U.S. patent application number 17/687411 was filed with the patent office on 2022-06-16 for rna targeting of mutations via suppessor trnas and deaminases.
The applicant listed for this patent is The Regents of the University of California. Invention is credited to Dhruva Katrekar, Prashant Mali.
Application Number | 20220186226 17/687411 |
Document ID | / |
Family ID | 1000006181688 |
Filed Date | 2022-06-16 |
United States Patent
Application |
20220186226 |
Kind Code |
A1 |
Mali; Prashant ; et
al. |
June 16, 2022 |
RNA TARGETING OF MUTATIONS VIA SUPPESSOR tRNAs AND DEAMINASES
Abstract
Aspects of the disclosure relate to a gene therapy approach for
diseases, disorders, or conditions caused by mutation in the stop
codon utilizing modified tRNA. At least 10-15% of all genetic
diseases, including muscular dystrophy (e.g. Duchene muscular
dystrophy), some cancers, beta thalassemia, Hurler syndrome, and
cystic fibrosis, fall into this category. Not to be bound by
theory, it is believed that this approach is safer than CRISPR
approaches due to minimal off-target effects and the lack of genome
level changes.
Inventors: |
Mali; Prashant; (La Jolla,
CA) ; Katrekar; Dhruva; (La Jolla, CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
The Regents of the University of California |
Oakland |
CA |
US |
|
|
Family ID: |
1000006181688 |
Appl. No.: |
17/687411 |
Filed: |
March 4, 2022 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
17170693 |
Feb 8, 2021 |
|
|
|
17687411 |
|
|
|
|
16864911 |
May 1, 2020 |
|
|
|
17170693 |
|
|
|
|
16490494 |
Aug 30, 2019 |
|
|
|
PCT/US2018/020762 |
Mar 2, 2018 |
|
|
|
16864911 |
|
|
|
|
62551732 |
Aug 29, 2017 |
|
|
|
62466961 |
Mar 3, 2017 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C12N 9/78 20130101; C12N
15/1137 20130101; C12N 15/113 20130101; C12Y 305/04 20130101; C12N
2310/531 20130101; C12N 2310/20 20170501; C12N 2320/34 20130101;
A61P 21/00 20180101; C12N 15/115 20130101; A61K 38/00 20130101 |
International
Class: |
C12N 15/115 20060101
C12N015/115; A61P 21/00 20060101 A61P021/00; C12N 9/78 20060101
C12N009/78 |
Goverment Interests
STATEMENT REGARDING GOVERNMENT SUPPORT
[0002] This invention was made with government support under Grant
No. R01HG009285 awarded by the National Institutes of Health. The
government has certain rights in the invention.
Claims
1. A method of increasing muscular strength in a subject having a
truncated protein associated with DMD, the method comprising
administering to the subject a vector encoding two copies of an
engineered serine suppressor, wherein the engineered serine
suppressor comprises an engineered loop configured to recognize and
read through an ochre (UAA) stop signal of a messenger template
encoding the truncated protein associated with DMD, thereby
increasing muscular strength in the subject; wherein 8 weeks
following the administering of the vector to an mdx mouse: (i) a
neuronal nitric oxide synthase (nNOS) binding site absent from the
truncated protein associated with DMD prior to the administering is
restored; (ii) the activity of the nNOS is restored at a sarcolemma
of the mdx mouse, wherein the nNOS activity was absent in the
sarcolemma of the mdx mouse prior to the administering; and (iii) a
level of full-length protein in the mdx mouse is increased,
relative to a level of full-length protein prior to the
administering.
2. The method of claim 1, wherein the engineered serine suppressor
is charged with a serine.
3. The method of claim 1, wherein the engineered serine suppressor
comprises a length of from about 10 nucleotides to about 76
nucleotides.
4. The method of claim 1, wherein an expression of each copy of the
engineered serine suppressor is driven by a U6 promoter.
5. The method of claim 4, wherein at least one copy of the
engineered serine suppressor is driven by a mouse U6 promoter.
6. The method of claim 4, wherein at least one copy of the
engineered serine suppressor is driven by a human U6 promoter.
7. The method of claim 4, wherein a first copy of the engineered
serine suppressor is driven by a mouse U6 promoter and a second
copy of the engineered serine suppressor is driven by a human U6
promoter.
8. The method of claim 1, wherein the subject is a pediatric
human.
9. The method of claim 1, wherein the administering is
parenteral.
