or apparent), a
k.sub.on-rate and/or a k.sub.off-rate, or alternatively as an
IC.sub.50 value, as further described herein) that is as defined
herein for the Nanobodies (or ISV's) of the invention.
[0611] The analogs are preferably also such that they retain the
favourable properties the Nanobodies (or ISV's), as described
herein.
[0612] Also, according to one preferred aspect, the analogs have a
degree of sequence identity of at least 70%, preferably at least
80%, more preferably at least 90%, such as at least 95% or 99% or
more; and/or preferably have at most 20, preferably at most 10,
even more preferably at most 5, such as 4, 3, 2 or only 1 amino
acid difference (as defined herein), with one of the Nanobodies (or
ISV's) of SEQ ID NOs: 623 to 693 (see Table A-1).
[0613] Also, the framework sequences and CDR's of the analogs are
preferably such that they are in accordance with the preferred
aspects defined herein. More generally, as described herein, the
analogs will have (a) a Q at position 108; and/or (b) a charged
amino acid or a cysteine residue at position 45 and preferably an E
at position 44, and more preferably E at position 44 and R at
position 45; and/or (c) P, R or S at position 103.
[0614] One preferred class of analogs of the Nanobodies (or ISV's)
of the invention comprise Nanobodies (or ISV's) that have been
humanized (i.e. compared to the sequence of a naturally occurring
Nanobody (or ISV) of the invention). As mentioned in the background
art cited herein, such humanization generally involves replacing
one or more amino acid residues in the sequence of a naturally
occurring V.sub.HH with the amino acid residues that occur at the
same position in a human V.sub.H domain, such as a human V.sub.H3
domain. Examples of possible humanizing substitutions or
combinations of humanizing substitutions will be clear to the
skilled person, for example from the Tables herein, from the
possible humanizing substitutions mentioned in the background art
cited herein, and/or from a comparison between the sequence of a
Nanobody (or ISV) and the sequence of a naturally occurring human
V.sub.H domain.
[0615] The humanizing substitutions should be chosen such that the
resulting humanized Nanobodies (or ISV's) still retain the
favourable properties of Nanobodies (or ISV's) as defined herein,
and more preferably such that they are as described for analogs in
the preceding paragraphs. A skilled person will generally be able
to determine and select suitable humanizing substitutions or
suitable combinations of humanizing substitutions, based on the
disclosure herein and optionally after a limited degree of routine
experimentation, which may for example involve introducing a
limited number of possible humanizing substitutions and determining
their influence on the properties of the Nanobodies (or ISV's) thus
obtained.
[0616] Generally, as a result of humanization, the Nanobodies (or
ISV's) of the invention may become more "human-like", while still
retaining the favorable properties of the Nanobodies (or ISV's) of
the invention as described herein. As a result, such humanized
Nanobodies (or ISV's) may have several advantages, such as a
reduced immunogenicity, compared to the corresponding naturally
occurring V.sub.HH domains. Again, based on the disclosure herein
and optionally after a limited degree of routine experimentation,
the skilled person will be able to select humanizing substitutions
or suitable combinations of humanizing substitutions which optimize
or achieve a desired or suitable balance between the favourable
properties provided by the humanizing substitutions on the one hand
and the favourable properties of naturally occurring V.sub.HH
domains on the other hand.
[0617] The Nanobodies (or ISV's) of the invention may be suitably
humanized at any framework residue(s), such as at one or more
Hallmark residues (as defined herein) or at one or more other
framework residues (i.e. non-Hallmark residues) or any suitable
combination thereof. One preferred humanizing substitution for
Nanobodies (or ISV's) of the "P,R,S-103 group" or the "KERE group"
is Q108 into L108. Nanobodies (or ISV's) of the "GLEW class" may
also be humanized by a Q108 into L108 substitution, provided at
least one of the other Hallmark residues contains a camelid
(camelizing) substitution (as defined herein). For example, as
mentioned above, one particularly preferred class of humanized
Nanobodies (or ISV's) has GLEW or a GLEW-like sequence at positions
44-47; P, R or S (and in particular R) at position 103, and an L at
position 108.
[0618] The humanized and other analogs, and nucleic acid sequences
encoding the same, can be provided in any manner known per se, for
example using one or more of the techniques mentioned on pages 103
and 104 of WO 08/020079.
[0619] Also, in addition to humanizing substitutions as described
herein, the amino acid sequences of the invention may contain one
or more other/further substitutions. Again, some preferred, but
non-limiting examples of such other/further substitutions will
become clear from the further description herein, and for example
may include (and preferably essentially consist of) one or more of
the following substitutions: [0620] (a) one or more conservative
amino acid substitutions; and/or [0621] (b) one or more
substitutions in which a "camelid" amino acid residue at a certain
position is replaced by a different "camelid" amino acid residue
that occurs at said position, for which reference is for example
made to Tables A-6 to A-9 from PCT/EP2008/066365 (published on Jun.
4, 2009 as WO 09/068627), which mention the various Camelid
residues that occur as each amino acid position in wild-type VHH's.
Such substitutions may even comprise suitable substitutions of an
amino acid residue that occurs at a Hallmark position with another
amino acid residue that occurring at a Hallmark position in a
wild-type VHH (for which reference is for example made to Tables
A-6 to A-9 from PCT/EP2008/066365); and/or [0622] (c) one or more
substitutions that improve the (other) properties of the protein,
such as substitutions that improve the long-term stability and/or
properties under storage of the protein. These may for example and
without limitation be substitutions that prevent or reduce
oxidation events (for example, of methionine residues); that
prevent or reduce pyroglutamate formation; and/or that prevent or
reduce isomerisation or deamidation of aspartic acids or
asparagines (for example, of DG, DS, NG or NS motifs). For such
substitutions, reference is for example made to the International
application WO 09/095235, which is generally directed to methods
for stabilizing single immunoglobulin variable domains by means of
such substitutions, and also gives some specific example of
suitable substitutions (see for example pages 4 and 5 and pages 10
to 15). One example of such substitution may be to replace an NS
motif at positions 82a and 82b with an NN motif (cf. Table B-6 of
the present description); [0623] (d) one or more substitutions that
improve expression levels in an intended host cell or host organism
and/or other properties that are relevant for production/expression
in a desired host cell or host organism. These may for example also
include substitutions that remove possible sites for (undesired)
post-translational modification and/or that otherwise reduce
(undesired) post-translational modification (such as, for example
and without limitation, possible glycosylation or phosphorylation),
depending on the host cell or host organism to be used for
expression/production; and also for example removing sites that may
be susceptible to proteolytic cleavage (again, depending on the
host cell or host organism to be used)
[0624] Some specific, but non-limiting examples of humanized and/or
sequenced-optimized amino acid sequences of the invention are given
in FIG. 7 and in SEQ ID NOs: 760 to 825, and each of these forms a
further aspect of the present invention. Based on the further
disclosure herein, the skilled person will be able to provide other
humanized and/or sequenced-optimized amino acid sequences of the
invention.
[0625] FIG. 8 and SEQ ID NOs: 826 to 837 give some preferred, but
non-limiting examples of polypeptides of the invention based on
humanized and/or sequenced-optimized amino acid sequences of the
invention as building blocks, and and each of these forms a further
aspect of the present invention. Based on the further disclosure
herein, the skilled person will be able to provide other compounds
and/or polypeptides of the invention that are based humanized
and/or sequenced-optimized amino acid sequences of the
invention.
[0626] As mentioned there, it will be also be clear to the skilled
person that the Nanobodies (or ISV's) of the invention (including
their analogs) can be designed and/or prepared starting from human
V.sub.H sequences (i.e. amino acid sequences or the corresponding
nucleotide sequences), such as for example from human V.sub.H3
sequences such as DP-47, DP-51 or DP-29, i.e. by introducing one or
more camelizing substitutions (i.e. changing one or more amino acid
residues in the amino acid sequence of said human V.sub.H domain
into the amino acid residues that occur at the corresponding
position in a V.sub.HH domain), so as to provide the sequence of a
Nanobody (or ISV) of the invention and/or so as to confer the
favourable properties of a Nanobody (or ISV) to the sequence thus
obtained. Again, this can generally be performed using the various
methods and techniques referred to in the previous paragraph, using
an amino acid sequence and/or nucleotide sequence for a human
V.sub.H domain as a starting point.
[0627] Some preferred, but non-limiting camelizing substitutions
can be derived from Tables B-4-B-7. It will also be clear that
camelizing substitutions at one or more of the Hallmark residues
will generally have a greater influence on the desired properties
than substitutions at one or more of the other amino acid
positions, although both and any suitable combination thereof are
included within the scope of the invention. For example, it is
possible to introduce one or more camelizing substitutions that
already confer at least some the desired properties, and then to
introduce further camelizing substitutions that either further
improve said properties and/or confer additional favourable
properties. Again, the skilled person will generally be able to
determine and select suitable camelizing substitutions or suitable
combinations of camelizing substitutions, based on the disclosure
herein and optionally after a limited degree of routine
experimentation, which may for example involve introducing a
limited number of possible camelizing substitutions and determining
whether the favourable properties of Nanobodies (or ISV's) are
obtained or improved (i.e. compared to the original V.sub.H
domain).
[0628] Generally, however, such camelizing substitutions are
preferably such that the resulting an amino acid sequence at least
contains (a) a Q at position 108; and/or (b) a charged amino acid
or a cysteine residue at position 45 and preferably also an E at
position 44, and more preferably E at position 44 and R at position
45; and/or (c) P, R or S at position 103; and optionally one or
more further camelizing substitutions. More preferably, the
camelizing substitutions are such that they result in a Nanobody
(or ISV) of the invention and/or in an analog thereof (as defined
herein), such as in a humanized analog and/or preferably in an
analog that is as defined in the preceding paragraphs.
[0629] Nanobodies (or ISV's) can also be derived from V.sub.H
domains by the incorporation of substitutions that are rare in
nature, but nonetheless, structurally compatible with the VH domain
fold. For example, but without being limiting, these substitutions
may include on or more of the following: Gly at position 35, Ser,
Val or Thr at position 37, Ser, Thr, Arg, Lys, His, Asp or Glu at
position 39, Glu or His at position 45, Trp, Leu, Val, Ala, Thr, or
Glu at position 47, S or R at position 50. (Barthelemy et al. J
Biol Chem. 2008 Feb. 8; 283(6):3639-54. Epub 2007 Nov. 28)
[0630] As will also be clear from the disclosure herein, it is also
within the scope of the invention to use parts or fragments, or
combinations of two or more parts or fragments, of the Nanobodies
(or ISV's) of the invention as defined herein, and in particular
parts or fragments of the Nanobodies (or ISV's) of SEQ ID NOs: 623
to 693 (see Table A-1). Thus, according to one aspect of the
invention, the term "Nanobody (or ISV) of the invention" in its
broadest sense also covers such parts or fragments.
[0631] Generally, such parts or fragments of the Nanobodies (or
ISV's) of the invention (including analogs thereof) have amino acid
sequences in which, compared to the amino acid sequence of the
corresponding full length Nanobody (or ISV) of the invention (or
analog thereof), one or more of the amino acid residues at the
N-terminal end, one or more amino acid residues at the C-terminal
end, one or more contiguous internal amino acid residues, or any
combination thereof, have been deleted and/or removed.
[0632] The parts or fragments are preferably such that they can
bind to any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof with an affinity (suitably measured and/or
expressed as a K.sub.D-value (actual or apparent), a K.sub.A-value
(actual or apparent), a k.sub.on-rate and/or a k.sub.off-rate, or
alternatively as an IC.sub.50 value, as further described herein)
that is as defined herein for the Nanobodies (or ISV's) of the
invention.
[0633] Any part or fragment is preferably such that it comprises at
least 10 contiguous amino acid residues, preferably at least 20
contiguous amino acid residues, more preferably at least 30
contiguous amino acid residues, such as at least 40 contiguous
amino acid residues, of the amino acid sequence of the
corresponding full length Nanobody (or ISV) of the invention.
[0634] Also, any part or fragment is such preferably that it
comprises at least one of CDR1, CDR2 and/or CDR3 or at least part
thereof (and in particular at least CDR3 or at least part thereof).
More preferably, any part or fragment is such that it comprises at
least one of the CDR's (and preferably at least CDR3 or part
thereof) and at least one other CDR (i.e. CDR1 or CDR2) or at least
part thereof, preferably connected by suitable framework
sequence(s) or at least part thereof. More preferably, any part or
fragment is such that it comprises at least one of the CDR's (and
preferably at least CDR3 or part thereof) and at least part of the
two remaining CDR's, again preferably connected by suitable
framework sequence(s) or at least part thereof.
[0635] According to another particularly preferred, but
non-limiting aspect, such a part or fragment comprises at least
CDR3, such as FR3, CDR3 and FR4 of the corresponding full length
Nanobody (or ISV) of the invention, i.e. as for example described
in the International application WO 03/050531 (Lasters et al.).
[0636] As already mentioned above, it is also possible to combine
two or more of such parts or fragments (i.e. from the same or
different Nanobodies (or ISV's) of the invention), i.e. to provide
an analog (as defined herein) and/or to provide further parts or
fragments (as defined herein) of a Nanobody (or ISV) of the
invention. It is for example also possible to combine one or more
parts or fragments of a Nanobody (or ISV) of the invention with one
or more parts or fragments of a human V.sub.H domain.
[0637] According to one preferred aspect, the parts or fragments
have a degree of sequence identity of at least 50%, preferably at
least 60%, more preferably at least 70%, even more preferably at
least 80%, such as at least 90%, 95% or 99% or more with one of the
Nanobodies (or ISV's) of SEQ ID NO:s 623 to 693 (see Table
A-1).
[0638] The parts and fragments, and nucleic acid sequences encoding
the same, can be provided and optionally combined in any manner
known per se. For example, such parts or fragments can be obtained
by inserting a stop codon in a nucleic acid that encodes a
full-sized Nanobody (or ISV) of the invention, and then expressing
the nucleic acid thus obtained in a manner known per se (e.g. as
described herein). Alternatively, nucleic acids encoding such parts
or fragments can be obtained by suitably restricting a nucleic acid
that encodes a full-sized Nanobody (or ISV) of the invention or by
synthesizing such a nucleic acid in a manner known per se. Parts or
fragments may also be provided using techniques for peptide
synthesis known per se.
[0639] The invention in its broadest sense also comprises
derivatives of the Nanobodies (or ISV's) of the invention. Such
derivatives can generally be obtained by modification, and in
particular by chemical and/or biological (e.g enzymatical)
modification, of the Nanobodies (or ISV's) of the invention and/or
of one or more of the amino acid residues that form the Nanobodies
(or ISV's) of the invention.
[0640] Examples of such modifications, as well as examples of amino
acid residues within the Nanobody (or ISV) sequence that can be
modified in such a manner (i.e. either on the protein backbone but
preferably on a side chain), methods and techniques that can be
used to introduce such modifications and the potential uses and
advantages of such modifications will be clear to the skilled
person.
[0641] For example, such a modification may involve the
introduction (e.g. by covalent linking or in an other suitable
manner) of one or more functional groups, residues or moieties into
or onto the Nanobody (or ISV) of the invention, and in particular
of one or more functional groups, residues or moieties that confer
one or more desired properties or functionalities to the Nanobody
(or ISV) of the invention. Example of such functional groups will
be clear to the skilled person.
[0642] For example, such modification may comprise the introduction
(e.g. by covalent binding or in any other suitable manner) of one
or more functional groups that increase the half-life, the
solubility and/or the absorption of the Nanobody (or ISV) of the
invention, that reduce the immunogenicity and/or the toxicity of
the Nanobody (or ISV) of the invention, that eliminate or attenuate
any undesirable side effects of the Nanobody (or ISV) of the
invention, and/or that confer other advantageous properties to
and/or reduce the undesired properties of the Nanobodies (or ISV's)
and/or polypeptides of the invention; or any combination of two or
more of the foregoing. Examples of such functional groups and of
techniques for introducing them will be clear to the skilled
person, and can generally comprise all functional groups and
techniques mentioned in the general background art cited
hereinabove as well as the functional groups and techniques known
per se for the modification of pharmaceutical proteins, and in
particular for the modification of antibodies or antibody fragments
(including ScFv's and single domain antibodies), for which
reference is for example made to Remington's Pharmaceutical
Sciences, 16th ed., Mack Publishing Co., Easton, Pa. (1980). Such
functional groups may for example be linked directly (for example
covalently) to a Nanobody (or ISV) of the invention, or optionally
via a suitable linker or spacer, as will again be clear to the
skilled person.
[0643] One of the most widely used techniques for increasing the
half-life and/or reducing the immunogenicity of pharmaceutical
proteins comprises attachment of a suitable pharmacologically
acceptable polymer, such as poly(ethyleneglycol) (PEG) or
derivatives thereof (such as methoxypoly(ethyleneglycol) or mPEG).
Generally, any suitable form of pegylation can be used, such as the
pegylation used in the art for antibodies and antibody fragments
(including but not limited to (single) domain antibodies and
ScFv's); reference is made to for example Chapman, Nat.
Biotechnol., 54, 531-545 (2002); by Veronese and Harris, Adv. Drug
Deliv. Rev. 54, 453-456 (2003), by Harris and Chess, Nat. Rev.
Drug. Discov., 2, (2003) and in WO 04/060965. Various reagents for
pegylation of proteins are also commercially available, for example
from Nektar Therapeutics, USA.
[0644] Preferably, site-directed pegylation is used, in particular
via a cysteine-residue (see for example Yang et al., Protein
Engineering, 16, 10, 761-770 (2003). For example, for this purpose,
PEG may be attached to a cysteine residue that naturally occurs in
a Nanobody (or ISV) of the invention, a Nanobody (or ISV) of the
invention may be modified so as to suitably introduce one or more
cysteine residues for attachment of PEG, or an amino acid sequence
comprising one or more cysteine residues for attachment of PEG may
be fused to the N- and/or C-terminus of a Nanobody (or ISV) of the
invention, all using techniques of protein engineering known per se
to the skilled person.
[0645] Preferably, for the Nanobodies (or ISV's) and proteins of
the invention, a PEG is used with a molecular weight of more than
5000, such as more than 10,000 and less than 200,000, such as less
than 100,000; for example in the range of 20,000-80,000.
[0646] Another, usually less preferred modification comprises
N-linked or O-linked glycosylation, usually as part of
co-translational and/or post-translational modification, depending
on the host cell used for expressing the Nanobody (or ISV) or
polypeptide of the invention.
[0647] Yet another modification may comprise the introduction of
one or more detectable labels or other signal-generating groups or
moieties, depending on the intended use of the labeled Nanobody (or
ISV). Suitable labels and techniques for attaching, using and
detecting them will be clear to the skilled person, and for example
include, but are not limited to, the fluorescent labels,
phosphorescent labels, chemiluminescent labels, bioluminescent
labels, radio-isotopes, metals, metal chelates, metallic cations,
chromophores and enzymes, such as those mentioned on page 109 of WO
08/020079. Other suitable labels will be clear to the skilled
person, and for example include moieties that can be detected using
NMR or ESR spectroscopy.
[0648] Such labeled Nanobodies (or ISV's) and polypeptides of the
invention may for example be used for in vitro, in vivo or in situ
assays (including immunoassays known per se such as ELISA, RIA, EIA
and other "sandwich assays", etc.) as well as in vivo diagnostic
and imaging purposes, depending on the choice of the specific
label.
[0649] As will be clear to the skilled person, another modification
may involve the introduction of a chelating group, for example to
chelate one of the metals or metallic cations referred to above.
Suitable chelating groups for example include, without limitation,
diethylenetriaminepentaacetic acid (DTPA) or
ethylenediaminetetraacetic acid (EDTA).
[0650] Yet another modification may comprise the introduction of a
functional group that is one part of a specific binding pair, such
as the biotin-(strept)avidin binding pair. Such a functional group
may be used to link the Nanobody (or ISV) of the invention to
another protein, polypeptide or chemical compound that is bound to
the other half of the binding pair, i.e. through formation of the
binding pair. For example, a Nanobody (or ISV) of the invention may
be conjugated to biotin, and linked to another protein,
polypeptide, compound or carrier conjugated to avidin or
streptavidin. For example, such a conjugated Nanobody (or ISV) may
be used as a reporter, for example in a diagnostic system where a
detectable signal-producing agent is conjugated to avidin or
streptavidin. Such binding pairs may for example also be used to
bind the Nanobody (or ISV) of the invention to a carrier, including
carriers suitable for pharmaceutical purposes. One non-limiting
example are the liposomal formulations described by Cao and Suresh,
Journal of Drug Targetting, 8, 4, 257 (2000). Such binding pairs
may also be used to link a therapeutically active agent to the
Nanobody (or ISV) of the invention.
[0651] For some applications, in particular for those applications
in which it is intended to kill a cell that expresses the target
against which the Nanobodies (or ISV's) of the invention are
directed (e.g. in the treatment of cancer), or to reduce or slow
the growth and/or proliferation such a cell, the Nanobodies (or
ISV's) of the invention may also be linked to a toxin or to a toxic
residue or moiety. Examples of toxic moieties, compounds or
residues which can be linked to a Nanobody (or ISV) of the
invention to provide--for example--a cytotoxic compound will be
clear to the skilled person and can for example be found in the
prior art cited above and/or in the further description herein. One
example is the so-called ADEPT.TM. technology described in WO
03/055527.
[0652] Other potential chemical and enzymatical modifications will
be clear to the skilled person. Such modifications may also be
introduced for research purposes (e.g. to study function-activity
relationships). Reference is for example made to Lundblad and
Bradshaw, Biotechnol. Appl. Biochem., 26, 143-151 (1997).
[0653] Preferably, the derivatives are such that they bind to any
of IL-17A, IL-17F and/or IL-17A/F including combinations thereof
with an affinity (suitably measured and/or expressed as a
K.sub.D-value (actual or apparent), a K.sub.A-value (actual or
apparent), a k.sub.on-rate and/or a k.sub.off-rate, or
alternatively as an IC.sub.50 value, as further described herein)
that is as defined herein for the Nanobodies (or ISV's) of the
invention.
[0654] As mentioned above, the invention also relates to proteins
or polypeptides that essentially consist of or comprise at least
one Nanobody (or ISV) of the invention. By "essentially consist of"
is meant that the amino acid sequence of the polypeptide of the
invention either is exactly the same as the amino acid sequence of
a Nanobody (or ISV) of the invention or corresponds to the amino
acid sequence of a Nanobody (or ISV) of the invention which has a
limited number of amino acid residues, such as 1-20 amino acid
residues, for example 1-10 amino acid residues and preferably 1-6
amino acid residues, such as 1, 2, 3, 4, 5 or 6 amino acid
residues, added at the amino terminal end, at the carboxy terminal
end, or at both the amino terminal end and the carboxy terminal end
of the amino acid sequence of the Nanobody (or ISV).
[0655] Said amino acid residues may or may not change, alter or
otherwise influence the (biological) properties of the Nanobody (or
ISV) and may or may not add further functionality to the Nanobody
(or ISV). For example, such amino acid residues: [0656] can
comprise an N-terminal Met residue, for example as result of
expression in a heterologous host cell or host organism. [0657] may
form a signal sequence or leader sequence that directs secretion of
the Nanobody (or ISV) from a host cell upon synthesis. Suitable
secretory leader peptides will be clear to the skilled person, and
may be as further described herein. Usually, such a leader sequence
will be linked to the N-terminus of the Nanobody (or ISV), although
the invention in its broadest sense is not limited thereto; [0658]
may form a sequence or signal that allows the Nanobody (or ISV) to
be directed towards and/or to penetrate or enter into specific
organs, tissues, cells, or parts or compartments of cells, and/or
that allows the Nanobody (or ISV) to penetrate or cross a
biological barrier such as a cell membrane, a cell layer such as a
layer of epithelial cells, a tumor including solid tumors, or the
blood-brain-barrier. Examples of such amino acid sequences will be
clear to the skilled person and include those mentioned in
paragraph c) on page 112 of WO 08/020079. [0659] may form a "tag",
for example an amino acid sequence or residue that allows or
facilitates the purification of the Nanobody (or ISV), for example
using affinity techniques directed against said sequence or
residue. Thereafter, said sequence or residue may be removed (e.g.
by chemical or enzymatical cleavage) to provide the Nanobody (or
ISV) sequence (for this purpose, the tag may optionally be linked
to the Nanobody (or ISV) sequence via a cleavable linker sequence
or contain a cleavable motif). Some preferred, but non-limiting
examples of such residues are multiple histidine residues,
glutatione residues and a myc-tag (see for example SEQ ID NO:31 of
WO 06/12282). [0660] may be one or more amino acid residues that
have been functionalized and/or that can serve as a site for
attachment of functional groups. Suitable amino acid residues and
functional groups will be clear to the skilled person and include,
but are not limited to, the amino acid residues and functional
groups mentioned herein for the derivatives of the Nanobodies (or
ISV's) of the invention.
[0661] According to one embodiment, a polypeptide of the invention
comprises or consists of an amino acid sequence selected from any
of SEQ ID NO: 623 to 693 and 826-838 (i.e. selected from SEQ ID NO
623, 624, 625, 626, 627, 628, 629, 630, 631, 632, 633, 634, 635,
636, 637, 638, 639, 640, 641, 642, 643, 644, 645, 646, 647, 648,
649, 650, 651, 652, 653, 654, 655, 656, 657, 658, 659, 660, 661,
662, 663, 664, 665, 666, 667, 668, 669, 670, 671, 672, 673, 674,
675, 676, 677, 678, 679, 680, 681, 682, 683, 684, 685, 686, 687,
688, 689, 690, 691, 692, 693, 826, 827, 828, 829, 830, 831, 832,
833, 834, 835, 836, 837 and SEQ ID NO 838), wherein the amino acid
sequence may comprise up to 6 single amino acid substitutions,
deletions and/or insertions and wherein the polypeptide preferably
specifically binds to IL-17A and/or to IL-17-F.
[0662] According to another embodiment, a polypeptide of the
invention comprises or consists of an amino acid sequence selected
from any of SEQ ID NO: 623 to 693 and 826-838 (i.e. selected from
SEQ ID NO 623, 624, 625, 626, 627, 628, 629, 630, 631, 632, 633,
634, 635, 636, 637, 638, 639, 640, 641, 642, 643, 644, 645, 646,
647, 648, 649, 650, 651, 652, 653, 654, 655, 656, 657, 658, 659,
660, 661, 662, 663, 664, 665, 666, 667, 668, 669, 670, 671, 672,
673, 674, 675, 676, 677, 678, 679, 680, 681, 682, 683, 684, 685,
686, 687, 688, 689, 690, 691, 692, 693, 826, 827, 828, 829, 830,
831, 832, 833, 834, 835, 836, 837 and SEQ ID NO 838), wherein the
amino acid sequence may comprise up to 6 single amino acid
substitutions, deletions and/or insertions and wherein the
polypeptide preferably binds to IL 17A and/or to IL 17-F with a Kd
of less than 5 nM and most preferably with a Kd of less than 50
pM.
[0663] According to one embodiment, a polypeptide of the invention
comprises or consists of an amino acid sequence selected from any
of SEQ ID NO: 623 to 693 and 826-838 (i.e. selected from SEQ ID NO
623, 624, 625, 626, 627, 628, 629, 630, 631, 632, 633, 634, 635,
636, 637, 638, 639, 640, 641, 642, 643, 644, 645, 646, 647, 648,
649, 650, 651, 652, 653, 654, 655, 656, 657, 658, 659, 660, 661,
662, 663, 664, 665, 666, 667, 668, 669, 670, 671, 672, 673, 674,
675, 676, 677, 678, 679, 680, 681, 682, 683, 684, 685, 686, 687,
688, 689, 690, 691, 692, 693, 826, 827, 828, 829, 830, 831, 832,
833, 834, 835, 836, 837 and SEQ ID NO 838), wherein the amino acid
sequence may comprise up to 3 single amino acid substitutions,
deletions and/or insertions and wherein the polypeptide preferably
specifically binds to IL 17A and/or to IL 17-F.
[0664] According to one embodiment, a polypeptide of the invention
comprises or consists of the amino acid sequence SEQ ID NO 836,
wherein the amino acid sequence may comprise up to 1, 2, 3, 4, 5,
6, 7, 8, 9 or up to 10 single amino acid substitutions, deletions
and/or insertions and wherein the polypeptide preferably
specifically binds to IL 17A and/or to IL 17-F with a Kd of less
than 5 nM and most preferably with a Kd of less than 50 pM.
[0665] According to a further embodiment, a polypeptide of the
invention comprises or consists of an amino acid sequence selected
from any of SEQ ID NO: 623 to 693 and 826-838 (i.e. selected from
SEQ ID NO 623, 624, 625, 626, 627, 628, 629, 630, 631, 632, 633,
634, 635, 636, 637, 638, 639, 640, 641, 642, 643, 644, 645, 646,
647, 648, 649, 650, 651, 652, 653, 654, 655, 656, 657, 658, 659,
660, 661, 662, 663, 664, 665, 666, 667, 668, 669, 670, 671, 672,
673, 674, 675, 676, 677, 678, 679, 680, 681, 682, 683, 684, 685,
686, 687, 688, 689, 690, 691, 692, 693, 826, 827, 828, 829, 830,
831, 832, 833, 834, 835, 836, 837 and SEQ ID NO 838), wherein the
amino acid sequence may comprise up to 6 single amino acid
substitutions, deletions and/or insertions and wherein the
polypeptide preferably specifically binds to SEQ ID NO: 839 and/or
to SEQ ID NO: 840, preferably with a Kd of less than 5 nM and most
preferably with a Kd of less than 50 pM.
[0666] According to a further embodiment, a polypeptide of the
invention comprises or consists of an amino acid sequence selected
from any of SEQ ID NO: 623 to 693 and 826-838 (i.e. selected from
SEQ ID NO 623, 624, 625, 626, 627, 628, 629, 630, 631, 632, 633,
634, 635, 636, 637, 638, 639, 640, 641, 642, 643, 644, 645, 646,
647, 648, 649, 650, 651, 652, 653, 654, 655, 656, 657, 658, 659,
660, 661, 662, 663, 664, 665, 666, 667, 668, 669, 670, 671, 672,
673, 674, 675, 676, 677, 678, 679, 680, 681, 682, 683, 684, 685,
686, 687, 688, 689, 690, 691, 692, 693, 826, 827, 828, 829, 830,
831, 832, 833, 834, 835, 836, 837 and SEQ ID NO 838), wherein the
amino acid sequence may comprise up to 3 single amino acid
substitutions, deletions and/or insertions and wherein the
polypeptide preferably specifically binds to SEQ ID NO: 839 and/or
to SEQ ID NO: 840, preferably with a Kd of less than 5 nM and most
preferably with a Kd of less than 50 pM.
[0667] Also provided is a polypeptide of the invention, wherein the
polypeptide comprises
[0668] (i) a first amino acid sequence selected from any of SEQ ID
NO: 640-649 (i.e. selected from any of SEQ ID NO 640, 641, 642,
643, 644, 645, 646, 647, 648 and 649), which specifically binds to
IL-17F (SEQ ID NO: 840) and to a heterodimer of IL-17A (SEQ ID NO:
839) and IL-17F (SEQ ID NO: 840), but does not specifically bind to
IL-17A (SEQ ID NO: 839); and/or
[0669] (ii) a second amino acid sequence selected from any of SEQ
ID NO: 650-693 (i.e. selected from any of SEQ ID NO 650, 651, 652,
653, 654, 655, 656, 657, 658, 659, 660, 661, 662, 663, 664, 665,
666, 667, 668, 669, 670, 671, 672, 673, 674, 675, 676, 677, 678,
679, 680, 681, 682, 683, 684, 685, 686, 687, 688, 689, 690, 691,
692, 693), which specifically binds to IL-17A (SEQ ID NO: 839), to
IL-17F (SEQ ID NO: 840) and to a heterodimer of IL-17A (SEQ ID NO:
839) and IL-17F (SEQ ID NO: 840); [0670] wherein the first and
second amino acid sequence may in total comprise up to 6 single
amino acid substitutions, deletions and/or insertions; and [0671]
wherein said specific binding in each instance occurs with a Kd of
less than 5 nM.
[0672] According to another aspect, a polypeptide of the invention
comprises a Nanobody (or ISV) of the invention, which specifically
binds to at least amino acids L74, Y85 and N88 of IL-17A (SEQ ID
NO: 839). These binding epitopes have been shown to be of
therapeutic value.
[0673] According to another aspect, a polypeptide of the invention
comprises a Nanobody (or ISV) of the invention, which specifically
binds to at least amino acids R47, R73, I86 and N89 of IL-17F (SEQ
ID NO: 840). These binding epitopes have been shown to be of
therapeutic value.
[0674] Of course also all of the above polypeptides can be used and
are effective for the treatment of a disease as disclosed
herein.
[0675] According to another aspect, a polypeptide of the invention
comprises a Nanobody (or ISV) of the invention, which is fused at
its amino terminal end, at its carboxy terminal end, or both at its
amino terminal end and at its carboxy terminal end to at least one
further amino acid sequence, i.e. so as to provide a fusion protein
comprising said Nanobody (or ISV) of the invention and the one or
more further amino acid sequences. Such a fusion will also be
referred to herein as a "Nanobody (or ISV) fusion".
[0676] The one or more further amino acid sequence may be any
suitable and/or desired amino acid sequences. The further amino
acid sequences may or may not change, alter or otherwise influence
the (biological) properties of the Nanobody (or ISV), and may or
may not add further functionality to the Nanobody (or ISV) or the
polypeptide of the invention. Preferably, the further amino acid
sequence is such that it confers one or more desired properties or
functionalities to the Nanobody (or ISV) or the polypeptide of the
invention.
[0677] For example, the further amino acid sequence may also
provide a second binding site, which binding site may be directed
against any desired protein, polypeptide, antigen, antigenic
determinant or epitope (including but not limited to the same
protein, polypeptide, antigen, antigenic determinant or epitope
against which the Nanobody (or ISV) of the invention is directed,
or a different protein, polypeptide, antigen, antigenic determinant
or epitope).
[0678] Example of such amino acid sequences will be clear to the
skilled person, and may generally comprise all amino acid sequences
that are used in peptide fusions based on conventional antibodies
and fragments thereof (including but not limited to ScFv's and
single domain antibodies). Reference is for example made to the
review by Holliger and Hudson, Nature Biotechnology, 23, 9,
1126-1136 (2005).
[0679] For example, such an amino acid sequence may be an amino
acid sequence that increases the half-life, the solubility, or the
absorption, reduces the immunogenicity or the toxicity, eliminates
or attenuates undesirable side effects, and/or confers other
advantageous properties to and/or reduces the undesired properties
of the polypeptides of the invention, compared to the Nanobody (or
ISV) of the invention per se. Some non-limiting examples of such
amino acid sequences are serum proteins, such as human serum
albumin (see for example WO 00/27435) or haptenic molecules (for
example haptens that are recognized by circulating antibodies, see
for example WO 98/22141).
[0680] In particular, it has been described in the art that linking
fragments of immunoglobulins (such as V.sub.H domains) to serum
albumin or to fragments thereof can be used to increase the
half-life. Reference is for made to WO 00/27435 and WO 01/077137).
According to the invention, the Nanobody (or ISV) of the invention
is preferably either directly linked to serum albumin (or to a
suitable fragment thereof) or via a suitable linker, and in
particular via a suitable peptide linked so that the polypeptide of
the invention can be expressed as a genetic fusion (protein).
According to one specific aspect, the Nanobody (or ISV) of the
invention may be linked to a fragment of serum albumin that at
least comprises the domain III of serum albumin or part thereof.
Reference is for example made to WO 07/112940 of Ablynx N.V.
[0681] Alternatively, the further amino acid sequence may provide a
second binding site or binding unit that is directed against a
serum protein (such as, for example, human serum albumin or another
serum protein such as IgG), so as to provide increased half-life in
serum. Such amino acid sequences for example include the Nanobodies
(or ISV's) described below, as well as the small peptides and
binding proteins described in WO 91/01743, WO 01/45746 and WO
02/076489 and the dAb's described in WO 03/002609 and WO 04/003019.
Reference is also made to Harmsen et al., Vaccine, 23 (41);
4926-42, 2005, as well as to EP 0 368 684, as well as to WO
08/028977, WO 08/043821, WO 08/043822 by Ablynx N.V. and US
provisional application of Ablynx N.V. entitled "Peptides capable
of binding to serum proteins" filed on Dec. 5, 2006 ((see also
PCT/EP2007/063348).
[0682] Such amino acid sequences may in particular be directed
against serum albumin (and more in particular human serum albumin)
and/or against IgG (and more in particular human IgG). For example,
such amino acid sequences may be amino acid sequences that are
directed against (human) serum albumin and amino acid sequences
that can bind to amino acid residues on (human) serum albumin that
are not involved in binding of serum albumin to FcRn (see for
example WO 06/0122787) and/or amino acid sequences that are capable
of binding to amino acid residues on serum albumin that do not form
part of domain III of serum albumin (see again for example WO
06/0122787); amino acid sequences that have or can provide an
increased half-life (see for example WO 08/028977 by Ablynx N.V.);
amino acid sequences against human serum albumin that are
cross-reactive with serum albumin from at least one species of
mammal, and in particular with at least one species of primate
(such as, without limitation, monkeys from the genus Macaca (such
as, and in particular, cynomolgus monkeys (Macaca fascicularis)
and/or rhesus monkeys (Macaca mulatta)) and baboon (Papio ursinus),
reference is again made to WO 08/028977; amino acid sequences that
can bind to serum albumin in a pH independent manner (see for
example WO 08/043821by Ablynx N.V. entitled "Amino acid sequences
that bind to serum proteins in a manner that is essentially
independent of the pH, compounds comprising the same, and uses
thereof") and/or amino acid sequences that are conditional binders
(see for example WO 08/043822 by Ablynx N.V. entitled "Amino acid
sequences that bind to a desired molecule in a conditional
manner").
[0683] According to another aspect, the one or more further amino
acid sequences may comprise one or more parts, fragments or domains
of conventional 4-chain antibodies (and in particular human
antibodies) and/or of heavy chain antibodies. For example, although
usually less preferred, a Nanobody (or ISV) of the invention may be
linked to a conventional (preferably human) V.sub.H or V.sub.L
domain or to a natural or synthetic analog of a V.sub.H or V.sub.L
domain, again optionally via a linker sequence (including but not
limited to other (single) domain antibodies, such as the dAb's
described by Ward et al.).
[0684] The at least one Nanobody (or ISV) may also be linked to one
or more (preferably human) C.sub.H1, C.sub.H2 and/or C.sub.H3
domains, optionally via a linker sequence. For instance, a Nanobody
(or ISV) linked to a suitable C.sub.H1 domain could for example be
used--together with suitable light chains--to generate antibody
fragments/structures analogous to conventional Fab fragments or
F(ab').sub.2 fragments, but in which one or (in case of an
F(ab').sub.2 fragment) one or both of the conventional V.sub.H
domains have been replaced by a Nanobody (or ISV) of the invention.
Also, two Nanobodies (or ISV's) could be linked to a C.sub.H3
domain (optionally via a linker) to provide a construct with
increased half-life in vivo.
[0685] According to one specific aspect of a polypeptide of the
invention, one or more Nanobodies (or 1SV's) of the invention may
be linked (optionally via a suitable linker or hinge region) to one
or more constant domains (for example, 2 or 3 constant domains that
can be used as part of/to form an Fc portion), to an Fc portion
and/or to to one or more antibody parts, fragments or domains that
confer one or more effector functions to the polypeptide of the
invention and/or may confer the ability to bind to one or more Fc
receptors. For example, for this purpose, and without being limited
thereto, the one or more further amino acid sequences may comprise
one or more C.sub.H2 and/or C.sub.H3 domains of an antibody, such
as from a heavy chain antibody (as described herein) and more
preferably from a conventional human 4-chain antibody; and/or may
form (part of) and Fc region, for example from IgG (e.g. from IgG1,
IgG2, IgG3 or IgG4), from IgE or from another human Ig such as IgA,
IgD or IgM. For example, WO 94/04678 describes heavy chain
antibodies comprising a Camelid V.sub.HH domain or a humanized
derivative thereof (i.e. a Nanobody (or ISV)), in which the
Camelidae C.sub.H2 and/or C.sub.H3 domain have been replaced by
human C.sub.H2 and C.sub.H3 domains, so as to provide an
immunoglobulin that consists of 2 heavy chains each comprising a
Nanobody (or ISV) and human C.sub.H2 and C.sub.H3 domains (but no
C.sub.H1 domain), which immunoglobulin has the effector function
provided by the C.sub.H2 and C.sub.H3 domains and which
immunoglobulin can function without the presence of any light
chains. Other amino acid sequences that can be suitably linked to
the Nanobodies (or ISV's) of the invention so as to provide an
effector function will be clear to the skilled person, and may be
chosen on the basis of the desired effector function(s). Reference
is for example made to WO 04/058820, WO 99/42077, WO 02/056910 and
WO 05/017148, as well as the review by Holliger and Hudson, supra;
and to the non-prepublished US provisional application by Ablynx
N.V. entitled "Constructs comprising single variable domains and an
Fc portion derived from IgE" which has a filing date of Dec. 4,
2007. Coupling of a Nanobody (or ISV) of the invention to an Fc
portion may also lead to an increased half-life, compared to the
corresponding Nanobody (or ISV) of the invention. For some
applications, the use of an Fc portion and/or of constant domains
(i.e. C.sub.H2 and/or C.sub.H3 domains) that confer increased
half-life without any biologically significant effector function
may also be suitable or even preferred. Other suitable constructs
comprising one or more Nanobodies (or ISV's) and one or more
constant domains with increased half-life in vivo will be clear to
the skilled person, and may for example comprise two Nanobodies (or
ISV's) linked to a C.sub.H3 domain, optionally via a linker
sequence. Generally, any fusion protein or derivatives with
increased half-life will preferably have a molecular weight of more
than 50 kD, the cut-off value for renal absorption.
[0686] In another one specific, but non-limiting, aspect, in order
to form a polypeptide of the invention, one or more amino acid
sequences of the invention may be linked (optionally via a suitable
linker or hinge region) to naturally occurring, synthetic or
semisynthetic constant domains (or analogs, variants, mutants,
parts or fragments thereof) that have a reduced (or essentially no)
tendency to self-associate into dimers (i.e. compared to constant
domains that naturally occur in conventional 4-chain antibodies).