10. The method of claim 1, wherein the administering is via
injection into a tibalis anterior of the subject.
11. The method of claim 1, wherein the administering is via
injection into a gastrocnemius of the subject.
12. The method of claim 1, wherein the vector is administered as a
unit dose.
13. The method of claim 1, wherein the engineered serine suppressor
comprises at least 95% sequence identity to SEQ ID NO: 61, wherein
the NNN of SEQ ID NO: 61 is TTA.
14. The method of claim 1, wherein the engineered serine suppressor
comprises at least 99% sequence identity to SEQ ID NO: 61, wherein
the NNN of SEQ ID NO: 61 is TTA.
15. The method of claim 1, wherein the engineered serine suppressor
is SEQ ID NO: 61, wherein the NNN of SEQ ID NO: 61 is TTA.
16. A method of treating Rett Syndrome in a subject, the method
comprising administering to the subject a vector encoding an
engineered arginine suppressor, wherein the engineered arginine
suppressor comprises an engineered loop configured to recognize and
read through an opal (UGA) stop signal of a messenger template
encoding a truncated protein associated with Rett Syndrome, thereby
treating the Rett Syndrome in the subject.
17. The method of claim 16, wherein the engineered arginine
suppressor is charged with an arginine.
18. The method of claim 16, wherein the engineered arginine
suppressor is SEQ ID NO: 63, wherein the NNN of SEQ ID NO: 63 is
TCA.
19. The method of claim 16, wherein the engineered arginine
suppressor comprises the polynucleotide sequence AATGGATA.
20. The method of claim 16, wherein the administering is
parenteral.
Description
CROSS REFERENCE TO RELATED APPLICATION
[0001] This application is a continuation of U.S. application Ser.
No. 17/170,693, filed Feb. 8, 2021, which is a continuation of U.S.
application Ser. No. 16/864,911, filed May 1, 2020, which is a
continuation of U.S. application Ser. No. 16/490,494, filed Aug.
30, 2019, which application is a U.S. National Stage Application
filed under 35 U.S.C. .sctn.371 and claims priority to
International Application No. PCT/US2018/020762, filed Mar. 2,
2018, which claims priority under 35 U.S.C. 119(e) to U.S. Ser. No.
62/466,961, filed Mar. 3, 2017, and U.S. Ser. No. 62/551,732, filed
Aug. 29, 2017, the disclosures of each of which are incorporated by
reference herein.
SEQUENCE LISTING
[0003] The instant application contains a Sequence Listing which
has been submitted electronically in ASCII format and is hereby
incorporated by reference in its entirety. Said ASCII copy, created
on Mar. 4, 2022, is named Sequence-Listing.txt and is 220,205 bytes
in size.
BACKGROUND
[0004] Aspects of the disclosure relate to a gene therapy approach
for diseases, disorders, or conditions caused by mutation in the
stop codon using modified tRNA. At least 10-15% of all genetic
diseases, including muscular dystrophy (e.g. Duchene muscular
dystrophy), some cancers, beta thalassemia, Hurler syndrome, and
cystic fibrosis, fall into this category. Not to be bound by
theory, it is believed that this approach is safer than CRISPR or
TALEN approaches due to minimal off-target effects and the lack of
genome level changes.
SUIIMARY
[0005] Aspects of the disclosure relate to a method for restoring
expression of a protein comprising a point mutation in an RNA
sequence encoding the protein in a subject in need thereof, the
method comprising, or alternatively consisting essentially of, or
yet further consisting of administering to the subject a vector
encoding one or more tRNA having an anticodon sequence that
recognizes a codon comprising the point mutation to the subject,
optionally wherein the point mutation results in a premature stop
codon, optionally wherein the point mutation results in a premature
stop codon. In some embodiments, the point mutation results in a
nonsense mutation having the DNA sequence TAA and the RNA sequence
UAA. In some embodiments, the tRNA is an endogenous tRNA with a
modified anticodon stem recognizing the codon comprising the point
mutation. In further embodiments, the tRNA is charged with a
serine. In some embodiments, the tRNA is an orthogonal tRNA charged
with a non-canonical amino acid. In further embodiments, the vector
further comprises a corresponding tRNA synthetase. In some
embodiments, the corresponding synthetase is E. coli
Glutaminyl-tRNA synthetase. In some embodiments involving an
orthogonal tRNA, the non-canonical amino acid is pyrrolysine. In
further embodiments, the pyrrolysine is administered to the subject
by introduction into the diet of the subject. In some embodiments,
the vector encodes two tRNA having an anticodon sequence that
recognizes the codon comprising the point mutation. In some
embodiments, the protein is dystrophin. In a further aspect, the
subject is a human and is optionally a pediatric patient.
[0006] Further method aspects relate to a treating a disease,
disorder, or condition characterized by the presence of a point
mutation in an RNA sequence encoding a protein associated with the
disease, disorder, or condition in a subject in need thereof, the
method comprising, or alternatively consisting essentially of, or
yet further consisting of, administering to the subject a vector
encoding one or more tRNA having an anticodon sequence that
recognizes a codon comprising the point mutation to the subject,
optionally wherein the point mutation results in a premature stop
codon. In some embodiments, the point mutation results in a
nonsense mutation having the DNA sequence TAA and the RNA sequence
UAA. In some embodiments, the tRNA is an endogenous tRNA with a
modified anticodon stem recognizing the codon comprising the point
mutation. In further embodiments, the tRNA is charged with a
serine. In some embodiments, the tRNA is an orthogonal tRNA charged
with a non-canonical amino acid. In further embodiments, the vector
further comprises a corresponding tRNA synthetase. In some
embodiments, the corresponding synthetase is E. coli
Glutaminyl-tRNA synthetase. In some embodiments involving an
orthogonal tRNA, the non-canonical amino acid is pyrrolysine. In
further embodiments, the pyrrolysine is introduced in the diet of
the subject. In some embodiments, the vector encodes two tRNA
having an anticodon sequence that recognizes the codon comprising
the point mutation. In some embodiments, the disease, disorder, or
condition is selected from the group consisting of the diseases,
disorders, and conditions listed in Table 1, optionally
characterized by the presence of a nonsense mutation and/or a
premature stop codon. In some embodiments, the protein is
dystrophin. In further embodiments, the disease, disorder, or
condition is muscular dystrophy. In still further embodiments, the
disease disorder or condition is Duchenne muscular dystrophy. In
some embodiments, the subject is a human and is optionally a
pediatric patient.
[0007] Still further aspects disclosed herein relate to a vector
encoding one or more tRNA having an anticodon sequence that
recognizes a codon comprising a point mutation in an RNA sequence
encoding a protein, optionally wherein the point mutation results
in a premature stop codon. In some embodiments, the point mutation
results in a nonsense mutation having the DNA sequence TAA and the
RNA sequence UAA. In some embodiments, the tRNA is an endogenous
tRNA with a modified anticodon stem recognizing the codon
comprising the point mutation. In further embodiments, the tRNA is
charged with a serine. In some embodiments, the tRNA is an
orthogonal tRNA charged with a non-canonical amino acid. In further
embodiments, the vector further comprises a corresponding tRNA
synthetase. In some embodiments, the corresponding synthetase is E.
coli Glutaminyl-tRNA synthetase. In some embodiments involving an
orthogonal tRNA, the non-canonical amino acid is pyrrolysine. In
some embodiments, the vector encodes two tRNA having an anticodon
sequence that recognizes the codon comprising the point mutation.
In some embodiments, the vector is an AAV vector, optionally an
AAV8 vector. In some embodiments, the protein is dystrophin. In a
further aspect, the subject is a human and is optionally a
pediatric patient.