Such monomeric (i.e. not self-associating) Fc chain variants, or
fragments thereof, will be clear to the skilled person. For
example, Helm et al., J Biol Chem 1996 271 7494, describe monomeric
Fc.gamma. chain variants that can be used in the polypeptide chains
of the invention.
[0687] Also, such monomeric Fc chain variants are preferably such
that they are still capable of binding to the complement or the
relevant Fc receptor(s) (depending on the Fc portion from which
they are derived), and/or such that they still have some or all of
the effector functions of the Fc portion from which they are
derived (or at a reduced level still suitable for the intended
use). Alternatively, in such a polypeptide chain of the invention,
the monomeric Fc chain may be used to confer increased half-life
upon the polypeptide chain, in which case the monomeric Fc chain
may also have no or essentially no effector functions.
[0688] Bivalent/multivalent, bispecific/multispecific or
biparatopic/multiparatopic polypeptides of the invention may also
be linked to Fc portions, in order to provide polypeptide
constructs of the type that is described in the non-prepublished
U.S. provisional application 61/005,331 entitled "immunoglobulin
constructs" filed on Dec. 4, 2007.
[0689] The further amino acid sequences may also form a signal
sequence or leader sequence that directs secretion of the Nanobody
(or ISV) or the polypeptide of the invention from a host cell upon
synthesis (for example to provide a pre-, pro- or prepro-form of
the polypeptide of the invention, depending on the host cell used
to express the polypeptide of the invention).
[0690] The further amino acid sequence may also form a sequence or
signal that allows the Nanobody (or ISV) or polypeptide of the
invention to be directed towards and/or to penetrate or enter into
specific organs, tissues, cells, or parts or compartments of cells,
and/or that allows the Nanobody (or ISV) or polypeptide of the
invention to penetrate or cross a biological barrier such as a cell
membrane, a cell layer such as a layer of epithelial cells, a tumor
including solid tumors, or the blood-brain-barrier. Suitable
examples of such amino acid sequences will be clear to the skilled
person, and for example include, but are not limited to, those
mentioned on page 118 of WO 08/020079. For some applications, in
particular for those applications in which it is intended to kill a
cell that expresses the target against which the Nanobodies (or
ISV's) of the invention are directed (e.g. in the treatment of
cancer), or to reduce or slow the growth and/or proliferation of
such a cell, the Nanobodies (or ISV's) of the invention may also be
linked to a (cyto)toxic protein or polypeptide. Examples of such
toxic proteins and polypeptides which can be linked to a Nanobody
(or ISV) of the invention to provide--for example--a cytotoxic
polypeptide of the invention will be clear to the skilled person
and can for example be found in the prior art cited above and/or in
the further description herein. One example is the so-called
ADEPT.TM. technology described in WO 03/055527.
[0691] According to one preferred, but non-limiting aspect, said
one or more further amino acid sequences comprise at least one
further Nanobody (or ISV), so as to provide a polypeptide of the
invention that comprises at least two, such as three, four, five or
more Nanobodies (or ISV's), in which said Nanobodies (or ISV's) may
optionally be linked via one or more linker sequences (as defined
herein). As described on pages 119 and 120 of WO 08/020079,
polypeptides of the invention that comprise two or more Nanobodies
(or ISV's), of which at least one is a Nanobody (or ISV) of the
invention, will also be referred to herein as "multivalent"
polypeptides of the invention, and the Nanobodies (or ISV's)
present in such polypeptides will also be referred to herein as
being in a "multivalent format". For example, "bivalent" and
"trivalent" polypeptides of the invention may be as further
described on pages 119 and 120 of WO 08/020079.
[0692] Polypeptides of the invention that contain at least two
Nanobodies (or ISV's), in which at least one Nanobody (or ISV) is
directed against a first antigen (i.e. against any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof) and at least
one Nanobody (or ISV) is directed against a second antigen (i.e.
different from any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof), will also be referred to as "multispecific"
polypeptides of the invention, and the Nanobodies (or ISV's)
present in such polypeptides will also be referred to herein as
being in a "multispecific format". Thus, for example, a
"bispecific" polypeptide of the invention is a polypeptide that
comprises at least one Nanobody (or ISV) directed against a first
antigen (i.e. any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof) and at least one further Nanobody (or ISV)
directed against a second antigen (i.e. different from any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof),
whereas a "trispecific" polypeptide of the invention is a
polypeptide that comprises at least one Nanobody (or ISV) directed
against a first antigen (i.e. any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof), at least one further Nanobody (or
ISV) directed against a second antigen (i.e. different from any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof) and
at least one further Nanobody (or ISV) directed against a third
antigen (i.e. different from both any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof, and the second antigen);
etc.
[0693] Accordingly, in its simplest form, a bispecific polypeptide
of the invention is a bivalent polypeptide of the invention (as
defined herein), comprising a first Nanobody (or ISV) directed
against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof, and a second Nanobody (or ISV) directed
against a second antigen, in which said first and second Nanobody
(or ISV) may optionally be linked via a linker sequence (as defined
herein); whereas a trispecific polypeptide of the invention in its
simplest form is a trivalent polypeptide of the invention (as
defined herein), comprising a first Nanobody (or ISV) directed
against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof, a second Nanobody (or ISV) directed against a
second antigen and a third Nanobody (or ISV) directed against a
third antigen, in which said first, second and third Nanobody (or
ISV) may optionally be linked via one or more, and in particular
one and more, in particular two, linker sequences.
[0694] However, as will be clear from the description hereinabove,
the invention is not limited thereto, in the sense that a
multispecific polypeptide of the invention may comprise at least
one Nanobody (or ISV) against any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof, and any number of Nanobodies (or
ISV's) directed against one or more antigens different from any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof.
[0695] Furthermore, although it is encompassed within the scope of
the invention that the specific order or arrangement of the various
Nanobodies (or ISV's) in the polypeptides of the invention may have
some influence on the properties of the final polypeptide of the
invention (including but not limited to the affinity, specificity
or avidity for any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof, or against the one or more other antigens),
said order or arrangement is usually not critical and may be
suitably chosen by the skilled person, optionally after some
limited routine experiments based on the disclosure herein. Thus,
when reference is made to a specific multivalent or multispecific
polypeptide of the invention, it should be noted that this
encompasses any order or arrangements of the relevant Nanobodies
(or ISV's), unless explicitly indicated otherwise.
[0696] Finally, it is also within the scope of the invention that
the polypeptides of the invention contain two or more Nanobodies
(or ISV's) and one or more further amino acid sequences (as
mentioned herein).
[0697] For multivalent and multispecific polypeptides containing
one or more V.sub.HH domains and their preparation, reference is
also made to Conrath et al., J. Biol. Chem., Vol. 276, 10.
7346-7350, 2001; Muyldermans, Reviews in Molecular Biotechnology 74
(2001), 277-302; as well as to for example WO 96/34103 and WO
99/23221. Some other examples of some specific multispecific and/or
multivalent polypeptide of the invention can be found in the
applications by Ablynx N.V. referred to herein.
[0698] One preferred, but non-limiting example of a multispecific
polypeptide of the invention comprises at least one Nanobody (or
ISV) of the invention and at least one Nanobody (or ISV) that
provides for an increased half-life. Such Nanobodies (or ISV's) may
for example be Nanobodies (or ISV's) that are directed against a
serum protein, and in particular a human serum protein, such as
human serum albumin, thyroxine-binding protein, (human)
transferrin, fibrinogen, an immunoglobulin such as IgG, IgE or IgM,
or against one of the serum proteins listed in WO 04/003019. Of
these, Nanobodies (or ISV's) that can bind to serum albumin (and in
particular human serum albumin) or to IgG (and in particular human
IgG, see for example Nanobody (or ISV) VH-1 described in the review
by Muyldermans, supra) are particularly preferred (although for
example, for experiments in mice or primates, Nanobodies (or ISV's)
against or cross-reactive with mouse serum albumin (MSA) or serum
albumin from said primate, respectively, can be used, however, for
pharmaceutical use, Nanobodies (or ISV's) against human serum
albumin or human IgG will usually be preferred). Nanobodies (or
ISV's) that provide for increased half-life and that can be used in
the polypeptides of the invention include the Nanobodies (or ISV's)
directed against serum albumin that are described in WO 04/041865,
in WO 06/122787 and in the further patent applications by Ablynx
N.V., such as those mentioned above.
[0699] For example, the some preferred Nanobodies (or ISV's) that
provide for increased half-life for use in the present invention
include Nanobodies (or ISV's) that can bind to amino acid residues
on (human) serum albumin that are not involved in binding of serum
albumin to FcRn (see for example WO 06/0122787); Nanobodies (or
ISV's) that are capable of binding to amino acid residues on serum
albumin that do not form part of domain III of serum albumin (see
for example WO 06/0122787); Nanobodies (or ISV's) that have or can
provide an increased half-life (see for example WO 08/028977 by
Ablynx N.V mentioned herein); Nanobodies (or ISV's) against human
serum albumin that are cross-reactive with serum albumin from at
least one species of mammal, and in particular with at least one
species of primate (such as, without limitation, monkeys from the
genus Macaca (such as, and in particular, cynomolgus monkeys
(Macaca fascicularis) and/or rhesus monkeys (Macaca mulatta)) and
baboon (Papio ursinus)) (see for example WO 08/028977 by Ablynx
N.V)); Nanobodies (or ISV's) that can bind to serum albumin in a pH
independent manner (see for example WO2008/043821 by Ablynx N.V.
mentioned herein) and/or Nanobodies (or ISV's) that are conditional
binders (see for example WO 08/043822by Ablynx N.V.).
[0700] Some particularly preferred Nanobodies (or ISV's) that
provide for increased half-life and that can be used in the
polypeptides of the invention include the Nanobodies (or ISV's)
ALB-1 to ALB-10 disclosed in WO 06/122787 (see Tables II and III)
of which ALB-8 (SEQ ID NO: 62 in WO 06/122787) is particularly
preferred.
[0701] According to a specific, but non-limiting aspect of the
invention, the polypeptides of the invention contain, besides the
one or more Nanobodies (or ISV's) of the invention, at least one
Nanobody (or ISV) against human serum albumin.
[0702] Generally, any polypeptide of the invention with increased
half-life that contains one or more Nanobodies (or ISV's) of the
invention, and any derivatives of Nanobodies (or ISV's) of the
invention or of such polypeptides that have an increased half-life,
preferably have a half-life that is at least 1.5 times, preferably
at least 2 times, such as at least 5 times, for example at least 10
times or more than 20 times, greater than the half-life of the
corresponding Nanobody (or ISV) of the invention per se. For
example, such a derivative or polypeptides with increased half-life
may have a half-life that is increased with more than 1 hours,
preferably more than 2 hours, more preferably more than 6 hours,
such as more than 12 hours, or even more than 24, 48 or 72 hours,
compared to the corresponding Nanobody (or ISV) of the invention
per se.
[0703] In a preferred, but non-limiting aspect of the invention,
such derivatives or polypeptides may exhibit a serum half-life in
human of at least about 12 hours, preferably at least 24 hours,
more preferably at least 48 hours, even more preferably at least 72
hours or more. For example, such derivatives or polypeptides may
have a half-life of at least 5 days (such as about 5 to 10 days),
preferably at least 9 days (such as about 9 to 14 days), more
preferably at least about 10 days (such as about 10 to 15 days), or
at least about 11 days (such as about 11 to 16 days), more
preferably at least about 12 days (such as about 12 to 18 days or
more), or more than 14 days (such as about 14 to 19 days).
[0704] According to one aspect of the invention the polypeptides
are capable of binding to one or more molecules which can increase
the half-life of the polypeptide in vivo. The polypeptides of the
invention are stabilized in vivo and their half-life increased by
binding to molecules which resist degradation and/or clearance or
sequestration. Typically, such molecules are naturally occurring
proteins which themselves have a long half-life in vivo. Another
preferred, but non-limiting example of a multispecific polypeptide
of the invention comprises at least one Nanobody (or ISV) of the
invention and at least one Nanobody (or ISV) that directs the
polypeptide of the invention towards, and/or that allows the
polypeptide of the invention to penetrate or to enter into specific
organs, tissues, cells, or parts or compartments of cells, and/or
that allows the Nanobody (or ISV) to penetrate or cross a
biological barrier such as a cell membrane, a cell layer such as a
layer of epithelial cells, a tumor including solid tumors, or the
blood-brain-barrier. Examples of such Nanobodies (or ISV's) include
Nanobodies (or ISV's) that are directed towards specific
cell-surface proteins, markers or epitopes of the desired organ,
tissue or cell (for example cell-surface markers associated with
tumor cells), and the single-domain brain targeting antibody
fragments described in WO 02/057445 and WO 06/040153, of which FC44
(SEQ ID NO: 189 of WO 06/040153) and FC5 (SEQ ID NO: 190 of WO
06/040154) are preferred examples. In the polypeptides of the
invention, the one or more Nanobodies (or ISV's) and the one or
more polypeptides may be directly linked to each other (as for
example described in WO 99/23221) and/or may be linked to each
other via one or more suitable spacers or linkers, or any
combination thereof.
[0705] Suitable spacers or linkers for use in multivalent and
multispecific polypeptides will be clear to the skilled person, and
may generally be any linker or spacer used in the art to link amino
acid sequences. Preferably, said linker or spacer is suitable for
use in constructing proteins or polypeptides that are intended for
pharmaceutical use. Some particularly preferred spacers include the
spacers and linkers that are used in the art to link antibody
fragments or antibody domains. These include the linkers mentioned
in the general background art cited above, as well as for example
linkers that are used in the art to construct diabodies or ScFv
fragments (in this respect, however, its should be noted that,
whereas in diabodies and in ScFv fragments, the linker sequence
used should have a length, a degree of flexibility and other
properties that allow the pertinent V.sub.H and V.sub.L domains to
come together to form the complete antigen-binding site, there is
no particular limitation on the length or the flexibility of the
linker used in the polypeptide of the invention, since each
Nanobody (or ISV) by itself forms a complete antigen-binding site).
For example, a linker may be a suitable amino acid sequence, and in
particular amino acid sequences of between 1 and 50, preferably
between 1 and 30, such as between 1 and 10 amino acid residues.
Some preferred examples of such amino acid sequences include
gly-ser linkers, for example of the type
(gly.sub.xser.sub.y).sub.z, such as (for example
(gly.sub.4ser).sub.3 or (gly.sub.3ser.sub.2).sub.3, as described in
WO 99/42077 and the GS30, GS15, GS9 and GS7 linkers described in
the applications by Ablynx mentioned herein (see for example WO
06/040153 and WO 06/122825), as well as hinge-like regions, such as
the hinge regions of naturally occurring heavy chain antibodies or
similar sequences (such as described in WO 94/04678). Some other
particularly preferred linkers are poly-alanine (such as AAA), as
well as the linkers GS30 (SEQ ID NO: 85 in WO 06/122825) and GS9
(SEQ ID NO: 84 in WO 06/122825). Other suitable linkers generally
comprise organic compounds or polymers, in particular those
suitable for use in proteins for pharmaceutical use. For instance,
poly(ethyleneglycol) moieties have been used to link antibody
domains, see for example WO 04/081026. It is encompassed within the
scope of the invention that the length, the degree of flexibility
and/or other properties of the linker(s) used (although not
critical, as it usually is for linkers used in ScFv fragments) may
have some influence on the properties of the final polypeptide of
the invention, including but not limited to the affinity,
specificity or avidity for any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof, or for one or more of the other
antigens. Based on the disclosure herein, the skilled person will
be able to determine the optimal linker(s) for use in a specific
polypeptide of the invention, optionally after some limited routine
experiments. For example, in multivalent polypeptides of the
invention that comprise Nanobodies (or ISV's) directed against a
multimeric antigen (such as a multimeric receptor or other
protein), the length and flexibility of the linker are preferably
such that it allows each Nanobody (or ISV) of the invention present
in the polypeptide to bind to the antigenic determinant on each of
the subunits of the multimer. Similarly, in a multispecific
polypeptide of the invention that comprises Nanobodies (or ISV's)
directed against two or more different antigenic determinants on
the same antigen (for example against different epitopes of an
antigen and/or against different subunits of a multimeric receptor,
channel or protein), the length and flexibility of the linker are
preferably such that it allows each Nanobody (or ISV) to bind to
its intended antigenic determinant. Again, based on the disclosure
herein, the skilled person will be able to determine the optimal
linker(s) for use in a specific polypeptide of the invention,
optionally after some limited routine experiments. It is also
within the scope of the invention that the linker(s) used confer
one or more other favourable properties or functionality to the
polypeptides of the invention, and/or provide one or more sites for
the formation of derivatives and/or for the attachment of
functional groups (e.g. as described herein for the derivatives of
the Nanobodies (or ISV's) of the invention). For example, linkers
containing one or more charged amino acid residues (see Table A-2
on page 48 of the International application WO 08/020079) can
provide improved hydrophilic properties, whereas linkers that form
or contain small epitopes or tags can be used for the purposes of
detection, identification and/or purification. Again, based on the
disclosure herein, the skilled person will be able to determine the
optimal linkers for use in a specific polypeptide of the invention,
optionally after some limited routine experiments. Finally, when
two or more linkers are used in the polypeptides of the invention,
these linkers may be the same or different. Again, based on the
disclosure herein, the skilled person will be able to determine the
optimal linkers for use in a specific polypeptide of the invention,
optionally after some limited routine experiments. Usually, for
easy of expression and production, a polypeptide of the invention
will be a linear polypeptide. However, the invention in its
broadest sense is not limited thererto. For example, when a
polypeptide of the invention comprises three of more Nanobodies (or
ISV's), it is possible to link them by use of a linker with three
or more "arms", which each "arm" being linked to a Nanobody (or
ISV), so as to provide a "star-shaped" construct. It is also
possible, although usually less preferred, to use circular
constructs. The invention also comprises derivatives of the
polypeptides of the invention, which may be essentially analogous
to the derivatives of the Nanobodies (or ISV's) of the invention,
i.e. as described herein. The invention also comprises proteins or
polypeptides that "essentially consist" of a polypeptide of the
invention (in which the wording "essentially consist of" has
essentially the same meaning as indicated hereinabove).
[0706] According to one aspect of the invention, the polypeptide of
the invention is in essentially isolated from, as defined herein.
The amino acid sequences, Nanobodies (or ISV's), polypeptides and
nucleic acids of the invention can be prepared in a manner known
per se, as will be clear to the skilled person from the further
description herein. For example, the Nanobodies (or ISV's) and
polypetides of the invention can be prepared in any manner known
per se for the preparation of antibodies and in particular for the
preparation of antibody fragments (including but not limited to
(single) domain antibodies and ScFv fragments). Some preferred, but
non-limiting methods for preparing the amino acid sequences,
Nanobodies (or ISV's), polypeptides and nucleic acids include the
methods and techniques described herein.
[0707] As will be clear to the skilled person, one particularly
useful method for preparing an amino acid sequence, Nanobody (or
ISV) and/or a polypeptide of the invention generally comprises the
steps of: [0708] i) the expression, in a suitable host cell or host
organism (also referred to herein as a "host of the invention") or
in another suitable expression system of a nucleic acid that
encodes said amino acid sequence, Nanobody (or ISV) or polypeptide
of the invention (also referred to herein as a "nucleic acid of the
invention"), optionally followed by: [0709] ii) isolating and/or
purifying the amino acid sequence, Nanobody (or ISV) or polypeptide
of the invention thus obtained.
[0710] In particular, such a method may comprise the steps of:
[0711] i) cultivating and/or maintaining a host of the invention
under conditions that are such that said host of the invention
expresses and/or produces at least one amino acid sequence,
Nanobody (or ISV) and/or polypeptide of the invention; optionally
followed by: [0712] ii) isolating and/or purifying the amino acid
sequence, Nanobody (or ISV) or polypeptide of the invention thus
obtained.
[0713] A nucleic acid of the invention can be in the form of single
or double stranded DNA or RNA, and is preferably in the form of
double stranded DNA. For example, the nucleotide sequences of the
invention may be genomic DNA, cDNA or synthetic DNA (such as DNA
with a codon usage that has been specifically adapted for
expression in the intended host cell or host organism). According
to one aspect of the invention, the nucleic acid of the invention
is in essentially isolated from, as defined herein. The nucleic
acid of the invention may also be in the form of, be present in
and/or be part of a vector, such as for example a plasmid, cosmid
or YAC, which again may be in essentially isolated form. The
nucleic acids of the invention can be prepared or obtained in a
manner known per se, based on the information on the amino acid
sequences for the polypeptides of the invention given herein,
and/or can be isolated from a suitable natural source. To provide
analogs, nucleotide sequences encoding naturally occurring V.sub.HH
domains can for example be subjected to site-directed mutagenesis,
so at to provide a nucleic acid of the invention encoding said
analog. Also, as will be clear to the skilled person, to prepare a
nucleic acid of the invention, also several nucleotide sequences,
such as at least one nucleotide sequence encoding a Nanobody (or
ISV) and for example nucleic acids encoding one or more linkers can
be linked together in a suitable manner. Techniques for generating
the nucleic acids of the invention will be clear to the skilled
person and may for instance include, but are not limited to,
automated DNA synthesis; site-directed mutagenesis; combining two
or more naturally occurring and/or synthetic sequences (or two or
more parts thereof), introduction of mutations that lead to the
expression of a truncated expression product; introduction of one
or more restriction sites (e.g. to create cassettes and/or regions
that may easily be digested and/or ligated using suitable
restriction enzymes), and/or the introduction of mutations by means
of a PCR reaction using one or more "mismatched" primers, using for
example a sequence of a naturally occurring form of any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof as a
template. These and other techniques will be clear to the skilled
person, and reference is again made to the standard handbooks, such
as Sambrook et al. and Ausubel et al., mentioned above, as well as
the Examples below. The nucleic acid of the invention may also be
in the form of, be present in and/or be part of a genetic
construct, as will be clear to the person skilled in the art and as
described on pages 131-134 of WO 08/020079 (incorporated herein by
reference). Such genetic constructs generally comprise at least one
nucleic acid of the invention that is optionally linked to one or
more elements of genetic constructs known per se, such as for
example one or more suitable regulatory elements (such as a
suitable promoter(s), enhancer(s), terminator(s), etc.) and the
further elements of genetic constructs referred to herein. Such
genetic constructs comprising at least one nucleic acid of the
invention will also be referred to herein as "genetic constructs of
the invention". The genetic constructs of the invention may be DNA
or RNA, and are preferably double-stranded DNA. The genetic
constructs of the invention may also be in a form suitable for
transformation of the intended host cell or host organism, in a
form suitable for integration into the genomic DNA of the intended
host cell or in a form suitable for independent replication,
maintenance and/or inheritance in the intended host organism. For
instance, the genetic constructs of the invention may be in the
form of a vector, such as for example a plasmid, cosmid, YAC, a
viral vector or transposon. In particular, the vector may be an
expression vector, i.e. a vector that can provide for expression in
vitro and/or in vivo (e.g. in a suitable host cell, host organism
and/or expression system).
[0714] In a preferred but non-limiting aspect, a genetic construct
of the invention comprises [0715] i) at least one nucleic acid of
the invention; operably connected to [0716] ii) one or more
regulatory elements, such as a promoter and optionally a suitable
terminator; and optionally also [0717] iii) one or more further
elements of genetic constructs known per se;
[0718] in which the terms "operably connected" and "operably
linked" have the meaning given on pages 131-134 of WO 08/020079;
and in which the "regulatory elements", "promoter", "terminator"
and "further elements" are as described on pages 131-134 of WO
08/020079; and in which the genetic constructs may further be as
described on pages 131-134 of WO 08/020079.
[0719] The nucleic acids of the invention and/or the genetic
constructs of the invention may be used to transform a host cell or
host organism, i.e. for expression and/or production of the amino
acid sequence, Nanobody (or ISV) or polypeptide of the invention.
Suitable hosts or host cells will be clear to the skilled person,
and may for example be any suitable fungal, prokaryotic or
eukaryotic cell or cell line or any suitable fungal, prokaryotic or
eukaryotic organism, for example those described on pages 134 and
135 of WO 08/020079; as well as all other hosts or host cells known
per se for the expression and production of antibodies and antibody
fragments (including but not limited to (single) domain antibodies
and ScFv fragments), which will be clear to the skilled person.
Reference is also made to the general background art cited
hereinabove, as well as to for example WO 94/29457; WO 96/34103; WO
99/42077; Frenken et al., (1998), supra; Riechmann and Muyldermans,
(1999), supra; van der Linden, (2000), supra; Thomassen et al.,
(2002), supra; Joosten et al., (2003), supra; Joosten et al.,
(2005), supra; and the further references cited herein.
[0720] The amino acid sequences, Nanobodies (or ISV's) and
polypeptides of the invention can also be introduced and expressed
in one or more cells, tissues or organs of a multicellular
organism, for example for prophylactic and/or therapeutic purposes
(e.g. as a gene therapy), as further described on pages 135 and 136
of in WO 08/020079 and in the further references cited in WO
08/020079.
[0721] For expression of the Nanobodies (or ISV's) in a cell, they
may also be expressed as so-called "intrabodies", as for example
described in WO 94/02610, WO 95/22618 and U.S. Pat. No. 7,004,940;
WO 03/014960; in Cattaneo, A. & Biocca, S. (1997) Intracellular
Antibodies: Development and Applications. Landes and
Springer-Verlag; and in Kontermann, Methods 34, (2004),
163-170.
[0722] The amino acid sequences, Nanobodies (or ISV's) and
polypeptides of the invention can for example also be produced in
the milk of transgenic mammals, for example in the milk of rabbits,
cows, goats or sheep (see for example U.S. Pat. Nos. 6,741,957,
6,304,489 and 6,849,992 for general techniques for introducing
transgenes into mammals), in plants or parts of plants including
but not limited to their leaves, flowers, fruits, seed, roots or
turbers (for example in tobacco, maize, soybean or alfalfa) or in
for example pupae of the silkworm Bombix mori.
[0723] Furthermore, the amino acid sequences, Nanobodies (or ISV's)
and polypeptides of the invention can also be expressed and/or
produced in cell-free expression systems, and suitable examples of
such systems will be clear to the skilled person. Some preferred,
but non-limiting examples include expression in the wheat germ
system; in rabbit reticulocyte lysates; or in the E. coli Zubay
system.
[0724] As mentioned above, one of the advantages of the use of
Nanobodies (or ISV's) is that the polypeptides based thereon can be
prepared through expression in a suitable bacterial system, and
suitable bacterial expression systems, vectors, host cells,
regulatory elements, etc., will be clear to the skilled person, for
example from the references cited above. It should however be noted
that the invention in its broadest sense is not limited to
expression in bacterial systems.
[0725] Preferably, in the invention, an (in vivo or in vitro)
expression system, such as a bacterial expression system, is used
that provides the polypeptides of the invention in a form that is
suitable for pharmaceutical use, and such expression systems will
again be clear to the skilled person. As also will be clear to the
skilled person, polypeptides of the invention suitable for
pharmaceutical use can be prepared using techniques for peptide
synthesis.
[0726] For production on industrial scale, preferred heterologous
hosts for the (industrial) production of Nanobodies (or ISV's) or
Nanobody (or ISV)-containing protein therapeutics include strains
of E. coli, Pichia pastoris, S. cerevisiae that are suitable for
large scale expression/production/fermentation, and in particular
for large scale pharmaceutical (i.e. GMP grade)
expression/production/fermentation. Suitable examples of such
strains will be clear to the skilled person. Such strains and
production/expression systems are also made available by companies
such as Biovitrum (Uppsala, Sweden).
[0727] Alternatively, mammalian cell lines, in particular Chinese
hamster ovary (CHO) cells, can be used for large scale
expression/production/fermentation, and in particular for large
scale pharmaceutical expression/production/fermentation. Again,
such expression/production systems are also made available by some
of the companies mentioned above. The choice of the specific
expression system would depend in part on the requirement for
certain post-translational modifications, more specifically
glycosylation. The production of a Nanobody (or ISV)-containing
recombinant protein for which glycosylation is desired or required
would necessitate the use of mammalian expression hosts that have
the ability to glycosylate the expressed protein. In this respect,
it will be clear to the skilled person that the glycosylation
pattern obtained (i.e. the kind, number and position of residues
attached) will depend on the cell or cell line that is used for the
expression. Preferably, either a human cell or cell line is used
(i.e. leading to a protein that essentially has a human
glycosylation pattern) or another mammalian cell line is used that
can provide a glycosylation pattern that is essentially and/or
functionally the same as human glycosylation or at least mimics
human glycosylation. Generally, prokaryotic hosts such as E. coli
do not have the ability to glycosylate proteins, and the use of
lower eukaryotes such as yeast usually leads to a glycosylation
pattern that differs from human glycosylation. Nevertheless, it
should be understood that all the foregoing host cells and
expression systems can be used in the invention, depending on the
desired amino acid sequence, Nanobody (or ISV) or polypeptide to be
obtained. Thus, according to one non-limiting aspect of the
invention, the amino acid sequence, Nanobody (or ISV) or
polypeptide of the invention is glycosylated. According to another
non-limiting aspect of the invention, the amino acid sequence,
Nanobody (or ISV) or polypeptide of the invention is
non-glycosylated. According to one preferred, but non-limiting
aspect of the invention, the amino acid sequence, Nanobody (or ISV)
or polypeptide of the invention is produced in a bacterial cell, in
particular a bacterial cell suitable for large scale pharmaceutical
production, such as cells of the strains mentioned above. According
to another preferred, but non-limiting aspect of the invention, the
amino acid sequence, Nanobody (or ISV) or polypeptide of the
invention is produced in a yeast cell, in particular a yeast cell
suitable for large scale pharmaceutical production, such as cells
of the species mentioned above. According to yet another preferred,
but non-limiting aspect of the invention, the amino acid sequence,
Nanobody (or ISV) or polypeptide of the invention is produced in a
mammalian cell, in particular in a human cell or in a cell of a
human cell line, and more in particular in a human cell or in a
cell of a human cell line that is suitable for large scale
pharmaceutical production, such as the cell lines mentioned
hereinabove. As further described on pages 138 and 139 of WO
08/020079, when expression in a host cell is used to produce the
amino acid sequences, Nanobodies (or ISV's) and the polypeptides of
the invention, the amino acid sequences, Nanobodies (or ISV's) and
polypeptides of the invention can be produced either
intracellullarly (e.g. in the cytosol, in the periplasma or in
inclusion bodies) and then isolated from the host cells and
optionally further purified; or can be produced extracellularly
(e.g. in the medium in which the host cells are cultured) and then
isolated from the culture medium and optionally further purified.
Thus, according to one non-limiting aspect of the invention, the
amino acid sequence, Nanobody (or ISV) or polypeptide of the
invention is an amino acid sequence, Nanobody (or ISV) or
polypeptide that has been produced intracellularly and that has
been isolated from the host cell, and in particular from a
bacterial cell or from an inclusion body in a bacterial cell.
According to another non-limiting aspect of the invention, the
amino acid sequence, Nanobody (or 1SV) or polypeptide of the
invention is an amino acid sequence, Nanobody (or ISV) or
polypeptide that has been produced extracellularly, and that has
been isolated from the medium in which the host cell is cultivated.
Some preferred, but non-limiting promoters for use with these host
cells include those mentioned on pages 139 and 140 of WO 08/020079.
Some preferred, but non-limiting secretory sequences for use with
these host cells include those mentioned on page 140 of WO
08/020079. Suitable techniques for transforming a host or host cell
of the invention will be clear to the skilled person and may depend
on the intended host cell/host organism and the genetic construct
to be used. Reference is again made to the handbooks and patent
applications mentioned above. After transformation, a step for
detecting and selecting those host cells or host organisms that
have been successfully transformed with the nucleotide
sequence/genetic construct of the invention may be performed. This
may for instance be a selection step based on a selectable marker
present in the genetic construct of the invention or a step
involving the detection of the amino acid sequence of the
invention, e.g. using specific antibodies. The transformed host
cell (which may be in the form or a stable cell line) or host
organisms (which may be in the form of a stable mutant line or
strain) form further aspects of the present invention. Preferably,
these host cells or host organisms are such that they express, or
are (at least) capable of expressing (e.g. under suitable
conditions), an amino acid sequence, Nanobody (or ISV) or
polypeptide of the invention (and in case of a host organism: in at
least one cell, part, tissue or organ thereof). The invention also
includes further generations, progeny and/or offspring of the host
cell or host organism of the invention, that may for instance be
obtained by cell division or by sexual or asexual reproduction. To
produce/obtain expression of the amino acid sequences of the
invention, the transformed host cell or transformed host organism
may generally be kept, maintained and/or cultured under conditions
such that the (desired) amino acid sequence, Nanobody (or ISV) or
polypeptide of the invention is expressed/produced. Suitable
conditions will be clear to the skilled person and will usually
depend upon the host cell/host organism used, as well as on the
regulatory elements that control the expression of the (relevant)
nucleotide sequence of the invention. Again, reference is made to
the handbooks and patent applications mentioned above in the
paragraphs on the genetic constructs of the invention. Generally,
suitable conditions may include the use of a suitable medium, the
presence of a suitable source of food and/or suitable nutrients,
the use of a suitable temperature, and optionally the presence of a
suitable inducing factor or compound (e.g. when the nucleotide
sequences of the invention are under the control of an inducible
promoter); all of which may be selected by the skilled person.
Again, under such conditions, the amino acid sequences of the
invention may be expressed in a constitutive manner, in a transient
manner, or only when suitably induced.
[0728] It will also be clear to the skilled person that the amino
acid sequence, Nanobody (or ISV) or polypeptide of the invention
may (first) be generated in an immature form (as mentioned above),
which may then be subjected to post-translational modification,
depending on the host cell/host organism used. Also, the amino acid
sequence, Nanobody (or ISV) or polypeptide of the invention may be
glycosylated, again depending on the host cell/host organism used.
The amino acid sequence, Nanobody (or ISV) or polypeptide of the
invention may then be isolated from the host cell/host organism
and/or from the medium in which said host cell or host organism was
cultivated, using protein isolation and/or purification techniques
known per se, such as (preparative) chromatography and/or
electrophoresis techniques, differential precipitation techniques,
affinity techniques (e.g. using a specific, cleavable amino acid
sequence fused with the amino acid sequence, Nanobody (or ISV) or
polypeptide of the invention) and/or preparative immunological
techniques (i.e. using antibodies against the amino acid sequence
to be isolated). Generally, for pharmaceutical use, the
polypeptides of the invention may be formulated as a pharmaceutical
preparation or compositions comprising at least one polypeptide of
the invention and at least one pharmaceutically acceptable carrier,
diluent or excipient and/or adjuvant, and optionally one or more
further pharmaceutically active polypeptides and/or compounds. By
means of non-limiting examples, such a formulation may be in a form
suitable for oral administration, for parenteral administration
(such as by intravenous, intramuscular or subcutaneous injection or
intravenous infusion), for topical administration, for
administration by inhalation, by a skin patch, by an implant, by a
suppository, etc. Such suitable administration forms--which may be
solid, semi-solid or liquid, depending on the manner of
administration--as well as methods and carriers for use in the
preparation thereof, will be clear to the skilled person, and are
further described herein. Thus, in a further aspect, the invention
relates to a pharmaceutical composition that contains at least one
amino acid of the invention, at least one Nanobody (or ISV) of the
invention or at least one polypeptide of the invention and at least
one suitable carrier, diluent or excipient (i.e. suitable for
pharmaceutical use), and optionally one or more further active
substances. Generally, the amino acid sequences, Nanobodies (or
ISV's) and polypeptides of the invention can be formulated and
administered in any suitable manner known per se, for which
reference is for example made to the general background art cited
above (and in particular to WO 04/041862, WO 04/041863, WO
04/041865, WO 04/041867 and WO 08/020079) as well as to the
standard handbooks, such as Remington's Pharmaceutical Sciences,
18.sup.th Ed., Mack Publishing Company, USA (1990), Remington, the
Science and Practice of Pharmacy, 21th Edition, Lippincott Williams
and Wilkins (2005); or the Handbook of Therapeutic Antibodies (S.
Dubel, Ed.), Wiley, Weinheim, 2007 (see for example pages 252-255).
For example, the amino acid sequences, Nanobodies (or ISV's) and
polypeptides of the invention may be formulated and administered in
any manner known per se for conventional antibodies and antibody
fragments (including ScFv's and diabodies) and other
pharmaceutically active proteins. Such formulations and methods for
preparing the same will be clear to the skilled person, and for
example include preparations suitable for parenteral administration
(for example intravenous, intraperitoneal, subcutaneous,
intramuscular, intraluminal, intra-arterial or intrathecal
administration) or for topical (i.e. transdermal or intradermal)
administration. Preparations for parenteral administration may for
example be sterile solutions, suspensions, dispersions or emulsions
that are suitable for infusion or injection. Suitable carriers or
diluents for such preparations for example include, without
limitation, those mentioned on page 143 of WO 08/020079. Usually,
aqueous solutions or suspensions will be preferred. The amino acid
sequences, Nanobodies (or ISV's) and polypeptides of the invention
can also be administered using gene therapy methods of delivery.
See, e.g., U.S. Pat. No. 5,399,346, which is incorporated by
reference in its entirety. Using a gene therapy method of delivery,
primary cells transfected with the gene encoding an amino acid
sequence, Nanobody (or ISV) or polypeptide of the invention can
additionally be transfected with tissue specific promoters to
target specific organs, tissue, grafts, tumors, or cells and can
additionally be transfected with signal and stabilization sequences
for subcellularly localized expression. Thus, the amino acid
sequences, Nanobodies (or ISV's) and polypeptides of the invention
may be systemically administered, e.g., orally, in combination with
a pharmaceutically acceptable vehicle such as an inert diluent or
an assimilable edible carrier. They may be enclosed in hard or soft
shell gelatin capsules, may be compressed into tablets, or may be
incorporated directly with the food of the patient's diet. For oral
therapeutic administration, the amino acid sequences, Nanobodies
(or ISV's) and polypeptides of the invention may be combined with
one or more excipients and used in the form of ingestible tablets,
buccal tablets, troches, capsules, elixirs, suspensions, syrups,
wafers, and the like. Such compositions and preparations should
contain at least 0.1% of the amino acid sequence, Nanobody (or ISV)
or polypeptide of the invention. Their percentage in the
compositions and preparations may, of course, be varied and may
conveniently be between about 2 to about 60% of the weight of a
given unit dosage form. The amount of the amino acid sequence,
Nanobody (or ISV) or polypeptide of the invention in such
therapeutically useful compositions is such that an effective
dosage level will be obtained.
[0729] The tablets, troches, pills, capsules, and the like may also
contain binders, excipients, disintegrating agents, lubricants and
sweetening or flavouring agents, for example those mentioned on
pages 143-144 of WO 08/020079. When the unit dosage form is a
capsule, it may contain, in addition to materials of the above
type, a liquid carrier, such as a vegetable oil or a polyethylene
glycol. Various other materials may be present as coatings or to
otherwise modify the physical form of the solid unit dosage form.
For instance, tablets, pills, or capsules may be coated with
gelatin, wax, shellac or sugar and the like. A syrup or elixir may
contain the amino acid sequences, Nanobodies (or ISV's) and
polypeptides of the invention, sucrose or fructose as a sweetening
agent, methyl and propylparabens as preservatives, a dye and
flavoring such as cherry or orange flavor. Of course, any material
used in preparing any unit dosage form should be pharmaceutically
acceptable and substantially non-toxic in the amounts employed. In
addition, the amino acid sequences, Nanobodies (or ISV's) and
polypeptides of the invention may be incorporated into
sustained-release preparations and devices.
[0730] Preparations and formulations for oral administration may
also be provided with an enteric coating that will allow the
constructs of the invention to resist the gastric environment and
pass into the intestines. More generally, preparations and
formulations for oral administration may be suitably formulated for
delivery into any desired part of the gastrointestinal tract. In
addition, suitable suppositories may be used for delivery into the
gastrointestinal tract. The amino acid sequences, Nanobodies (or
ISV's) and polypeptides of the invention may also be administered
intravenously or intraperitoneally by infusion or injection, as
further described on pages 144 and 145 of WO 08/020079. For topical
administration, the amino acid sequences, Nanobodies (or ISV's) and
polypeptides of the invention may be applied in pure form, i.e.,
when they are liquids. However, it will generally be desirable to
administer them to the skin as compositions or formulations, in
combination with a dermatologically acceptable carrier, which may
be a solid or a liquid, as further described on page 145 of WO
08/020079.
[0731] Generally, the concentration of the amino acid sequences,
Nanobodies (or ISV's) and polypeptides of the invention in a liquid
composition, such as a lotion, will be from about 0.1-25 wt-%,
preferably from about 0.5-10 wt-%. The concentration in a
semi-solid or solid composition such as a gel or a powder will be
about 0.1-5 wt-%, preferably about 0.5-2.5 wt-%. The amount of the
amino acid sequences, Nanobodies (or ISV's) and polypeptides of the
invention required for use in treatment will vary not only with the
particular amino acid sequence, Nanobody (or ISV) or polypeptide
selected but also with the route of administration, the nature of
the condition being treated and the age and condition of the
patient and will be ultimately at the discretion of the attendant
physician or clinician. Also the dosage of the amino acid
sequences, Nanobodies (or ISV's) and polypeptides of the invention
varies depending on the target cell, tumor, tissue, graft, or
organ. The desired dose may conveniently be presented in a single
dose or as divided doses administered at appropriate intervals, for
example, as two, three, four or more sub-doses per day. The
sub-dose itself may be further divided, e.g., into a number of
discrete loosely spaced administrations; such as multiple
inhalations from an insufflator or by application of a plurality of
drops into the eye. An administration regimen could include
long-term, daily treatment. By "long-term" is meant at least two
weeks and preferably, several weeks, months, or years of duration.
Necessary modifications in this dosage range may be determined by
one of ordinary skill in the art using only routine experimentation
given the teachings herein. See Remington's Pharmaceutical Sciences
(Martin, E. W., ed. 4), Mack Publishing Co., Easton, Pa. The dosage
can also be adjusted by the individual physician in the event of
any complication.
[0732] In another aspect, the invention relates to a method for the
prevention and/or treatment of at least one immune related diseases
and disorders of the invention, said method comprising
administering, to a subject in need thereof, a pharmaceutically
active amount of an amino acid sequence of the invention, of a
Nanobody (or ISV) of the invention, of a polypeptide of the
invention, and/or of a pharmaceutical composition comprising the
same. In the context of the present invention, the term "prevention
and/or treatment" not only comprises preventing and/or treating the
disease, but also generally comprises preventing the onset of the
disease, slowing or reversing the progress of disease, preventing
or slowing the onset of one or more symptoms associated with the
disease, reducing and/or alleviating one or more symptoms
associated with the disease, reducing the severity and/or the
duration of the disease and/or of any symptoms associated therewith
and/or preventing a further increase in the severity of the disease
and/or of any symptoms associated therewith, preventing, reducing
or reversing any physiological damage caused by the disease, and
generally any pharmacological action that is beneficial to the
patient being treated. The subject to be treated may be any
warm-blooded animal, but is in particular a mammal, and more in
particular a human being. As will be clear to the skilled person,
the subject to be treated will in particular be a person suffering
from, or at risk of, the diseases and disorders mentioned herein.
The invention relates to a method for the prevention and/or
treatment of at least one disease or disorder that is associated
with any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof, with its biological or pharmacological activity, and/or
with the biological pathways or signalling in which any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof is involved,
said method comprising administering, to a subject in need thereof,
a pharmaceutically active amount of an amino acid sequence of the
invention, of a Nanobody (or ISV) of the invention, of a
polypeptide of the invention, and/or of a pharmaceutical
composition comprising the same. In particular, the invention
relates to a method for the prevention and/or treatment of at least
one disease or disorder that can be treated by modulating any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof, its
biological or pharmacological activity, and/or the biological
pathways or signalling in which any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof is involved, said method
comprising administering, to a subject in need thereof, a
pharmaceutically active amount of an amino acid sequence of the
invention, of a Nanobody (or ISV) of the invention, of a
polypeptide of the invention, and/or of a pharmaceutical
composition comprising the same. In particular, said
pharmaceutically effective amount may be an amount that is
sufficient to modulate any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof, its biological or pharmacological
activity, and/or the biological pathways or signalling in which any
of IL-17A, IL-17F and/or IL-17A/F including combinations thereof is
involved; and/or an amount that provides a level of the amino acid
sequence of the invention, of a Nanobody (or ISV) of the invention,
of a polypeptide of the invention in the circulation that is
sufficient to modulate any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof, its biological or pharmacological
activity, and/or the biological pathways or signalling in which any
of IL-17A, IL-17F and/or IL-17A/F including combinations thereof is
involved. The invention furthermore relates to a method for the
prevention and/or treatment of at least one disease or disorder
that can be prevented and/or treated by administering an amino acid
sequence of the invention, a Nanobody (or ISV) of the invention or
a polypeptide of the invention to a patient, said method comprising
administering, to a subject in need thereof, a pharmaceutically
active amount of an amino acid sequence of the invention, of a
Nanobody (or ISV) of the invention, of a polypeptide of the
invention, and/or of a pharmaceutical composition comprising the
same. More in particular, the invention relates to a method for the
prevention and/or treatment of at least one disease or disorder
chosen from the group consisting of the diseases and disorders
listed herein, said method comprising administering, to a subject
in need thereof, a pharmaceutically active amount of an amino acid
sequence of the invention, of a Nanobody (or ISV) of the invention,
of a polypeptide of the invention, and/or of a pharmaceutical
composition comprising the same. Examples of the immune related
diseases and disorders of the invention will be clear to the
skilled person based on the disclosure herein, and for example
include the following diseases and disorders: systemic lupus
erythematosis, rheumatoid arthritis, osteoarthritis, juvenile
chronic arthritis, spondyloarthropathies, systemic sclerosis,
idiopathic inflammatory myopathies, Sjogren's syndrome, systemic
vasculitis, sarcoidosis, autoimmune hemolytic anemia, autoimmune
thrombocytopenia, thyroiditis, diabetes mellitus, immune-mediated
renal disease, demyelinating diseases of the central and peripheral
nervous systems such as multiple sclerosis, idiopathic
demyelinating polyneuropathy or Guillain Barre syndrome, and
chronic inflammatory demyelinating polyneuropathy, hepatobiliary
diseases such as infectious, autoimmune chronic active hepatitis,
primary biliary cirrhosis, granulomatous hepatitis, and sclerosing
cholangitis, inflammatory bowel disease, gluten-sensitive
enteropathy, and Whipple's disease, autoimmune or immune-mediated
skin diseases including bullous skin diseases, erythema multiforme
and contact dermatitis, psoriasis, allergic diseases such as
asthma, allergic rhinitis, atopic dermatitis, food hypersensitivity
and urticaria, immunologic diseases of the lung such as
eosinophilic pneumonia, idiopathic pulmonary fibrosis and
hypersensitivity pneumonitis, transplantation associated diseases
including graft rejection and graft-versus-host-disease.
[0733] In the above methods, the amino acid sequences, Nanobodies
(or ISV's) and/or polypeptides of the invention and/or the
compositions comprising the same can be administered in any
suitable manner, depending on the specific pharmaceutical
formulation or composition to be used. Thus, the amino acid
sequences, Nanobodies (or ISV's) and/or polypeptides of the
invention and/or the compositions comprising the same can for
example be administered orally, intraperitoneally (e.g.
intravenously, subcutaneously, intramuscularly, or via any other
route of administration that circumvents the gastrointestinal
tract), intranasally, transdermally, topically, by means of a
suppository, by inhalation, again depending on the specific
pharmaceutical formulation or composition to be used. The clinician
will be able to select a suitable route of administration and a
suitable pharmaceutical formulation or composition to be used in
such administration, depending on the disease or disorder to be
prevented or treated and other factors well known to the
clinician.
[0734] The amino acid sequences, Nanobodies (or ISV's) and/or
polypeptides of the invention and/or the compositions comprising
the same are administered according to a regime of treatment that
is suitable for preventing and/or treating the disease or disorder
to be prevented or treated. The clinician will generally be able to
determine a suitable treatment regimen, depending on factors such
as the disease or disorder to be prevented or treated, the severity
of the disease to be treated and/or the severity of the symptoms
thereof, the specific amino acid sequence, Nanobody (or ISV) or
polypeptide of the invention to be used, the specific route of
administration and pharmaceutical formulation or composition to be
used, the age, gender, weight, diet, general condition of the
patient, and similar factors well known to the clinician.
[0735] Generally, the treatment regimen will comprise the
administration of one or more amino acid sequences, Nanobodies (or
ISV's) and/or polypeptides of the invention, or of one or more
compositions comprising the same, in one or more pharmaceutically
effective amounts or doses. The specific amount(s) or doses to
administered can be determined by the clinician, again based on the
factors cited above.
[0736] Generally, for the prevention and/or treatment of the
diseases and disorders mentioned herein and depending on the
specific disease or disorder to be treated, the potency of the
specific amino acid sequence, Nanobody (or ISV) and polypeptide of
the invention to be used, the specific route of administration and
the specific pharmaceutical formulation or composition used, the
amino acid sequences, Nanobodies (or ISV's) and polypeptides of the
invention will generally be administered in an amount between 1
gram and 0.01 microgram per kg body weight per day, preferably
between 0.1 gram and 0.1 microgram per kg body weight per day, such
as about 1, 10, 100 or 1000 microgram per kg body weight per day,
either continuously (e.g. by infusion), as a single daily dose or
as multiple divided doses during the day. The clinician will
generally be able to determine a suitable daily dose, depending on
the factors mentioned herein. It will also be clear that in
specific cases, the clinician may choose to deviate from these
amounts, for example on the basis of the factors cited above and
his expert judgment. Generally, some guidance on the amounts to be
administered can be obtained from the amounts usually administered
for comparable conventional antibodies or antibody fragments
against the same target administered via essentially the same
route, taking into account however differences in affinity/avidity,
efficacy, biodistribution, half-life and similar factors well known
to the skilled person.
[0737] Usually, in the above method, a single amino acid sequence,
Nanobody (or ISV) or polypeptide of the invention will be used. It
is however within the scope of the invention to use two or more
amino acid sequences, Nanobodies (or ISV's) and/or polypeptides of
the invention in combination.
[0738] The Nanobodies (or ISV's), amino acid sequences and
polypeptides of the invention may also be used in combination with
one or more further pharmaceutically active compounds or
principles, i.e. as a combined treatment regimen, which may or may
not lead to a synergistic effect. Again, the clinician will be able
to select such further compounds or principles, as well as a
suitable combined treatment regimen, based on the factors cited
above and his expert judgment. In particular, the amino acid
sequences, Nanobodies (or ISV's) and polypeptides of the invention
may be used in combination with other pharmaceutically active
compounds or principles that are or can be used for the prevention
and/or treatment of the diseases and disorders cited herein, as a
result of which a synergistic effect may or may not be obtained.
Examples of such compounds and principles, as well as routes,
methods and pharmaceutical formulations or compositions for
administering them will be clear to the clinician.
[0739] When two or more substances or principles are to be used as
part of a combined treatment regimen, they can be administered via
the same route of administration or via different routes of
administration, at essentially the same time or at different times
(e.g. essentially simultaneously, consecutively, or according to an
alternating regime). When the substances or principles are to be
administered simultaneously via the same route of administration,
they may be administered as different pharmaceutical formulations
or compositions or part of a combined pharmaceutical formulation or
composition, as will be clear to the skilled person.
[0740] Also, when two or more active substances or principles are
to be used as part of a combined treatment regimen, each of the
substances or principles may be administered in the same amount and
according to the same regimen as used when the compound or
principle is used on its own, and such combined use may or may not
lead to a synergistic effect. However, when the combined use of the
two or more active substances or principles leads to a synergistic
effect, it may also be possible to reduce the amount of one, more
or all of the substances or principles to be administered, while
still achieving the desired therapeutic action. This may for
example be useful for avoiding, limiting or reducing any unwanted
side-effects that are associated with the use of one or more of the
substances or principles when they are used in their usual amounts,
while still obtaining the desired pharmaceutical or therapeutic
effect.
[0741] The effectiveness of the treatment regimen used according to
the invention may be determined and/or followed in any manner known
per se for the disease or disorder involved, as will be clear to
the clinician. The clinician will also be able, where appropriate
and on a case-by-case basis, to change or modify a particular
treatment regimen, so as to achieve the desired therapeutic effect,
to avoid, limit or reduce unwanted side-effects, and/or to achieve
an appropriate balance between achieving the desired therapeutic
effect on the one hand and avoiding, limiting or reducing undesired
side effects on the other hand. Generally, the treatment regimen
will be followed until the desired therapeutic effect is achieved
and/or for as long as the desired therapeutic effect is to be
maintained. Again, this can be determined by the clinician.
[0742] In another aspect, the invention relates to the use of an
amino acid sequence, Nanobody (or ISV) or polypeptide of the
invention in the preparation of a pharmaceutical composition for
prevention and/or treatment of at least one immune related diseases
and disorders of the invention; and/or for use in one or more of
the methods of treatment mentioned herein.
[0743] The subject to be treated may be any warm-blooded animal,
but is in particular a mammal, and more in particular a human
being. For instance, it has been found that most Nanobodies (or
ISV's) primarily raised against human IL-17A, IL-17F and/or
IL-17A/F (or combinations thereof) of the invention cross-react
with marmoset IL-17A, IL-17F and/or IL-17A/F (or combinations
thereof). As will be clear to the skilled person, the subject to be
treated will in particular be a person suffering from, or at risk
of, the diseases and disorders mentioned herein.
[0744] The invention also relates to the use of an amino acid
sequence, Nanobody (or ISV) or polypeptide of the invention in the
preparation of a pharmaceutical composition for the prevention
and/or treatment of at least one disease or disorder that can be
prevented and/or treated by administering an amino acid sequence,
Nanobody (or ISV) or polypeptide of the invention to a patient.
[0745] More in particular, the invention relates to the use of an
amino acid sequence, Nanobody (or ISV) or polypeptide of the
invention in the preparation of a pharmaceutical composition for
the prevention and/or treatment of immune related diseases and
disorders of the invention, and in particular for the prevention
and treatment of one or more of the diseases and disorders listed
herein. Again, in such a pharmaceutical composition, the one or
more amino acid sequences, Nanobodies (or ISV's) or polypeptides of
the invention may also be suitably combined with one or more other
active principles, such as those mentioned herein. Finally,
although the use of the Nanobodies (or ISV's) of the invention (as
defined herein) and of the polypeptides of the invention is much
preferred, it will be clear that on the basis of the description
herein, the skilled person will also be able to design and/or
generate, in an analogous manner, other amino acid sequences and in
particular (single) domain antibodies against any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof, as well as
polypeptides comprising such (single) domain antibodies. For
example, it will also be clear to the skilled person that it may be
possible to "graft" one or more of the CDR's mentioned above for
the Nanobodies (or ISV's) of the invention onto such (single)
domain antibodies or other protein scaffolds, including but not
limited to human scaffolds or non-immunoglobulin scaffolds.
Suitable scaffolds and techniques for such CDR grafting will be
clear to the skilled person and are well known in the art, see for
example those mentioned in WO 08/020079. For example, techniques
known per se for grafting mouse or rat CDR's onto human frameworks
and scaffolds can be used in an analogous manner to provide
chimeric proteins comprising one or more of the CDR's of the
Nanobodies (or ISV's) of the invention and one or more human
framework regions or sequences. It should also be noted that, when
the Nanobodies (or ISV's) of the inventions contain one or more
other CDR sequences than the preferred CDR sequences mentioned
above, these CDR sequences can be obtained in any manner known per
se, for example using one or more of the techniques described in WO
08/020079. Further uses of the amino acid sequences, Nanobodies (or
ISV's), polypeptides, nucleic acids, genetic constructs and hosts
and host cells of the invention will be clear to the skilled person
based on the disclosure herein. For example, and without
limitation, the amino acid sequences of the invention can be linked
to a suitable carrier or solid support so as to provide a medium
than can be used in a manner known per se to purify any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof from
compositions and preparations comprising the same. Derivatives of
the amino acid sequences of the invention that comprise a suitable
detectable label can also be used as markers to determine
(qualitatively or quantitatively) the presence of any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof in a
composition or preparation or as a marker to selectively detect the
presence of any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof on the surface of a cell or tissue (for
example, in combination with suitable cell sorting techniques).
[0746] Some very preferred aspects of the invention are: [0747] An
amino acid sequence that is directed against and/or that can
specifically bind to any of human IL-17A, human IL-17F and/or human
IL-17A/F including combinations thereof. [0748] A respective amino
acid sequence with a rate of dissociation (k.sub.off rate) between
between 10.sup.-4 s.sup.-1 and 10.sup.-6 s.sup.-1. [0749] A
respective amino acid sequence with an affinity to human IL-17A,
human IL-17F and/or human IL-17A/F including combinations thereof
less than 1 nM. [0750] A respective amino acid sequence that
comprises an immunoglobulin fold. [0751] A respective amino acid
sequence that is an immunoglobulin sequence. [0752] A respective
amino acid sequence that essentially consists of a light chain
variable domain sequence (e.g. a VL-sequence); or of a heavy chain
variable domain sequence (e.g. a VH-sequence). [0753] A respective
amino acid sequence that essentially consists of a Nanobody. [0754]
A respective amino acid sequence that essentially consists of a
polypeptide that has at least 80% amino acid identity with at least
one of the amino acid sequences of SEQ ID NOs: 623 to 693, in which
for the purposes of determining the degree of amino acid identity,
the amino acid residues that form the CDR sequences are
disregarded; and in which preferably one or more of the amino acid
residues at positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and 108
according to the Kabat numbering are chosen from the Hallmark
residues mentioned in Table B-2. [0755] A respective amino acid
sequence that can specifically bind to human IL-17A. [0756] A
respective amino acid sequence according to any of the preceding
claims that can specifically bind to human IL-17A and human
IL-17A/F. [0757] A respective amino acid sequence that can
specifically bind to human IL-17F. [0758] A respective amino acid
sequence that can specifically bind to human IL-17A, IL-17F and
IL-17A/F. [0759] An amino acid sequence that is directed against
and/or that can specifically bind to human IL-17 A and IL-17A/F
(class 2), characterized in that the amino acid sequence binds to a
L74A or a Y85A or a H54A IL-17A mutant with significantly reduced
affinity as compared to binding to the wildtype IL-17A sequence.
[0760] An amino acid sequence that is directed against and/or that
can specifically bind to human IL-17A, IL-17F and IL-17A/F (class
4), characterized in that the amino acid sequence binds to a L74A
or a Y85A or a N88A IL-17A mutant with significantly reduced
affinity as compared to binding to the wildtype IL-17A sequence.
[0761] An amino acid sequence that is directed against and/or that
can specifically bind to human IL17F, characterized in that the
amino acid sequence binds to a R47A or R73A or I86A or N89A IL-17F
mutant with significantly reduced affinity as compared to binding
to the wildtype IL-17F sequence. [0762] A first amino acid sequence
competing for binding to human IL-17A and/or IL-17 A/F with a
second amino acid sequence, wherein that second amino acid sequence
specifically binds to human IL-17 A and IL-17A/F (class 2), and
wherein that second amino acid sequence binds to a L74A or a Y85A
or a H54A IL-17A mutant with significantly reduced affinity as
compared to binding to the wildtype IL-17A sequence, the first
amino acid sequence not being IL-17A, IL-17 A/F and/or IL-17F.
[0763] A first amino acid sequence competing for binding to human
IL-17A, IL-17 A/F and/or IL-17F with a second amino acid sequence,
wherein that second amino acid sequence specifically binds to human
IL-17A, IL-17F and IL-17A/F (class 4), and wherein that second
amino acid sequence binds to a L74A or a Y85A or a N88A IL-17A
mutant with significantly reduced affinity as compared to binding
to the wildtype IL-17A sequence, the first amino acid sequence not
being IL-17A, IL-17 A/F and/or IL-17F. [0764] A first amino acid
sequence competing for binding to human IL-17F with a second amino
acid sequence, wherein that second amino acid sequence specifically
bind to human IL17F, and wherein that second amino acid sequence
binds to a R47A or R73A or I86A or N89A IL-17F mutant with
significantly reduced affinity as compared to binding to the
wildtype IL-17F sequence, the first amino acid sequence not being
IL-17A, IL-17 A/F and/or IL-17F. [0765] A polypeptide comprising at
least one amino acid sequence of the invention. [0766] Use of an
amino acid sequence and/or a polypeptide of the invention for the
treatment of a disease. [0767] Use of an amino acid sequence and/or
a of the invention for the treatment of systemic lupus
erythematosis, rheumatoid arthritis, osteoarthritis, juvenile
chronic arthritis, spondyloarthropathies, systemic sclerosis,
idiopathic inflammatory myopathies, Sjogren's syndrome, systemic
vasculitis, sarcoidosis, autoimmune hemolytic anemia, autoimmune
thrombocytopenia, thyroiditis, diabetes mellitus, immune-mediated
renal disease, demyelinating diseases of the central and peripheral
nervous systems such as multiple sclerosis, idiopathic
demyelinating polyneuropathy or Guillain-Barre syndrome, and
chronic inflammatory demyelinating polyneuropathy, hepatobiliary
diseases such as infectious, autoimmune chronic active hepatitis,
primary biliary cirrhosis, granulomatous hepatitis, and sclerosing
cholangitis, inflammatory bowel disease, gluten-sensitive
enteropathy, and Whipple's disease, autoimmune or immune-mediated
skin diseases including bullous skin diseases, erythema multiforme
and contact dermatitis, psoriasis, allergic diseases such as
asthma, allergic rhinitis, atopic dermatitis, food hypersensitivity
and urticaria, immunologic diseases of the lung such as
eosinophilic pneumonia, idiopathic pulmonary fibrosis and
hypersensitivity pneumonitis, transplantation associated diseases
including graft rejection and graft-versus-host-disease; or [0768]
a pharmaceutical composition comprising a polypeptide and/or a
amino acid sequence of the invention and a pharmaceutically
acceptable excipient for the treatment of systemic lupus
erythematosis, rheumatoid arthritis, osteoarthritis, juvenile
chronic arthritis, spondyloarthropathies, systemic sclerosis,
idiopathic inflammatory myopathies, Sjogren's syndrome, systemic
vasculitis, sarcoidosis, autoimmune hemolytic anemia, autoimmune
thrombocytopenia, thyroiditis, diabetes mellitus, immune-mediated
renal disease, demyelinating diseases of the central and peripheral
nervous systems such as multiple sclerosis, idiopathic
demyelinating polyneuropathy or Guillain-Barre syndrome, and
chronic inflammatory demyelinating polyneuropathy, hepatobiliary
diseases such as infectious, autoimmune chronic active hepatitis,
primary biliary cirrhosis, granulomatous hepatitis, and sclerosing
cholangitis, inflammatory bowel disease, gluten-sensitive
enteropathy, and Whipple's disease, autoimmune or immune-mediated
skin diseases including bullous skin diseases, erythema multiforme
and contact dermatitis, psoriasis, allergic diseases such as
asthma, allergic rhinitis, atopic dermatitis, food hypersensitivity
and urticaria, immunologic diseases of the lung such as
eosinophilic pneumonia, idiopathic pulmonary fibrosis and
hypersensitivity pneumonitis, transplantation associated diseases
including graft rejection and graft-versus-host-disease; or [0769]
a method of treating a patient in need thereof by administering an
effective amount of a polypeptide and/or amino acid sequence
according to claims 1 to 13, wherein the method is suitable for the
treatment of systemic lupus erythematosis, rheumatoid arthritis,
osteoarthritis, juvenile chronic arthritis, spondyloarthropathies,
systemic sclerosis, idiopathic inflammatory myopathies, Sjogren's
syndrome, systemic vasculitis, sarcoidosis, autoimmune hemolytic
anemia, autoimmune thrombocytopenia, thyroiditis, diabetes
mellitus, immune-mediated renal disease, demyelinating diseases of
the central and peripheral nervous systems such as multiple
sclerosis, idiopathic demyelinating polyneuropathy or
Guillain-Barre syndrome, and chronic inflammatory demyelinating
polyneuropathy, hepatobiliary diseases such as infectious,
autoimmune chronic active hepatitis, primary biliary cirrhosis,
granulomatous hepatitis, and sclerosing cholangitis, inflammatory
bowel disease, gluten-sensitive enteropathy, and Whipple's disease,
autoimmune or immune-mediated skin diseases including bullous skin
diseases, erythema multiforme and contact dermatitis, psoriasis,
allergic diseases such as asthma, allergic rhinitis, atopic
dermatitis, food hypersensitivity and urticaria, immunologic
diseases of the lung such as eosinophilic pneumonia, idiopathic
pulmonary fibrosis and hypersensitivity pneumonitis,
transplantation associated diseases including graft rejection and
graft-versus-host-disease. [0770] A pharmaceutical composition
comprising an amino acid sequence and/or a polypeptide of the
invention and a pharmaceutically acceptable excipient
[0771] Some preferred but non-limiting aspects of the invention are
listed below. Other aspects and embodiments of the invention will
be clear to the skilled person based on the disclosure herein.
[0772] Aspect A-1: An amino acid sequence that is directed against
and/or that can specifically bind to any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof, preferably said amino acid
sequence functions as binding unit. [0773] Aspect A-2: An amino
acid sequence according to aspect A-1, that is in essentially
isolated form. [0774] Aspect A-3: An amino acid sequence according
to aspect A-1 or A-2, for administration to a subject, wherein said
amino acid sequence does not naturally occur in said subject.
[0775] Aspect A-4: An amino acid sequence that can specifically
bind to any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof with a dissociation constant (K.sub.D) of
10.sup.-5 to 10.sup.-12 moles/litre or less, and preferably
10.sup.-7 to 10.sup.-12 moles/litre or less and more preferably
10.sup.-8 to 10.sup.-12 moles/litre. Such an amino acid sequence
may in particular be an amino acid sequence according to any of the
preceding aspects. [0776] Aspect A-5: An amino acid sequence that
can specifically bind to any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof with a rate of association
(k.sub.on-rate) of between 10.sup.2 M.sup.-1s.sup.-1 to about
10.sup.7 M.sup.-1s.sup.-1, preferably between 10.sup.3
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1, more preferably
between 10.sup.4 M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1,
such as between 10.sup.5 M.sup.-1s.sup.-1 and 10.sup.7
M.sup.-1s.sup.-1. Such an amino acid sequence may in particular be
an amino acid sequence according to any of the preceding aspects.
[0777] Aspect A-6: An amino acid sequence that can specifically
bind to any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof with a rate of dissociation (k.sub.off rate)
between 1 s.sup.-1 and 10.sup.-6 s.sup.-1, preferably between
10.sup.-2 s.sup.-1 and 10.sup.-6 s.sup.-1, more preferably between
10.sup.-3 s.sup.-1 and 10.sup.-6 s.sup.-1, such as between
10.sup.-4 s.sup.-1 and 10.sup.-6 s.sup.-1. Such an amino acid
sequence may in particular be an amino acid sequence according to
any of the preceding aspects. [0778] Aspect A-7: An amino acid
sequence that can specifically bind to any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof with an affinity less than
500 nM, preferably less than 200 nM, more preferably less than 10
nM, such as less than 500 pM. Such an amino acid sequence may in
particular be an amino acid sequence according to any of the
preceding aspects. [0779] Aspect A-8: An amino acid sequence
according to any of the preceding aspects, that essentially
consists of a polypeptide that [0780] i) has at least 80% amino
acid identity with at least one of the amino acid sequences of SEQ
ID NOs: 623 to 693, in which for the purposes of determining the
degree of amino acid identity, the amino acid residues that form
the CDR sequences are disregarded; and in which: [0781] ii)
preferably one or more of the amino acid residues at positions 11,
37, 44, 45, 47, 83, 84, 103, 104 and 108 according to the Kabat
numbering are chosen from the Hallmark residues mentioned in Table
B-2. [0782] Aspect A-9: An amino acid sequence according to any of
the preceding aspects, that essentially consists of a Nanobody that
[0783] i) has at least 80% amino acid identity with at least one of
the amino acid sequences of SEQ ID NOs: 623 to 693, in which for
the purposes of determining the degree of amino acid identity, the
amino acid residues that form the CDR sequences are disregarded;
and in which: [0784] ii) preferably one or more of the amino acid
residues at positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and 108
according to the Kabat numbering are chosen from the Hallmark
residues mentioned in Table B-2. [0785] Aspect A-10: An amino acid
sequence according to any of the preceding aspects, that in
addition to the at least one binding site for binding against any
of IL-17A, IL-17F and/or IL-17A/F including combinations thereof,
contains one or more further binding sites for binding against
other antigens, proteins or targets. [0786] Aspect A-11: An amino
acid sequence that is directed against and/or that can specifically
bind to any of 1L-17A. [0787] Aspect A-12: An amino acid sequence
that can specifically bind to any of IL-17A with a dissociation
constant (K.sub.D) of 10.sup.-5 to 10.sup.-12 moles/litre or less,
and preferably 10.sup.-7 to 10.sup.-12 moles/litre or less and more
preferably 10.sup.-8 to 10.sup.-12 moles/litre. Such an amino acid
sequence may in particular be an amino acid sequence according to
any of the preceding aspects. [0788] Aspect A-13: An amino acid
sequence that can specifically bind to any of IL-17A with a rate of
association (k.sub.on-rate) of between 10.sup.2 M.sup.-1s.sup.-1 to
about 10.sup.7 M.sup.-1s.sup.-1, preferably between 10.sup.3
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1, more preferably
between 10.sup.4 M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1,
such as between 10.sup.5 M.sup.-1s.sup.-1 and 10.sup.7
M.sup.-1s.sup.-1. Such an amino acid sequence may in particular be
an amino acid sequence according to any of the preceding aspects.
[0789] Aspect A-14: An amino acid sequence that can specifically
bind to any of IL-17A with a rate of dissociation (k.sub.off rate)
between 1 s.sup.-1 and 10.sup.-6 s.sup.-1, preferably between
10.sup.-2 s.sup.-1 and 10.sup.-6 s.sup.-1, more preferably between
10.sup.-3 s.sup.-1 and 10.sup.-6 s.sup.-1, such as between
10.sup.-4 s.sup.-1 and 10.sup.-6 s.sup.-1. Such an amino acid
sequence may in particular be an amino acid sequence according to
any of the preceding aspects. [0790] Aspect A-15: An amino acid
sequence that can specifically bind to any of IL-17A with an
affinity less than 500 nM, preferably less than 200 nM, more
preferably less than 10 nM, such as less than 500 pM. Such an amino
acid sequence may in particular be an amino acid sequence according
to any of the preceding aspects. [0791] Aspect A-16: An amino acid
sequence according to any of the preceding aspects, that
essentially consists of a polypeptide that [0792] (i) has at least
80% amino acid identity with at least one of the amino acid
sequences of SEQ ID NOs: 623 to 627, in which for the purposes of
determining the degree of amino acid identity, the amino acid
residues that form the CDR sequences are disregarded; and in which:
[0793] (ii) preferably one or more of the amino acid residues at
positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and 108 according to
the Kabat numbering are chosen from the Hallmark residues mentioned
in Table B-2. [0794] Aspect A-17: An amino acid sequence according
to any of the preceding aspects, that essentially consists of a
Nanobody that [0795] (i) has at least 80% amino acid identity with
at least one of the amino acid sequences of SEQ ID NOs: 623 to 627,
in which for the purposes of determining the degree of amino acid
identity, the amino acid residues that form the CDR sequences are
disregarded; and in which: [0796] (ii) preferably one or more of
the amino acid residues at positions 11, 37, 44, 45, 47, 83, 84,
103, 104 and 108 according to the Kabat numbering are chosen from
the Hallmark residues mentioned in Table B-2. [0797] Aspect A-18:
An amino acid sequence that is directed against and/or that can
specifically bind to any of IL-17A and IL-17A/F. [0798] Aspect
A-19: An amino acid sequence that can specifically bind to IL-17A
and IL-17A/F with a dissociation constant (K.sub.D) of 10.sup.-5 to
10.sup.-12 moles/litre or less, and preferably 10.sup.-7 to
10.sup.-12 moles/litre or less and more preferably 10.sup.-8 to
10.sup.-12 moles/litre. Such an amino acid sequence may in
particular be an amino acid sequence according to any of the
preceding aspects. [0799] Aspect A-20: An amino acid sequence that
can specifically bind to IL-17A and IL-17A/F with a rate of
association (k.sub.on-rate) of between 10.sup.2 M.sup.-1s.sup.-1 to
about 10.sup.7 M.sup.-1s.sup.-1, preferably between 10.sup.3
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1, more preferably
between 10.sup.4 M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1,
such as between 10.sup.5 M.sup.-1s.sup.-1 and 10.sup.7
M.sup.-1s.sup.-1. Such an amino acid sequence may in particular be
an amino acid sequence according to any of the preceding aspects.
[0800] Aspect A-21: An amino acid sequence that can specifically
bind to IL-17A and IL-17A/F with a rate of dissociation (k.sub.off
rate) between 1 s.sup.-1 and 10.sup.-6 s.sup.-1, preferably between
10.sup.-2 s.sup.-1 and 10.sup.-6 s.sup.-1, more preferably between
10.sup.-3 s.sup.-1 and 10.sup.-6 s.sup.-1, such as between
10.sup.-4 s.sup.-1 and 10.sup.-6 s.sup.-1. Such an amino acid
sequence may in particular be an amino acid sequence according to
any of the preceding aspects. [0801] Aspect A-22: An amino acid
sequence that can specifically bind to IL-17A and IL-17A/F with an
affinity less than 500 nM, preferably less than 200 nM, more
preferably less than 10 nM, such as less than 500 pM. Such an amino
acid sequence may in particular be an amino acid sequence according
to any of the preceding aspects. [0802] Aspect A-23: An amino acid
sequence according to any of the preceding aspects, that
essentially consists of a polypeptide that [0803] (i) has at least
80% amino acid identity with at least one of the amino acid
sequences of SEQ ID NOs: 628 to 639, in which for the purposes of
determining the degree of amino acid identity, the amino acid
residues that form the CDR sequences are disregarded; and in which:
[0804] (ii) preferably one or more of the amino acid residues at
positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and 108 according to
the Kabat numbering are chosen from the Hallmark residues mentioned
in Table B-2. [0805] Aspect A-24: An amino acid sequence according
to any of the preceding aspects, that essentially consists of a
Nanobody that [0806] (i) has at least 80% amino acid identity with
at least one of the amino acid sequences of SEQ ID NOs: 628 to 339,
in which for the purposes of determining the degree of amino acid
identity, the amino acid residues that form the CDR sequences are
disregarded; and in which: [0807] (ii) preferably one or more of
the amino acid residues at positions 11, 37, 44, 45, 47, 83, 84,
103, 104 and 108 according to the Kabat numbering are chosen from
the Hallmark residues mentioned in Table B-2. [0808] Aspect A-25:
An amino acid sequence according to any of the preceding aspects,
that in addition to the at least one binding site for binding
against IL-17A and IL-17A/F, contains one or more further binding
sites for binding against other antigens, proteins or targets.
[0809] Aspect A-26: An amino acid sequence that is directed against
and/or that can specifically bind to IL-17F. [0810] Aspect A-27: An
amino acid sequence that can specifically bind to IL-17F with a
dissociation constant (K.sub.D) of 10.sup.-5 to 10.sup.-12
moles/litre or less, and preferably 10.sup.-7 to 10.sup.-12
moles/litre or less and more preferably 10.sup.-8 to 10.sup.-12
moles/litre. Such an amino acid sequence may in particular be an
amino acid sequence according to any of the preceding aspects.
[0811] Aspect A-28: An amino acid sequence that can specifically
bind to IL-17F with a rate of association (k.sub.on-rate) of
between 10.sup.2 M.sup.-1s.sup.-1 to about 10.sup.7
M.sup.-1s.sup.-1, preferably between 10.sup.3 M.sup.-1s.sup.-1 and
10.sup.7 M.sup.-1s.sup.-1, more preferably between 10.sup.4
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1, such as between
10.sup.5 M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1. Such an
amino acid sequence may in particular be an amino acid sequence
according to any of the preceding aspects. [0812] Aspect A-29: An
amino acid sequence that can specifically bind to IL-17F with a
rate of dissociation (k.sub.off rate) between 1 s.sup.-1 and
10.sup.-6 s.sup.-1, preferably between 10.sup.-2 s.sup.-1 and
10.sup.-6 s.sup.-1, more preferably between 10.sup.-3 s.sup.-1 and
10.sup.-6 s.sup.-1, such as between 10.sup.-4 s.sup.-1 and
10.sup.-6 s.sup.-1. Such an amino acid sequence may in particular
be an amino acid sequence according to any of the preceding
aspects. [0813] Aspect A-30: An amino acid sequence that can
specifically bind to IL-17F with an affinity less than 500 nM,
preferably less than 200 nM, more preferably less than 10 nM, such
as less than 500 pM. Such an amino acid sequence may in particular
be an amino acid sequence according to any of the preceding
aspects. [0814] Aspect A-31: An amino acid sequence according to
any of the preceding aspects, that essentially consists of a
polypeptide that [0815] (i) has at least 80% amino acid identity
with at least one of the amino acid sequences of SEQ ID NOs: 640 to
649, in which for the purposes of determining the degree of amino
acid identity, the amino acid residues that form the CDR sequences
are disregarded; and in which: [0816] (ii) preferably one or more
of the amino acid residues at positions 11, 37, 44, 45, 47, 83, 84,
103, 104 and 108 according to the Kabat numbering are chosen from
the Hallmark residues mentioned in Table B-2. [0817] Aspect A-32:
An amino acid sequence according to any of the preceding aspects,
that essentially consists of a Nanobody that [0818] (i) has at
least 80% amino acid identity with at least one of the amino acid
sequences of SEQ ID NOs: 640 to 649, in which for the purposes of
determining the degree of amino acid identity, the amino acid
residues that form the CDR sequences are disregarded; and in which:
[0819] (ii) preferably one or more of the amino acid residues at
positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and 108 according to
the Kabat numbering are chosen from the Hallmark residues mentioned
in Table B-2. [0820] Aspect A-33: An amino acid sequence according
to any of the preceding aspects, that in addition to the at least
one binding site for binding against IL-17F, contains one or more
further binding sites for binding against other antigens, proteins
or targets. [0821] Aspect A-34: An amino acid sequence that is
directed against and/or that can specifically bind to IL-17A,
IL-17F and IL-17A/F. [0822] Aspect A-35: An amino acid sequence
that can specifically bind to IL-17A, IL-17F and IL-17A/F with a
dissociation constant (K.sub.D) of 10.sup.-5 to 10.sup.-12
moles/litre or less, and preferably 10.sup.-7 to 10.sup.-12
moles/litre or less and more preferably 10.sup.-8 to 10.sup.-12
moles/litre. Such an amino acid sequence may in particular be an
amino acid sequence according to any of the preceding aspects.
[0823] Aspect A-36: An amino acid sequence that can specifically
bind to IL-17A, IL-17F and IL-17A/F with a rate of association
(k.sub.on-rate) of between 10.sup.2 M.sup.-1s.sup.-1 to about
10.sup.7 M.sup.-1s.sup.-1, preferably between 10
.sup.3 M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1, more
preferably between 10.sup.4 M.sup.-1s.sup.-1 and 10.sup.7
M.sup.-1s.sup.-1, such as between 10.sup.5 M.sup.-1s.sup.-1 and
10.sup.7 M.sup.-1s.sup.-1. Such an amino acid sequence may in
particular be an amino acid sequence according to any of the
preceding aspects. [0824] Aspect A-37: An amino acid sequence that
can specifically bind to IL-17A, IL-17F and IL-17A/F with a rate of
dissociation (k.sub.off rate) between 1 s.sup.-1 and 10.sup.-6
s.sup.-1, preferably between 10.sup.-2 s.sup.-1 and 10.sup.-6
s.sup.-1, more preferably between 10.sup.-3 s.sup.-1 and 10.sup.-6
s.sup.-1, such as between 10.sup.-4 s.sup.-1 and 10.sup.-6
s.sup.-1. Such an amino acid sequence may in particular be an amino
acid sequence according to any of the preceding aspects. [0825]
Aspect A-38: An amino acid sequence that can specifically bind to
IL-17A, IL-17F and IL-17A/F with an affinity less than 500 nM,
preferably less than 200 nM, more preferably less than 10 nM, such
as less than 500 pM. Such an amino acid sequence may in particular
be an amino acid sequence according to any of the preceding
aspects. [0826] Aspect A-39: An amino acid sequence according to
any of the preceding aspects, that is a naturally occurring amino
acid sequence (from any suitable species, in particular mammal such
as human or marmoset) or a synthetic or semi-synthetic amino acid
sequence. [0827] Aspect A-40: An amino acid sequence according to
any of the preceding aspects, that comprises an immunoglobulin fold
or that under suitable conditions is capable of forming an
immunoglobulin fold. [0828] Aspect A-41: An amino acid sequence
according to any of the preceding aspects, that essentially
consists of 4 framework regions (FR1 to FR4 respectively) and 3
complementarity determining regions (CDR1 to CDR3 respectively).
[0829] Aspect A-42: An amino acid sequence according to any of the
preceding aspects, that is an immunoglobulin sequence. [0830]
Aspect A-43: An amino acid sequence according to any of the
preceding aspects, that is a naturally occurring immunoglobulin
sequence (from any suitable species) or a synthetic or
semi-synthetic immunoglobulin sequence. [0831] Aspect A-44: An
amino acid sequence according to any of the preceding aspects that
is a humanized immunoglobulin sequence, a camelized immunoglobulin
sequence or an immunoglobulin sequence that has been obtained by
techniques such as affinity maturation. [0832] Aspect A-45: An
amino acid sequence according to any of the preceding aspects, that
essentially consists of a light chain variable domain sequence
(e.g. a VL-sequence); or of a heavy chain variable domain sequence
(e.g. a VH-sequence). [0833] Aspect A-46: An amino acid sequence
according to any of the preceding aspects, that essentially
consists of a heavy chain variable domain sequence that is derived
from a conventional four-chain antibody or that essentially consist
of a heavy chain variable domain sequence that is derived from
heavy chain antibody. [0834] Aspect A-47: An amino acid sequence
according to any of the preceding aspects, that essentially
consists of a domain antibody (or an An amino acid sequence that is
suitable for use as a domain antibody), of a single domain antibody
(or an An amino acid sequence that is suitable for use as a single
domain antibody), of a "dAb" (or an An amino acid sequence that is
suitable for use as a dAb) or of a Nanobody (including but not
limited to a VHH sequence). [0835] Aspect A-48: An amino acid
sequence according to any of the preceding aspects, that
essentially consists of a Nanobody. [0836] Aspect A-49: An amino
acid sequence according to any of the preceding aspects, that
essentially consists of a Nanobody that [0837] i) has at least 80%
amino acid identity with at least one of the An amino acid
sequences of SEQ ID NOs: 1 to 22, in which for the purposes of
determining the degree of amino acid identity, the amino acid
residues that form the CDR sequences are disregarded; and in which:
[0838] ii) preferably one or more of the amino acid residues at
positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and 108 according to
the Kabat numbering are chosen from the Hallmark residues mentioned
in Table B-2. [0839] Aspect A-50: An amino acid sequence according
to any of the preceding aspects, that essentially consists of a
polypeptide that [0840] (i) has at least 80% amino acid identity
with at least one of the amino acid sequences of SEQ ID NOs: 650 to
693, in which for the purposes of determining the degree of amino
acid identity, the amino acid residues that form the CDR sequences
are disregarded; and in which: [0841] (ii) preferably one or more
of the amino acid residues at positions 11, 37, 44, 45, 47, 83, 84,
103, 104 and 108 according to the Kabat numbering are chosen from
the Hallmark residues mentioned in Table B-2. [0842] Aspect A-51:
An amino acid sequence according to any of the preceding aspects,
that essentially consists of a Nanobody that [0843] (i) has at
least 80% amino acid identity with at least one of the amino acid
sequences of SEQ ID NOs: 650 to 693, in which for the purposes of
determining the degree of amino acid identity, the amino acid
residues that form the CDR sequences are disregarded; and in which:
[0844] (ii) preferably one or more of the amino acid residues at
positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and 108 according to
the Kabat numbering are chosen from the Hallmark residues mentioned
in Table B-2. [0845] Aspect A-52: An amino acid sequence according
to any of the preceding aspects, that essentially consists of a
humanized Nanobody. [0846] Aspect A-53: An amino acid sequence
according to any of the preceding aspects, that in addition to the
at least one binding site for binding against IL-17A, IL-17F and
IL-17A/F contains one or more further binding sites for binding
against other antigens, proteins or targets. [0847] Aspect A-54: An
amino acid sequence according to each and any of the preceding
aspects A-1 to A-53, in which said amino acid sequence is an ISV
(as defined herein) and functions as a binding unit.