[0008] In another aspect, the disclosure relates to a method for
restoring expression of a protein comprising a point mutation in an
RNA sequence encoding the protein in a subject in need thereof
comprising administering one or more vectors encoding an ADAR based
RNA editing system comprising one or more forward guide RNAs for
the ADAR ("adRNAs") and one or more corresponding reverse guide
RNAs for the ADAR ("radRNAs") to the subject, wherein the ADAR
based RNA editing system specifically edits the point mutation. In
some embodiments, the point mutation results in a nonsense mutation
having the DNA sequence TAA and the RNA sequence UAA. In some
embodiments, the ADAR based RNA editing system converts UAA to UIA
and, optionally, further UIA to UII. In some embodiments, the ADAR
based RNA editing system converts UAA to UAI. In some embodiments,
optionally those involving nonsense or missense mutations, the RNA
targeted in mRNA. In further embodiments, the one or more vector
further encodes a tRNA that targets an amber codon. In some
embodiments, the protein is dystrophin. In some embodiments, the
point mutation results in a splice site or missense mutation having
the DNA sequence CAG and the RNA sequence CAG. In some embodiments,
the ADAR based RNA editing system converts CAG to CIG. In some
embodiments, optionally those involving splice site mutations, the
RNA targeted is pre-mRNA. In some embodiments, the protein is
ornithine transcabamylase. In some embodiments, the ADAR based
editing system further comprises ADAR1, ADAR2, the E488Q and E100Q
mutants each thereof, a fusion protein comprising the catalytic
domain of an ADAR and a domain which associates with an RNA hairpin
motif, a fusion protein comprising the catalytic domain of an ADAR
and a dead Cas9, or a fusion protein comprising the double stranded
binding domain of an ADAR and an APOBEC. In further embodiments,
the domain which associates with an RNA hairpin motif is selected
from the group of an MS2 bacteriophage coat protein (MCP) and an
N22 peptide. In some embodiments, the method further comprises
administering an effective amount of an interferon to enhance
endogenous ADAR1 expression. In still further embodiments, the
interferon is interferon a. In some embodiments, the adRNA
comprises one or more RNA hairpin motifs. In some embodiments, the
one or more RNA hairpin motifs are selected from the group of an
MS2 stem loop and a BoxB loop and/or are stabilized by replacing
A-U with G-C. In some embodiments, the adRNA is stabilized through
the incorporation of one or more of 2'-O-methyl, 2'-O-methyl
3'phosphorothioate, or 2'-O-methyl 3'thioPACE at either or both
termini of the adRNA. In a further aspect, the subject is a human
and is optionally a pediatric patient.
[0009] Further method aspects relate to a method of treating a
disease, disorder, or condition characterized by the presence of a
point mutation in an RNA sequence encoding a protein associated
with the disease, disorder, or condition in a subject in need
thereof, the method comprising, or alternatively consisting
essentially of, or yet further consisting of, administering to the
subject one or more vectors encoding an ADAR based RNA editing
system comprising one or more forward guide RNAs for the ADAR
("adRNAs") and one or more corresponding reverse guide RNAs for the
ADAR ("radRNAs") to the subject, wherein the ADAR based RNA editing
system specifically edits the point mutation. In some embodiments,
the point mutation results in a nonsense mutation having the DNA
sequence TAA and the RNA sequence UAA. In some embodiments, the
ADAR based RNA editing system converts UAA to UIA and, optionally,
further UIA to UII In some embodiments, the ADAR based RNA editing
system converts UAA to UAI. In some embodiments, optionally those
involving nonsense or missense mutations, the RNA targeted in mRNA.
In further embodiments, the one or more vector further encodes a
tRNA that targets an amber codon. In some embodiments, the protein
is dystrophin. In some embodiments, the point mutation results in a
splice site or missense mutation having the DNA sequence CAG and
the RNA sequence CAG. In some embodiments, the ADAR based RNA
editing system converts CAG to CIG. In some embodiments, optionally
those involving splice site mutations, the RNA targeted is
pre-mRNA. In some embodiments, the protein is ornithine
transcabamylase. In some embodiments, the ADAR based editing system
further comprises ADAR1, ADAR2, the E488Q and E100Q mutants each
thereof, a fusion protein comprising the catalytic domain of an
ADAR and a domain which associates with an RNA hairpin motif, a
fusion protein comprising the catalytic domain of an ADAR and a
dead Cas9, or a fusion protein comprising the double stranded
binding domain of an ADAR and an APOBEC. In further embodiments,
the domain which associates with an RNA hairpin motif is selected
from the group of an MS2 bacteriophage coat protein (MCP) and an
N22 peptide. In some embodiments, the method further comprises
administering an effective amount of an interferon to enhance
endogenous ADAR1 expression. In still further embodiments, the
interferon is interferon a. In some embodiments, the adRNA
comprises one or more RNA hairpin motifs. In some embodiments, the
one or more RNA hairpin motifs are selected from the group of an
MS2 stem loop and a BoxB loop and/or are stabilized by replacing
A-U with G-C. In some embodiments, the adRNA is stabilized through
the incorporation of one or more of 2'-O-methyl, 2'-O-methyl
3'phosphorothioate, or 2'-O-methyl 3'thioPACE at either or both
termini of the adRNA. In some embodiments, the disease, disorder,
or condition is selected from the group consisting of the diseases,
disorders, and conditions listed in Table 1. In further
embodiments, the protein is dystrophin and the disease, disorder,
or condition is muscular dystrophy. In still further embodiments,
the disease disorder or condition is Duchenne muscular dystrophy.