CDR-Based Aspects
[0847] [0848] Aspect B-1: An amino acid sequence that is directed
against and/or that can specifically bind (e.g. a binding unit) any
of IL-17A, IL-17F and/or IL-17A/F including combinations thereof,
and that comprises one or more stretches of amino acid residues
chosen from the group consisting of: [0849] a) the amino acid
sequences of SEQ ID NOs: 197 to 267; [0850] b) amino acid sequences
that have at least 80% amino acid identity with at least one of the
amino acid sequences of SEQ ID NOs: 197 to 267; [0851] c) amino
acid sequences that have 3, 2, or 1 amino acid difference with at
least one of the amino acid sequences of SEQ ID NOs: 197 to 267;
[0852] d) the amino acid sequences of SEQ ID NOs: 339 to 409;
[0853] e) amino acid sequences that have at least 80% amino acid
identity with at least one of the amino acid sequences of SEQ ID
NOs: 339 to 409; [0854] f) amino acid sequences that have 3, 2, or
1 amino acid difference with at least one of the amino acid
sequences of SEQ ID NOs: 339 to 409; [0855] g) the amino acid
sequences of SEQ ID NOs: 481 to 551; [0856] h) amino acid sequences
that have at least 80% amino acid identity with at least one of the
amino acid sequences of SEQ ID NOs: 481 to 551; [0857] i) amino
acid sequences that have 3, 2, or 1 amino acid difference with at
least one of the amino acid sequences of SEQ ID NOs: 481 to 551; or
any suitable combination thereof.
[0858] Such an amino acid sequence may in particular be an amino
acid sequence according to any of the aspects A-1 to A-54. [0859]
Aspect B-2: An amino acid sequence according to aspect B-1, in
which at least one of said stretches of amino acid residues forms
part of the antigen binding site for binding against any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof. [0860]
Aspect B-3: An amino acid sequence sequence that is directed
against and/or that can specifically bind any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof and that comprises
two or more stretches of amino acid residues chosen from the group
consisting of: [0861] a) the amino acid sequences of SEQ ID NOs:
197 to 267; [0862] b) amino acid sequences that have at least 80%
amino acid identity with at least one of the amino acid sequences
of SEQ ID NOs: 197 to 267; [0863] c) amino acid sequences that have
3, 2, or 1 amino acid difference with at least one of the amino
acid sequences of SEQ ID NOs: 197 to 267; [0864] d) the amino acid
sequences of SEQ ID NOs: 339 to 409; [0865] e) amino acid sequences
that have at least 80% amino acid identity with at least one of the
amino acid sequences of SEQ ID NOs: 339 to 409; [0866] f) amino
acid sequences that have 3, 2, or 1 amino acid difference with at
least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
[0867] g) the amino acid sequences of SEQ ID NOs: 481 to 551;
[0868] h) amino acid sequences that have at least 80% amino acid
identity with at least one of the amino acid sequences of SEQ ID
NOs: 481 to 551; [0869] i) amino acid sequences that have 3, 2, or
1 amino acid difference with at least one of the amino acid
sequences of SEQ ID NOs: 481 to 551; that (i) when the first
stretch of amino acid residues corresponds to one of the amino acid
sequences according to a), b) or c), the second stretch of amino
acid residues corresponds to one of the amino acid sequences
according to d), e), f), g), h) or i); (ii) when the first stretch
of amino acid residues corresponds to one of the amino acid
sequences according to d), e) or f), the second stretch of amino
acid residues corresponds to one of the amino acid sequences
according to a), b), c), g), h) or i); or (iii) when the first
stretch of amino acid residues corresponds to one of the amino acid
sequences according to g), h) or i), the second stretch of amino
acid residues corresponds to one of the amino acid sequences
according to a), b), c), d), e) or f).
[0870] Such an amino acid sequence may in particular be an amino
acid sequence according to any of the aspects A-1 to A-54, B-1 or
B-2. [0871] Aspect B-4: An amino acid sequence according to aspect
B-3, in which the at least two stretches of amino acid residues
forms part of the antigen binding site for binding against any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof.
[0872] Aspect B-5: An amino acid sequence sequence that is directed
against and/or that can specifically bind any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof and that comprises
three or more stretches of amino acid residues, in which the first
stretch of amino acid residues is chosen from the group consisting
of: [0873] a) the amino acid sequences of SEQ ID NOs: 197 to 267;
[0874] b) amino acid sequences that have at least 80% amino acid
identity with at least one of the amino acid sequences of SEQ 1D
NOs: 197 to 267; [0875] c) amino acid sequences that have 3, 2, or
1 amino acid difference with at least one of the amino acid
sequences of SEQ ID NOs: 197 to 267; the second stretch of amino
acid residues is chosen from the group consisting of: [0876] d) the
amino acid sequences of SEQ ID NOs: 339 to 409; [0877] e) amino
acid sequences that have at least 80% amino acid identity with at
least one of the amino acid sequences of SEQ ID NOs: 339 to 409;
[0878] f) amino acid sequences that have 3, 2, or 1 amino acid
difference with at least one of the amino acid sequences of SEQ ID
NOs: 339 to 409; and the third stretch of amino acid residues is
chosen from the group consisting of: [0879] g) the amino acid
sequences of SEQ ID NOs: 481 to 551; [0880] h) amino acid sequences
that have at least 80% amino acid identity with at least one of the
amino acid sequences of SEQ ID NOs: 481 to 551; [0881] i) amino
acid sequences that have 3, 2, or 1 amino acid difference with at
least one of the amino acid sequences of SEQ ID NOs: 481 to
551.
[0882] Such an amino acid sequence may in particular be an amino
acid sequence according to any of the aspects A-1 to A-54 and/or
B-1 to B-4. [0883] Aspect B-6: An amino acid sequence according to
aspect B-5, in which the at least three stretches of amino acid
residues forms part of the antigen binding site for binding against
any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof. [0884] Aspect B-7: An amino acid sequence that is directed
against and/or that can specifically bind any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof in which the CDR
sequences of said amino acid sequence have at least 70% amino acid
identity, preferably at least 80% amino acid identity, more
preferably at least 90% amino acid identity, such as 95% amino acid
identity or more or even essentially 100% amino acid identity with
the CDR sequences of at least one of the amino acid sequences of
SEQ ID NOs: 623 to 693. Such an amino acid sequence may in
particular be an amino acid sequence according to any of the
aspects A-1 to A-54 and/or B-1 to B-6. [0885] Aspect B-8: An amino
acid sequence according to each and any of the preceding aspects
B-1 to B-7, in which said amino acid sequence is an ISV (as defined
herein). [0886] Aspect C-1: An amino acid sequence that is directed
against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof and that cross-blocks the binding (e.g. a
binding unit) of at least one of the amino acid sequences of SEQ ID
NOs: 623 to 693 to any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof. Such an amino acid sequence may in particular
be an amino acid sequence according to any of the aspects A-1 to
A-54 and/or according to aspects B-1 to B-8. Also, preferably, such
an amino acid sequence is able to specifically bind to any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof.
[0887] Aspect C-2: An amino acid sequence that is directed against
any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof and that is cross-blocked from binding to any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof by at least
one of the amino acid sequences of SEQ ID NOs: 623 to 693. Such an
amino acid sequence may in particular be an amino acid sequence
according to any of the aspects A-1 to A-54 and/or according to
aspects B-1 to B-8. Also, preferably, such an amino acid sequence
is able to specifically bind to any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof. [0888] Aspect C-3: An
amino acid sequence according to any of aspects C-1 or C-2, wherein
the ability of said amino acid sequence to cross-block or to be
cross-blocked is detected in a Biacore assay.
[0889] Aspect C-4: An amino acid sequence according to any of
aspects C-1 to C-3 wherein the ability of said amino acid sequence
to cross-block or to be cross-blocked is detected in an ELISA
assay. [0890] Aspect C-5: An amino acid sequence according to each
and any of the preceding aspects C-1 to C-4, in which said amino
acid sequence is an ISV (as defined herein), and preferably
functions as a binding unit. [0891] Aspect D-1: An amino acid
sequence according to any of aspects B-1 to B-8 or C-1 to C-5, that
is in essentially isolated form. [0892] Aspect D-2: An amino acid
sequence according to any of aspects B-1 to B-8, C-1 to C-5, and/or
D1 for administration to a subject, wherein said amino acid
sequence does not naturally occur in said subject. [0893] Aspect
D-3: An amino acid sequence according to any of aspects B-1 to B-8,
C-1 to C-5, and/or D1 to D-2 that can specifically bind to any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof with
a dissociation constant (K.sub.D) of 10.sup.-5 to 10.sup.-12
moles/litre or less, and preferably 10.sup.-7 to 10.sup.-12
moles/litre or less and more preferably 10.sup.-8 to 10.sup.-12
moles/litre. [0894] Aspect D-4: An amino acid sequence according to
any of aspects B-1 to B-8, C-1 to C-5, and/or D-1 to D-3 that can
specifically bind to any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof with a rate of association
(k.sub.on-rate) of between 10.sup.2 M.sup.-1s.sup.-1 to about
10.sup.7 M.sup.-1s.sup.-1, preferably between 10.sup.3
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1, more preferably
between 10.sup.4 M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1,
such as between 10.sup.5 M.sup.-1s.sup.-1 and 10.sup.7
M.sup.-1s.sup.-1. [0895] Aspect D-5: An amino acid sequence
according to any of aspects B-1 to B-8, C-1 to C-5, and/or D-1 to
D-4 that can specifically bind to any of IL-17A, IL-17F and/or
IL-17A/F including combinations thereof with a rate of dissociation
(k.sub.off rate) between 1 s.sup.-1 and 10.sup.-6 s.sup.-1
preferably between 10.sup.-2 s.sup.-1 and 10.sup.-6 s.sup.-1, more
preferably between 10.sup.-3 s.sup.-1 and 10.sup.-6 s.sup.-1, such
as between 10.sup.-4 s.sup.-1 and 10.sup.-6 s.sup.-1. [0896] Aspect
D-6: An amino acid sequence according to any of aspects B-1 to B-8,
C-1 to C-5, and/or D-1 to D-5 that can specifically bind to any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof with
an affinity less than 500 nM, preferably less than 200 nM, more
preferably less than 10 nM, such as less than 500 pM. [0897] Aspect
D-7: An amino acid sequence according to each and any of the
preceding aspects D-1 to D-6, in which said amino acid sequence is
an ISV (as defined herein), and preferably functions as a binding
unit.
[0898] The amino acid sequences according to aspects D-1 to D-7 may
in particular be an amino acid sequence according to any of the
aspects A-1 to A-54. [0899] Aspect E-1: An amino acid sequence
according to any of aspects B-1 to B-8, C-1 to C-5 and/or D1 to
D-7, that is a naturally occurring amino acid sequence (from any
suitable species) or a synthetic or semi-synthetic amino acid
sequence. [0900] Aspect E-2: An amino acid sequence according to
any of aspects B-1 to B-8, C-1 to C-5, D1 to D-7, and/or E-1 that
comprises an immunoglobulin fold or that under suitable conditions
is capable of forming an immunoglobulin fold. [0901] Aspect E-3: An
amino acid sequence according to any of aspects B-1 to B-8, C-1 to
C-5, D1 to D-7, and/or E-1 or E-2, that is an immunoglobulin
sequence. [0902] Aspect E-4: An amino acid sequence according to
any of aspects B-1 to B-8, C-1 to C-5, D1 to D-7, and/or E-1 to
E-3, that is a naturally occurring immunoglobulin sequence (from
any suitable species) or a synthetic or semi-synthetic
immunoglobulin sequence. [0903] Aspect E-5: An amino acid sequence
according to any of aspects B-1 to B-8, C-1 to C-5, D1 to D-7,
and/or E-1 to E-4 that is a humanized immunoglobulin sequence, a
camelized immunoglobulin sequence or an immunoglobulin sequence
that has been obtained by techniques such as affinity maturation.
[0904] Aspect E-6: An amino acid sequence according to any of
aspects B-1 to B-8, C-1 to C-5, D1 to D-7, and/or E-1 to E-5 that
essentially consists of a light chain variable domain sequence
(e.g. a V.sub.L-sequence); or of a heavy chain variable domain
sequence (e.g. a V.sub.H-sequence). [0905] Aspect E-7: An amino
acid sequence according to any of aspects B-1 to B-8, C-1 to C-5,
D1 to D-7, and/or E-1 to E-6, that essentially consists of a heavy
chain variable domain sequence that is derived from a conventional
four-chain antibody or that essentially consist of a heavy chain
variable domain sequence that is derived from heavy chain antibody.
[0906] Aspect E-8: An amino acid sequence according to any of
aspects B-1 to B-8, C-1 to C-5, D1 to D-7, and/or E-1 to E-7, that
essentially consists of a domain antibody (or an An amino acid
sequence that is suitable for use as a domain antibody), of a
single domain antibody (or an An amino acid sequence that is
suitable for use as a single domain antibody), of a "dAb" (or an An
amino acid sequence that is suitable for use as a dAb) or of a
Nanobody (including but not limited to a V.sub.HH sequence). [0907]
Aspect E-9: An amino acid sequence according to any of aspects B-1
to B-8, C-1 to C-5, D1 to D-7, and/or E-1 to E-8 that essentially
consists of a Nanobody. [0908] Aspect E-10: An amino acid sequence
according to any of aspects B-1 to B-8, C-1 to C-5, D1 to D-7,
and/or E-1 to E-9 that essentially consists of a Nanobody that
[0909] i) has at least 80% amino acid identity with at least one of
the amino acid sequences of SEQ ID NOs: 1 to 22, in which for the
purposes of determining the degree of amino acid identity, the
amino acid residues that form the CDR sequences are disregarded;
and in which: [0910] ii) preferably one or more of the amino acid
residues at positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and 108
according to the Kabat numbering are chosen from the Hallmark
residues mentioned in Table B-2. [0911] Aspect E-11: An amino acid
sequence according to any of aspects B-1 to B-8, C-1 to C-5, D1 to
D-7, and/or E-1 to E-10, that essentially consists of a Nanobody
that [0912] i) has at least 80% amino acid identity with at least
one of the An amino acid sequences of SEQ ID NOs: 623 to 693, in
which for the purposes of determining the degree of amino acid
identity, the amino acid residues that form the CDR sequences are
disregarded; and in which: [0913] ii) preferably one or more of the
amino acid residues at positions 11, 37, 44, 45, 47, 83, 84, 103,
104 and 108 according to the Kabat numbering are chosen from the
Hallmark residues mentioned in Table B-2. [0914] Aspect E-12: An
amino acid sequence according to any of aspects B-1 to B-8, C-1 to
C-5, D1 to D-7, and/or E-1 to E-11that essentially consists of a
humanized Nanobody. [0915] Aspect E-13: An amino acid sequence
according to any of the aspects B-1 to B-8, C-1 to C-5, D1 to D-7,
and/or E-1 to E-11, that in addition to the at least one binding
site for binding formed by the CDR sequences, contains one or more
further binding sites for binding against other antigens, proteins
or targets. [0916] Aspect E-14: An amino acid sequence according to
each and any of the preceding aspects E-1 to E-13, in which said
amino acid sequence is an ISV (as defined herein), and preferably
functions as a binding unit.
[0917] The amino acid sequences according to aspects E-1 to E-14
may in particular be an amino acid sequence according to any of the
aspects A-1 to A-54.
Framework+CDR's Aspects
[0918] Aspect F-1: An amino acid sequence that essentially consists
of 4 framework regions (FR1 to FR4, respectively) and 3
complementarity determining regions (CDR1 to CDR3, respectively),
in which: [0919] CDR1 is chosen from the group consisting of:
[0920] a) the amino acid sequences of SEQ ID NOs: 197 to 267;
[0921] b) amino acid sequences that have at least 80% amino acid
identity with at least one of the amino acid sequences of SEQ ID
NOs: 197 to 267; [0922] c) amino acid sequences that have 3, 2, or
1 amino acid difference with at least one of the amino acid
sequences of SEQ ID NOs: 197 to 267; and/or [0923] CDR2 is chosen
from the group consisting of: [0924] d) the amino acid sequences of
SEQ ID NOs: 339 to 409; [0925] e) amino acid sequences that have at
least 80% amino acid identity with at least one of the amino acid
sequences of SEQ ID NOs: 339 to 409; [0926] f) amino acid sequences
that have 3, 2, or l amino acid difference with at least one of the
amino acid sequences of SEQ ID NOs: 339 to 409; and/or [0927] CDR3
is chosen from the group consisting of: [0928] g) the amino acid
sequences of SEQ ID NOs: 481 to 551; [0929] h) amino acid sequences
that have at least 80% amino acid identity with at least one of the
amino acid sequences of SEQ ID NOs: 481 to 551; [0930] i) amino
acid sequences that have 3, 2, or 1 amino acid difference with at
least one of the amino acid sequences of SEQ ID NOs: 481 to 551.
Such an amino acid sequence is preferably directed against any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof
and/or an amino acid sequence that can specifically bind (e.g. as a
binding unit) to any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof. Also, such an amino acid sequence is
preferably an amino acid sequence according to any of the aspects
A-1 to A-54, C-1 to C-5, D1 to D-7 and/or E-1 to E-14. [0931]
Aspect F-2: An amino acid sequence that essentially consists of 4
framework regions (FR1 to FR4, respectively) and 3 complementarity
determining regions (CDR1 to CDR3, respectively), in which: [0932]
CDR1 is chosen from the group consisting of: [0933] a) the amino
acid sequences of SEQ ID NOs: 197 to 267; [0934] b) amino acid
sequences that have at least 80% amino acid identity with at least
one of the amino acid sequences of SEQ ID NOs: 197 to 267; [0935]
c) amino acid sequences that have 3, 2, or 1 amino acid difference
with at least one of the amino acid sequences of SEQ ID NOs: 197 to
267; and [0936] CDR2 is chosen from the group consisting of: [0937]
d) the amino acid sequences of SEQ ID NOs: 339 to 409; [0938] e)
amino acid sequences that have at least 80% amino acid identity
with at least one of the amino acid sequences of SEQ ID NOs: 339 to
409; [0939] f) amino acid sequences that have 3, 2, or 1 amino acid
difference with at least one of the amino acid sequences of SEQ ID
NOs: 339 to 409; and [0940] CDR3 is chosen from the group
consisting of: [0941] g) the amino acid sequences of SEQ ID NOs:
481 to 551; [0942] h) amino acid sequences that have at least 80%
amino acid identity with at least one of the amino acid sequences
of SEQ ID NOs: 481 to 551; [0943] i) amino acid sequences that have
3, 2, or 1 amino acid difference with at least one of the amino
acid sequences of SEQ ID NOs: 481 to 551. Such an amino acid
sequence is preferably directed against any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof and/or an amino acid
sequence that can specifically bind (e.g. as a binding unit) to any
of IL-17A, IL-17F and/or IL-17A/F including combinations thereof.
Also, such an amino acid sequence is preferably an amino acid
sequence according to any of the aspects A-1 to A-54, C-1 to C-5,
D1 to D-7 and/or E-1 to E-14. [0944] Aspect F-3: An amino acid
sequence according to any of aspects F-1 and F-2, in which the CDR
sequences of said amino acid sequence have at least 70% amino acid
identity, preferably at least 80% amino acid identity, more
preferably at least 90% amino acid identity, such as 95% amino acid
identity or more or even essentially 100% amino acid identity with
the CDR sequences of at least one of the amino acid sequences of
SEQ ID NOs: 623 to 693. Such an amino acid sequence is preferably
directed against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof and/or an amino acid sequence that can
specifically bind to any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof. Also, such an amino acid sequence
is preferably an amino acid sequence according to any of the
aspects A-1 to A-54, C-1 to C-5, D1 to D-7 and/or E-1 to E-14.
[0945] Aspect F-4: An amino acid sequence according to any of
aspects F-1 to F-3 that is directed against any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof and that
cross-blocks the binding of at least one of the amino acid
sequences according to any of aspects the amino acid sequences of
SEQ ID NOs: 623 to 693. [0946] Aspect F-5: An amino acid sequence
according to any of aspects F-1 to F-3 that is directed against any
of IL-17A, IL-17F and/or IL-17A/F including combinations thereof
and that is cross-blocked from binding to any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof by at least one of
the amino acid sequences of SEQ ID NOs: 623 to 693. [0947] Aspect
F-6: Amino acid sequence according to any of aspects F-4 or F-5
wherein the ability of said amino acid sequence to cross-block or
to be cross-blocked is detected in a Biacore assay. [0948] Aspect
F-7: Amino acid sequence according to any of aspects F4 or F-5
wherein the ability of said amino acid sequence to cross-block or
to be cross-blocked is detected in an ELISA assay. [0949] Aspect
F-8: An amino acid sequence according to any of aspects F-1 to F-7,
that is in essentially isolated form. [0950] Aspect F-9: An amino
acid sequence according to any of aspects F-1 to F-8, for
administration to a subject, wherein said an amino acid sequence
does not naturally occur in said subject. [0951] Aspect F-10: An
amino acid sequence according to any of aspects F-1 to F-9, that
can specifically bind to any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof with a dissociation constant
(K.sub.D) of 10.sup.-5 to 10.sup.-12 moles/litre or less, and
preferably 10.sup.-7 to 10.sup.-12 moles/litre or less and more
preferably 10.sup.-8 to 10.sup.-12 moles/litre. [0952] Aspect F-11:
An amino acid sequence according to any of aspects F-1 to F-10,
that can specifically bind to any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof with a rate of association
(k.sub.on-rate) of between 10.sup.2 M.sup.-1s.sup.-1 to about
10.sup.7 M.sup.-1s.sup.-1, preferably between 10.sup.3
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1, more preferably
between 10.sup.4 M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1,
such as between 10.sup.5 M.sup.-1s.sup.-1 and 10.sup.7
M.sup.-1s.sup.-1. [0953] Aspect F-12: An amino acid sequence
according to any of aspects F-1 to F-11, that can specifically bind
to any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof with a rate of dissociation (k.sub.off rate) between 1
s.sup.-1 and 10.sup.-6 s.sup.-1 preferably between 10.sup.-2
s.sup.-1 and 10.sup.-6 s.sup.-1, more preferably between 10.sup.-3
s.sup.-1 and 10.sup.-6 s.sup.-1, such as between 10.sup.-4 s.sup.-1
and 10.sup.-6 s.sup.-1. [0954] Aspect F-13: An amino acid sequence
according to any of aspects F-1 to F-12, that can specifically bind
to any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof with an affinity less than 500 nM, preferably less than 200
nM, more preferably less than 10 nM, such as less than 500 pM.
[0955] Aspect F-14: An amino acid sequence according to any of
aspects F-1 to F-13, that is a naturally occurring amino acid
sequence (from any suitable species) or a synthetic or
semi-synthetic amino acid sequence. [0956] Aspect F-15: An amino
acid sequence according to any of aspects F-1 to F-14, that
comprises an immunoglobulin fold or that under suitable conditions
is capable of forming an immunoglobulin fold. [0957] Aspect F-16:
An amino acid sequence according to any of aspects F-1 to F-15,
that is an immunoglobulin sequence, and in particular an ISV.
[0958] Aspect F-17: An amino acid sequence according to any of
aspects F-1 to F-16, that is a naturally occurring immunoglobulin
sequence (from any suitable species) or a synthetic or
semi-synthetic immunoglobulin sequence. [0959] Aspect F-18: An
amino acid sequence according to any of aspects F-1 to F-17, that
is a humanized immunoglobulin sequence, a camelized immunoglobulin
sequence or an immunoglobulin sequence that has been obtained by
techniques such as affinity maturation. [0960] Aspect F-19: An
amino acid sequence according to any of aspects F-1 to F-18, that
essentially consists of a light chain variable domain sequence
(e.g. a V.sub.L-sequence); or of a heavy chain variable domain
sequence (e.g. a V.sub.H-sequence) [0961] Aspect F-20: An amino
acid sequence according to any of aspects F-1 to F-19, that
essentially consists of a heavy chain variable domain sequence that
is derived from a conventional four-chain antibody or that
essentially consist of a heavy chain variable domain sequence that
is derived from heavy chain antibody. [0962] Aspect F-21: An amino
acid sequence according to any of aspects F-1 to F-20, that
essentially consists of a domain antibody (or an amino acid
sequence that is suitable for use as a domain antibody), of a
single domain antibody (or an amino acid sequence that is suitable
for use as a single domain antibody), of a "dAb" (or an amino acid
sequence that is suitable for use as a dAb) or of a Nanobody
(including but not limited to a V.sub.HH sequence). [0963] Aspect
F-22: An amino acid sequence according to any of aspects F-1 to
F-21, that essentially consists of a Nanobody. [0964] Aspect F-23:
An amino acid sequence according to any of aspects F-1 to F-22,
that essentially consists of a Nanobody that [0965] i) has at least
80% amino acid identity with at least one of the amino acid
sequences of SEQ ID NOs: 1 to 22, in which for the purposes of
determining the degree of amino acid identity, the amino acid
residues that form the CDR sequences are disregarded; and in which:
[0966] ii) preferably one or more of the amino acid residues at
positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and 108 according to
the Kabat numbering are chosen from the Hallmark residues mentioned
in Table B-2. [0967] Aspect F-24: An amino acid sequence according
to any of aspects F-1 to F-23, that essentially consists of a
Nanobody that [0968] i) has at least 80% amino acid identity with
at least one of the amino acid sequences of SEQ ID NOs: 623 to 693,
in which for the purposes of determining the degree of amino acid
identity, the amino acid residues that form the CDR sequences are
disregarded; and in which: [0969] ii) preferably one or more of the
amino acid residues at positions 11, 37, 44, 45, 47, 83, 84, 103,
104 and 108 according to the Kabat numbering are chosen from the
Hallmark residues mentioned in Table B-2. [0970] Aspect F-25: An
amino acid sequence according to any of aspects F-1 to F-24, that
essentially consists of a humanized Nanobody. [0971] Aspect G-1: An
amino acid sequence according to any of the preceding aspects, that
in addition to the at least one binding site for binding formed by
the CDR sequences, contains one or more further binding sites (e.g.
as binding units) for binding against another antigen, protein or
target. [0972] Aspect H-1: Nanobody that is directed against and/or
that can specifically bind (e.g. as a binding unit) to any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof.
[0973] Aspect H-2: Nanobody according to aspect H-1, that is in
essentially isolated form. [0974] Aspect H-3: Nanobody according to
any of aspects H-1 to H-2, that can specifically bind to any of
IL-17A, IL-17F and/or IL-17A/F including combinations thereof with
a dissociation constant (K.sub.D) of 10.sup.-5 to 10.sup.-12
moles/litre or less, and preferably 10.sup.-7 to 10.sup.-12
moles/litre or less and more preferably 10.sup.-8 to 10.sup.-12
moles/litre. [0975] Aspect H-4: Nanobody according to any of
aspects H-1 to H-3, that can specifically bind to any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof with a rate
of association (k.sub.on-rate) of between 10.sup.2 M.sup.-1s.sup.-1
to about 10.sup.7 M.sup.-1s.sup.-1, preferably between 10.sup.3
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1, more preferably
between 10.sup.4 M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1,
such as between 10.sup.5 M.sup.-1s.sup.-1 and 10.sup.7
M.sup.-1s.sup.-1. [0976] Aspect H-5: Nanobody according to any of
aspects H-1 to H-4, that can specifically bind to any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof with a rate
of dissociation (k.sub.off rate) between 1 s.sup.-1 and 10.sup.-6
s.sup.-1 preferably between 10.sup.-2 s.sup.-1 and 10.sup.-6
s.sup.-1, more preferably between 10.sup.-3 s.sup.-1 and 10.sup.-6
s.sup.-1, such as between 10.sup.-4 s.sup.-1 and 10.sup.-6
s.sup.-1. [0977] Aspect H-6: Nanobody according to any of aspects
H-1 to H-5, that can specifically bind to any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof with an affinity
less than 500 nM, preferably less than 200 nM, more preferably less
than 10 nM, such as less than 500 pM. [0978] Aspect H-7: Nanobody
according to any of aspects H-1 to H-6, that is a naturally
occurring Nanobody (from any suitable species) or a synthetic or
semi-synthetic Nanobody. [0979] Aspect H-8: Nanobody according to
any of aspects to H-1 to H-7, that is a V.sub.HH sequence, a
partially humanized V.sub.HH sequence, a fully humanized V.sub.HH
sequence, a camelized heavy chain variable domain or a Nanobody
that has been obtained by techniques such as affinity maturation.
[0980] Aspect H-9: Nanobody according to any of aspects H-1 to H-8,
that [0981] i) has at least 80% amino acid identity with at least
one of the An amino acid sequences of SEQ ID NOs: 1 to 22, in which
for the purposes of determining the degree of amino acid identity,
the amino acid residues that form the CDR sequences are
disregarded; and in which: [0982] ii) preferably one or more of the
amino acid residues at positions 11, 37, 44, 45, 47, 83, 84, 103,
104 and 108 according to the Kabat numbering are chosen from the
Hallmark residues mentioned in Table B-2. [0983] Aspect H-10:
Nanobody according to any of aspects H-1 to H-9, that [0984] i) has
at least 80% amino acid identity with at least one of the An amino
acid sequences of SEQ ID NOs: 623 to 693, in which for the purposes
of determining the degree of amino acid identity, the amino acid
residues that form the CDR sequences are disregarded; and in which:
[0985] ii) preferably one or more of the amino acid residues at
positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and 108 according to
the Kabat numbering are chosen from the Hallmark residues mentioned
in Table B-2.
[0986] Aspect H-11: Nanobody according to any of aspects H-1 to
H-10, in which: [0987] CDR1 is chosen from the group consisting of:
[0988] a) the amino acid sequences of SEQ ID NOs: 197 to 267;
[0989] b) amino acid sequences that have at least 80% amino acid
identity with at least one of the amino acid sequences of SEQ ID
NOs: 197 to 267; [0990] c) amino acid sequences that have 3, 2, or
1 amino acid difference with at least one of the amino acid
sequences of SEQ ID NOs: 197 to 267; and/or [0991] CDR2 is chosen
from the group consisting of: [0992] d) the amino acid sequences of
SEQ ID NOs: 339 to 409; [0993] e) amino acid sequences that have at
least 80% amino acid identity with at least one of the amino acid
sequences of SEQ ID NOs: 339 to 409; [0994] f) amino acid sequences
that have 3, 2, or 1 amino acid difference with at least one of the
amino acid sequences of SEQ ID NOs: 339 to 409; and/or [0995] CDR3
is chosen from the group consisting of: [0996] g) the amino acid
sequences of SEQ ID NOs: 481 to 551; [0997] h) amino acid sequences
that have at least 80% amino acid identity with at least one of the
amino acid sequences of SEQ ID NOs: 481 to 551; [0998] i) amino
acid sequences that have 3, 2, or 1 amino acid difference with at
least one of the amino acid sequences of SEQ ID NOs: 481 to 551.
[0999] Aspect H-12: Nanobody according to any of aspects H-1 to
H-11, in which: [1000] CDR1 is chosen from the group consisting of:
[1001] a) the amino acid sequences of SEQ ID NOs: 197 to 267;
[1002] b) amino acid sequences that have at least 80% amino acid
identity with at least one of the amino acid sequences of SEQ ID
NOs: 197 to 267; [1003] c) amino acid sequences that have 3, 2, or
1 amino acid difference with at least one of the amino acid
sequences of SEQ ID NOs: 197 to 267; and [1004] CDR2 is chosen from
the group consisting of: [1005] d) the amino acid sequences of SEQ
ID NOs: 339 to 409; [1006] e) amino acid sequences that have at
least 80% amino acid identity with at least one of the amino acid
sequences of SEQ ID NOs: 339 to 409; [1007] f) amino acid sequences
that have 3, 2, or 1 amino acid difference with at least one of the
amino acid sequences of SEQ ID NOs: 339 to 409; and [1008] CDR3 is
chosen from the group consisting of: [1009] g) the amino acid
sequences of SEQ ID NOs: 481 to 551; [1010] h) amino acid sequences
that have at least 80% amino acid identity with at least one of the
amino acid sequences of SEQ ID NOs: 481 to 551; [1011] i) amino
acid sequences that have 3, 2, or 1 amino acid difference with at
least one of the amino acid sequences of SEQ ID NOs: 481 to 551.
[1012] Aspect H-13: Nanobody according to any of aspects H-1 to
H-I2, in which the CDR sequences have at least 70% amino acid
identity, preferably at least 80% amino acid identity, more
preferably at least 90% amino acid identity, such as 95% amino acid
identity or more or even essentially 100% amino acid identity with
the CDR sequences of at least one of the amino acid sequences of
SEQ ID NOs: 623 to 693. [1013] Aspect H-14: Nanobody according to
any of aspects H-1 to H-13, which is a partially humanized
Nanobody. [1014] Aspect H-15: Nanobody according to any of aspects
H-1 to H-14, which is a fully humanized Nanobody. [1015] Aspect
H-16: Nanobody according to any of aspects H-1 to H-15, that is
chosen from the group consisting of SEQ ID NOs: 623 to 693 or from
the group consisting of from amino acid sequences that have more
than 80%, preferably more than 90%, more preferably more than 95%,
such as 99% or more sequence identity (as defined herein) with at
least one of the amino acid sequences of SEQ ID NOs: 623 to 693.
[1016] Aspect H-17: Nanobody according to any of aspects H-1 to
H-16, which is a humanized Nanobody that is chosen from the group
consisting of from amino acid sequences that have more than 80%,
preferably more than 90%, more preferably more than 95%, such as
99% or more sequence identity (as defined herein) with at least one
of the amino acid sequences of SEQ ID NOs: 623 to 693. [1017]
Aspect H-18: Nanobody according to any of aspects H-1 to H-17, that
is chosen from the group consisting of SEQ ID NOs: 623 to 693.
[1018] Aspect H-19: Nanobody directed against any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof that cross-blocks
the binding of at least one of the amino acid sequences of SEQ ID
NOs: 623 to 693 to any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof. [1019] Aspect H-20: Nanobody directed against
any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof that is cross-blocked from binding to any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof by at least one of
the amino acid sequences of SEQ ID NOs: 623 to 693. [1020] Aspect
H-21: Nanobody according to any of aspects H-19 or H-20 wherein the
ability of said Nanobody to cross-block or to be cross-blocked is
detected in a Biacore assay. [1021] Aspect H-22: Nanobody according
to any of aspects H-19 to H-21 wherein the ability of said Nanobody
to cross-block or to be cross-blocked is detected in an ELISA
assay
Polypeptides.
[1021] [1022] Aspect K-1: Polypeptide that comprises or essentially
consists of one or more amino acid sequences according to any of
aspects A-1 to A-54, B-1 to B-8, C-1 to C-5, D-1 to D-7, E-1 to
E-14, F-1 to F-25 or G-1 and/or one or more Nanobodies according to
any of aspects H-1 to H-22, and optionally further comprises one or
more peptidic linkers and/or one or more other groups, residues,
moieties or binding units. [1023] Aspect K-2: Polypeptide according
to aspect K-1, in which said one or more binding units are
immunoglobulin sequences, and in particular ISV's. [1024] Aspect
K-3: Polypeptide according to any of aspects K-1 or K-2, in which
said one or more other groups, residues, moieties or binding units
are chosen from the group consisting of domain antibodies, amino
acid sequences that are suitable for use as a domain antibody,
single domain antibodies, amino acid sequences that are suitable
for use as a single domain antibody, "dAb"'s, amino acid sequences
that are suitable for use as a dAb, or Nanobodies. [1025] Aspect
K-4: Polypeptide according to any of aspects K-1 to K-3, in which
said one or more amino acid sequences of the invention are
immunoglobulin sequences. [1026] Aspect K-5: Polypeptide according
to any of aspects K-1 to K-4, in which said one or more amino acid
sequences of the invention are chosen from the group consisting of
domain antibodies, amino acid sequences that are suitable for use
as a domain antibody, single domain antibodies, amino acid
sequences that are suitable for use as a single domain antibody,
"dAb"'s, amino acid sequences that are suitable for use as a dAb,
or Nanobodies. [1027] Aspect K-6: Polypeptide according to any of
aspects K-1 to K-5, that comprises or essentially consists of one
or more Nanobodies according to any of aspects H-1 to H-22 and in
which said one or more other binding units are Nanobodies. [1028]
Aspect K-7: Polypeptide according to any of aspects K-1 to K-6,
wherein at least one binding unit is a multivalent construct.
[1029] Aspect K-8: Polypeptide according to any of aspects K-1 to
K-8, wherein at least one binding unit is a multiparatopic
construct. [1030] Aspect K-9: Polypeptide according to any of
aspects K-1 to K-8, wherein at least one binding unit is a
multispecific construct. [1031] Aspect K-10: Polypeptide according
to any of aspects K-1 to K-9, which has an increased half-life,
compared to the corresponding amino acid sequence according to any
of aspects A-1 to A-54, B-1 to B-8, C-1 to C-5, D-1 to D-7, E-1 to
E-14, F-1 to F-25 or G-1 per se or Nanobody according to any of
aspects H-1 to H-22 per se, respectively. [1032] Aspect K-11:
Polypeptide according to aspect K-10, in which said one or more
other binding units provide the polypeptide with increased
half-life, compared to the corresponding amino acid sequence
according to any of aspects A-1 to A-54, B-1 to B-8, C-1 to C-5,
D-1 to D-7, E-1 to E-14, F-1 to F-25 or G-1 per se or Nanobody
according to any of aspects H-1 to H-22 per se, respectively.
[1033] Aspect K-12: Polypeptide according to aspect K-10 or K-11,
in which said one or more other binding units that provide the
polypeptide with increased half-life is chosen from the group
consisting of serum proteins or fragments thereof, binding units
that can bind to serum proteins, an Fc portion, and small proteins
or peptides that can bind to serum proteins. [1034] Aspect K-13:
Polypeptide according to any of aspects K-10 to K-12, in which said
one or more other binding units that provide the polypeptide with
increased half-life is chosen from the group consisting of human
serum albumin or fragments thereof. [1035] Aspect K-14: Polypeptide
according to any of aspect K-10 to K-13, in which said one or more
other binding units that provides the polypeptide with increased
half-life are chosen from the group consisting of binding units
that can bind to serum albumin (such as human serum albumin) or a
serum immunoglobulin (such as IgG). [1036] Aspect K-15: Polypeptide
according to any of aspects K-10 to K-14, in which said one or more
other binding units that provides the polypeptide with increased
half-life are chosen from the group consisting of domain
antibodies, amino acid sequences that are suitable for use as a
domain antibody, single domain antibodies, amino acid sequences
that are suitable for use as a single domain antibody, "dAb"'s ,
amino acid sequences that are suitable for use as a dAb, or
Nanobodies that can bind to serum albumin (such as human serum
albumin) or a serum immunoglobulin (such as IgG). [1037] Aspect
K-16: Polypeptide according to aspect K-10 to K-15, in which said
one or more other binding units that provides the polypeptide with
increased half-life is a Nanobody that can bind to serum albumin
(such as human serum albumin) or a serum immunoglobulin (such as
IgG). [1038] Aspect K-17: Polypeptide according to any of aspects
K-10 to K-16, that has a serum half-life that is at least 1.5
times, preferably at least 2 times, such as at least 5 times, for
example at least 10 times or more than 20 times, greater than the
half-life of the corresponding amino acid sequence according to any
of aspects A-1 to A-54, B-1 to B-8, C-1 to C-5, D-1 to D-7, E-1 to
E-14, F-1 to F-25 or G-1 per se or Nanobody according to any of
aspects H-1 to H-22 per se, respectively. [1039] Aspect K-18:
Polypeptide according to any of aspects K-10 to K-17, that has a
serum half-life that is increased with more than 1 hours,
preferably more than 2 hours, more preferably more than 6 hours,
such as more than 12 hours, or even more than 24, 48 or 72 hours,
compared to the corresponding amino acid sequence according to any
of aspects A-1 to A-54, B-1 to B-8, C-1 to C-5, D-1 to D-7, E-1 to
E-14, F-1 to F-25 or G-1 per se or Nanobody according to any of
aspects H-1 to H-22 per se, respectively. [1040] Aspect K-19:
Polypeptide according to any of aspects K-1 to K-18, that has a
serum half-life in human of at least about 12 hours, preferably at
least 24 hours, more preferably at least 48 hours, even more
preferably at least 72 hours or more; for example, of at least 5
days (such as about 5 to 10 days), preferably at least 9 days (such
as about 9 to 14 days), more preferably at least about 10 days
(such as about 10 to 15 days), or at least about 11 days (such as
about 11 to 16 days), more preferably at least about 12 days (such
as about 12 to 18 days or more), or more than 14 days (such as
about 14 to 19 days).
Compound or Construct.
[1040] [1041] Aspect L-1: Compound or construct, that comprises or
essentially consists of one or more amino acid sequences according
to any of aspects A-1 to A-54, B-1 to B-8, C-1 to C-5, D-1 to D-7,
E-1 to E-14, F-1 to F-25 or G-1 and/or one or more Nanobodies
according to any of aspects H-1 to H-22, and optionally further
comprises one or more other groups, residues, moieties or binding
units, optionally linked via one or more linkers. [1042] Aspect
L-2: Compound or construct according to aspects L-1, in which said
one or more other groups, residues, moieties or binding units are
amino acid sequences. [1043] Aspect L-3: Compound or construct
according to aspect L-1 or L-2, in which said one or more linkers,
if present, are one or more amino acid sequences. [1044] Aspect
L-4: Compound or construct according to any of aspects L-1 to L-3,
in which said one or more other groups, residues, moieties or
binding units are immunoglobulin sequences, and in particular
ISV's. [1045] Aspect L-5: Compound or construct according to any of
aspects L-1 to L-4, in which said one or more other groups,
residues, moieties or binding units are chosen from the group
consisting of domain antibodies, amino acid sequences that are
suitable for use as a domain antibody, single domain antibodies,
amino acid sequences that are suitable for use as a single domain
antibody, "dAb"'s, amino acid sequences that are suitable for use
as a dAb, or Nanobodies. [1046] Aspect L-6: Compound or construct
according to any of aspects L-1 to L-5, in which said one or more
amino acid sequences of the invention are immunoglobulin sequences.