In some embodiments, the subject is a human and is optionally a
pediatric patient.
[0010] Additional aspects relate to a recombinant expression system
comprising one or more vectors encoding an ADAR based RNA editing
system comprising one or more forward guide RNAs for the ADAR
("adRNAs") and one or more corresponding reverse guide RNAs for the
ADAR ("radRNAs") to the subject, wherein the ADAR based RNA editing
system specifically edits a point mutation in an RNA sequence
encoding a protein. In some embodiments, the point mutation results
in a nonsense mutation having the DNA sequence TAA and the RNA
sequence UAA. In some embodiments, the ADAR based RNA editing
system converts UAA to UIA and, optionally, further UIA to UII In
some embodiments, the ADAR based RNA editing system converts UAA to
UAI. In some embodiments, optionally those involving nonsense or
missense mutations, the RNA targeted in mRNA. In further
embodiments, the one or more vector further encodes a tRNA that
targets an amber codon. In some embodiments, the protein is
dystrophin. In some embodiments, the point mutation results in a
splice site or missense mutation having the DNA sequence CAG and
the RNA sequence CAG. In some embodiments, the ADAR based RNA
editing system converts CAG to CIG. In some embodiments, optionally
those involving splice site mutations, the RNA targeted is
pre-mRNA. In some embodiments, the protein is ornithine
transcabamylase. In some embodiments, the ADAR based editing system
further comprises ADAR1, ADAR2, the E488Q and E100Q mutants each
thereof, a fusion protein comprising the catalytic domain of an
ADAR and a domain which associates with an RNA hairpin motif, a
fusion protein comprising the catalytic domain of an ADAR and a
dead Cas9, or a fusion protein comprising the double stranded
binding domain of an ADAR and an APOBEC. In further embodiments,
the domain which associates with an RNA hairpin motif is selected
from the group of an MS2 bacteriophage coat protein (MCP) and an
N22 peptide. In some embodiments, the adRNA comprises one or more
RNA hairpin motifs. In some embodiments, the one or more RNA
hairpin motifs are selected from the group of an MS2 stem loop and
a BoxB loop and/or are stabilized by replacing A-U with G-C. In
some embodiments, the adRNA is stabilized through the incorporation
of one or more of 2'-O-methyl, 2'-O-methyl 3'phosphorothioate, or
2'-O-methyl 3'thioPACE at either or both termini of the adRNA. In a
further aspect, the subject is a human and is optionally a
pediatric patient.
[0011] Still further aspects relate to a composition comprising any
one or more of the vectors disclosed herein and optionally one or
more carriers, such as a pharmaceutically acceptable carrier. In
some embodiments, the composition further comprises an effective
amount of an interferon to enhance endogenous ADAR1 expression. In
still further embodiments, the interferon is interferon a.
[0012] Some aspects disclosed herein relate to methods for
restoring expression of a protein in a subject in need thereof, the
method comprising, or alternatively consisting essentially of, or
yet further consisting of, administering to the subject a tRNA
having an anticodon sequence that recognizes a mutation in an RNA
sequence encoding the protein or a vector encoding one or more of
said tRNA to the subject. In some embodiments, the mutation is a
nonsense mutation, optionally a premature stop codon. In some
embodiments, the nonsense mutation is TAA in DNA and UAA in RNA. In
some embodiments, the tRNA is a modified endogenous tRNA charged
with a canonical amino acid. In some embodiments, the canonical
amino acid is serine. In some embodiments, the tRNA is an
orthogonal tRNA charged with a non-canonical amino acid. In some
embodiments, the orthogonal tRNA has a corresponding synthetase. In
some embodiments, the corresponding synthetase is E. coli
Glutaminyl-tRNA synthetase. In some embodiments, the non-canonical
amino acid is introduced or administered to the subject (e.g.
through food), allowing for the induction of the orthogonal tRNA
activity. In some embodiments, the non-canonical amino acid is
pyrrolysine. In some embodiments, the tRNA targets an amber codon.
In some embodiments, the tRNA targets an ochre codon. In some
embodiments, the tRNA targets an opal codon. In some embodiments,
the protein is dystrophin. In a further aspect, the subject is a
human and is optionally a pediatric patient.