[1047] Aspect L-7: Compound or construct according to any of
aspects L-1 to L-6, in which said one or more amino acid sequences
of the invention are chosen from the group consisting of domain
antibodies, amino acid sequences that are suitable for use as a
domain antibody, single domain antibodies, amino acid sequences
that are suitable for use as a single domain antibody, "dAb"'s,
amino acid sequences that are suitable for use as a dAb, or
Nanobodies. [1048] Aspect L-8: Compound or construct, that
comprises or essentially consists of one or more Nanobodies
according to any of aspects H-1 to H-22 and in which said one or
more other groups, residues, moieties or binding units are
Nanobodies. [1049] Aspect L-9: Compound or construct according to
any of aspects L-1 to L-9, which is a multivalent construct. [1050]
Aspect L-10: Compound or construct according to any of aspects L-1
to L-10, which is a multispecific construct. [1051] Aspect L-11:
Compound or construct according to any of aspects L-1 to L-10,
which has an increased half-life, compared to the corresponding
amino acid sequence according to any of aspects A-1 to A-54, B-1 to
B-8, C-1 to C-5, D-1 to D-7, E-1 to E-14, F-1 to F-25 or G-1 per se
or Nanobody according to any of aspects H-1 to H-22 per se,
respectively. [1052] Aspect L-12: Compound or construct according
to aspect L-1 to L-11, in which said one or more other groups,
residues, moieties or binding units provide the compound or
construct with increased half-life, compared to the corresponding
amino acid sequence according to any of aspects A-1 to A-54, B-1 to
B-8, C-1 to C-5, D-1 to D-7, E-1 to E-14, F-1 to F-25 or G-1 per se
or Nanobody according to any of aspects H-1 to H-22 per se,
respectively. [1053] Aspect L-13: Compound or construct according
to aspect L-12, in which said one or more other groups, residues,
moieties or binding units that provide the compound or construct
with increased half-life is chosen from the group consisting of
serum proteins or fragments thereof, binding units that can bind to
serum proteins, an Fc portion, and small proteins or peptides that
can bind to serum proteins. [1054] Aspect L-14: Compound or
construct according to aspect L-12 or L-13, in which said one or
more other groups, residues, moieties or binding units that provide
the compound or construct with increased half-life is chosen from
the group consisting of human serum albumin or fragments thereof.
[1055] Aspect L-15: Compound or construct according to any of
aspects L-12 to L-14, in which said one or more other groups,
residues, moieties or binding units that provides the compound or
construct with increased half-life are chosen from the group
consisting of binding units that can bind to serum albumin (such as
human serum albumin) or a serum immunoglobulin (such as IgG).
[1056] Aspect L-16: Compound or construct according to any of
aspects L-12 to L-14, in which said one or more other groups,
residues, moieties or binding units that provides the compound or
construct with increased half-life are chosen from the group
consisting of domain antibodies, amino acid sequences that are
suitable for use as a domain antibody, single domain antibodies,
amino acid sequences that are suitable for use as a single domain
antibody, "dAb"'s , amino acid sequences that are suitable for use
as a dAb, or Nanobodies that can bind to serum albumin (such as
human serum albumin) or a serum immunoglobulin (such as IgG).
[1057] Aspect L 17: Compound or construct according to any of
aspects L-12 to L-14, in which said one or more other groups,
residues, moieties or binding units that provides the compound or
construct with increased half-life is a Nanobody that can bind to
serum albumin (such as human serum albumin) or a serum
immunoglobulin (such as IgG). [1058] Aspect L-18: Compound or
construct according to any of aspects L-12 to L-17, that has a
serum half-life that is at least 1.5 times, preferably at least 2
times, such as at least 5 times, for example at least 10 times or
more than 20 times, greater than the half-life of the corresponding
amino acid sequence according to any of aspects A-1 to A-54, B-1 to
B-8, C-1 to C-5, D-1 to D-7, E-1 to E-14, F-1 to F-25 or G-1 per se
or Nanobody according to any of aspects H-1 to H-22 per se,
respectively. [1059] Aspect L-19: Compound or construct according
to any of aspects L-12 to L-18, that has a serum half-life that is
increased with more than 1 hours, preferably more than 2 hours,
more preferably more than 6 hours, such as more than 12 hours, or
even more than 24, 48 or 72 hours, compared to the corresponding
amino acid sequence according to any of aspects A-1 to A-54, B-1 to
B-8, C-1 to C-5, D-1 to D-7, E-1 to E-14, F-1 to F-25 or G-1 per se
or Nanobody according to any of aspects H-1 to H-22 per se,
respectively. [1060] Aspect L-20: Compound or construct according
to any of aspects L-12 to L-19, that has a serum half-life in human
of at least about 12 hours, preferably at least 24 hours, more
preferably at least 48 hours, even more preferably at least 72
hours or more; for example, of at least 5 days (such as about 5 to
10 days), preferably at least 9 days (such as about 9 to 14 days),
more preferably at least about 10 days (such as about 10 to 15
days), or at least about 11 days (such as about 11 to 16 days),
more preferably at least about 12 days (such as about 12 to 18 days
or more), or more than 14 days (such as about 14 to 19 days).
[1061] Aspect L-21: Monovalent construct, comprising or essentially
consisting of one amino acid sequence according to any of aspects
A-1 to A-54, B-1 to B-8, C-1 to C-5, D-1 to D-7, E-1 to E-14, F-1
to F-25 or G-1 and/or one Nanobody according to any of aspects H-1
to H-22. [1062] Aspect L-22: Monovalent construct according to
aspect L-21, in which said amino acid sequence of the invention is
chosen from the group consisting of domain antibodies, amino acid
sequences that are suitable for use as a domain antibody, single
domain antibodies, amino acid sequences that are suitable for use
as a single domain antibody, "dAb"'s, amino acid sequences that are
suitable for use as a dAb, or Nanobodies. [1063] Aspect L-23:
Monovalent construct, comprising or essentially consisting of one
Nanobody according to any of aspects H-1 to H-22.
Nucleic Acid
[1063] [1064] Aspect M-1: Nucleic acid or nucleotide sequence, that
encodes an amino acid sequence according to any of aspects A-1 to
A-54, B-1 to B-8, C-1 to C-5, D-1 to D-7, E-1 to E-14, F-1 to F-25
or G-1, a Nanobody according to any of aspects H-1 to H-22, a
compound or construct according to any of aspects that is such that
it can be obtained by expression of a nucleic acid or nucleotide
sequence encoding the same, or a monovalent construct according to
any of aspects. [1065] Aspect M-2: Nucleic acid or nucleotide
sequence according to aspect M-1, that is in the form of a genetic
construct.
Host Cell
[1065] [1066] Aspect N-1: Host or host cell that expresses, or that
under suitable circumstances is capable of expressing, an amino
acid sequence according to any of aspects A-1 to A-54, B-1 to B-8,
C-1 to C-5, D-1 to D-7, E-1 to E-14, F-1 to F-25 or G-1, a Nanobody
according to any of aspects H-1 to H-22, a polypeptide according to
any of aspects K-1 to K-19, a compound or construct according to
any of aspects L-1 to L-21 that is such that it can be obtained by
expression of a nucleic acid or nucleotide sequence encoding the
same, or a monovalent construct according to any of aspects L-22 or
L-23; and/or that comprises a nucleic acid or nucleotide sequence
according to aspect M-1 or a genetic construct according to aspect
M-2.
Compositions
[1066] [1067] Aspect O-1: Composition comprising at least one amino
acid sequence according to any of aspects A-1 to A-5454, B-1 to
B-8, C-1 to C-5, D-1 to D-7, E-1 to E-14, F-1 to F-25 or G-1,
Nanobody according to any of aspects H-1 to H-22, polypeptide
according to any of aspects K-1 to K-19, compound or construct
according to any of aspects L-1 to L-21, monovalent construct
according to any of aspects L-22 or L-23, or nucleic acid or
nucleotide sequence according to aspects M-1 or M-2. [1068] Aspect
O-2: Composition according to aspect O-1, which is a pharmaceutical
composition. [1069] Aspect O-3: Composition according to aspect
O-2, which is a pharmaceutical composition, that further comprises
at least one pharmaceutically acceptable carrier, diluent or
excipient and/or adjuvant, and that optionally comprises one or
more further pharmaceutically active polypeptides and/or
compounds.
Making of Agent and Composition of the Invention
[1069] [1070] Aspect P-1: Method for producing an amino acid
sequence according to any of aspects A-1 to A-54, B-1 to B-8, C-1
to C-5, D-1 to D-7, E-1 to E-14, F-1 to F-25 or G-1, a Nanobody
according to any of aspects H-1 to H-22, a polypeptide according to
any of aspects K-1 to K-19, a compound or construct according to
any of aspects L-1 to L-21 that is such that it can be obtained by
expression of a nucleic acid or nucleotide sequence encoding the
same, or a monovalent construct according to any of aspects L-22 or
L-23, said method at least comprising the steps of: [1071] a)
expressing, in a suitable host cell or host organism or in another
suitable expression system, a nucleic acid or nucleotide sequence
according to aspect M-1, or a genetic construct according to aspect
M-2; optionally followed by: [1072] b) isolating and/or purifying
the amino acid sequence according to any of aspects A-1 to A-54,
B-1 to B-8, C-1 to C-5, D-1 to D-7, E-1 to E-14, F-1 to F-25 or
G-1, a Nanobody according to any of aspects H-1 to H-22, a
polypeptide according to any of aspects K-1 to K-19, a compound or
construct according to any of aspects L-1 to L-21, or a monovalent
construct according to any of aspects L-22 or L-23 thus obtained.
[1073] Aspect P-2: Method for producing an amino acid sequence
according to any of aspects A-1 to A-54, B-1 to B-8, C-1 to C-5,
D-1 to D-7, E-1 to E-14, F-1 to F-25 or G-1, a Nanobody according
to any of aspects H-1 to H-22, a polypeptide according to any of
aspects K-1 to K-19, a compound or construct according to any of
aspects L-1 to L-21 that is such that it can be obtained by
expression of a nucleic acid or nucleotide sequence encoding the
same, or a monovalent construct according to any of aspects L-22 or
L-23, said method at least comprising the steps of: [1074] a)
cultivating and/or maintaining a host or host cell according to
aspect . . . under conditions that are such that said host or host
cell expresses and/or produces at least one amino acid sequence
according to any of aspects A-1 to A-54, B-1 to B-8, C-1 to C-5,
D-1 to D-7, E-1 to E-14, F-1 to F-25 or G-1, Nanobody according to
any of aspects H-1 to H-22, a polypeptide according to any of
aspects K-1 to K-19, a compound or construct according to any of
aspects L-1 to L-21, or monovalent construct according to any of
aspects L-22 or L-23; optionally followed by: [1075] b) isolating
and/or purifying the amino acid sequence according to any of
aspects A-1 to A-54, B-1 to B-8, C-1 to C-5, D-1 to D-7, E-1 to
E-14, F-1 to F-25 or G-1, Nanobody according to any of aspects H-1
to H-22, a polypeptide according to any of aspects K-1 to K-19, a
compound or construct according to any of aspects L-1 to L-21, or
monovalent construct according to any of aspects L-22 or L-23 thus
obtained.
Method of Screening Using Leads
[1075] [1076] Aspect Q-1: Method for screening amino acid sequences
directed against any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof that comprises at least the steps of: [1077]
a) providing a set, collection or library of nucleic acid sequences
encoding amino acid sequences; [1078] b) screening said set,
collection or library of nucleic acid sequences for nucleic acid
sequences that encode an amino acid sequence that can bind to
and/or has affinity for any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof and that is cross-blocked or is
cross blocking a Nanobody of the invention, e.g. SEQ ID NO: 623 to
693 (Table-1); and [1079] c) isolating said nucleic acid sequence,
followed by expressing said amino acid sequence.
Use of Binding Agent of the Invention
[1079] [1080] Aspect R-1: Method for the prevention and/or
treatment of at least one immune related diseases and disorders of
the invention, said method comprising administering, to a subject
in need thereof, a pharmaceutically active amount of at least one
amino acid sequence according to any of aspects A-1 to A-54, B-1 to
B-8, C-1 to C-5, D-1 to D-7, E-1 to E-14, F-1 to F-25 or G-1,
Nanobody according to any of aspects H-1 to H-22, polypeptide
according to any of aspects K-1 to K-19, compound or construct
according to any of aspects L-1 to L-21, monovalent construct
according to any of aspects L-22 or L-23; or composition according
to aspect O-2 or O-3. [1081] Aspect R-2: Method for the prevention
and/or treatment of at least one disease or disorder that is
associated with any of IL-17A, IL-17F and/or IL-17A/F including
combinations thereof, with its biological or pharmacological
activity, and/or with the biological pathways or signalling in
which any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof is involved, said method comprising administering, to a
subject in need thereof, a pharmaceutically active amount of at
least one amino acid sequence according to any of aspects A-1 to
A-54, B-1 to B-8, C-1 to C-5, D-1 to D-7, E-1 to E-14, F-1 to F-25
or G-1, Nanobody according to any of aspects H-1 to H-22,
polypeptide according to any of aspects K-1 to K-19, compound or
construct according to any of aspects L-1 to L-21, monovalent
construct according to any of aspects L-22 or L-23; or composition
according to aspect O-2 or O-3. [1082] Aspect R-3: Method for the
prevention and/or treatment of at least one disease or disorder
that can be prevented and/or treated by administering, to a subject
in need thereof, at least one amino acid sequence according to any
of aspects A-1 to A-54, B-1 to B-8, C-1 to C-5, D-1 to D-7, E-1 to
E-14, F-1 to F-25 or G-1, Nanobody according to any of aspects H-1
to H-22, polypeptide according to any of aspects K-1 to K-19,
compound or construct according to any of aspects L-1 to L-21,
monovalent construct according to any of aspects L-22 or L-23; or
composition according to aspect O-2 or O-3, said method comprising
administering, to a subject in need thereof, a pharmaceutically
active amount of at least one at least one amino acid sequence
according to any of aspects A-1 to A-54, B-1 to B-8, C-1 to C-5,
D-1 to D-7, E-1 to E-14, F-1 to F-25 or G-1, Nanobody according to
any of aspects H-1 to H-22, polypeptide according to any of aspects
K-1 to K-19, compound or construct according to any of aspects L-1
to L-21, monovalent construct according to any of aspects L-22 or
L-23; or composition according to aspect O-2 or O-3. [1083] Aspect
R-4: Method for immunotherapy, said method comprising
administering, to a subject in need thereof, a pharmaceutically
active amount of at least one amino acid sequence according to any
of aspects A-1 to A-54, B-1 to B-8, C-1 to C-5, D-1 to D-7, E-1 to
E-14, F-1 to F-25 or G-1, Nanobody according to any of aspects H-1
to H-22, polypeptide according to any of aspects K-1 to K-19,
compound or construct according to any of aspects L-1 to L-21,
monovalent construct according to any of aspects L-22 or L-23; or
composition according to aspect O-2 or O-3. [1084] Aspect R-5: Use
of an amino acid sequence according to any of aspects A-1 to A-54,
B-1 to B-8, C-1 to C-5, D-1 to D-7, E-1 to E-14, F-1 to F-25 or
G-1, a Nanobody according to any of aspects H-1 to H-22, a
polypeptide according to any of aspects K-1 to K-19, a compound or
construct according to any of aspects L-1 to L-21, or a monovalent
construct according to any of aspects L-22 or L-23 in the
preparation of a pharmaceutical composition for prevention and/or
treatment of at least one immune related diseases and disorders of
the invention; and/or for use in one or more of the methods
according to aspects R-1 to R-3. [1085] Aspect R-6: Amino acid
sequence according to any of aspects A-1 to A-54, B-1 to B-8, C-1
to C-5, D-1 to D-7, E-1 to E-14, F-1 to F-25 or G-1, Nanobody
according to any of aspects H-1 to H-22, polypeptide according to
any of aspects K-1 to K-19, compound or construct according to any
of aspects L-1 to L-21, monovalent construct according to any of
aspects L-22 or L-23; or composition according to aspect O-2 or O-3
for the prevention and/or treatment of at least one immune related
diseases and disorders of the invention.
Fragment Aspects
[1085] [1086] Aspect S-1: Part or fragment of an amino acid
sequence according to any of aspects A-1 to A-54, B-1 to B-8, C-1
to C-5, D-1 to D-7, E-1 to E-14, F-1 to F-25 or G-1, or of a
Nanobody according to any of aspects H-1 to H-22. [1087] Aspect
S-2: Part or fragment according to aspect S-1, that can
specifically bind to any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof. [1088] Aspect S-3: Part of fragment
according to any of aspects S-1 or S-2, that can specifically bind
to any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof with a dissociation constant (K.sub.D) of 10.sup.-5 to
10.sup.-12 moles/litre or less, and preferably 10.sup.-7 to
10.sup.-12 moles/litre or less and more preferably 10.sup.-8 to
10.sup.-12 moles/litre. [1089] Aspect S-4: Part or fragment
according to any of aspects S-1 to S-3, that can specifically bind
to any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof with a rate of association (k.sub.on-rate) of between
10.sup.2 M.sup.-1s.sup.-1 to about 10.sup.7 M.sup.-1s.sup.-1,
preferably between 10.sup.3 M.sup.-1s.sup.-1 and 10.sup.7
M.sup.-1s.sup.-1, more preferably between 10.sup.4 M.sup.-1s.sup.-1
and 10.sup.7 M.sup.-1s.sup.-1, such as between 10.sup.5
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1. [1090] Aspect S-5:
Part or fragment according to any of aspects S-1 to S-4, that can
specifically bind to any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof with a rate of dissociation
(k.sub.off rate) between 1 s.sup.-1 and 10.sup.-6 s.sup.-1
preferably between 10.sup.-2 s.sup.-1 and 10.sup.-6 s.sup.-1, more
preferably between 10.sup.-3 s.sup.-1 and 10.sup.-6 s.sup.-1, such
as between 10.sup.-4 s.sup.-1 and 10.sup.-6 s.sup.-1. [1091] Aspect
S-6: Compound or construct, that comprises or essentially consists
of one or more parts or fragments according to any of aspects S-1
to S-4, and optionally further comprises one or more other groups,
residues, moieties or binding units, optionally linked via one or
more linkers. [1092] Aspect S-7: Compound or construct according to
aspect S-6, in which said one or more other groups, residues,
moieties or binding units are amino acid sequences. [1093] Aspect
S-8: Compound or construct according to aspect S-6 or S-7, in which
said one or more linkers, if present, are one or more amino acid
sequences. [1094] Aspect S-9: Nucleic acid or nucleotide sequence,
that encodes a part or fragment according to any of aspects S-1 to
S-7 or a compound or construct according to aspect S-8. [1095]
Aspect S-10: Composition, comprising at least one part or fragment
according to any of aspects S-1 to S-7, compound or construct
according to any of aspects S-6 to S-8, or nucleic acid or
nucleotide sequence according to aspect S-9.
Derivatives Aspects
[1095] [1096] Aspect T-1: Derivative of an amino acid sequence
according to any of aspects A-1 to A-54, B-1 to B-8, C-1 to C-5,
D-1 to D-7, E-1 to E-14, F-1 to F-25 or G-1, or of a Nanobody
according to any of aspects H-1 to H-22. [1097] Aspect T-2:
Derivative according to aspect T-1, that can specifically bind to
any of IL-17A, IL-17F and/or IL-17A/F including combinations
thereof. [1098] Aspect T-3: Derivative according to any of aspects
T-1 or T-2, that can specifically bind to any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof with a dissociation
constant (K.sub.D) of 10.sup.-5 to 10.sup.-12 moles/litre or less,
and preferably 10.sup.-7 to 10.sup.-12 moles/litre or less and more
preferably 10.sup.-8 to 10 .sup.-12 moles/litre. [1099] Aspect T-4:
Derivative according to any of aspects T-1 to T-3, that can
specifically bind to any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof with a rate of association
(k.sub.on-rate) of between 10.sup.2 M.sup.-1s.sup.-1 to about
10.sup.7 M.sup.-1s.sup.-1, preferably between 10.sup.3
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1, more preferably
between 10.sup.4 M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1,
such as between 10.sup.5 M.sup.-1s.sup.-1 and 10.sup.7
M.sup.-1s.sup.-1. [1100] Aspect T-5: Derivative according to any of
aspects T-1 to T-4, that can specifically bind to any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof with a rate
of dissociation (k.sub.off rate) between 1 s.sup.-1 and 10.sup.-6
s.sup.-1 preferably between 10.sup.-2 s.sup.-1 and 10.sup.-6
s.sup.-1, more preferably between 10.sup.-3 s.sup.-1 and 10.sup.-6
s.sup.-1, such as between 10.sup.-4 s.sup.-1 and 10.sup.-6
s.sup.-1. [1101] Aspect T-6: Derivative of a polypeptide according
to any of aspects K-1 to K-19 or compound or construct according to
any of aspects L-1 to L-23. [1102] Aspect T-7: Derivative according
to aspect T-6, that can specifically bind to any of IL-17A, IL-17F
and/or IL-17A/F including combinations thereof. [1103] Aspect T-8:
Derivative according to any of aspects T-6 or T-7, that can
specifically bind to any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof with a dissociation constant
(K.sub.D) of 10.sup.-5 to 10.sup.-12 moles/liter or less, and
preferably 10.sup.-7 to 10.sup.-12 moles/liter or less and more
preferably 10.sup.-8 to 10.sup.-12 moles/liter. [1104] Aspect T-9:
Derivative according to any of aspects T-6 to T-8, that can
specifically bind to any of IL-17A, IL-17F and/or IL-17A/F
including combinations thereof with a rate of association
(k.sub.on-rate) of between 10.sup.2 M.sup.-1s.sup.-1 to about
10.sup.7 M.sup.-1s.sup.-1, preferably between 10.sup.3
M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1, more preferably
between 10.sup.4 M.sup.-1s.sup.-1 and 10.sup.7 M.sup.-1s.sup.-1,
such as between 10.sup.5 M.sup.-1s.sup.-1 and 10.sup.7
M.sup.-1s.sup.-1. [1105] Aspect T-10: Derivative according to any
of aspects T-6 to T-9, that can specifically bind to any of IL-17A,
IL-17F and/or IL-17A/F including combinations thereof with a rate
of dissociation (k.sub.off rate) between 1 s.sup.-1 and 10.sup.-6
s.sup.-1 preferably between 10.sup.-2 s.sup.-1 and 10.sup.-6
s.sup.-1, more preferably between 10.sup.-3 s.sup.-1 and 10.sup.-6
s.sup.-1, such as between 10.sup.-4 s.sup.-1 and 10.sup.-6
s.sup.-1. [1106] Aspect T-11: Derivative according to any of
aspects T-1 to T-10, that has a serum half-life that is at least
1.5 times, preferably at least 2 times, such as at least 5 times,
for example at least 10 times or more than 20 times, greater than
the half-life of the corresponding amino acid sequence according to
any of aspects A-1 to A-54, B-1 to B-8, C-1 to C-5, D-1 to D-7, E-1
to E-14, F-1 to F-25 or G-1 per se,
[1107] Nanobody according to any of aspects H-1 to H-22 per se,
polypeptide according to any of aspects K-1 to K-19 or compound or
construct according to any of aspects L-1 to L-23 per se. [1108]
Aspect T-12: Derivative according to any of aspects T-1 to T-11,
that has a serum half-life that is increased with more than 1
hours, preferably more than 2 hours, more preferably more than 6
hours, such as more than 12 hours, or even more than 24, 48 or 72
hours, compared to the corresponding amino acid sequence according
to any of aspects A-1 to A-54, B-1 to B-8, C-1 to C-5, D-1 to D-7,
E-1 to E-14, F-1 to F-25 or G-1 per se, Nanobody according to any
of aspects H-1 to H-23 per se, polypeptide according to any of
aspects K-1 to K-19 or compound or construct according to any of
aspects L-1 to L-23 per se, respectively. [1109] Aspect T-13:
Derivative according to any of aspects T-1 to T-12, that has a
serum half-life in human of at least about 12 hours, preferably at
least 24 hours, more preferably at least 48 hours, even more
preferably at least 72 hours or more; for example, at least 5 days
(such as about 5 to 10 days), preferably at least 9 days (such as
about 9 to 14 days), more preferably at least about 10 days (such
as about 10 to 15 days), or at least about 11 days (such as about
11 to 16 days), more preferably at least about 12 days (such as
about 12 to 18 days or more), or more than 14 days (such as about
14 to 19 days). [1110] Aspect T-14: Derivative according to any of
aspects T-1 to T-13, that is a pegylated derivative. [1111] Aspect
T-15: Compound or construct, that comprises or essentially consists
of one or more derivatives according to any of aspects T-1 to T-14,
and optionally further comprises one or more other groups,
residues, moieties or binding units, optionally linked via one or
more linkers. [1112] Aspect T-16: Compound or construct according
to aspect T-15, in which said one or more other groups, residues,
moieties or binding units are amino acid sequences. [1113] Aspect
T-17: Compound or construct according to aspect T-16, in which said
one or more linkers, if present, are one or more amino acid
sequences. [1114] Aspect T-18: Nucleic acid encoding a compound or
construct according to aspect T-16 or T-17. [1115] Aspect T-19:
Composition, comprising at least one derivative to any of aspects
T-1 to T-14, compound or construct according to any of aspects T-15
to T-17, or nucleic acid or nucleotide sequence according to aspect
T-18. The invention will now be further illustrated by means of the
following non-limiting Examples and non-limiting Figures. The
sequences of the amino acid sequences of the invention and of the
polypeptides of the invention that are referred to in the Examples
are given in the sequence listing as well as in FIGS. 5 to 8.
LEGEND TO FIGURES
[1116] FIG. 1: Exemplary graph of the IC50 determination of Class 2
Nanobodies in AlphaScreen for blocking of the hIL-17A-hIL-17RA
interaction.
[1117] FIG. 2: IL-6 secretion by HT-1080 cells stimulated with
IL-17A. Representative dose-response curves of IL-6 secretion by
HT-1080 cells in the presence of 0.3 .mu.g/mL recombinant human
IL-17A and various concentrations of Nanobodies or reference
compound mAb02. Results are shown as mean IL-6 secretion and
STD.
[1118] FIG. 3: IL-6 secretion by HT-1080 cells stimulated with
IL-17F. Representative dose-response curves of IL-6 secretion by
HT-1080 cells in the presence of 4.5 .mu.g/mL recombinant human
IL-17F and various concentrations of Nanobodies or reference
compound mAb B-E52. Results are shown as mean IL-6 secretion and
STD.
[1119] FIG. 4: IL-6 secretion by HT-1080 cells stimulated with
IL-17A/F. Representative dose-response curves of IL-6 secretion by
HT-1080 cells in the presence of 1.5 .mu.g/mL recombinant human
IL-17A/F and various concentrations of Nanobodies or reference
compound mAb02. Results are shown as mean IL-6 secretion and
STD.
[1120] FIG. 5: Amino acid sequences of Nanobodies from Class 1,
Class 2, Class 3, and Class 4
[1121] FIG. 6: Amino acid sequences of some preferred, but
non-limiting examples of polypeptides of the invention.
[1122] FIG. 7: Amino acid sequences of some preferred, but
non-limiting examples of humanized and/or sequence-optimized amino
acid sequences of the invention.
[1123] FIG. 8: Amino acid sequences of some preferred, but
non-limiting examples of polypeptides of the invention that are
based on humanized and/or sequence-optimized amino acid sequences
of the invention.
[1124] FIG. 9: Amino acid sequences of some of the reagents and
reference materials used in the Examples.
[1125] FIG. 10: Sensorgram of an epitope binning experiment, where
IL17A was immobilized, 01A01 was bound and the binding of a second
test Nanobody (see table on the right) was evaluated.
[1126] FIG. 11: Sensorgram of an epitope binning experiment, where
IL17F was immobilized, 07B11 was bound and the binding of a second
test Nanobody (see table on the right) was evaluated.
[1127] FIG. 12: Serum KC levels following subcutaneous
administration of rhIL-17A (A) or rhIL-17F (B) in groups of 5
BALB/c mice previously administered intravenously with the
indicated doses of the IL17MS3086 Nanobody, the reference positive
controls mAb02 (A), mAb B-F60 (B), mAb03 (A,B) or negative Nanobody
(ALB11) or antibody (hIgG1) controls (A,B). Results are expressed
as mean.+-.SEM per group. Statistical analyses were performed with
One way ANOVA with Dunnet's post test and significant values are
indicated. As used throughout this specification, "Alb11" refers to
a nanobody that specifically binds to human serum albumin (HSA).
ISVs comprising an Alb11 sequence have an extended biological
half-life, i.e. a half life extension (HLE).
[1128] FIG. 13: Mean (with s.d. if n=3) serum concentration-time
profiles of IL17MS3086 following a single i.v. bolus dose at 2
mg/kg (n=2) and 6 mg/kg (n=3) or a single s.c. dose at 6 mg/kg
(n=3), respectively in the female cynomolgus monkey.
[1129] FIG. 14. Arthritis score of the study animals. 5-10 female
cynomolgus monkeys per group were subcutaneously sensitized twice
with bovine type II collagen in Freund's complete adjuvant and
treated weekly with either IL17MS3086 (2.8 mg/kg and 10 mg/kg),
mAb03 (10 mg/kg) or formulation buffer subcutaneously. An
additional group (2 animals) received Tocilizumab at 10 mg/kg
intravenously to serve as positive control. Arthritis of the joints
was scored weekly until day 56 and are depicted as mean.+-.SEM.
[1130] FIG. 15. Serum CRP levels in study animals. 5-10 female
cynomolgus monkeys per group were subcutaneously sensitized twice
with bovine type II collagen in Freund's complete adjuvant and
treated weekly with either IL17MS3086 (2.8 mg/kg and 10 mg/kg),
mAb03 (10 mg/kg) or formulation buffer subcutaneously. An
additional group (2 animals) received Tocilizumab at 10 mg/kg
intravenously to serve as positive control. Serum CRP levels were
measured weekly until day 56 and are reported as mg/dL. The results
are depicted as mean.+-.SEM.
[1131] FIG. 16. Radiological evaluation of the hands and feet of
study animals. 5-10 female cynomolgus monkeys per group were
subcutaneously sensitized twice with bovine type II collagen in
Freund's complete adjuvant and treated weekly with either
IL17MS3086 (2.8 mg/kg and 10 mg/kg), mAb03 (10 mg/kg) or
formulation buffer subcutaneously. An additional group (2 animals)
received Tocilizumab at 10 mg/kg intravenously to serve as positive
control. Joint space narrowing and atrophy (score A) (A) and bone
erosion or architectural joint destruction accompanied by bone
erosion (Score B) (B) was scored. The results are depicted as
mean.+-.SEM for each individual score.
[1132] FIG. 17. Histological evaluation for all study animals. 5-10
female cynomolgus monkeys per group were subcutaneously sensitized
twice with bovine type II collagen in Freund's complete adjuvant
and treated weekly with either IL17MS3086 (2.8 mg/kg and 10 mg/kg),
mAb03 (10 mg/kg) or formulation buffer subcutaneously. An
additional group (2 animals) received Tocilizumab at 10 mg/kg
intravenously to serve as positive control. Following necropsy on
day 57, slide specimens of the right carpal and PIP joints were
prepared by sectioning paraffin-embedded tissue and staining with
Hematoxylin-Eosin and safranin-O. The incidence in percent of
joints with higher grades for each parameter is depicted. Higher
grades was defined as scores of + and 2+.
[1133] FIG. 18. General condition score for study animals. 5-10
female cynomolgus monkeys per group were subcutaneously sensitized
twice with bovine type II collagen in Freund's complete adjuvant
and treated weekly with either IL17MS3086 (2.8 mg/kg and 10 mg/kg),
mAb03 (10 mg/kg) or formulation buffer subcutaneously. An
additional group (2 animals) received Tocilizumab at 10 mg/kg
intravenously to serve as positive control. The way the animals
moved and hung to the bars of their cages was evaluated and scored
weekly based on the criteria described in Table 40. The results are
the mean.+-.SEM for each group.
EXAMPLES
Example 1: Production and Purification of IL-17A and IL-17F
Immunogens
[1134] Human IL-17A was expressed by transfection of Hek293 cells
with plasmid DNA encoding the human secreted form of IL-17A
(GenBank Acc. number U32659 and coding sequence in appendix) with a
6-His C-terminal extension. Briefly, cells in suspension in
DMEM:F12 medium (Invitrogen) containing 4 ml/L
Insulin-Transferrin-Selenium-X supplement (Invitrogen) and 1%
Foetal Bovine Serum (Invitrogen) were incubated with a mixture of
plasmid DNA and Poly-Ethylenelmine (PolySciences). After 90 min,
transfected cells were diluted 1:1 in Freestyle medium (Invitrogen)
and placed on an orbital shaker at 37.degree. C. in a 5% CO2
incubator under agitation at 160 rpm. The supernatant was harvested
after 6 days and sterile filtered through a 0.22 .mu.m membrane
cartridge (Millipore). The recombinant protein was purified on a
Poros 20 MC metal chelate affinity chromatography column (Applied
Biosystems) charged with Ni ions, followed by size exclusion
chromatography in PBS on a HiLoad Superdex 75 prepgrade 16/60
column from GE Healthcare.
[1135] Human IL-17F (GenBank Acc. number AF384857 and coding
sequence in appendix) was expressed as a 6-His C-terminal tagged
protein and purified under the same conditions as described for
human IL-17A.
Example 2: Immunization
[1136] Three llamas (346, 347 and 374) were immunized with
recombinant human IL-17A with the aim to induce a heavy-chain
antibody dependent humoral immune response. On day 0, 100 .mu.g of
antigen emulsified in Complete Freund's Adjuvant was administered
via intramuscular injection in the neck. Three additional
injections of respectively 50, 25 arid 25 .mu.g of antigen
emulsified in Incomplete Freund's Adjuvant were administered every
2 weeks. Peripheral blood lymphocytes (PBLs) and the lymph node
(LN) biopsy were collected 4 and 8 days after the last boost.
[1137] Similarly, three llamas (292, 293 and 399) were immunized
with recombinant human IL-17F, and two llamas (190b and 344) were
immunized with recombinant human IL-17A/F heterodimer which was
produced in E. coli and purchased from R&D Systems (Cat No
5194-IL/CF).
[1138] The humoral immune response was monitored during the
immunization process by comparing the antigen specific serum titers
of a sample collected prior to initiation of immunization (day 0)
and a serum sample typically collected after three antigen
administrations (day 35). Briefly, 96-well Maxisorp plates (Nunc,
Wiesbaden, Germany) were coated with human IL-17A, IL-17F or
IL-17A/F. After blocking and adding diluted serum samples, the
presence of anti-IL-17 Nanobodies was demonstrated by using HRP
(horseradish peroxidase) conjugated goat anti-llama immunoglobulin
(Bethyl Laboratories Inc., Montgomery, Tex. USA) and a subsequent
enzymatic reaction in the presence of the substrate TMB
(3,3',5,5'-tetramentylbenzidine) (Pierce, Rockford, Ill., USA).
Example 3: Library Construction
[1139] Peripheral blood mononuclear cells were prepared from the
blood samples using Ficoll-Hypaque according to the manufacturer's
instructions. Total RNA extracted from these cells and from lymph
nodes was used as starting material for RT-PCR to amplify Nanobody
encoding gene fragments. These fragments were cloned into phagemid
vector pAX50. Phage was prepared according to standard protocols
(Phage Display of Peptides and Proteins: A Laboratory Manual,
Academic Press; 1st edition (Oct. 28, 1996) Brian K. Kay, Jill
Winter, John McCafferty) and stored after filter sterilization at
4.degree. C. until further use. In total, 8 phage libraries were
constructed (346, 347, 374, 292, 293, 399, 190b and 344), with
library sizes between 4.5.times.10.sup.7 and 5.times.10.sup.8, and
a percentage of insert ranging from 95 to 100%.
Example 4: Selections in Search of Anti-IL-17A, IL-17F and IL-17A/F
Nanobodies
[1140] To identify Nanobodies recognizing human and Cynomolgus
monkey IL-17A and/or IL-17F and/or IL-17A/F, the phage libraries
were incubated with soluble biotinylated IL-17 Cynomolgus monkey
IL-17A and IL-17F were produced in Hek293 cells and purified as
described in Example 1. Both proteins were expressed from plasmids
bearing the coding sequences mentioned in the appendix with an
additional 3' end in-frame 6-His-encoding nucleotide sequence.
[1141] Cynomolgus monkey IL-17A, Cynomolgus monkey IL-17F, human
IL-17A, human IL-17F and human IL-17A/F were biotinylated using
Sulfo-NHS-LC-Biotin (Pierce). Complexes of biotinylated IL-17 and
phage were captured from solution on streptavidin coated magnetic
beads. After extensive washing with PBS/0.05% Tween20, bound phage
were eluted by addition of trypsin (1 mg/ml). The phage libraries
292, 293 and 399 were incubated with soluble biotinylated human and
Cynomolgus IL-17A (100, 10 and 1 nM), phage libraries 346, 347 and
374 with soluble biotinylated human and Cynomolgus IL-17F (100, 10
and 1 nM) and phage libraries 190b and 344 with soluble
biotinylated human IL-17A/F, Cynomolgus IL-17A and Cynomolgus
IL-17F (100 and 1 nM). Outputs of these round 1 selections were
analyzed for enrichment factor (number of phage present in eluate
relative to controls) and individual clones from these first round
outputs were picked.
[1142] To identify human IL-17F Nanobodies that bound with high
affinity, phage libraries 292, 293 and 399 were incubated with low
concentrations of soluble biotinylated hIL-17A/F (1000, 100, 10, 1
and 0.1 pM). Also from these outputs individual clones were picked.
To specifically identify Nanobodies recognizing human IL-17A and
IL-17F and IL-17A/F, two strategies were followed. In the first
strategy, outputs of phage libraries 346, 347 and 374 selected on
human and Cynomolgus IL-17A (100, 10 and 1 nM), were incubated with
biotinylated hIL-17F (10-1 nM) and outputs of phage libraries 292,
293 and 399 selected on human and Cynomolgus IL-17F (100, 10 and 1
nM), were incubated with biotinylated hIL-17A (10-1 nM). In the
second strategy, phage libraries 346, 347 and 374 were selected on
biotinylated hIL-17F (10-1 nM) and phage libraries 292, 293 and 399
on biotinylated hIL-17A (10-1 nM) in two consecutive selections
rounds using the same conditions. From these round 2 selections
individual clones were picked.
[1143] All individual clones were grown in 96 deep well plates (1
ml volume). Nanobody expression was induced by adding IPTG to a
final concentration of 1 mM. Periplasmic extracts were prepared by
freezing the cell pellets and dissolving them in 100 .mu.l PBS.
Cell debris was removed by centrifugation. As a control, selected
periplasmic extracts were screened in an ELISA for binding to
hIL-17A, hIL-17F or hIL-17A/F. Briefly, neutravidin (1 .mu.g/ml)
was immobilized on polysorp microtiter plates (Nunc). Free binding
sites were blocked using 4% Marvel in PBS. Biotinylated hIL-17 (10
nM) was incubated in 0.1% Marvel/PBS/0.05% Tween20 with 1/10
diluted periplasmic extracts, containing Nanobody of the different
clones, for 1 hour and then captured via the immobilized
neutravidin. After incubation and washing, Nanobody binding was
detected using anti-c-Myc, followed by HRP-conjugated anti-mouse
antibody and TMB substrate.
Example 5: Screening for Blocking Nanobodies in Periplasmic
Extracts by AlphaScreen Assays Using Human IL-17A, IL-17F and
IL-17A/F
[1144] In order to determine the blocking capacity of the
Nanobodies, periplasmic extracts were screened in protein-based
competition assays using the AlphaScreen technology (PerkinElmer,
Waltham, Mass. USA). AlphaScreen assays were set-up for the
different combinations of IL-17A, IL-17F and IL-17A/F ligands with
either IL-17RA or IL-17RC.
[1145] hIL-17A and hIL-17F produced in Hek293 cells and hIL-17A/F
produced in E. coli were biotinylated using Sulfo-NHS-LC-Biotin
(Pierce). Human IL-17RA-Fc (R&D Systems, and hIL-17RC-Fc
chimera (produced in Hek293 cells as described in Example 1) were
captured on anti-human Fc Nanobody coated Acceptor beads which were
prepared according to the manufacturer's instructions
(PerkinElmer). To evaluate the blocking capacity of anti-IL-17
Nanobodies, dilutions of the periplasmic extracts were
pre-incubated with biotinylated hIL-17. To this mixture, IL-17R-Fc,
Acceptor beads and the streptavidin-coupled Donor beads were added
and further incubated for 1 hour at room temperature. Fluorescence
was measured using the EnVision Multilabel Plate Reader
(PerkinElmer) using an excitation wavelength of 680 nm and an
emission wavelength of 520 nm. Decrease in the AlphaScreen signal
indicates that the binding of biotinylated hIL-17 to the IL-17
receptor is blocked by the Nanobody present in the periplasmic
extract.
[1146] Following this screening process, several Classes of
Nanobodies were identified: 1) Nanobodies inhibiting the IL-17A but
not the IL-17A/F interaction with both receptors, 2) Nanobodies
inhibiting the IL-17A and IL-17A/F interaction with both receptors,
3) Nanobodies inhibiting the IL-17F interaction with both
receptors, some of them also partially blocking IL-17A/F, and 4)
Nanobodies inhibiting the IL-17A and IL-17F interactions with both
receptors (called IL-17A and IL-17F cross-reactive Nanobodies)
(Table 1).
TABLE-US-00005 TABLE 1 Nanobody classes identified during the
screening procedure using AlphaScreen assays. AlphaScreen assay
Nanobody IL-17A- IL-17A- IL-17F- IL-17F- IL-17A/F- IL-17A/F- Class
Properties IL-17RA IL-17RC IL-17RA IL-17RC IL-17RA IL-17RC Class 1
Anti-IL-17A + + - - Class 2 Anti-IL-17A and IL- + + + + 17A/F Class
3 Anti-IL-17F type 1 + + - - Anti-IL-17F type 2 + + + - Anti-IL-17F
type 3 + + - + Class 4 Cross-reactive: + + + + Anti-IL-17A, IL-17F
and IL-17A/F (+ = blocking; - = non-blocking; blank = not
tested)
Example 6: Surface Plasmon Resonance Analysis of Periplasmic
Extracts on IL-17A, IL-17F and IL-17A/F
[1147] Off-rates of the periplasmic extracts containing anti-IL-17
Nanobodies were measured by Surface Plasmon Resonance (SPR) using a
Biacore T100 instrument. Human IL-17A, IL-17F or IL-17A/F was
covalently bound to a CM sensor chip surface via amine coupling
using EDC/NHS for activation and HCl for deactivation. Periplasmic
extracts containing IL-17 neutralizing Nanobodies were injected for
2 minutes at a flow rate of 45 .mu.l/min to allow binding to
chip-bound antigen. Next, binding buffer without periplasmic
extracts was sent over the chip at the same flow rate to allow
spontaneous dissociation of bound Nanobody. From the sensorgrams
obtained for the different periplasmic extracts k.sub.off-values
(k.sub.d) were calculated. Based on this Biacore analysis, a set of
IL-17 Nanobodies with the best off-rates was selected and
sequenced. Sequencing analysis revealed 63 different families of
anti-IL-17 neutralizing Nanobodies (Table 2). FIG. 5 depicts
selected sequences of Class 1 to Class 4 Nanobodies.
TABLE-US-00006 TABLE 2 Number of Nanobody families per anti-IL-17
Nanobody type Nanobody Number of Class Description families Class 1
Anti-IL-17A 14 Class 2 Anti-IL-17A and IL-17A/F 22 Class 3
Anti-IL-17F 18 Class 4 Cross-reactive: Anti-IL-17A, 9 IL-17F and
IL-17A/F
[1148] The periplasmic extracts containing Nanobodies from Class 1,
Class 2, Class 3 and Class 4 were also screened for
cross-reactivity towards Cynomolgus monkey IL-17, by determining
off-rates on immobilized Cynomolgus monkey IL-17A and IL-17F. All
tested extracts containing Nanobodies from Class 1, Class 2 and
Class 4 also showed binding to Cynomolgus monkey IL-17A and the
ones from Class 3 and 4 showed binding to Cynomolgus monkey
IL-17F.
Example 7: Expression and Purification of Anti-IL-17A, IL-17F and
IL-17A/F Nanobodies from Various Classes
[1149] Five of the Class 1 Nanobodies, 12 of the Class 2
Nanobodies, 10 of the Class 3 Nanobodies and 9 of the Class 4
cross-reactive Nanobodies were selected for expression and
purification, based on their blocking capacity in AlphaScreen
assays and off-rate values. Sequences are shown in FIG. 5.
[1150] Nanobodies were expressed in E. coli TG1 cells as c-myc,
His6-tagged proteins in a culture volume of 500 mL. Expression was
induced by addition of 1 mM IPTG and allowed to continue for 3 h at
37.degree. C. After spinning the cell cultures, periplasmic
extracts were prepared by freeze-thawing the pellets and
resuspension in dPBS. These extracts were used as starting material
for immobilized metal affinity chromatography (IMAC) using Histrap
FF crude columns (GE Healthcare). Nanobodies were eluted from the
column with 250 mM imidazole and subsequently desalted towards
dPBS. For the cell based assays described below, endotoxins were
removed by gel filtration in the presence of 50 mM
Octyl.beta.-D-glucopyranoside (OGP, Sigma). Endotoxin levels were
determined using a standard LAL-assay.
Example 8: Blocking Capacity of Purified Nanobodies in AlphaScreen
Assays Using Human IL-17A, IL-17F and IL-17A/F
[1151] Blocking capacity of 36 purified Nanobodies belonging to 4
different Classes, as described in Example 7, was determined in
AlphaScreen protein-based competition assays for all possible
interactions between the human ligands IL-17A, IL-17F and IL-17-A/F
and human receptors IL-17RA and IL-17RC. A dilution series of each
Nanobody starting from 250 nM down to 1 pM was pre-incubated with
biotinylated hIL-17 ligand during 15 minutes at room temperature
(RT). The concentration of the ligand used in the different assay
set-ups is listed in Table 3. To this mixture, the IL-17RA or
IL-17RC Fc-fusions, Acceptor beads and the streptavidin Donor beads
were added and further incubated for 1 hour at RT. A dose-dependent
decrease of the fluorescence intensity at 520 nm was observed for
Nanobodies that blocked a specific ligand-receptor interaction, and
the IC50 value could be determined for each blocking Nanobody
(Table 4). An exemplary graph illustrating the blocking capacity of
a selection of anti-IL-17 Nanobodies for the IL-17A - IL-17RA
interaction is shown in FIG. 1. An anti-IL-17A and IL-17A/F
specific Fab fragment Fab01 was included as positive control.
TABLE-US-00007 TABLE 3 Overview of the concentrations of IL-17
ligand and IL-17 receptors used in the AlphaScreen assays to
determine IC50 values of the Nanobodies Assay set-up Concentration
Concentration Ligand - receptor combination ligand (nM) receptor
(nM) IL-17A - IL-17RA 0.26 0.26 IL-17A - IL-17RC 0.64 0.64 IL-17F -
IL-17RA 1.60 0.64 IL-17F - IL-17RC 0.10 0.26 IL-17A/F - IL-17RA
0.64 1.60 IL-17A/F - IL-17RC 0.10 0.26
TABLE-US-00008 TABLE 4 IC50 values for the various blocking
anti-IL-17 Nanobodies as determined in the different AlphaScreen
assays. IL-17A- IL-17A- IL-17F- IL-17F- IL-17A/F- IL-17A/F- Nano-
IL-17RA IL-17RC IL-17RA IL-17RC IL-17RA IL-17RC Nano- body (IC50 in
(IC50 in (IC50 in (IC50 in (IC50 in (IC50 in body Class pM) pM) pM)
pM) pM) pM) 01D02 Class 1 130 363 nb nb 71660 94650 01G03 Class 1
325 1147 nb nb nb nb 02E03 Class 1 256 778 nb nb nb >250000
03B08 Class 1 80 384 nb nb nb nb 03E05 Class 1 58 380 nb nb
>250000 nb 01D06 Class 2 618 1521 nb nb 401 198 02A08 Class 2
126 419 >250000 >250000 170 87 02A10 Class 2 115 381 nb nb
199 248 03C07 Class 2 84 371 nb nb 366 565 04A02 Class 2 399 837 nb
nb 1960 3173 04B09 Class 2 67 252 nb nb 121 169 04B10 Class 2 68
366 nb nb 95 52 04F09 Class 2 99 468 nb nb 3978 3149 04G01 Class 2
14 217 nb nb 67 39 09D10 Class 2 211 1122 nb 69400 9020 8655 09G10
Class 2 46 323 nb nb 101 120 11A06 Class 2 81 461 nb >250000 140
39 06E11 Class 3 nb nb 799 71 nb 952 07B09 Class 3 nb nb 614 19
partial 89 07B11 Class 3 nb nb 1104 15 partial 58 08A08 Class 3 nb
nb 3843 1297 nb 19660 08B07 Class 3 nb nb 761 108 >250000 nb
08H01 Class 3 nb nb 323 33 partial 259 12A09 Class 3 nb nb 1842 612
>250000 33210 16A04 Class 3 >77870 >131000 1093 52 90360
389 24B08 Class 3 nb nb 491 42 138 partial 24G10 Class 3 nb nb 476
23 partial 47 01A01 Class 4 51 211 16180 13500 102 46 10A04 Class 4
78140 >250000 746 220 37740 15640 11C08 Class 4 2119 4798 2255
488 3252 1162 13B03 Class 4 56 202 2114 848 79 31 13B05 Class 4 118
249 719 603 464 944 13E02 Class 4 67 187 395 214 71 117 13E05 Class
4 159 1091 1100 286 862 315 17C01 Class 4 66 169 296 168 264 801
18B05 Class 4 173 408 36640 13260 231 87 Fab01 N/A 787 1115 nb nb
2736 5842 nb: non-blocking; N/A: not applicable
Example 9: Blocking Activity of Purified Nanobodies in Cell-Based
Assays Using IL-17A, IL-17F and IL-17A/F
[1152] The blocking capacity of the purified Nanobodies was also
assessed using the HT-1080 cell-based assay, in which
dose-dependent inhibition of hIL-17A, hIL-17F or hIL-17A/F induced
IL-6 secretion by the HT-1080 cells is investigated. The
experimental protocol was as follows: Human HT-1080 fibrosarcoma
cells (ATCC reference CCL-121) were grown in Dulbecco's Minimum
Essential Medium (DMEM) supplemented with 10% Fetal Bovine Serum
(FBS) and 1% penicillin-streptomycin solution (P-S), referred as
Complete Medium at 37.degree. C. with 5% CO.sub.2. For cell
production and weekly passage, cells were seeded at
2.times.10.sup.4 cells/cm.sup.2 into T75 culture flasks.
[1153] For in vitro stimulation assays, 3.times.10.sup.4 HT-1080
cells in 100 .mu.L DMEM plus 2.5% FBS and 0.25% P-S were
distributed to flat-bottom 96-well plates and incubated overnight.
On the day of the stimulation, 80 .mu.L of the medium was replaced.
Seven serial 1:3 dilutions of Nanobodies or anti-IL-17A mAb02
reference compound were performed in PBS from a starting
concentration of 100 .mu.g/mL, and 10 .mu.L of each Nanobody or
mAb02 diluted solution were added per well of HT-1080 cells in
duplicate for Nanobodies and quadruplicate for mAb02. Final
concentrations of Nanobodies or reference compound mAb02 ranged
between 10 .mu.g/mL and 0.0045 .mu.g/mL. Seven serial 1:3 dilutions
of anti-IL-17F mAb reference compound mAb B-E52 (Diaclone,
Besancon, France) were performed in PBS from a starting
concentration of 500 .mu.g/mL, and 10 .mu.L of each mAb B-E52
diluted solution were added per well of HT-1080 cells. Final
concentrations of reference compound mAb B-E52 ranged between 100
.mu.g/mL and 0.045 .mu.g/mL. Control wells for stimulus alone or
vehicle alone received 10 .mu.L PBS, in quadruplicate.
[1154] Plates were incubated for 30 min. at 37.degree. C. with 5%
CO.sub.2 before adding specific stimuli. For stimulation with human
IL-17A, 10 .mu.L of a solution of recombinant human IL-17A at 3
.mu.g/mL in PBS (final concentration of IL-17A: 0.3 .mu.g/mL) were
added per each corresponding well. For stimulation with human
IL-17F, 10 .mu.L of a solution of recombinant human IL-17F at 45
.mu.g/mL in PBS (final concentration of IL-17F: 4.5 .mu.g/mL) were
added per each corresponding well. For stimulation with human
IL-17A/F, 10 .mu.L of a solution of recombinant human IL-17A/F at
15 .mu.g/mL in PBS (final concentration of IL-17A/F: 1.5 .mu.g/mL)
were added per each corresponding well. Negative control wells for
vehicle alone receive 10 .mu.L PBS.
[1155] Plates were incubated for 24 hours at 37.degree. C. with 5%
CO2. Supernatants were harvested, transferred into 96-well plates,
and stored at -80.degree. C. Levels of human IL-6 in 1:3 or 1:4
diluted supernatants (diluent is PBS plus 1% Bovine Serum Albumin)
were determined using a commercial IL-6 ELISA assay (Human Duoset
IL-6 ELISA, R&D Systems, Abingdon, UK) following the
manufacturer's instructions. Optical density reading (OD) at 450 nM
was performed using a Fluostar OPTIMA reader (BMG Labtech,
Offenburg, Germany) and IL-6 concentration for each sample
extrapolated from a four-parameter logistic curve fit calculated
using OD readings from the internal IL-6 standards.
[1156] For data analyses, the molar mass of Nanobody compounds was
estimated at 15 kDa for each Nanobody. The molecular mass of
reference mAbs was estimated at 150 kDa. IC50 and E max were
calculated for each experiment from paired data compound
concentration/IL-6 concentration using the XLFit software (ID
Business Solutions, Guilford, UK) and a four-parameter log fit as
given by the following formula: y=A+((B-A)/(1+((C/x){circumflex
over ( )}D))) where A is the Minimum y, B the Maximum y, C is Log
IC50, and D the Slope Factor. Mean IC50, E max and respective STD
for each compound across multiple experiments was calculated using
XLFit.
[1157] As shown in FIG. 2 and Table 5, the Class 1, Class 2 and
Class 4 Nanobodies as well as the reference compound mAb02
inhibited IL-6 secretion in HT-1080 cells induced by IL-17A in a
concentration-dependent manner.
[1158] As shown in FIG. 3 and Table 6, the Class 3 and Class 4
Nanobodies (with the exception of 17C01 and 18B05), as well as the
reference compound B-E52 inhibited IL-6 secretion in HT-1080 cells
induced by IL-17F in a concentration-dependent manner.
[1159] As shown in FIG. 4 and Table 7, the Class 2, Class 3 (with
the exception of 08A08 and 08B07) and Class 4 Nanobodies as well as
the reference compound mAb02 inhibited IL-6 secretion in HT-1080
cells induced by IL-17A/F in a concentration-dependent manner.
TABLE-US-00009 TABLE 5 Inhibition of IL-17A-induced IL-6 production
in human fibrosarcoma HT-1080 cells by anti-IL-17 monovalent
Nanobodies and reference compounds. Nanobody Stimulus IL-17A
Nanobody Class IC50 (nM) Emax (%) N 02E03 Class 1 16.4 .+-. 9 99.3
.+-. 5 3 03E05 Class 1 4.0 .+-. 3 100.0 .+-. 6 2 01D02 Class 1 4.8
.+-. 3 101.0 .+-. 6 2 01G03 Class 1 68.3 .+-. 33 85.7 .+-. 5 3
03B08 Class 1 3.6 .+-. 3 98.5 .+-. 5 2 02A08 Class 2 8.8 .+-. 7
102.7 .+-. 10 3 03C07 Class 2 4.2 .+-. 4 101.0 .+-. 6 3 04B09 Class
2 3.2 .+-. 3 105.7 .+-. 6 3 04G01 Class 2 5.4 .+-. 7 112.7 .+-. 9 3
09G10 Class 2 4.0 .+-. 3 99.0 .+-. 0 2 11A06 Class 2 4.0 .+-. 3
98.5 .+-. 2 2 01D06 Class 2 42.8 .+-. 38 98.3 .+-. 5 3 02A10 Class
2 4.3 .+-. 4 103.7 .+-. 9 3 04A02 Class 2 12.6 .+-. 10 102 .+-. 7 3
04B10 Class 2 5.1 .+-. 4 99.7 .+-. 12 3 04F09 Class 2 9.7 .+-. 10
111.3 .+-. 13 3 09D10 Class 2 8.5 .+-. 5 93.5 .+-. 1 2 06E11 Class
3 NI NI 2 07B09 Class 3 NI NI 2 07B11 Class 3 NI NI 2 08H01 Class 3
NI NI 2 16A04 Class 3 NI NI 2 24B08 Class 3 NI NI 2 24G10 Class 3
NI NI 2 08A08 Class 3 NI NI 2 08B07 Class 3 NI NI 2 12A09 Class 3
NI NI 2 01A01 Class 4 2.7 .+-. 2 104.0 .+-. 10 3 11C08 Class 4
130.1 .+-. 64 73.0 .+-. 1 2 13B03 Class 4 2.9 .+-. 1 101.0 .+-. 0 2
13B05 Class 4 14.0 .+-. 3 104.0 .+-. 6 4 13E02 Class 4 3.5 .+-. 2
102.5 .+-. 2 2 13E05 Class 4 12.3 .+-. 1 101.0 .+-. 7 2 17C01 Class
4 15.1 .+-. 5 104.8 .+-. 4 4 10A04 Class 4 65.4 .+-. 17 31.5 .+-. 6
2 18B05 Class 4 20.6 .+-. 21 103.7 .+-. 3 3 mAb02 N/A 3.9 .+-. 4
99.1 .+-. 5 20 mAb B-E52 N/A NI NI 2 Results expressed as mean .+-.
SD of N experiments. NI: no inhibition observed; N/A: not
applicable
TABLE-US-00010 TABLE 6 Inhibition of IL-17F-induced IL-6 production
in human fibrosarcoma HT-1080 cells by anti-IL-17 monovalent
Nanobodies and reference compounds. Nanobody Stimulus IL-17F
Nanobody Class IC50 (nM) Emax (%) N 02E03 Class 1 NI NI 3 03E05
Class 1 NI NI 2 01D02 Class 1 NI NI 2 01G03 Class 1 NI NI 3 03B08
Class 1 NI NI 2 02A08 Class 2 NI NI 2 03C07 Class 2 NI NI 2 04B09
Class 2 NI NI 2 04G01 Class 2 NI NI 2 09G10 Class 2 NI NI 2 11A06
Class 2 NI NI 2 01D06 Class 2 NI NI 2 02A10 Class 2 NI NI 2 04A02
Class 2 NI NI 2 04B10 Class 2 NI NI 2 04F09 Class 2 NI NI 2 09D10
Class 2 NI NI 2 06E11 Class 3 88.0 .+-. 20 70.5 .+-. 6 2 07B09
Class 3 75.1 .+-. 15 71.8 .+-. 12 4 07B11 Class 3 57.5 .+-. 23 67.0
.+-. 14 2 08H01 Class 3 85.5 .+-. 16 71.5 .+-. 1 2 16A04 Class 3
112.4 .+-. 22 100.0 .+-. 6 4 24B08 Class 3 141.4 .+-. 43 84.3 .+-.
9 4 24G10 Class 3 90.6 .+-. 17 78.8 .+-. 7 4 08A08 Class 3 206.0
.+-. 105 62.0 .+-. 8 2 08B07 Class 3 174.5 .+-. 23 77.0 .+-. 14 2
12A09 Class 3 105.2 .+-. 28 91.0 .+-. 10 2 01A01 Class 4 206.2 .+-.
87 47.2 .+-. 12 3 11C08 Class 4 222.6 .+-. 86 84.5 .+-. 15 2 13B03
Class 4 149.2 .+-. 38 85.5 .+-. 11 2 13B05 Class 4 249.0 .+-. 137
43.0 .+-. 8 4 13E02 Class 4 103.6 .+-. 15 86.5 .+-. 11 2 13E05
Class 4 115.0 .+-. 9 123.5 .+-. 22 2 17C01 Class 4 NI NI 4 10A04
Class 4 111.9 .+-. 14 102.0 .+-. 10 2 18B05 Class 4 NI NI 3 mAb02
N/A NI NI 2 mAb B-E52 N/A 62.4 .+-. 27 84.0 .+-. 11 20 Results
expressed as mean .+-. SD of N experiments. NI: no inhibition
observed; N/A: not applicable
TABLE-US-00011 TABLE 7 Inhibition of IL-17A/F-induced IL-6
production in human fibrosarcoma HT-1080 by anti-IL-17 monovalent
Nanobodies and reference compounds. Nanobody Stimulus IL-17A/F
Nanobody Class IC50 (nM) Emax (%) N 02E03 Class 1 NI NI 3 03E05
Class 1 NI NI 2 01D02 Class 1 NI NI 2 01G03 Class 1 NI NI 3 03B08
Class 1 NI NI 2 02A08 Class 2 26.2 .+-. 16 109.0 .+-. 1 2 03C07
Class 2 27.8 .+-. 17 102.0 .+-. 3 2 04B09 Class 2 22.7 .+-. 10
102.0 .+-. 17 2 04G01 Class 2 34.7 .+-. 0.5 104.5 .+-. 2 2 09G10
Class 2 22.2 .+-. 0.1 107.5 .+-. 25 2 11A06 Class 2 28.1 .+-. 8
106.5 .+-. 9 2 01D06 Class 2 51.1 .+-. 0.2 79.5 .+-. 23 2 02A10
Class 2 29.2 .+-. 16 98.5 .+-. 9 2 04A02 Class 2 70.4 .+-. 4 67.6
.+-. 23 2 04B10 Class 2 59.2 .+-. 13 97.0 .+-. 23 2 04F09 Class 2
45.9 .+-. 37 68.5 .+-. 6 2 09D10 Class 2 124.4 .+-. 131 55.0 .+-. 7
2 06E11 Class 3 7.2 .+-. 5 57.5 .+-. 4 4 07B09 Class 3 12.4 .+-. 9
70.3 .+-. 6 4 07B11 Class 3 15.1 .+-. 13 71.0 .+-. 1 2 08H01 Class
3 15.9 .+-. 14 62.5 .+-. 4 2 16A04 Class 3 48.2 .+-. 32 95.0 .+-.
10 4 24B08 Class 3 18.1 .+-. 11 50.5 .+-. 18 4 24G10 Class 3 28.9
.+-. 14 72.8 .+-. 14 4 08A08 Class 3 NI NI 2 08B07 Class 3 NI NI 2
12A09 Class 3 100.5 .+-. 108 41.5 .+-. 4 2 01A01 Class 4 27.8 .+-.
17 102.0 .+-. 3 2 11C08 Class 4 91.2 .+-. 4 89.5 .+-. 13 2 13B03
Class 4 26.8 .+-. 3 112.5 .+-. 13 2 13B05 Class 4 35.5 .+-. 15
108.5 .+-. 7 4 13E02 Class 4 21.7 .+-. 4 108.5 .+-. 11 2 13E05
Class 4 26.0 .+-. 9 159.5 .+-. 35 2 17C01 Class 4 41.8 .+-. 25
107.3 .+-. 12 2 10A04 Class 4 122.1 .+-. 19 79.5 .+-. 18 2 18B05
Class 4 37.1 .+-. 4 118.0 .+-. 1 3 mAb02 N/A 18.4 .+-. 11 91.3 .+-.
12 17 Results expressed as mean .+-. SD of N experiments. NI: no
inhibition observed; ND: not done; N/A: not applicable
Example 10: SPR Analysis of Purified Nanobodies on IL-17A, IL-17F
and IL-17A/F
[1160] Off-rates of the anti-IL-17 Nanobodies showing the best
potencies in AlphaScreen assays and in the cellular assays were
measured by SPR using a Biacore T100 instrument as described in
Example 6. From the sensorgrams obtained for the different
Nanobodies k.sub.w-values were calculated and are indicated in
Table 8.
TABLE-US-00012 TABLE 8 Off-rates for human IL-17 binding of the
anti- IL-17 Nanobodies as determined in Biacore. koff for koff for
koff for Nanobody hIL-17A hIL-17F hIL-17A/F Class Nanobody (s-1)
(s-1) (s-1) Class 1 01D02 4.4E-04* NB* NB* Class 1 01G03 4.5E-04*
NB* NB* Class 1 02E03 9.0E-04* NB* NB* Class 1 03B08 1.0E-04* NB*
NB* Class 1 03E05 1.0E-04* NB* NB* Class 2 01D06 9.7E-04* NB*
1.3E-03* Class 2 02A08 4.2E-04 NB* 1.5E-04 Class 2 02A10 2.2E-04
NB* 2.8E-04 Class 2 03C07 2.0E-04 NB* 7.6E-04 Class 2 04A02
1.3E-03* NB* 1.1E-02* Class 2 04B09 2.7E-04 NB* 3.5E-04 Class 2
04B10 4.0E-04 NB* 5.0E-04 Class 2 04F09 6.3E-04 NB* 8.1E-03 Class 2
04G01 1.8E-04 NB* 2.3E-04 Class 2 09D10 1.5E-04* NB* 1.7E-03* Class
2 09G10 1.2E-04 NB* 1.3E-04 Class 2 11A06 1.6E-04 NB* 3.8E-05 Class
3 06E11 NB* 3.10E-04 4.4E-03 Class 3 07B09 NB* 1E-03-1E-04
1E-03-1E-04 Class 3 07B11 NB* 1.50E-04 4.7E-04 Class 3 08A08 NB*
4.8E-02 7.9E-03 Class 3 08B07 NB* 1.9E-03 2.0E-01 Class 3 08H01 NB*
8.8E-04 1.1E-03 Class 3 12A09 NB* 1.0E-02-1.0E-03 1.7E-02 Class 3
16A04 NB* 5.30E-04 3.0E-03 Class 3 24B08 NB* <1.0E-05 <1E-04
Class 3 24G10 NB* 1.6E-04 <1E-04 Class 4 01A01 8.5E-05 2.6E-02
2.7E-04 Class 4 10A04 .sup. <2E-04* 4.8E-03 1.5E-02 Class 4
11C08 7.9E-03 1.3E-02 6.3E-03 Class 4 13B03 6.3E-05 5.8E-03 3.6E-05
Class 4 13B05 3.0E-04 6.3E-02 6.8E-04 Class 4 13E02 1.3E-04 3.6E-03
7.1E-05 Class 4 13E05 1.6E-03 1.3E-02 1.9E-03 Class 4 17C01 2.9E-04
5.6E-02 7.5E-04 Class 4 18B05 2.2E-04 1.4E-01 1.2E-04 NB = no
binding (off-rates marked with * are measured on periplasmic
extract, the others are measured on purified protein)
Example 11: Species Cross-Reactivity of Anti-IL-17 Nanobodies
[1161] Binding of a selected panel of anti-IL-17 Nanobodies to
IL-17 of other species was assessed using a binding ELISA. 96-well
Maxisorp plates (Nunc, Wiesbaden, Germany) were coated with IL-17A
or IL-17F from different species at 1 .mu.g/ml in PBS. After
blocking with PBS/1% casein, anti-IL-17 Nanobodies were added at a
concentration of 250 nM in PBS/0.1% casein/0.05% Tween20. HRP
(horseradish peroxidase) conjugated anti-myc (Serotec, MCA 2200P)
was used for detection using esTMB as substrate. IL-17A from
marmoset, mouse or guinea pig origin, and IL-17F from marmoset,
mouse and rat origin were expressed under the same conditions as
described in Example 1 for human IL-17A and F using Hek293 cells.
Rat IL-17A produced in E. coli was purchased from eBioscience (San
Diego, Calif., USA; Cat Nr 14-8170). Class 2 and Class 4 Nanobodies
all cross-reacted with marmoset IL-17A, but not with mouse, rat or
guinea pig IL-17A (Table 9). Most Nanobodies from Class 3 and Class
4 cross-reacted with marmoset IL-17F, albeit to a lesser extent.
These Nanobodies did not cross-react with mouse or rat IL-17F
(Table 10).
TABLE-US-00013 TABLE 9 OD-values for binding of the anti-IL-17
Nanobodies to IL-17A from human, marmoset, mouse, rat and guinea
pig origin in ELISA Marmos Guinea Nanobody Human et IL- Mouse Rat
pig IL- Class Nanobody IL-17A 17A IL-17A IL-17A 17A Class 2 02A08
1.945 1.953 -0.001 0.002 0.002 Class 2 03C07 1.704 1.699 -0.004
0.003 0.004 Class 2 04B09 1.817 1.842 0.000 0.001 0.006 Class 2
04G01 1.897 1.932 -0.001 0.004 0.008 Class 2 09G10 1.635 1.582
-0.001 0.003 0.006 Class 2 11A06 1.691 1.707 0.004 0.008 0.007
Class 3 06E11 0.073 -0.003 -0.001 0.006 0.006 Class 3 07B09 0.005
0.005 -0.001 0.003 0.009 Class 3 07B11 0.030 0.186 -0.003 0.005
0.007 Class 3 08H01 0.022 0.431 -0.002 0.006 0.007 Class 3 16A04
0.043 0.019 -0.002 0.003 0.008 Class 3 24B08 0.103 0.129 -0.002
0.004 0.012 Class 3 24G10 0.009 0.122 -0.001 0.004 0.008 Class 4
01A01 1.830 1.839 -0.003 0.004 0.008 Class 4 11C08 1.710 0.671
-0.005 0.002 0.002 Class 4 13B03 1.948 1.936 -0.001 0.004 0.004
Class 4 13B05 1.824 1.911 -0.006 0.003 0.001 Class 4 13E02 1.787
1.846 -0.001 0.003 0.006 Class 4 13E05 1.957 1.889 0.004 0.003
0.006 Class 4 17C01 1.826 1.843 -0.001 0.000 0.007
TABLE-US-00014 TABLE 10 OD-values for binding of the anti-IL-17
Nanobodies to IL- 17F from human, marmoset, mouse and rat origin in
ELISA Nanobody Human Marmoset Mouse Rat Class Nanobody IL-17F
IL-17F IL-17F IL-17F Class 2 02A08 -0.014 -0.0005 -0.0005 0.0035
Class 2 03C07 -0.016 -0.0015 0.0005 0.0015 Class 2 04B09 -0.015
0.0025 -0.0025 0.0015 Class 2 04G01 -0.016 0.0005 -0.0005 -0.0005
Class 2 09G10 -0.018 0.0045 -0.0005 0.0025 Class 2 11A06 0.673
0.0225 0.0455 0.0045 Class 3 06E11 2.593 2.123 0.0215 0.0085 Class
3 07B09 1.872 1.0855 -0.0015 0.0025 Class 3 07B11 1.849 1.6395
-0.0005 -0.0105 Class 3 08H01 1.767 0.5515 -0.0005 0.0045 Class 3
16A04 1.736 1.6365 -0.0015 0.0015 Class 3 24B08 1.815 1.7625
-0.0015 0.0035 Class 3 24G10 1.96 1.6365 -0.0005 0.0025 Class 4
01A01 0.612 0.2195 -0.0005 0.0005 Class 4 11C08 1.655 1.4045
-0.0025 0.0005 Class 4 13B03 1.656 1.3255 -0.0005 0.0085 Class 4
13B05 0.712 0.445 0.0205 0.0095 Class 4 13E02 1.099 0.248 0.0155
0.0255 Class 4 13E05 1.771 0.3375 0.0005 0.0025 Class 4 17C01 0.772
0.0525 -0.0005 0.0025
Example 12: Specificity of the Anti-IL-17 Nanobodies
[1162] Off-target binding of a selected panel of anti-IL-17
Nanobodies 02A08, 03C07, 04B9, 04G1, 09G10, 11A06 (Class 2), 06E11,
07B09, 07B11, 08H01, 16A04, 24G10 (Class 3), and 01A01, 11C08,
13B03, 13B05, 13E02, 13E05, 17C01 (Class 4) was assessed by
measuring the binding capacity of the anti-IL-17 Nanobodies to
human IL-17B (Peprotech Cat No 200-28), IL-17C (R&D Systems,
Cat No 234-IL/CF), IL-17D (Peprotech 200-27) or IL-17E (Peprotech
Cat No 200-24), by SPR using a Biacore T100 instrument. Human
IL-17B, IL-17C, IL-17D or IL-17E were all expressed in E. coli, and
covalently bound to a CM sensor chip surface via amine coupling
using EDC/NHS for activation and HCl for deactivation. Purified
Nanobodies or control mAbs (anti-hIL-17B Mab1248, anti-hIL-17E
Mab1258, anti-hIL-17C Mab1234, anti-hIL-17D Mab1504, R&D
Systems), were injected for 2 minutes at a flow rate of 45
.mu.l/min to allow binding to chip-bound antigen. Next, binding
buffer was sent over the chip at the same flow rate to allow
spontaneous dissociation of bound Nanobody or antibody. Whereas all
control antibodies bound to their respective targets, the tested
Nanobodies did not bind to human IL-17B, IL-17C, IL-17D or
IL-17E.
Example 13: Epitope Mapping Using Site Directed Mutagenesis
A. Design of Mutant IL17A and IL17F
[1163] Human IL-17A an F being symmetrical dimers, the
corresponding mutation sets were defined on a single chain of the
monomer. The network of mutations was distributed at the surface of
the dimer in a symmetrical way. The detailed list of mutations is
as follows:
[1164] For IL-17A: K38E, K38A, D42A, N45A, N45Q, R46A, H54A, K70A,
K70Q, R72A, H73A, L74A, I77A, D80A, N82K, N82A, Y85A, H86A,
N88A
[1165] For IL-17F: S39E, S39A, N43A, R47A, T55A, T55H, Q71A, Q71K,
R73A, N74A, L75A, I78A, Q81A, K83N, K83A, I86A, S87A, S87H,
N89A
[1166] All the selected positions were mutated to an Alanine, a
neutral amino acid, which is usually well tolerated at most
positions in a protein structure. Other amino acids than Ala were
also used at certain positions in order to introduce a more drastic
change. As mentioned earlier, all these position cover half the
surface of IL-17A and F.
B. Principle of the Screening Method
[1167] Single amino acid mutants of FLAG-tagged IL-17A and F were
obtained by site-directed mutagenesis, transiently expressed in
HEK-293 cells and tested by ELISA for binding of the Nanobodies.
The binding of each Nanobody to single IL-17 mutants was compared
and normalized to that of the same Nanobody to the wild type
cytokine. A polyclonal specific anti-IL-17 antibody was used as
positive control to check for the structural integrity of the
mutant molecules.
C. Construction of Single IL-17 Mutants by Site-Directed
Mutagenesis
[1168] Single amino acid mutations in IL-17A and F cytokine were
introduced with mutagenic oligonucleotides using an adapted version
of the Quick Change mutagenesis PCR protocol originally described
by Stratagene. The main differences from the original protocol are
the use of only one primer rather than 2, the sequence of the sense
strand is sufficient and the use of the Pwo DNA polymerase from
Roche (Cat No 03789403001) rather than the Pfu Turbo DNA polymerase
from Stratagene. Both cytokines have a FLAG tag at their C-terminal
and were cloned into the expression vector pTT5 (Durocher Y et al.,
Nucleic Acids Res. 2002, 30, E9) for expression in mammalian cells.
The final constructs were confirmed by DNA sequence analysis of the
full length IL-17A or IL-17F coding gene.
D. Transient Expression of Single IL-17 Mutants in Mammalian
Cells
[1169] Small-scale production of the recombinant Flag-tagged IL-17A
and -F mutants as well as reference parental wild type cytokines
was performed in a 6-well plate format by growing HEK-293 cells in
D-MEM/F-12 (1:1) medium (Invitrogen cat no 21331-020) supplemented
with 10% FCS, 2 mM L-Glutamine, 100 U/ml Penicillin and 100
.mu.g/ml Streptomycin. The TransIT-LT1 transfection reagent from
Minis Bio Corporation (cat no MIR-2305) was used according to the
protocol recommended by the supplier. Transfections were carried
out in serum-containing media. Briefly, 2.5 .mu.g of LPS-free
miniprep plasmid DNA per well of a 6-well plate were used for
transfection and the incubation time was between 48 and 72
hours.
E. ELISA Protocol for Detection of Nanobody Binding to IL-17
Mutants
[1170] Nunc-Immuno plates Maxisorp (invitrogen, Nunc #439454) were
coated overnight at 4.degree. C. with polyclonal rabbit
anti-FLAG.RTM. epitope (DYKDDDDK) antibody (Covance #PRB-132P) at 2
.mu.g/ml in PBS, pH 7.4. The plates were washed 3 times in PBST
(PBS containing 0.05% Tween20) and the undiluted neat tissue
culture supernatants containing the IL-17-FLAG-tagged mutants were
incubated for 1 hr 30 at 37.degree. C. The plates were washed with
PBST 3 times and blocked for 2 hrs at 37.degree. C. with PBS
containing 2% BSA. The plates were washed 3 times with PBST and the
different anti-IL17 HIS and cmyc-tagged monovalent nanobodies added
to the wells at 5 .mu.g/ml in PBS pH 7.4. The plates were incubated
for 2 hrs at 37.degree. C. and then washed 3 times with PBST. The
secondary HRP-conjugated rabbit polyclonal to 6.times. His tag.RTM.
(HHHHHH) antibody (Abcam #ab1187) was then added to the wells at
1/5000 dilution in PBS pH 7.4. The plates were incubated for 45 min
at room temperature (RT), washed 3 times with PBST and 100
.mu.l/well of the tetramethylbenzidine (TMB) ELISA peroxidase
substrate solution (Uptima #UP664781) added. The plates were left
for 5 min at RT, blocked with 1M H2SO4 and the OD read at 450 nm.
In order to verify that the single IL-17 mutants and wild type
cytokines were expressed, structurally well folded and well
captured by anti-FLAG antibody, a polyclonal anti-IL17A or -F were
used as primary antibodies followed by a HRP-conjugated secondary
antibody. For IL-17A and IL-17F constructs a polyclonal Goat IgG
anti-human IL-17A (Life span, #LS-C37027) and a polyclonal Goat IgG
anti-human IL-17F (R&D systems, #AF1335) were used,
respectively; followed by a HRP-conjugated bovine anti-goat
IgG(H+L) for detection (Jackson ImmunoResearch #805-035-180).
Epitope Recognized by Class 2 Nanobodies
[1171] Five residue positions were identified that are common to
all A-blockers and X-reactive Nanobody epitopes: L74, Y85, H73, N82
and R72 (Table 11). Both L74 and Y85 are crucial positions for the
said epitopes, as, in all expect one case, they strongly affect
Nanobody binding. Binding affinity of the selected Nanobodies to
those two mutants is always below 50% of the wild type binding at
least, and in most cases is below 25%. The exception is Y85 for
4B09 where binding affinity is 60% of that of the wild type
protein. In light of our results, L74 can be clearly categorized as
a hot spot. To a lower extent, H73 also appeared as a very
important residue for all epitopes. A few positions discriminate
A-blockers versus X-reactive Nanobodies. N88 was found exclusively
in epitopes of X-reactive Nanobodies (except 11C08). By contrast,
either H54 or K70 was found in epitopes of A-blockers, but rarely
in epitopes of X-reactive Nanobodies. Among the five common residue
positions between A-blocker and X-reactive epitopes on IL-17A,
three have different amino acids in IL-17F (Y85I, H73N and N82K).
This suggests that epitopes of X-reactive Nanobodies does not have
to be strictly identical between related proteins. A certain degree
of variability in the amino acid set which constitutes an epitope
is tolerated. However, the two key residues (L74, Y85) have
identical counterparts in IL-17F (L75, I86).
Epitope Recognized by Class 4 Nanobodies
[1172] Only the X-reactive Nanobodies 13B03 and 13E02 were tested
as Fc fusions against the IL-17 mutants. Their affinity is on
average 10 times less on IL-17F than on IL-17A. As for IL-17A, L75
and I86 (the equivalent residues of L74 and Y85 in IL-17A) are
crucial positions in the epitopes of all Nanobodies on IL-17F.
Moreover, our results indicate that I78 is also a key residue in
all Nanobody epitopes on IL-17F. The later result is difficult to
explain as we did not observe a similar behavior of the equivalent
position (I77) in IL-17A, even for the X-reactive Nanobodies. The
distinction between the average A-blocker and X-reactive epitopes
observed on IL-17A was not possible on IL-17F as the corresponding
experimental data set was limited (only two cross-reactive
Nanobodies tested due to weak binding of monovalent forms).
[1173] All the mutants were tested for binding to both chains of
the receptor complex, IL-17RA and IL-17RC. Results obtained on
IL-17A indicate that R46 is strongly involved in the binding site
of both receptor chains (data not shown). This data, in combination
with the X-ray structure of the complex between IL-17F and IL-17RA
(Ely et al., Nature Immunology 10, 1245-1251, 2009), provides some
clues that the epitopes of most Nanobodies tested are likely to
overlap partially with the receptor binding site on IL-17A.
[1174] From below Table 11 it becomes clear that Y85 is an
important residue since it affects all 3 Nanobodies binding to
IL-17A tested. N88 is critical for cross-(X)-reactive Nanobodies
and not the others.
Epitope Recognized by Class 3 Nanobodies
[1175] For the anti-IL-17F specific Nanobody 4 positions on IL-17F
have been identified as critical R73, I86 and N89, interestingly
they correspond to the positions L74, Y85 and N88 on IL-17A which
have been also shown as critical for the Nanobodies. R47 looks
critical which was not seen for IL-17A (R46).
TABLE-US-00015 TABLE 11 Percentage binding of nanobodies to IL-17A
single alanine mutants as normalised to the binding of a polyclonal
anti-IL-17A Human IL-17A mutant R46 L74 H54 N78 D80 Y85 N88 class 2
90 13.6 18 100 100 12 93 class 4 92 9.6 81 100 95 29 9 class 4 89
9.2 100 100 100 11 38 Human IL-17F mutant R47 R73 I86 N89 class 3
14.2 18.3 2.8 1.7
Example 14: Epitope Binning of the Monovalent Nanobodies Versus the
IL-17 Receptors
[1176] To investigate whether the selected anti-IL-17 Nanobodies
bind to an overlapping epitope on IL17A, respectively IL-17F as
IL-17RA respectively IL-17RC, an epitope binning experiment on
Biacore was set up. The receptor (IL-17RA or IL-17RC) was captured
via its human Fc-tail by an anti-human IgG-Fc antibody coated on
the chip. Subsequently, a mixture of IL-17A or IL-17F complexed to
a Nanobody was injected over the surface. Concentrations of IL-17A
or IL-17F were used for which theoretical calculations showed
complex formation for >99% of the IL-17. For none of the Class 2
or Class 4 Nanobody--IL-17A complexes, binding to IL-17RA was
observed (Table 12), indicating that these Nanobodies bind to a
similar epitope on IL-17A as IL-17RA. For the Class 3 Nanobodies
only one Nanobody--IL-17F complex, 24B08--IL-17F, showed binding to
IL17RC (Table 12), indicating that this Nanobody interacts with a
different epitope on IL-17F as IL-17RC. For the Class 4 Nanobodies,
only 2 Nanobody--IL-17F complexes did not bind to IL-17RC; 11C08,
and 13E02. 01A01, 13B03 and 13E05--IL-17F complexes showed minor
binding, whereas 13B05 and 17C01 showed significant binding,
indicating that the IL-17F epitope recognized by these Nanobodies
is only partly overlapping with IL-17RC.
TABLE-US-00016 TABLE 12 % Biacore binding of the IL-17 - Nanobody
complex to immobilized IL-17RC or IL-17RA % Biacore % Biacore
Nanobody binding (IL- binding (IL- Nanobody Class 17A-NB)-IL-17RA
17F-NB)-IL-17RC 02A08 Class 2 0.46 03C07 Class 2 -0.08 04B09 Class
2 -1.39 04G01 Class 2 -0.43 09G10 Class 2 2.05 11A06 Class 2 -0.35
06E11 Class 3 8.17 07B09 Class 3 5.17 07B11 Class 3 6.67 08H01
Class 3 9.17 16A04 Class 3 4.84 24B08 Class 3 59.88 24G10 Class 3
8.51 01A01 Class 4 -1.04 12.01 11C08 Class 4 3.25 6.34 13B03 Class
4 -2.24 15.68 13B05 Class 4 -0.89 35.03 13E02 Class 4 -1.04 7.17
13E05 Class 4 0.54 15.51 17C01 Class 4 -2.01 32.53
[1177] To confirm the fact that most Class 2 and Class 4 Nanobodies
recognize an overlapping epitope on IL-17A, a SPR experiment was
conducted whereby human IL17A was immobilized on the sensor chip,
the Class 4 Nanobody 01A01 was bound and subsequentially a second
test Nanobody from Class 2 or Class 4 was send over the chip. If no
increase in RU levels was observed, the test Nanobody binds to an
overlapping epitope than 01A01. This was the case for all tested
Nanobodies, except for 11A06, again confirming that this Nanobody
binds to a different epitope on IL-17A. The results are shown in
FIG. 10.
[1178] Similarly, by immobilizing human IL-17F, binding of the
Class 3 Nanobody 07B11, and subsequential binding of a second test
Nanobody from Class 3 or Class 4, it was shown that all those
Nanobodies recognize an overlapping epitope, except for 24B08,
which again confirms the observations described above. The results
are shown in FIG. 11.
Example 15: Generation of Multivalent Wild-Type Anti-IL-17
Nanobodies with Half-Life Extension (HLE)
[1179] In order to generate a half-life extended Nanobody product
that blocks IL-17A, IL-17F and IL-17A/F, the monovalent Nanobodies
were formatted. Class 2 (IL-17A and IL-17A/F-blocking, further
indicated in figures with A) and Class 3 Nanobodies
(IL-17F-blocking, further indicated with F) were combined into A-F
or F-A combinations. The Class 4 (IL-17A-IL-17F cross-reactive
Nanobodies, further indicated with X, were formatted into a
bivalent construct X-X or combined with a Class 3 Nanobody F-X or
X-F. For half-life extension it was opted to fuse the constructs
either to the anti-HSA Nanobody ALB8 or to an Fc-portion.
Formatted Wild-Type Nanobodies with ALB8 HLE
[1180] It was opted to make on the DNA-level various A-F, F-A, X-X,
F-X and X-F combinations, and to also vary the position of the ALB8
Nanobody, either between the anti-IL-17 Nanobodies linked at both
sites via 9GS-linkers or at the C-terminus of the construct,
wherein the two anti-IL-17 Nanobodies are linked via a 35GS-linker
and ALB8 is linked to the middle Nanobody via a 9GS-linker. The
monovalent Nanobodies used as building blocks are shown in Table
13.
TABLE-US-00017 TABLE 13 Nanobodies selected as building blocks for
the formatted constructs. Only the cross-reactive Nanobodies
indicated in bold were used in the F-X and F-X combinations. Class
2 (A) Class 3 (F) Class 4 (X) 02A08 06e11 01A01 03C07 07B11 11C08
04B09 08H01 13B03 04G01 16A04 13B05 09G10 24G10 13E02 11A06
13E05
[1181] A selection of 50 multivalent Nanobodies was expressed as
c-myc, His6-tagged protein in Pichia pastoris (amino acid sequences
are shown in FIG. 6). Induction of Nanobody expression occurred by
stepwise addition of methanol. Clarified medium with secreted
Nanobody was used as starting material for immobilized metal
affinity chromatography (IMAC) followed by desalting resulting in
90% purity as assessed by SDS-PAGE. Where appropriate, the methods
described in WO 2010/125187 were applied to further improve
expression and folding.
Formatted Wild-Type Nanobodies with Fc HLE
[1182] Bivalent cross-reactive Nanobodies fused to an Fc-tail were
constructed. Fc-fusions were made of the cross-reactive Nanobodies
01A01, 13E02 and 13B03. Constructs were made with a short hinge
region from human IgG1 C.fwdarw.S (sequence: EPKSSDKTHTCPPCP) or
with a long hinge region from llama IgG2b
(EPKTPKPQPQPQPQPNPTTESKCPKCP). Also two types of signal peptides
were used: the one from VH3-23 (hIgG HC), with the sequence
MEFGLSWLFLVAKIKGVQC and the one from the mouse germline, with
sequence MEWSWVFLFFLSVTTGVHS, for secretion of these Nanobodies
after expression in Hek-293-6E cells. Fc-constructs were
transiently transfected in Hek-293-6E cells, and expressed
Nanobodies got secreted into the culture medium (75-400 ml
Freestyle medium). The medium was harvested 3 days
post-transfection and the Fc-fused Nanobodies were purified using
Protein A chromatography (Mab Select Sure), followed by size
exclusion chromatography.
Example 16: Blocking Capacity of Purified Multivalent Wild-Type
Anti-IL-17 Nanobodies with ALB8 HLE in AlphaScreen Assays Using
Human IL-17A, IL-17F and IL-17A/F
[1183] The 50 multivalent Nanobodies were tested in the AlphaScreen
IL-17A-IL-17RA, IL-17F-IL-17RC and IL-17-A/F-RA assay, as described
in Example 8, but with optimized ligand and receptor concentrations
as shown in Table 14, and using a dilution series of each Nanobody
starting from 50 nM down to 0.181 pM.
TABLE-US-00018 TABLE 14 Overview of the optimised concentrations of
IL-17 ligand and IL-17 receptors used in the AlphaScreen assays to
determine IC50 values of the multivalent Nanobodies Assay set-up
Concentration Concentration Ligand - receptor combination ligand
(nM) receptor (nM) IL-17A-IL-17RA 0.10 10 IL-17F-IL-17RC 0.05 3
IL-17A/F-IL-17RA 0.32 4
[1184] Based on potency and maximum level of inhibition, the 14
best multivalent Nanobodies were chosen for further
characterization. For nine of them IC50's in all six Alphascreen
assays were measured. In addition, it was investigated whether
presence of HSA in the Alphascreen assay influences the IC50. To
this end, the IL-17A-IL-17RA, IL-17F-IL-17RC and the
IL-17A/F-IL-17RA assays were repeated in absence or presence of 5
.mu.M HSA. For the other five Nanobodies only potencies in
IL-17A-IL-17RA and IL-17F-IL-17RC assay were measured. Results are
summarized in Table 15. All Nanobodies show very good potencies,
albeit that the X-X formats are less potent in blocking the
IL-17F-receptor interactions. The presence of HSA did not have a
major influence on the potencies.
TABLE-US-00019 TABLE 15 Summary of IC50-values for the selected
panel of 14 formatted wild-type anti-IL17 Nanobodies derived from
Alphascreen, nd = not determined IC50 (pM) AlphaScreen IL17A-
IL17F- IL17A/F- Nanobody IL17A- RA + IL17A- IL17F- IL17F- RC +
IL17A/F- RA + IL17A/F- Specificity ID Construct RA HSA RC RA RC HSA
RA HSA RC A - F IL17MS0089 02A08-35GS- 115 185 130 369 41 54 97 131
47 16A04-9GS-ALB8 F - A IL17MS0141 07B11-35GS- 87 92 146 819 29 36
99 130 68 04B09-9GS-ALB8 F - A IL17MS0166 24G10-35GS- 161 203 367
1094 46 56 128 95 51 04G01-9GS-ALB8 X - X IL17MS1003
13B03-9GS-ALB8- 116 72 171 564 189 177 85 90 45 9GS-13B03 X - X
IL17MS1013 13E02-35GS- 64 67 167 408 102 113 101 86 104
13E02-9GS-ALB8 F - X IL17MS2022 16A04-9GS-ALB8- 63 83 183 456 23 28
98 90 39 9GS-13B03 F - X IL17MS2024 16A04-9GS-ALB8- 99 70 170 328
17 22 142 124 50 9GS-13E02 X - F IL17MS2042 01A01-9GS-ALB8- 130 111
152 619 30 35 122 99 59 9GS-24G10 F - X IL17MS2081 07B11-35GS- 78
86 138 543 22 27 99 100 36 01A01-9GS-ALB8 A - F IL17MS0110
04G01-35GS-16A04- 45 nd nd nd 48 nd nd nd nd 9GS-ALB8 F - A
IL17MS0154 16A04-35GS-04G01- 56 nd nd nd 47 nd nd nd nd 9GS-ALB8 X
- X IL17MS1005 13E02-9GS-ALB8- 56 nd nd nd 363 nd nd nd nd
9GS-13E02 X - F IL17MS2117 13B03-35GS-16A04- nd nd nd nd 30 nd nd
nd nd 9GS-ALB8 X - F IL17MS2131 13E02-35GS-16A04- 44 nd nd nd 20 nd
nd nd nd 9GS-ALB8
Example 17: Blocking Capacity of Purified Multivalent
Cross-Reactive Anti-IL-17 Nanobodies with ALB8 HLE Versus Fc HLE in
Competition ELISA Using Human IL-17A or IL-17F
[1185] The potency of the formatted Nanobodies carrying ALB8 HLE,
13E02-35GS-13E02-9GS-ALB8 and 13B03-9GS-ALB8-9GS-13B03 was compared
with the potency of the same Nanobodies carrying the Fc-HLE,
SH-Fc-(GS)2-13E02 and 13B03-SH-Fc 13B03-LH-Fc in a competition
ELISA. To this end, IL-17RA, respectively IL-17RC was coated at a
concentration of 1 .mu.g/ml in PBS. A dilution series of the
Nanobodies or reference compounds was incubated with biotinylated
IL-17A (12 pM), respectively IL-17F (10 pM) and binding to the
receptor was detected with extravidin-HRP. In both assays, all
formatted Nanobodies show improved potency compared to their
monovalent counterpart and most Nanobodies have better potencies
than the reference compounds, as shown in Table 16.
TABLE-US-00020 TABLE 16 IC50 values for the multivalent anti-IL17
Nanobodies determined in a competition ELISA IC50 Competition IC50
Competition ELISA ELISA Test compound IL17A -RA (pM) IL17F -RC (pM)
13B03-9GS-ALB8-9GS- 20 148 13B03 13B03-SH-Fc 20 3364 13B03-LH-Fc 31
292 SH-Fc-(GS)2-13B03 44 350 13E02-35GS-13E02-9GS- 102 534 ALB8
SH-Fc-(GS)2-13E02 112 267 13B03 121 91600 13E02 420 3020 mAB02 914
B-F60 mAB 1200
Example 18: Blocking Activity of Purified Formatted Wild-Type
Anti-IL-17 Nanobodies in Cell-Based Assay Using Human IL-17A,
IL-17F and IL-17A/F in Presence or Absence of HSA
[1186] For 9 selected formatted Nanobodies with ALB-HLE, and 4
Fc-fused Nanobodies, the dose-dependent inhibition of hIL-17A,
hIL-17F or hIL-17A/F induced IL-6 secretion by HT-1080 cells was
investigated. Human HT-1080 fibrosarcoma cells were seeded at 1500
cells/well in 96-well flat bottom plates. Serial 1:3 dilutions of
Nanobodies, mAB02 reference compound or anti-IL-17F B-F60 mAb
reference compound were made and added to the wells with the
HT-1080 cells, resulting in final concentrations ranging from 10
.mu.g/mL to 0.0045 .mu.g/mL for the Nanobodies and mAB02 and from
100 .mu.g/mL to 0.045 .mu.g/mL for mAB B-F60. In the first
experiments, Nanobodies were added as such (Table 17), in a second
experiment, Nanobodies were preincubated with 100 .mu.M HSA (Table
18). Plates were incubated for 30 min. at 37.degree. C. with 5%
CO.sub.2 before adding specific stimuli, which were either human
IL-17A at 1 nM final concentration, human IL-17F at 15 nM final
concentration or human IL-17A/F at 5 nM final concentration. Plates
were incubated for another 24 hours at 37.degree. C. with 5% CO2.
Supernatants were harvested, transferred into 96-well plates, and
levels of human IL-6 were determined using a commercial IL-6 ELISA
assay. As shown in Table 17, all Nanobodies had similar potencies
(IC.sub.50 in the range of 0.19-0.78 nM) for blocking IL-17A
activity, irrespective of the format or HLE. The potency for
blocking IL-17F activity was also similar for all Nanobodies
(IC.sub.50 in the range of 2.7-8.2 nM). As shown in Table 18
(compared to Table 17), the presence of 100 .mu.M HSA in the assay
did not have influence on the potency of the Nanobodies.
TABLE-US-00021 TABLE 17 Inhibition of human IL-17A or IL-17F
induced IL-6 production in human fibrosarcoma HT-1080 cells by
formatted wild-type anti-IL-17 Nanobodies or reference compounds
without HSA. IC50 IC50 Nanobody (nM) Emax (nM) Emax specificity or
reference Construct hIL-17A (%) hIL-17F (%) A - F IL17MS0089
02A08-35GS- 0.38 .+-. 0.1 102 .+-. 1 4 87 16A04-9GS-ALB8 F - A
IL17MS0141 07B11-35GS- 0.25 105 5.9 110 04B09-9GS-ALB8 F - A
IL17MS0166 24G10-35GS- 0.83 105 7.35 .+-. 2 102 .+-. 3
04G01-9GS-ALB8 X - X IL17MS1003 13B03-9GS-ALB8- 0.45 .+-. 0.03 101
.+-. 1 6.4 .+-. 5 101 .+-. 4 9GS-13B03 X - X IL17MS1013 13E02-35GS-
0.47 .+-. 0.04 102 .+-. 3 6.45 .+-. 2 97.5 .+-. 1 13E02-9GS-ALB8 F
- X IL17MS2022 16A04-9GS-ALB8- 0.60 .+-. 0.1 102 .+-. 8.05 .+-. 0.2
97 .+-. 5 9GS-13B03 F - X IL17MS2024 16A04-9GS-ALB8- 0.78 .+-. 0.1
103 .+-. 4 8.2 .+-. 0.6 96 .+-. 7 9GS-13E02 X - F IL17MS2042
01A01-9GS-ALB8- 0.28 101 6.6 111 9GS-24G10 F - X IL17MS2081
07B11-35GS- 0.7 100 6.3 99 01A01-9GS-ALB8 X - X MSB0010606
13E02-LH-Fc 0.19 .+-. 0.1 100 .+-. 6 2.7 .+-. 2.9 96 .+-. 4 X - X
MSB0010619 SH-Fc-(GS)2-13E02 0.31 .+-. 0.3 102 .+-. 5 4.9 .+-. 3.5
98 .+-. 6 X - X MSB0010618 SH-Fc-(GS)2-13B 0.37 .+-. 0.3 100 .+-. 6
5.7 .+-. 3.2 94 .+-. 14 X - X MSB0010493 13B03-SH-Fc 0.19 .+-. 0
100 .+-. 4 5.8 .+-. 0.3 105 .+-. 15 A mAb02 0.59 .+-. 0.4 99 .+-. 2
ND ND F B-F60 mAb ND ND 3.9 .+-. 3.12 93 .+-. 10 Results are
expressed as mean .+-. SD of N (1 to 7) experiments.
TABLE-US-00022 TABLE 18 Inhibition of human IL-17A, IL-17F or
IL-17A/F induced IL-6 production in human fibrosarcoma HT-1080
cells by formatted wild-type anti-IL-17 Nanobodies or reference
compounds in the presence of 100 .mu.M HSA. IC50 Nanobody IC50 IC50
(nM) or (nM) Emax (nM) Emax hIL- Emax property reference Construct
hIL-17A (%) hIL-17F (%) 17A/F (%) A - F IL17MS0089 02A08-35GS- 1.00
.+-. 0.6 97 .+-. 1 7.3 .+-. 1.3 89.5 .+-. 1 1.01 .+-. 0.1 83 .+-. 3
16A04-9GS-ALB8 F - A IL17MS0141 07B11-35GS- 0.85 .+-. 0.5 98 .+-. 0
14.8 .+-. 10.2 91.5 .+-. 5 0.34 .+-. 0.1 78 .+-. 3 04B09-9GS-ALB8 F
- A IL17MS0166 24G10-35GS- 1.95 .+-. 0.6 98 .+-. 1 8.5 .+-. 3.5
85.0 .+-. 8 1.47 .+-. 0.5 72 .+-. 15 04G01-9GS-ALB8 X - X
IL17MS1003 13B03-9GS- 1.55 .+-. 1.2 96 .+-. 1 10.8 .+-. 3.2 86.5
.+-. 6 0.53 .+-. 0.4 78 .+-. 8 ALB8-9GS-13B03 X - X IL17MS1013
13E02-35GS- 1.00 .+-. 0.6 97 .+-. 0 14.8 .+-. 3.6 81 .+-. 3 0.43
.+-. 0.1 78 .+-. 6 13E02-9GS-ALB8 F - X IL17MS2022 16A04-9GS- 0.85
.+-. 0.4 97 .+-. 0 4.1 .+-. 3.1 91.5 .+-. 1 0.61 .+-. 0.4 72 .+-. 9
ALB8-9GS-13B03 F - X IL17MS2024 16A04-9GS- 0.90 .+-. 0.7 96 .+-. 6
8.3 .+-. 0.5 91.5 .+-. 8 0.44 .+-. 0.0 86 .+-. 2 ALB8-9GS-13E02 X -
F IL17MS2042 01A01-9GS- *044 *100 *5.7 *93 0.57 .+-. 0.1 85 .+-. 4
ALB8-9GS-24G10 F - X IL17MS2081 07B11-35GS- 1.05 .+-. 0.4 95 .+-. 6
5.2 .+-. 4.6 93.5 .+-. 8 0.72 .+-. 0.5 87 .+-. 8 X - X MSB0010530
13B03-LH-Fc 0.95 .+-. 0.8 97.5 .+-. 1 15.6 .+-. 0.07 75 .+-. 4 ND
ND X - X MSB0010606 13E02-LH-Fc 0.85 .+-. 0.5 98.5 .+-. 2 15.3 .+-.
1.3 80.5 .+-. 2 ND ND A mAb02 0.65 .+-. 0.2 96 .+-. 3 ND ND 3.94
.+-. 5.4 74 .+-. 9 F mAb B-F60 ND ND 5.8 .+-. 2.6 84 .+-. 7 ND ND
Results are expressed as mean .+-. SD of N experiments. N = 2 or *N
= 1
Example 19: Dual Inhibition of Purified Formatted Wild-Type
Anti-IL-17 Nanobodies in HT-1080 Cells Stimulated by Combinations
of Human IL-17A and IL-17F
[1187] As a next step, it was investigated whether the formatted
Nanobodies were able to inhibit IL-6 secretion in a dose dependent
manner, when HT-1080 cells were stimulated with a combination of
human IL-17A and IL-17F. IL-17A and IL-17F were combined at
different concentrations: 1) 1 nM IL-17A+15 nM IL-17F, 2) 5 nM
IL-17A and 5 nM IL-17F, 3) 15 nM IL-17A and 15 nM IL-17F. The
tested set of Nanobodies showed a very good dual inhibitory
activity (Table 19).
TABLE-US-00023 TABLE 19 IC50-values of some of the formatted WT
anti-IL-17 Nanobodies in the HT-1080 bioassay using combinations of
human IL- 17A and human IL-17F. Nanobody IC50 (nM) hIL- IC50 (nM)
IL- IC50 (nM) IL- IC50 (nM) IL- or IC50 (nM) hIL- 17F 17A + IL-17F
17A + IL-17F 17A + IL-17F specificity reference Construct 17A (1
nM) (15 nM) (1 + 15 nM) (5 + 5 nM) (15 + 15 nM) A - F IL17MS0089
02A08-35G5- 0.38 .+-. 0.1 *4 *1.03 *3.11 *10.3 16A04-9GS-ALB8 X - X
IL17MS1013 13E02-35GS- 0.47 .+-. 0.04 6.45 .+-. 2 *0.82 *1.64 *4.9
13E02-9GS-ALB8 F - X IL17MS2022 16A04-9GS-ALB8- 0.60 .+-. 0.1 8.05
.+-. 0.2 *3.23 *2.77 *10.5 9GS-13B03 F - X IL17MS2024
16A04-9GS-ALB8- 0.78 .+-. 0.1 8.2 .+-. 0.6 *3.76 *3.02 *11.2
9GS-13E02 A mAb02 0.48 .+-. 0.2 ND ND ND ND A + F rnAb02 + ND ND
*1.03 *1.23 *5.3 mAb B-F60 F F60 ND 2.5 .+-. 1.6 ND ND ND Results
are expressed as mean .+-. SD of N experiments. N = 2 or *N = 1.
ND: Not Done.
TABLE-US-00024 TABLE 20 IC50-values of formatted anti-IL-17
Nanobodies in the HT-1080 bioassay using Cynomolgus monkey IL-17A
or IL-17F. Nanobody IC50 (nM) IC50 (nM) specificity ID Construct
Cyno IL17A Emax (%) Cyno IL17F Emax (%) A-F IL17MS0089 02A08-35GS-
0.52 100 ND ND 16A04-9GS-ALB8 X-X IL17MS1003 13B03-9GS- 0.86 102
3.8 .+-. 4.3 98 .+-. 16 ALB8-9GS-13B03 X-X IL17MS1013 13E02-35GS-
0.88 102 NI NI 13E02-9GS-ALB8 F-X IL17MS2022 16A04-9GS- 0.76 101
3.6 .+-. 0.4 93 .+-. 21 ALBS-9GS-13B03 F-X IL 7M52024 16A04-9GS-
1.02 100 4.5 .+-. 4.9 94 .+-. 20 ALB8-9GS-13E02 X-X MSB0010606
13E02-LH-Fc 0.19 .+-. 0.09 101 .+-. 7 NI NI X-X MSB0010619
SH-Fc-(GS)2-13E02 0.29 .+-. 0.09 100 .+-. 6 8.3 .+-. 6 87 .+-. 21
X-X MSB0010618 SH-Fc-(GS)2-13B03 0.37 .+-. 0.21 98 .+-. 4 5.0 .+-.
4 103 .+-. 16 X-X MSB0010493 13B03VHH-SH-Fc 0.21 106 3.8 111
Results are expressed as mean .+-. SD of N (1 to 5) experiments. NI
= non inhibiting
Example 20: Blocking Activity of Purified Formatted Wild-Type
Anti-IL-17 Nanobodies in Cell-Based Assays Using Cynomolgus Monkey
IL-17A and IL-17F
[1188] The dose-dependent inhibition of Cynomolgus monkey IL-17A (1
nM) and IL-17F (15 nM) induced IL-6 secretion by the HT-1080 cells
was investigated. As the monovalent Nanobodies all showed equal
potency towards human and Cynomolgus monkey IL-17A and IL-17F, it
was expected that multivalent and Fc Nanobodies would also be
equally potent. This was indeed the case for the tested Nanobodies
(Table 20), except for IL17MS1013 (13E02-35GS-13E02-9GS-ALB8) and
MSB0010606 (13E02-LH-Fc) which showed no inhibition of Cynomolgus
IL-17F.
Example 21: Binding of Formatted Wild-Type Anti-IL-17 Nanobodies,
Carrying the ALB8 HLE, to Human Serum Albumin
[1189] For the fourteen formatted wild-type anti-IL-17 Nanobodies
carrying the ALB8 HLE, off rates for binding to human serum albumin
were determined by surface plasmon resonance, using the Biacore
(Table 21). All Nanobodies show similar off-rates ranging from
5.4E-03 to 6.6E-03 s-1. This is slightly higher than the off-rate
for ALB8 alone (1.65E-03 s-1), which is generally observed when
ALB8 is fused to other Nanobody building blocks, thus, these
off-rates are acceptable.
TABLE-US-00025 TABLE 21 Affinities for HSA of ALB8 HLE anti-IL-17
Nanobodies compared to the affintiy of ALB8 alone K.sub.off
specificity Nanobody ID Construct (s-1) A - F IL17MS0089
02A08-35GS-16A04-9GS- 6.60E-03 ALB8 A - F IL17MS0110
04G01-35GS-16A04-9GS- 6.10E-03 ALB8 F - A IL17MS0141
07B11-35GS-04B09-9GS- 5.80E-03 ALB8 F - A IL17MS0154
16A04-35GS-04G01-9GS- 5.70E-03 ALB8 F - A IL17MS0166
24G10-35GS-04G01-9GS- 5.90E-03 ALB8 X - X IL17MS1003
13B03-9GS-ALB8-9GS- 5.80E-03 13B03 X - X IL17MS1005
13E02-9GS-ALB8-9GS- 5.80E-03 13E02 X - X IL17MS1013
13E02-35GS-13E02-9GS- 6.40E-03 ALB8 F - X IL17MS2022
16A04-9GS-ALB8-9GS- 5.40E-03 13B03 F - X IL17MS2024
16A04-9GS-ALB8-9GS- 5.70E-03 13E02 X - F IL17MS2042
01A01-9GS-ALB8-9GS- 6.30E-03 24G10 F - X IL17MS2081
07B11-35GS-01A01-9GS- 6.60E-03 ALB8 X - F IL17MS2117
13B03-35GS-16A04-9GS- 6.00E-03 ALB8 X - F IL17MS2131
13E02-35GS-16A04-9GS- 6.20E-03 ALB8
Example 22: Affinity Determination of the Formatted Wild-Type
Anti-IL17 Nanobodies Using the KinExA Technology
[1190] The affinity of a limited set of formatted Nanobodies was
determined using the KinExA. As shown in Table 22, there is a
definite avidity effect that can been measured when formatting the
Nanobodies, this effect is particularly evident on IL-17F for
example for the cross-reactive Nanobody 13E02 X-X formatted as
13E02-35GS-13E02-9GS-ALB8 or as an Fc-fusion, for the
cross-reactive Nanobody 13B03 X-X formatted as an Fc-fusion and for
both Nanobodies F-X formatted as 16A04-9GS-ALB8-9GS-13B03 and
16A04-9GS-ALB8-9GS-13E02. As expected, no avidity effect is
observed for A-F constructs, but avidity is not necessary since the
building blocks have already a high affinity. For the Fc-fusion
constructs, the 13B03-Fc with the long hinge seems to give a higher
avidity effect than 13B03-Fc with the short hinge.
TABLE-US-00026 TABLE 22 Affinities for human IL-17A and IL17-F
binding of some of the monovalent and formatted wild-type
anti-IL-17 Nanobodies and reference compounds as determined in
KinExA. Nanobody conc Nanobody Kd (pM) Kd (pM) Specificity ID
construct (pM) IL-17A-6HIS IL-17F-6HIS A 04G01 600 13.4 A 04B09 600
20.7 X 01A01 200 1.3 X 13B03 500 22.5 4910.0 X 13E02 500 35.9
3625.0 F 16A04 100 19.4 F 07B11 600 12.8 X-X 13B03-SH-Fc 300 0.2
132.3 X-X 13B03-LH-Fc 50 2.0 20.0 X-X 13B03-LH-Fc 10 0.5 22.3 X-X
SH- (GS)2-Fc-13B03 100 144.8 X-X SH- (GS)2-Fc-13B03 10 0.1 X-X
13E02-SH-Fc 100 9.0 155.5 X-X 13E02-SH-Fc 30 3.6 X-X 13E02-LH-Fc
600 2040.0 X-X SH-(GS)2-Fc-13E02 100 11.8 X-X IL17MS1013
13E02-35GS- 300 0.3 230.0 13E02-9GS-ALB8 A-F IL17MS0089 02A08-35GS-
50 7.0 16A04-9GS-ALB8 A-F IL17MS0089 02A08-35GS- 100 17.9
16A04-9GS-ALB9 A-F IL17MS0089 02A08-35GS- 300 156.4 16A04-9GS-ALB9
F-A IL17MS0141 07B11-35GS- 50 5.0 04B09-9GS-ALB8 F-A IL17MS0141
07B11-35GS- 100 10.5 04B09-9GS-ALB8 F-X IL17MS2022 16A04-9GS-ALB8-
50 4.2 4.6 9GS-13B03 F-X IL17MS2024 16A04-9GS-ALB8- 50 4.6 1.7
9GS-13E02 A mAb02 Fab 200 362.8 A mAb02 IgG 500 112.2 A mAb02 IgG
100 255.6 F B-E52 mAB 600 643.0
Example 23: Sequence Optimization
[1191] Nanobodies IL17MS04G01 (A) (SEQ ID NO: 635), IL17MS16A04 (F)
(SEQ ID NO: 648), IL17MS13E02 (X) (SEQ ID NO: 664) and IL17MS13B03
(X) (SEQ ID NO: 662) were taken further for humanization and
sequence optimization. As such it is still possible to make all
formats A-F/F-A, X-F/F-X and X-X. Humanization is a process in
which parental wild type Nanobody.RTM. sequences are mutated to
yield Nanobody.RTM. sequences that are more identical to human
VH3-JH germline consensus sequences. Sequence optimization involves
replacing one or more specific amino acid residues in the sequence
in order to improve one or more (desired) properties of the
Nanobodies. Some examples of such sequence optimization are
mentioned in the further description herein and for example
include, without limitation, substitutions that improve long-term
stability or properties under storage, substitutions that increase
expression levels in a desired host cell or host organism, and/or
substitutions that remove or reduce (undesired) post-translational
modification(s) (such as glycosylation or phosphorylation), again
depending on the desired host cell or host organism. Specific amino
acids, with the exception of the so-called hallmark residues, in
the FRs that differ between the Nanobody.RTM. and the human VH3-JH
germline consensus are altered to the human counterpart in such a
way that the protein structure, activity and stability are kept
intact. The parental wild type Nanobody.RTM. amino acid sequence is
also aligned to the llama IGHV germline amino acid sequence of the
Nanobody.RTM. (identified as the top hit from a BlastP analysis of
the Nanobody.RTM. against the llama IGHV germlines), and in certain
cases mutations towards the llama germline are introduced to
increase the stability of the Nanobody, which is defined as
camelisation.
[1192] For example and without limitation, when the humanization
and sequence optimization of IL17MS04G01 were investigated, 8 amino
acid residues in IL17MS04G01 were found which can be substituted
for humanization/camelisation purposes and 1 possible amino acid
residue was found which could be substituted for improving chemical
stability. In the sequence optimization process of IL17MS04G01, 12
IL17MS04G01 versions (a basic variant and 11 additional variants)
were constructed. The basic variant (IL17MS3010) contains 5
substitutions: A14P, A74S, E81Q, K83R and Q108L. In addition to
these changes, the E1D, Q18L, T23A and A84P substitutions were
introduced and investigated in additional variants. They were
assembled from oligonucleotides using a PCR overlap extension
method. The constructs were expressed in E. coli and purified by
IMAC and desalting.
[1193] A selected number of variants were were evaluated for their
hIL-17 binding capacity by surface plasmon resonance and for their
neutralizing activity in Alphascreen. Also thermal stability of the
variants was tested in either DSC or in a thermal shift assay using
the Lightcycler (Roche). In this assay the Nanobodies variants are
incubated at different pH's in the presence of sypro orange and a
temperature gradient is applied. When the Nanobodies start
denaturing, sypro orange binds and the measured fluorescence
increases suddenly, as such a melting temperature can be determined
for a certain pH. The analysis occurred in two rounds, in a first
round single mutations and combined mutations upon the basic
variants were evaluated, and based upon these results, two final
variants were made were influence of the E1D mutation was studied.
These mutation is introduced to prevent possible pyroglutamate
formation. Results are summarized in Table 23 and 24.
[1194] In Tables 24, 26, 28, 30, 33 and 34: [1195] "IC50 cell based
assay hIL-17A" and "IC50 hIL17A", respectively, refer to the cell
based assay using hIL-17A described in Example 9; [1196] "IC50 cell
based assay hIL-17F" and "IC50 hIL17F", respectively, refer to the
cell based assay using hIL-17F described in Example 9; [1197] "IC50
cell based assay hIL-17A/F" and "IC50 hIL17A/F", respectively,
refer to the cell based assay using hIL-17A/F described in Example
9.
TABLE-US-00027 [1197] TABLE 23 results of analysis of the first
round sequence optimization variants of IL17MS04G01 average IC 50
Alpha- screen koff IL- Tm IL-17A-IL- koff hIL- 17A/F Tm at pH 7
(.degree. C.) ID Mutation(s) 17RA (pM) 17A (s-1) (1-s) (.degree.
C.) TSA DSC IL17MS04G01 WT 93 1.80- 2.30- 73.13-75 74.5 1.16E-04
1.70E-04 IL17MS3010 A14P, A74S, 184 1.30E-04 2.17E-04 74.79 74.4
basic E81Q, K83R, Q108L IL17MS3011 basic + Q18L 139 1.32E-04
2.23E-04 77.28 IL17MS3012 basic + T23A 101 1.37E-04 2.28E-04 71.47
69.5 IL17MS3013 basic + A84P 81 1.16E-04 1.85E-04 78.11 76.3
IL17MS3015 basic + Q18L, 171 79.8 A84P IL17MS3016 basic + T23A, 177
72.7 A84P IL17MS3017 basic + Q18L, 163 1.44E-04 2.42E-04 76.45 76.1
T23A, A84P
TABLE-US-00028 TABLE 24 Results of analysis of the second round
sequence optimization variants of IL17MS04G01 average IC50 IL- IC50
17A-IL- Alphascreen IC50 cell IC50 cell 17RA Tm at IL-17A- based
assay based assay competition koff koff cyno koff IL- pH 7 Tm
IL-17RA hIL-17A hIL-17A/F ELISA hIL-17A IL-17A 17A/F (.degree. C.)
(.degree. C.) ID Mutations (pM) (pM) (pM) (pM) (s-1) (s-1) (s-1)
TSA DSC IL17MS04G01 WT 93 710 7550 122 1.16E-04 3.20E-04 1.70-
73-75 74.5 2.30E-04 IL17MS3060 basic + 81 930 5500 181 1.50E-04
1.54E-04 2.09E-04 81 81.6 E1D, Q18L, A84P IL17MS3061 basic + 27 940
8150 1.46E-04 1.81E-04 1.95E-04 76.5 77.6 E1D, Q18L, T23A, A84P
[1198] In the receptor blocking assays, it was found that all
variations are well tolerated without significant changes in
potency (maximum 2 fold difference compared to Wild type). Also the
off-rate data are in the same range as the Wild type. Q18L and A84P
have a positive effect on the Tm. However T23A has a negative
effect on Tm and was therefore omitted from the final variant.
[1199] From the second round analysis (Table 24), it can be
concluded that the E1D mutation has no influence on Tm or potency.
The Tm of IL17MS3060 is 7.degree. C. higher than WT, Tm of
IL17MS3061 is only 2.5.degree. C. higher than WT, and therefore
IL17MS3060/3015 became the final variant, it's potency in the
receptor blocking assay is comparable to wild type and also in the
cell based HT-1080 assay on hIL-17A and h-IL17A/F potencies are in
the same range of the WT. The off-rates for IL17MS3060 on human
IL-17A, human IL-17A/F and cyno IL-17A are similar to the off-rate
of the WT. The % framework identity in the framework regions for
IL17MS3060 is 88.8% and for IL17MS3015 89.9%, based on the AbM
definition (see Antibody Engineering, Vol 2 by Kontermann &
Dubel (Eds), Springer Verlag Heidelberg Berlin, 2010).
TABLE-US-00029 TABLE 25 Results of analysis of sequence
optimization variants of IL17MS13B03 selected from a library
screen, A-RA = hIL-17A-IL-17RA Alphascreen; F-RC = hIL-17F-IL-17RC
Alphascreen IC50 IC50 F-RC A-RA fold fold Mutations difference
difference koff Tm at (basic = A14P, A74S, compared compared koff
(s-1) koff (s-1) IL-17A/F pH 7 ID K83R, Q108L) to WT to WT IL-17A
IL-17F (s-1) (.degree. C.) IL17MS13B03 WT 1.0 1 1.31E- 7.92E-03
.sub. 6.21E-05- 80 2.08E-04 1.25E-04 IL17MS3044 basic + S11L
2.12E-04 7.76E-03 2.53E-04 79 IL17MS3045 basic + T40A 2.70E-04
7.94E-03 6.16E-04 83 IL17MS3046 basic + N61A 2.81E-04 8.48E-03
5.15E-04 81 IL17MS3048 basic + D82aN 2.95E-04 8.74E-03 6.65E-04
81.5 IL17MS3050 basic + D16G 2.67E-04 8.55E-03 5.75E-04 82
IL17MS3051 N29F 1.4 0.4 2.05E-04 2.16E-03 3.96E-04 75 IL17MS3052
N29S 0.9 0.5 2.89E-04 4.39E-03 5.18E-04 78 IL17MS3053 S30T 1.3 1.22
2.58E-04 9.82E-03 5.20E-04 78 IL17MS3043 basic + D16G, D79Y
2.76E-04 8.11E-03 5.85E-04 91 IL17MS3049 basic + T40A, D79Y
1.50E-04 7.57E-03 2.48E-04 91 IL17MS3047 basic + S11L, D16G, T40A,
1.1 0.7 2.52E-04 3.48E-03 5.38E-04 94.5 N61A, D79Y, D82aN
[1200] Similarly and without limitation, when the humanization and
sequence optimization of IL17MS13B03 (SEQ ID NO 662) were
investigated, it was found that 10 amino acid residues in
IL17MS13B03 can be substituted for humanization purposes. In this
case the basic variant was made, containing mutations A14P, A74S,
K83R and Q108L. Then a mini-library of the basic mutant with
2.sup.5*3=96 permutations at positions 11, 16, 40, 61, 79 and 82aN
was constructed. Two additional libraries were constructed to
randomize position 29 and 30 to eliminate the deamidation site
N29S30.
[1201] The libraries were transformed in TG1 and individual
colonies were picked and grown in 96 well plates. Periplasmic
extracts were prepared, sequenced and screened for off-rates. The
mutations do not have an major influence on the off-rates. A
selection of constructs was purified to check potency in
Alphascreen and to determine Tm. Results are summarized in Table
25.
[1202] It was confirmed that most of the investigated mutants do
not have a major influence on the potency or on the off-rates of
13B03, only the N29S and N29F mutation seem to improve the potency
for human IL-17F. Since N29F causes a drop in the Tm, N29S was
chosen to elaborate further.
[1203] All other mutations show a slight increase in Tm and the
D79Y mutation even provokes an increase of Tm of 11.degree. C.
Second round variants were produced where all humanization
mutations and the N29S mutation were included. Also the effect of
the E1D mutation, to prevent the 20% pyroglutamate formation on
position E1, was evaluated. In addition, a F34M mutation was
included. Evaluation occurred through measuring receptor blocking
potency in protein based competition assays and cell based assays,
off-rate and Tm determination and is presented in Table 26. A huge
increase in Tm is observed for the new variants, compared to WT.
The potency of the variants for IL17A blocking is comparable with
the WT, however potencies of the variants for IL-17F have improved
significantly. The final variant became IL17MS3067 and IL17MS3068
(containing the E1D mutation in case the Nanobody is N-terminally
located in the multivalent construct). The % framework identity in
the framework regions for IL17MS3067 is 88.8% and for IL17MS3068
89.9%, based on the AbM definition.
[1204] Also, and again without limitation, when the humanization
and sequence optimization of IL17MS13E02 were investigated, it was
found that 8 amino acid residues in IL17MS13E02 can be substituted
for humanization/camelisation purposes. In the first round sequence
optimization process of IL17M13E02, 16 IL17MS13E02 versions (a
basic variant and 15 additional variants) were constructed. The
basic variant (IL17MS3018) contains 4 substitutions: A14P, A74S,
K83R and Q108L. In addition to these changes, the L37F, K71R, G75K
and I76N substitutions were introduced and investigated in
additional variants. They were assembled from oligonucleotides
using a PCR overlap extension method. A selection of the constructs
was expressed in E. coli and purified by IMAC and desalting for
further analysis.
[1205] In order to eliminate PTM sites, four libraries were
constructed to randomize position M34, M78, D100c and S100D. The
libraries were transformed in TG1 and individual colonies were
picked and grown in 96 well plates. Periplasmic extracts were
prepared, sequenced and screened for off-rates. Based on the
results the following mutants were chosen for further investigation
as purified protein: M34L, M34V, M78L, M78V, S100dT and S100dA.
Results are summarized in Table 27.
TABLE-US-00030 TABLE 26 Results of analysis of second round
sequence optimization variants of IL17MS13B03; A-RA =
hIL-17A-IL-17RA Alphascreen; F-RC = hIL-17F-IL-17RC Alphascreen
IC50 IC50 A-RA F-RC fold fold IC50 IC50 diffe- diffe- IC50 IC50
cell cell Mutations rence rence A-RA F-RC based based (basic =
A14P, com- com- compe- compe- assay assay A74S, K83R, pared pared
tition tition hIL17A hIL17F ID Q108L) to WT to WT ELISA ELISA (nM)
(nM) IL17MS13B03 WT 1.0 1.0 131 7042 1.34 35 IL17MS3066 basic +
E1D, S11L, 0.7 0.3 D16G, N29S, T40A, N61D, D79Y, D82aN IL17MS3068
basic + S11L, 1.2 0.2 D16G, N29S F34M, T40A, N61D, D79Y, D82aN
IL17MS3067 basic + E1D, S11L, 1.3 0.2 333 2301 0.7 35.0 D16G, N29S,
F34M, T40A, N61D, D79Y, D82aN IC50 IC50 cell cell based based assay
assay koff koff cyno hIL17A koff cyno koff cyno koff Tm at Tm IL17F
A/F hIL17A IL17A hIL17F IL17F hIL17A/F pH 7 DSC ID (nM) (nM) (s-1)
(s-1) (s-1) (s-1) (s-1) (.degree. C.) (.degree. C.) IL17MS13B03 29
+/- 4.32 1.31- 1.14E-04 7.92E-03 4.69E-03 6.21E-05- 80 81 15
2.08E-04 1.25E-04 IL17MS3066 96 IL17MS3068 99 100 IL17MS3067 13 +/-
1.8 1.33E-04 1.26E-04 1.38E-03 1.66E-03 1.83E-04 99 100 5
TABLE-US-00031 TABLE 27 Results of analysis of sequence
optimization variants of IL17MS13E02; A-RA = hIL-17A-IL-17RA
Alphascreen; F-RC = hIL-17F-IL-17RC Alphascreen IC50 A-RA IC50 F-RC
Mutation(s) fold fold koff koff Tm at (basic = A14P, A74S,
difference difference hIL-17A hIL-17F Biacore koff pH 7 ID K83R,
Q108L) vs WT vs WT (s-1) 17F (s-1) IL-17A/F (s-1) (.degree. C.)
IL17MS13E02 WT 1 1 1.14E-04 2.23E-03 3.97E-05 66 IL17MS3018 A14P,
A74S, 1.13 0.8 9.26E-05 2.67E-03 1.38E-05 67 basic K83R, Q108L
IL17MS3019 basic + L37F 3.72 4.6 7.45E-04 3.49E-02 3.10E-04 74.39
IL17MS3020 basic + K71R 1.24 1.3 2.84E-05 1.47E-03 <1E-0* 67.34
IL17MS3021 basic + G75K 2.75 0.9 2.16E-04 4.32E-03 6.43E-05 64.02
IL17MS3022 basic + I76N 1.17 0.9 6.41E-05 2.40E-03 9.89E-06 70.24
IL17MS3027 basic + K71R, I76N 1.23 0.6 1.30E-03 70.6 IL17MS3032
basic + K71R, G75K, I76N 1.42 0.5 8.30E-04 72.7 IL17MS3034 M34L
1.68 2.7 1.16E-04 5.96E-03 4.02E-05 63.93 IL17MS3038 M34V 3.2
2.25E-04 1.01E-02 6.82E-05 62 IL17MS3035 M78L 2 1.22 7.59E-05
4.31E-03 3.65E-05 66.47 IL17MS3039 M78V 1.25 2.10E-04 5.15E-03
4.03E-05 66.5 IL17MS3036 S100dT 2.06 2.2 1.32E-04 4.40E-03 4.31E-05
67.71 IL17MS3037 S100dA 1.61 1 1.16E-04 3.67E-03 4.67E-05 68.54
TABLE-US-00032 TABLE 28 Results of analysis of second round
sequence optimization variants of IL17MS13E02 ; A-RA = hIL-17A-
IL-17RA Alphascreen; F-RC = hIL-17F-IL-17RC Alphascreen IC50 IC50
IC50 IC50 fold fold based based IC50 Mutations diffe- diffe- assay
assay cell based (basic = A14P, A74S, rence rence hIL-17A hIL-17F
assay cyno ID K83R, Q108L) vs WT vs WT (nM) (nM) IL-17F (nM)
IL17MS13E02 WT 1 1 1.73 44 +/- 35 +/- 22 1 IL17MS3069 basic + K71R,
G75K, 0.15 I76N, M78L, S100dA IL17MS3070 basic + E1D, K71R, 0.58
0.15 0.74 18 +/- 34 +/- G75K, I76N, 10 33 M78L, S100dA IL17MS3071
basic + M34L, K71R, 0.3 G75K, I76N, M78L, S100dA IL17MS3072 basic +
E1D, M34L, 0.59 0.3 0.77 27 +/- 25.2 +/- K71R, G75K, I76N, 15 23
M78L, S100dA Biacore Biacore IC50 cell koff koff koff based assay
koff cyno koff cyno hIL- Tm at Tm hIL-17A/F hIL-17A IL-17A hIL-17F
IL-17F 17A/F pH 7 DSC ID (nM) (s-1) (s-1) (s-1) (s-1) (s-1)
(.degree. C.) pH 8.8 IL17MS13E02 1.99 1.14E-04 1.03E-04 2.23E-03
4.60E-02 3.97E-05 66.09 70 IL17MS3069 75.62 78 IL17MS3070 1.63
6.34E-05 5.85E-05 1.12E-03 1.62E-02 7.82E-05 75.62 IL17MS3071 73.55
IL17MS3072 3.5 73.55
[1206] The L37F mutation shows a drop in potency in the IL-17A-RA
and 1L-17F-RC Alphascreen and also the off-rate on IL-17F is
affected. Hence, the mutation was not included in the final
variant. The other humanization mutations K71R, G75K and I76N do
not have a major influence on the potency or on the off-rate and
were included in the final variant. Mutation of M34 to V or L
decreases the potency of 13E02.
[1207] Four second round variants were made of IL17MS3032
containing M78L and S100dA. Mutations M34L and E1D were randomized.
Results of the analysis of these variants are represented in Table
28. The E1 D mutation has no effect on Tm nor potency. The Tm of
all variants is increased with respect to WT (about 9.5.degree. C.
or 7.5.degree. C.). The potency of the variants improved compared
to WT, with the variant IL17MS3070, not containing the M34L
mutation, being the best. Therefore the M34L mutation was not
included in the final variants, which became IL17MS3069 and
IL17MS3070 (containing the E1D mutation in case the Nanobody is
N-terminally located in the multivalent construct) The % framework
identity in the framework regions for IL17MS3069 is 92.1% and for
IL17MS3070 91%, based on the AbM definition.
[1208] Similarly, and again without limitation, when the
humanization and sequence optimization of IL17MS16A04 were
investigated, it was found that 10 amino acid residues in
IL17MS16A04 can be substituted for humanization/camelisation
purposes. In this case the basic variant was made, containing
mutations A14P, K83R and Q108L. Then a mini-library of the basic
mutant with 2.sup.7=128 permutations at positions 48, 61, 63, 65,
74, 82a and 84 was constructed. Two additional libraries were
constructed to randomize position 55 and 56 to eliminate the
isomeristation site D55S56. The libraries were transformed in TG1
and individual colonies were picked and grown in 96 well plates.
Periplasmic extracts were prepared, sequenced and screened for
off-rates. A drop in off-rate is observed when introducing the V61D
and/or E63V mutation. These mutations will not be included in
consecutive variants. For the PTM libraries it was decided to
investigated further the mutations D55G, D55E and S56T. In first
instance a few mutants were purified, mainly to analyze the Tm,
results are summarized in Table 29.
TABLE-US-00033 TABLE 29 Results of analysis of sequence
optimization variants of IL17MS16A04 IC50 IL- 17F-IL 17RC
Mutation(s) Alphascreen (basic = fold koff koff Tm at A17P, K83R,
difference hIL-17F IL-17A/F pH 7 Tm (.degree. C.) ID Q108L) vs WT
(s-1) (s-1) (.degree. C.) DSC IL17MS16A04 WT 1.0 4.05E-04 2.40E-03
69.44 69 IL17MS3040 D55G 9.6 1.48E-03 8.78E-03 64.87 IL17MS3041
D55E 2.2 6.06E-04 4.27E-03 66.53 IL17MS3042 S56T 8.6 1.21E-03
5.00E-03 70.68 IL17MS3055 basic + D65G, 4.93E-04 3.32E-03 68.6
S82aN IL17MS3054 basic + G74S, 4.59E-04 3.08E-03 72.34 75.5 A84P
IL17MS3056 basic +I48V, 5.14E-04 2.88E-03 63.62 G74S
[1209] Without limitation to a specific mechanism, hypothesis or
explanation, based on the data it was assumed that D55E is the best
mutation with respect to affinity, but gives a small drop in Tm.
D55E is a conservative mutation, which was pursued further. D55G is
potency wise not a good candidate and gives a large drop in Tm and
was dropped. S56T is the best mutation with respect to the Tm, but
is potency wise less good.
[1210] Also, and again without limitation to a specific mechanism,
hypothesis or explanation, based on the data it was noted that
IL17MS3056 gives a drop in Tm, which is not seen in IL17MS3054
(which has the G74S mutation in common with IL17MS3056). Since the
A84P mutation usually increases stability, the drop in Tm is
probably caused by I48V. This was further examined. In a second
round, five variants with fixed mutations (basic+D65G, G74S, S82aN
and A84P) and randomized mutations (E1D, I48V, D55E, S56T) were
made and analyzed, of which the results are presented in Table
30.
[1211] Analysis of the second round variants confirmed that the
I48V mutation caused a drop in the Tm, and also negatively
influences the potency. Hence this mutation was omitted from the
final variant. The E1D mutation does not influence potency or Tm.
Although the potency of all variants decreased compared to WT,
IL17MS3063 was considered to be give the best results with respect
to potency in a monovalent format. This is not observed in the cell
based assays, but this assay is less sensitive than the
Alphascreen. The Tm of IL17MS3063 is slightly higher than of the
WT. Thus IL17MS3063 (when N-terminally), or a building block based
thereon without the E1D mutation (when not N-terminally in the
multivalent construct), were selected as the preferred amino acid
sequences of the invention for further investigation. The %
identity in the framework regions for IL17MS3063 is 86.5% and for
IL17MS3063 without the E1D mutation 87.6%, based on the AbM
definition.
TABLE-US-00034 TABLE 30 Results of analysis of second round
sequence optimization variants of IL17MS16A04 IC50 IL-17F- IL-17RC
IC50 IC50 cell Alphascreen cell based based assay IC50 cell koff
Mutations fold assay cyno based assay koff cyno koff Tm at Tm
(basic = A14P, A74S, difference hIL-17F IL-17F hIL-17A/F IL-F
IL-17F IL-17A/F pH 7 (.degree. C.) ID K83R, Q108L) vs WT (nM) (nM)
(nM) (s-1) (s-1) (s-1) (.degree. C.) DSC IL17MS16A04 WT 1.0 28 +/-
31 7.30 +/- 0.1 8.0 3.82- 6.36E-04 2.39- 69.4 69.0 4.10E-04
2.50E-03 IL17MS3059 Basic + E1D, I48V, 6.7 66.9 D55E, D65G, G74S,
S82aN, A84P IL17MS3062 Basic + I48V, D55E, 7.4 67.7 D65G, G74S,
S82aN, A84P IL17MS3063 Basic + E1D, D55E, 3.7 14 +/- 13 34.2 +/- 34
1.6 6.55E-04 1.11E-03 2.65E-02 71.0 74.5 D65G, G74S, S82aN, A84P
IL17MS3064 Basic + E1D, I48V, 30.3 68.9 S56T, D65G, G74S, S82aN,
A84P IL17MS3065 Basic + E1D, S56T, 12.7 D65G, G74S, S82aN, A84P
Example 24: Generation and Expression Level Analysis of the
Multivalent Sequence Optimized Anti-IL-17 Nanobodies with ALB11
HLE
[1212] The preferred sequence optimized variants were reformatted
in all possible combinations: A-F/F-A, X-F/F-X and X-X, with the
ALB-HLE in the middle connected with two 9GS-linkers. As back-up
also two A-only formats were generated (see Table 31). The
constructs were produced in Pichia pastoris as tagless proteins and
purified via MEP hypercel or Protein A affinity chromatography,
followed by desalting. A copy number screen was performed and
expression yields estimated from the clones with the highest copy
number (see Table 31).
TABLE-US-00035 TABLE 31 Results of expression level analysis of
purified multivalent sequence optimised anti-IL-17 Nanobodies with
ALB11 HLE estimated yield in Nanobody ID Construct fermentor (g/L)
IL17MS3076 IL17MS3070-9GS-ALB11-9GS- 1.5 IL17MS3068 IL17MS3077
IL17MS3067-9GS-ALB11-9GS- 1.5 IL17MS3069 IL17MS3078
IL17MS3070-9GS-ALB11-9GS- >1.5 IL17MS3069 IL17MS3079
IL17MS3067-9GS-ALB11-9GS- 1 IL17MS3068 IL17MS3080
IL17MS3060-9GS-ALB11 0.5 IL17MS3081 ALB11(with E1D)-9GS-IL17MS3015
<<0.5 IL17MS3082 IL17MS3060-9GS-ALB11-9GS- <0.5 IL17MS3063
(without E1D) IL17MS3083 IL17MS3063-9GS-ALB11-9GS- <0.5
IL17MS3015 IL17MS3084 IL17MS3063-9GS-ALB11-9GS- 1.5 IL17MS3068
IL17MS3085 IL17MS3067-9GS-ALB11-9GS- 1 IL17MS3063 (without E1D)
IL17MS3086 IL17MS3063-9GS-ALB11-9GS- 1.5 IL17MS3069 IL17MS3087
IL17MS3070-9GS-ALB11-9GS- 1 IL17MS3063 (without E1D)
Example 25: Analysis of the Blocking Capacity of the Multivalent
Sequence Optimized Anti-IL-17 Nanobodies with ALB11 HLE in a
Competition ELISA Using Human IL-17A or IL-17F
[1213] Potencies were checked in the IL-17A-IL-17RA and
IL-17F-IL-17RC competition ELISA, as described in Example 17. IC50
values are presented in Table 32.
TABLE-US-00036 TABLE 32 Results of blocking capacity of the
purified multivalent sequence optimised anti-IL17 Nanobodies with
ALB11 HLE in competition ELISA; IC50 IC50 comp comp ELISA ELISA
parental parental IL-17A- IL-17F- N-terminal Middle C-terminal
IL-17RA IL-17RC Specificity Nanobody ID Nanobody Nanobody Nanobody
(pM) (pM) X-X IL17MS3076 13E02 ALB11 13B03 64 149 X-X IL17MS3077
13B03 ALB11 13E02 62 153 X-X IL17MS3078 13E02 ALB11 13E02 58 143
X-X IL17MS3079 13B03 ALB11 13803 56 184 A IL17MS3080 04G01 ALB11
140 NI A IL17MS3081 ALB11 04G01 nd nd A-F IL17MS3082 04G01 ALB11
16A04 43 100 F-A IL17MS3083 16A04 ALB11 04G01 141 99 F-X IL17MS3084
16A04 ALB11 13B03 29 16 X-F IL17MS3085 13B03 ALB11 16A04 40 20 F-X
IL17MS3086 16A04 ALB11 13E02 54 13 X-F IL17MS3087 13E02 ALB11 16A04
88 23 X mAB03 50 17 A mAB02 3309 NI NI = non-inhibiting, nd = not
determined
Example 26: Blocking Activity of Purified Multivalent Sequence
Optimized Anti-IL-17 Nanobodies with ALB11 HLE in Cell-Based Assay
Using Human IL-17A, IL-17F and IL-17A/F in Presence or Absence of
HSA
[1214] The dose-dependent inhibition of hIL-17A, hIL-17F,
hIL-17A/F, cIL-17A, and cIL-17F induced IL-6 secretion by HT-1080
cells was investigated for 5 purified multivalent sequence
optimized anti-IL-17 Nanobodies with ALB11 HLE in the HT-1080
bioassay as in Examples 18 and 20.
[1215] Results show that the 5 purified multivalent sequence
optimized anti-IL-17 Nanobodies tested inhibit hIL-17A, hIL-17F,
hIL-17A/F, cIL-17A, and cIL-17F with similar, sub-nanomolar to
single-digit nanomolar potencies (Table 33). Potencies and
efficacies are similar or better than those observed with the
anti-IL-17A and anti-IL-17A/F mAb reference compounds. Furthermore,
addition of 100 .mu.M HSA to cultures had no significant impact on
the potency of the purified multivalent sequence optimized
anti-IL-17 Nanobodies (Table 34 compared to Table 33).
TABLE-US-00037 TABLE 33 IC50-values of formatted sequence optimized
anti-IL-17 Nanobodies in the HT-1080 bioassay in absence of HSA.
Cellular assay HT-1080 (1500 cells) IC50 IC50 IC50 IC50 IC50 Cyno
Cyno Nanobody or hIL17A.sup.1) Emax hIL17F.sup.2) Emax
hIL17A/F.sup.3) Emax IL17A.sup.4) Emax IL17F.sup.5) Emax control
Construct (nM) (%) (nM) (%) (nM) (%) (nM) (%) (nM) (%) IL17MS3079
IL17MS3067-9GS- 0.35 .+-. 95 .+-. 2 5.4 .+-. 3 82 .+-. -3 0.59 .+-.
0.25 83 .+-. 26 0.35 .+-. 97 .+-. 1 4.5 .+-. 4 88 .+-. 20
ALB11-9GA- 0.08 0.04 IL17MS3068 IL17MS3084 IL17MS3063-9GS- 0.44
.+-. 94 .+-. 1 5.5 .+-. 3 85 .+-. 6 1.66 .+-. 1.2 82 .+-. 23 0.37
.+-. 97 .+-. 2 5.0 .+-. 2 89 .+-. 16 ALB11-9GS- 0.03 0.06
IL17MS3068 IL17MS3085 IL17MS3067-9GS- 0.54 .+-. 94 .+-. 1 5.8 .+-.
3 87 .+-. 4 0.98 .+-. 0.5 83 .+-. 21 0.44 .+-. 95 .+-. 5 6.7 .+-. 1
90 .+-. 11 ALB11-9GS- 0.16 0.04 IL17MS3063 (without E1D) IL17MS3086
IL17MS3063-9GS- 0.50 .+-. 95 .+-. 1 3.4 .+-. 1 84 .+-. 7 1.85 .+-.
0.7 87 .+-. 0.35 .+-. 96 .+-. 1 3.6 .+-. 3 94 .+-. 11 ALB11-9GS-
0.13 -23 0.08 IL17MS3069 IL17MS3087 IL17MS3070-9GS- 0.44 .+-. 94
.+-. 2 5.8 .+-. 1 84 .+-. 5 1.04 .+-. 0.2 87 .+-. 24 0.39 .+-. 97
.+-. 5 6.7 .+-. 2 95 .+-. 5 ALB11-9GS- 0.01 0.04 IL17MS3063
(without E1D) mAb03 mAb 0.89* 94 7.1 .+-. 0.5 88 .+-. -9 1.93* 102
2.8 .+-. 1.6 93 .+-. 1 6.3 .+-. 1 96 .+-. 18 mAb02 mAb 0.74* 90
0.95* 60 final ligand concentration 1 nM; .sup.2)final ligand
concentration 15 nM; .sup.3)final ligand concentration 5 nM;
.sup.4)final ligand concentration 15 nM; .sup.5)final ligand
concentration 1 nM; Results are expressed as mean .+-. SD of N
experiments. N = 2 or *N = 1.
TABLE-US-00038 TABLE 34 IC50-values of formatted sequence optimized
anti-IL-17 Nanobodies in the HT-1080 bioassay in presence of HSA.
Cellular assay HT-1080 (1500 cells) IC50 IC50 IC50 IC50 IC50 Cyno
Cyno Nanobody or hIL17A Emax hIL17F Emax hIL17A/F Emax IL17A Emax
IL17F Emax control Construct (nM) (%) (nM) (%) (nM) (%) (nM) (%)
(nM) (%) IL17MS3079 IL17MS3067-9GS- 0.50 .+-. 91 .+-. 1 8.5 .+-. 1
87 .+-. 2 1.32 .+-. 0.3 95 .+-. 11 0.40* 100 4.0* 89 ALB11-9GA-
0.03 IL17MS3068 IL17MS3084 IL17MS3063-9GS- 0.55 .+-. 93 .+-. 0 5.6
.+-. 5 89 .+-. 3 1.14 .+-. 0.9 96 .+-. 18 0.30* 98 1.1* 97
ALB11-9GS- 0.16 IL17MS3068 IL17MS3085 IL17MS3067-9GS- 0.73 .+-. 92
.+-. 2 6.6 .+-. 6 89 .+-. 4 1.58 .+-. 1.4 90 .+-. 9 0.33* 98 8.0*
80 ALB11-9GS- 0.21 IL17MS3063 (without E1D) IL17MS3086
IL17MS3063-9GS- 0.70 .+-. 93 .+-. 0 6.0 .+-. 4 91 .+-. 4 2.52 .+-.
94 .+-. 15 0.33* 98 1.2* 97 ALB11-9GS- 0.20 0.09 IL17MS3069
IL17MS3087 IL17MS3070-9GS- 0.57 .+-. 91 .+-. 4 6.3 .+-. 4 83 .+-. 9
1.54 .+-. 1.3 88 .+-. 16 0.35* 94 7.0* 70 ALB11-9GS- 0.16
IL17MS3063 (without E1D) mAb03 mAb 0.89* 90 8.3 .+-. 1 90 .+-. 6
1.67* 104 2.68* 90 1.9* 96 mAb02 mAb 1.42* 88 9.21* 72 Results are
expressed as mean .+-. SD of N experiments. N = 2 or *N = 1.
Example 27: Binding of Formatted Sequence Optimized Anti-IL-17
Nanobodies, Carrying the ALB11 HLE, to Human Serum Albumin
[1216] For the 5 selected formatted sequence optimized anti-IL-17
Nanobodies carrying the ALB11 HLE, off-rates for binding to human
serum albumin were determined by surface plasmon resonance, using
the Biacore (Table 35). All Nanobodies show similar off-rates
ranging from 5.1E-03 to 4.4E-03 s-1, comparable to the wild-type
formatted anti-IL-17 Nanobodies
TABLE-US-00039 TABLE 35 Affinities for HSA of ALB11 HLE anti-IL-17
formatted sequence optimized Nanobodies specificity Nanobody ID
koff (s-1) X-X IL17MS3079 4.40E-03 F-X IL17MS3084 4.60E-03 X-F
IL17MS3085 4.60E-03 F-X IL17MS3086 5.00E-03 X-F IL17MS3087
5.10E-03
Example 28: Blocking Activity of Purified Multivalent Sequence
Optimized Anti-IL-17 Nanobodies Carrying the ALB11 HLE In Vivo in
Mice Administered with Recombinant Human IL-17A and IL-17F
[1217] Although the monovalent and multivalent anti-IL-17
Nanobodies described herein do not recognize mouse IL-17A nor
IL-17F, mouse cells are responsive to human recombinant IL-17A and
IL-17F (see WO2007/070750, Example 7). Furthermore, recombinant
IL-17A or IL-17F administered to normal mice induce a secretion of
the chemokine CXCL8 (aka KC for keratinocyte-derived Chemokine)
which can be measured in serum at selected time points. The ability
of the formatted sequence optimized anti-IL-17 Nanobody carrying
the ALB11 HLE Nanobody IL17MS3086 to block in vivo induction of
serum KC after injection of recombinant human IL-17A (rhIL-17A) or
recombinant human IL-17F (rhIL-17F) was investigated in mice. Each
group of five mice received a subcutaneously (s.c) injection of 100
.mu.l PBS, either alone (sham group PBS) or containing 10
.mu.g/mouse of recombinant human IL-17A or IL-17F. Four hours
before IL-17 injection, mice were treated intravenously (i.v.) with
isotype control antibody, control Nanobody (ALB11) or with
anti-human IL-17 Nanobody IL17MS3086 (100 .mu.g, 28.5 .mu.g, 8.1
.mu.g, or 2.3 .mu.g/mouse). The anti-IL-17A monoclonal antibody
mAb02, the anti-IL-17F monoclonal antibody mAb B-F60, and dual
specific anti-IL17A/F monoclonal antibody mAb03 were used as
reference controls. Equimolar doses of antibodies versus Nanobody
were used for better comparison (350 .mu.g, 100 .mu.g, 28.5 .mu.g
or 8.1 .mu.g antibodies). At two hours after rhIL-17A
administration and four hours after rhIL-17F administration, blood
was collected and mice sacrificed. The serum was collected and
analyzed for KC levels by ELISA.
[1218] Both rhIL-17A and rhIL-17F induced and increase in KC
levels, although this was more pronounced with rhIL-17A (FIG. 12).
The IL17MS3086 Nanobody blocked the ability of rhIL-17A and
rhIL-17F to induce KC in mouse serum. Blocking was clearly
dose-dependent for rhIL-17A (FIG. 12). At all doses tested, the
IL17MS3086 Nanobody blocked the ability of rhIL-17F to induce KC in
mouse serum better than the equivalent dose of mAb03 or mAb B-F60.
Additionally, the inhibition by the Nanobody was better at
equivalent doses to what seen with mAb03 or mAb02 for rhIL-17A, as
for example a dose of 8.1 .mu.g of IL17MS3086 significantly
neutralized rhIL-17A-induced KC in serum while the same dose of
mAb02 or mAb03 (FIG. 12) did not.
Example 29: Affinity Determination of a Formatted Sequence
Optimized Anti-IL17 Nanobody with ALB11 HLE Using the KinExA
Technology
[1219] The relative affinity of IL17MS3091 (SEQ ID NO: 838; FIG.
8)--a Myc-HIS tagged variant of the formatted sequence optimized
with ALB11 HLE anti-IL-17 Nanobody IL17MS3086--for human and
cynomolgus monkey IL-17A and IL-17F was assessed using the
KinExA.RTM. (Kinetic Exclusion Assay) method for measuring the
equilibrium dissociation constant (Kd) in solution. Values of the
kinetic binding constants Kon and Koff were not determined.
[1220] Range and average Kd values observed with IL17MS3091 (see
Table 36) suggest that the parent formatted sequence optimized
anti-IL-17 Nanobody IL17MS3086 binds in solution with very strong
affinity (single digit pM to sub-pM) to IL-17A and IL-17F, with a
slightly better affinity for IL-17A. In addition, there were no
significant differences between the Kd observed for human and
cynomolgus recombinant cytokines,
TABLE-US-00040 TABLE 36 Range and average Kd values observed with
IL17MS3091 by KinExA Kd - (picoM) Range Cytokine Low-High Average
human IL-17A 0.094-1.02 0.4 cynomolgus IL-17A 0.476-3.14 1.37 human
IL-17F 0.146-3.16 1.14 cynomolgus IL-17F 0.360-11.2 2.82
[1221] In comparison, the binding affinity as determined by Biacore
of mAb03 for hIL-17A was 15 pM, and for hIL-17F was 10 pM. Hence, a
polypeptide with a combination of a Class 3 ISV with a Class 4 ISV
results in superior binding affinities compared to conventional
antibodies.
Example 30: Species Cross-Reactivity of a Formatted Sequence
Optimized Anti-IL17 Nanobody with ALB11 HLE
[1222] Binding to IL17A and IL17F of other species was assessed for
IL17MS3091, a tagged version of IL17MS3086, using a binding ELISA
as described in Example 11. IL17MS3091 shows binding to marmoset
and cynomolgus IL17A and IL17F. No signals are detected for binding
to IL17A from mouse, rat and guinea pig origin nor for binding to
IL17F from mouse and rat origin (Table 37 and 38).
TABLE-US-00041 TABLE 37 OD values obtained for binding of
IL17MS3091 to IL17A of different species in a binding ELISA,
signals of positive and negative controls are presented as well.
Human cyno marmo- mouse rat guinea pig Samples IL17A IL17A set
IL17A IL17A IL17A IL17A Negative control 0.018 0.011 0.013 0.015
0.010 0.011 Positive controls 3.979 4.085 4.122 3.628 3.641 --*
IL17MS3091 1.523 2.225 2.517 -0.005 0.000 0.103 *no control
available for guinea pig IL17A
TABLE-US-00042 TABLE 38 OD values obtained for binding of
IL17MS3091 to IL17F of different species in a binding ELISA. Human
cyno marmoset mouse rat Samples IL17F IL17F IL17F IL17F IL17F
Negative control 0.017 0.021 0.020 0.046 0.037 Positive control
3.564 3.981 3.550 3.549 3.571 IL17MS3091 0.741 1.314 0.573 -0.034
-0.027
Example 31: Specificity of a Formatted Sequence Optimized Anti-IL17
Nanobody with ALB11 HLE
[1223] Off-target binding of IL17MS3086 was assessed by measuring
the binding capacity of this Nanobody to human IL-17B, IL-17C,
IL-17D or IL-17E by SPR as described in Example 12.
[1224] Whereas all control antibodies bound to their respective
targets, IL17MS3086 did not bind to human IL-17B, IL-17C, IL-17D or
1L-17E.
Example 32: Pharmacokinetic Profile of IL17MS3086 in Female
Cynomolgus Monkeys
[1225] The pharmacokinetic profile of IL17MS3086 was determined in
female cynomolgus monkey following a single intravenous (i.v.)
bolus dose (2 and 6 mg/kg) and after a single subcutaneous (s.c.)
dose (6 mg/kg). IL17MS3086 was dosed to three healthy treatment
naive female cynomolgus monkeys per route and per dose level.
[1226] For the pharmacokinetic data analysis, descriptive
statistics were calculated per route, per dose group and per
sampling time point.
[1227] Individual plasma concentration-time profiles were subjected
to non-compartmental analysis (NCA) using WinNonlin Pro 5.1
(Pharsight Corporation, USA; 2006). The area under the curve (AUC)
was estimated using the lin up/log down rule. LLOQ values were
treated as missing, except when comprised between two values above
the LLOQ (lower limit of quantification), then they were set to
zero.
[1228] The following main pharmacokinetic parameters were
estimated: the plasma concentration at time zero (C0) after i.v.
administration or maximum plasma concentration (C.sub.max) after
s.c. administration; the area under the plasma concentration-time
curve extrapolated to infinity (AUC.sub.inf), (apparent) total body
clearance (CL for i.v. data, CL/F in case of s.c. data), volume of
distribution at steady-state (Vd.sub.ss) in case of i.v. data only,
the terminal half-life (t.sub.1/2) and the absolute s.c.
bioavailability (F).
[1229] In case of i.v. data, the concentration at time zero
(C.sub.0) was estimated through back-calculation based on the two
first data points. The terminal elimination half-life (t1/2) was
calculated automatically (best-fit) using a log-linear regression
of the non-zero concentration-time data of the log-linear portion
of the terminal phase. A minimum of three points were considered
for the determination of .lamda.z.
[1230] In one animal, i.e. No 6317 (i.v., 2 mg/kg) positive ADA
titers, as evaluated with a homogeneous electrochemiluminescent
bridging MSD assay, correlated with a slope change in the
pharmacokinetic profile (from 21 d post-dose onwards). This animal
was therefore removed from subsequent PK data analysis.
[1231] In FIG. 13, the mean serum concentration-time profiles of
IL17MS3086 following a single i.v. bolus dose at 2 and 6 mg/kg or a
single s.c. dose at 6 mg/kg, respectively in the female cynomolgus
monkey are depicted.
[1232] Table 39 lists the main pharmacokinetic parameters and
corresponding descriptive statistics, of IL17MS3086 following a
single i.v. bolus dose at 2 and 6 mg/kg or a single s.c. dose at 6
mg/kg, respectively in the female cynomolgus monkey.
TABLE-US-00043 TABLE 39 Main pharmacokinetic parameters (n = 2 or
3) of IL17MS3086 following single i.v. bolus dose with 2 and 6
mg/kg (upper panel) or a single s.c. dose with 6 mg/kg (lower
panel), respectively in the female cynomolgus monkey. Single
intravenous (i.v.) administration C.sub.0 AUC.sub.inf CL Vd.sub.ss
t.sub.1/2 Dose level (.mu.g/ml) (day*.mu.g/ml (ml/day/kg) (ml/kg)
(day) 2 mg/kg N 2 2 2 2 2 Mean 46.8 218 9.17 81.0 6.05 SD NC NC NC
NC NC Min 46.2 216 9.10 78.5 5.39 Median 46.8 218 9.17 81.0 6.05
Max 47.4 220 9.24 83.4 6.71 CV % NC NC NC NC NC 6 mg/kg N 3 3 3 3 3
Mean 181 866 6.99 64.4 6.86 SD 17.5 102 0.774 9.02 1.15 Min 168 796
6.11 58.9 5.72 Median 174 818 7.34 59.6 6.86 Max 201 983 7.53 74.8
8.01 CV % 9.67 11.8 11.1 14.0 16.7 NC, not calculated
TABLE-US-00044 TABLE 39 lower panel Single subcutaneous (i.v.)
administration C.sub.max T.sub.max AUC.sub.inf CL/F t.sub.1/2 Dose
level (.mu.g/ml) (day) (day*.mu.2/ml (ml/day/k (day) 6 mg/kg N 3 3
3 3 3 Mean 62.7 1.1 667 9.07 6.79 SD 10.3 0.858 76.2 0.973 0.246
Min 52.6 0.292 623 7.95 6.61 Median 62.3 1 623 9.63 6.71 Max 73.2 2
755 9.64 7.07 CV % 16.4 78.2 11.4 10.7 3.62
[1233] Following i.v. bolus administration, the pharmacokinetic
profile of IL17MS3086 displayed a bi-exponential decline. During
the first day after i.v. dosing a distribution phase was apparent.
Thereafter IL17MS3086 serum concentrations declined in a
mono-exponential fashion. The available data did not suggest target
mediated disposition in these healthy monkeys.
[1234] After i.v. administration, the exposure to IL17MS3086
(AUC.sub.inf) increased with increasing dose. The increase in
exposure was slightly greater than dose proportional over the 2-6
mg/kg dose range (AUC.times.3.96 vs dose.times.3) leading to CL
values of 9.17 and 6.99 ml/kg/day at 2 and 6 mg/kg i.v.,
respectively. Corresponding values of Vd.sub.ss were 81.0 and 64.4
ml/kg, respectively suggesting distribution to the tissues. The
t.sub.1/2 was ca 6-7 d, in line with the serum half-life of
cynomolgus albumin.
[1235] After s.c. administration, C.sub.max occurred at 1 d
post-dose. No evidence of absorption controlled kinetics (t.sub.1/2
ca 6.8 versus 6-6.8 d) was apparent after s.c. administration. The
absolute s.c. bioavailability was estimated at 77%.
Example 33: In Vivo Efficacy of an Anti-IL-17 A/F Nanobody in a
Collagen-Induced Cynomolgus Monkey Model
[1236] A collagen-induced arthritis (CIA) cynomolgus monkey model
was used to assess the in vivo efficacy of IL17MS3086. In brief,
3-6 year old female cynomolgus monkeys of Chinese origin were
anesthetized by an intramuscular injection of ketamine
hydrochloride (Kamud Drugs Pvt., Ltd 50 mg/ml) and were
subsequently sensitized with bovine type II collagen in Freund's
complete adjuvant subcutaneously over 19 sites on the back and at
one site at the base of the tail. The sensitization procedure was
repeated on day 21 of the study. On the same day as the first
sensitization and once a week henceforth, the animals were dosed
with either 10 mg/kg or 2.8 mg/kg IL17MS3086 (9-10 animals/group)
subcutaneously. These two selected doses corresponded to either an
equivalent dose (10 mg/kg) or an equimolar dose (2.8 mg/kg) to a
dual specific anti-IL17A/F monoclonal antibody mAb03 that was used
as reference control and also administered subcutaneously at 10
mg/kg. Additionally, both a negative control group (9 animals until
day 28 and 8 animals thereafter) and a positive control group (2
animals) were included. The negative control animals were dosed
subcutaneously with formulation buffer whereas the positive control
group animals were dosed intravenously with 10 mg/kg of Tocilizumab
(RoActemra.RTM.), an anti-IL-6R monoclonal antibody, following the
same schedule. Tocilizumab was previously shown to effectively
reduce arthritis related changes in a similar CIA cynomolgus monkey
model (Uchiyama et al, 2008; Biol. Pharm. Bull, 31(6):
1159-1163).
[1237] All animals from all groups were observed at least once
daily throughout the study duration that lasted 8 weeks following
which they were all necropsied. The symptoms of arthritis were
evaluated using a visual scoring system and radiography. In
addition, C-reactive protein (CRP), an inflammatory parameter, was
monitored regularly. Each animal underwent numerous assessments at
various timepoints that are summarized in Table 40.
TABLE-US-00045 TABLE 40 Measured endpoints in the cynomolgus monkey
CIA study Endpoint Timepoints Methods Arthritis Acclimation: Day -4
of Swelling of the metacarpophalangeal, proximal interphalangeal
distal interphalangeal sensitization joints and the wrist, ankle,
elbow and knee joints was evaluated blindly and scored as Dosing
period: Days 7 follows: 0 = No abnormality, 1 = Swelling not
visible but can be determined by touch, 14, 21, 28, 35, 42, 49, 2 =
Swelling slightly visible and can be determined by touch, 3 =
Swelling clearly 56 visible and joint can be completetly flexed, 4
= Swelling clearly visible but joint cannot be completely flexed, 5
= Rigidity of the joints. The arthritis score of each animal is the
total of the swelling scores for the individual joints. General
condition Acclimation: Day -4 of The general condition of each
animal was scored as follows: 0 = No abnormality, 1 = sensitization
Difficulty in hanging from the bars of the cage by the fingers, 2 =
Inability to hang from Dosing period: Days 7, the bars of the cage
by the fingers (using wrists), 3 = Movement only by using 14, 21,
28, 35, 42, 49, forelimbs or hindlimbs, 4 = Crouching, 5 = Abnormal
body position. 56 X-ray examination Acclimation: Day -4 of X-ray
images were taken, whilst the animal was under ketamine
hydrochloride sensitization anesthesia, using an X-ray TV system
(DREX-WIN64, Toshiba Medical Systems Dosing period: Days 28,
Corporation). The images were then examined to determine the
condition of the joints 56 of the hands and feet
(metacarpophalangeal, proximal interphalangeal and distal
interphalangeal joints of all fingers except the first finger - 48
joints/animal). Each joint with a narrowing of the joint space
and/or atrophy was given a score of 1. Similarly when bone erosion
or architectural joint destruction was present the joint was given
a score of 1. The total score for each parameter was then
determined. Body weight Acclimation: Day -1 of All the animals were
weighed using an electronic balance (HP-40K, A&D Co., Ltd.)
sensitization Dosing period: Days 7, 14, 21, 28, 35, 42, 49, 56
Clinical signs Daily All animals were observed throughout the
duration of the study for clinical signs and mortality. Behaviour,
Consciousness, position neurological examination, respiration, body
temperature, pulse, stool, urine, vomiting/salivation and
skin/fur/mucosa were observed as necessary Blood CRP levels
Acclimation: Day -6 of The serum CRP levels were determined in a
latex turbidimetric immunoassay using an sensitization automatic
analyzer (JCA-BM6070, JEOL Ltd.) and expressed as mg/dL. Dosing
period: Days 7, 14, 21, 28, 35, 42, 49, 56 Histopathology Following
necropsy on After collection the skin of the carpal and tarsal
joint and digits were cut with scissors day 57 before being excised
and fixed in 10% neutral buffered formalin. Following delipidation
in ethanol and decalcification in EDTA decalcification solution,
the joints were paraffin-embedded and prepared for sectioning. The
slides were subsequently stained with hematoxylin-eosin and
safranin-O before being microscopically examined.
[1238] The sensitization with bovine type II collagen effectively
led to progressive joint stiffness and swelling that reached a
maximum on day 56, as measured by the arthritic score in the
negative control group animals. In contrast, the IL17MS3086, mAb03
and positive control treated animals displayed a significant
(p<0.01) reduction in arthritic scores (FIG. 14) which were
paralleled by a mild reduction in serum CRP levels, although these
levels were not reduced to the extent of that of the positive
control group animals (FIG. 15).
[1239] Additionally, radiological examination of the affected
joints at the end of the study showed that IL17MS3086-treatment
significantly reduced bone erosion and architectural joint
destruction (Score B) (p<0.01) and to a lesser extent joint
space narrowing (Score A) (FIG. 16) which are hallmarks of
arthritis (Van der Heijde et al., 1995; J. Rheumatol. 22(9):
1792-1796). The protective effect of IL17MS3086 on pathological
joint changes was further confirmed by histological examination of
the joints following necropsy. The joint sections were scored for
several parameters which are closely linked to the biology of
IL-17A and IL-17F and are indicative of joint inflammation and bone
remodeling based on the criteria depicted in Table 41. The results
showed that the incidence of severe grades was decreased following
IL17MS3086-treatment for all findings similarly to that seen after
mAb03-treatment or positive control-treatment and that they were
equally effective in that respect (FIG. 17).
[1240] As a result of the improvement seen on joint stiffness,
swelling and damage the IL17MS3086-treated animals had a
concomitantly improved general condition score which was indicative
of a lesser discomfort and an improved joint mobility in comparison
to the buffer-treated animals (FIG. 18). Finally, the drop in
body-weights for the IL17MS3086-treated animals at the end of the
study, in comparison to the initial body-weights, were within 5%
similarly to the mAb03-treated animals, whereas the body weights
dropped by 14%.+-.2.5% (mean.+-.SEM) for the buffer-treated
animals.
[1241] All these findings are consistent with a decreased disease
severity in the IL17MS3086-treated and mAb03-treated animals and
demonstrated that IL17MS3086-treatment improved the arthritis in
this established CIA monkey model. Interestingly, no
dose-dependency was observed for the IL17MS3086-treated animals for
the assessed endpoints likely indicating that the 2.8 mg/kg dose
already gives maximal efficacy which was similar to that of the 10
mg/kg dose of mAb03.
[1242] The blocking activity study in mice of Example 28 shows a
dose effect of IL17MS3086 inhibiting IL-17A induced KC serum
levels. In FIG. 12A (with doses adjusted to .mu.g/kg), a dose of
.about.0.1 mg/kg (2.3 .mu.g/mouse) reduces KC serum levels
significantly. A dose of .about.0.4 mg/kg (8.1 .mu.g/mouse) or
.about.1.4 mg/kg (28.5 .mu.g/mouse) further reduces the KC serum
levels. However, it appears that already 0.4 mg/kg IL17MS3086 is
saturating, i.e. a plateau is reached in that 1.4 mg/kg
IL17MS308628 only reduces KC serum levels only minimally. In
contrast, mAb03 was not saturating in this study.
[1243] In the present Cynomolgus CIA study 2.8 mg/kg and 10 mg/kg
IL17MS3086 were used, which in analogy are also saturating, while
mAb03 would not be.
[1244] Accordingly, IL17MS2086 appears also more efficacious in the
present study.
TABLE-US-00046 TABLE 41 Scoring criteria for histological analysis
Findings Grade Criteria Hyperplasia in + Increase in synovial cells
synovial cells 2+ Marked increase in synovial cells Granulation
tissue .+-. Granulation tissue in less than 30% of joint cavity
morphogenesis* + Granulation tissue in 30% to 80% of joint cavity
2+ Granulation tissue in more than 80% of joint cavity Fibrosis +
Sparse fibre and abundant cell content 2+ Abundant and dense fibre,
and scarce cell content Degeneration of .+-. Rough surface of joint
cartilage, and disappearance joint cartilage of circular and
spindle chondrocytes in cartilage + Acidophilic joint cartilage,
degenerative necrosis of chondrocytes, and partial destruction 2+
Wide range destruction of existing joint cartilage Osteoclasia +
Partial bone destruction 2+ Bone destruction in the medullary
cavity Osteogenesis + Increase in osteoblasts and neogenesis in
bone Neutrophil .+-. Minimal infiltration infiltration + Moderate
infiltration 2+ Marked infiltration
Sequence CWU 0 SQTB SEQUENCE LISTING The patent application
contains a lengthy "Sequence Listing" section. A copy of the
"Sequence Listing" is available in electronic form from the USPTO
web site
(https://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20220195031A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
0 SQTB SEQUENCE LISTING The patent application contains a lengthy
"Sequence Listing" section. A copy of the "Sequence Listing" is
available in electronic form from the USPTO web site
(https://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20220195031A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
* * * * *
References