[0013] Further aspects disclosed herein relate to methods of a
disease, disorder, or condition characterized by a protein
deficiency in a subject in need thereof, the method comprising, or
alternatively consisting essentially or, or yet further consisting
of administering a tRNA having an anticodon sequence that
recognizes a mutation in an RNA sequence encoding the protein or a
vector encoding one or more of said tRNA to the subject. In some
embodiments, the mutation is a nonsense mutation, optionally a
premature stop codon. In some embodiments, the nonsense mutation is
TAA in DNA and UAA in RNA. In some embodiments, the tRNA is a
modified endogenous tRNA charged with a canonical amino acid. In
some embodiments, the canonical amino acid is serine. In some
embodiments, the tRNA is an orthogonal tRNA charged with a
non-canonical amino acid. In some embodiments, the orthogonal tRNA
has a corresponding synthetase. In some embodiments, the
corresponding synthetase is E. coli Glutaminyl-tRNA synthetase. In
some embodiments, the non-canonical amino acid is administered or
introduced to the subject (e.g. through food), allowing for the
induction of the orthogonal tRNA activity. In some embodiments, the
non-canonical amino acid is pyrrolysine. In some embodiments, the
tRNA targets an amber codon. In some embodiments, the tRNA targets
an ochre codon. In some embodiments, the tRNA targets an opal
codon. In some embodiments, the protein deficiency is a dystrophin
deficiency. In some embodiments, the disease, disorder, or
condition is muscular dystrophy. In some embodiments, the muscular
dystrophy is Duchene muscular dystrophy. In a further aspect, the
subject is a human and is optionally a pediatric patient.
[0014] Other aspects relate to a vector encoding one or more tRNA
having an anticodon sequence that recognizes a mutation in an RNA
sequence encoding the protein. In some embodiments, the mutation is
a nonsense mutation, optionally a premature stop codon. In some
embodiments, the nonsense mutation is TAA in DNA and UAA in RNA. In
some embodiments, the tRNA is a modified endogenous tRNA charged
with a canonical amino acid. In some embodiments, the canonical
amino acid is serine. In some embodiments, the tRNA is an
orthogonal tRNA charged with a non-canonical amino acid. In some
embodiments, the orthogonal tRNA has a corresponding synthetase. In
some embodiments, the corresponding synthetase is E. coli
Glutaminyl-tRNA synthetase. In some embodiments, the vector further
comprises the corresponding synthetase. In some embodiments, the
non-canonical amino acid is introduced or administered to the
subject (e.g. through food), allowing for the induction of the
orthogonal tRNA activity. In some embodiments, the non-canonical
amino acid is pyrrolysine. In some embodiments, the tRNA targets an
amber codon. In some embodiments, the tRNA targets an ochre codon.
In some embodiments, the tRNA targets an opal codon. In some
embodiments, the protein is dystrophin. In some embodiments, the
mutation is a nonsense mutation, optionally a premature stop codon.
In some embodiments, the vector is an Adeno-Associated Virus (AAV)
vector. In some embodiments, the AAV vector is an AAV8 vector.
[0015] Additional aspects of this disclosure relate to on-demand,
in vivo production of therapeutic proteins, such as, but not
limited to, (i) insulin; (ii) neutralizing antibodies for viruses
(e.g. HIV, HCV, HPV, influenza) and bacteria (e.g. Staph Aureus;
drug resistant strains). Such method aspects comprise administering
to a subject a vector encoding the therapeutic protein with a
mutation in its sequence and a tRNA having an anticodon sequence
that recognizes the mutation in the RNA sequence encoding the
therapeutic protein or a vector encoding one or more of said tRNA.
Accordingly, any of the methods and vectors disclosed hereinabove
relating to a tRNA having an anticodon sequence that recognizes a
mutation in an RNA sequence encoding the protein or a vector
encoding one or more of said tRNA may be applied to this aspect, as
well.
[0016] Some aspects disclosed herein relate to methods for
restoring expression of a protein in a subject in need thereof
comprising administering an ADAR2 based RNA editing system
comprising an ADAR2, one or more forward guide RNAs for the ADAR2
("adRNAs"), and one or more corresponding reverse guide RNAs for
the ADAR2 ("radRNAs") to the subject, wherein the ADAR2 based RNA
editing system specifically edits a mutation in an RNA sequence
encoding the protein or one or more vectors encoding said ADAR2,
adRNAs, radRNAs. In some embodiments, the ADAR2 based RNA editing
system changes adenosine (A) to inosine (I), which is read during
translation as guanosine (G). In some embodiments, the mutation is
a nonsense mutation. In some embodiments, the nonsense mutation is
TAA in DNA and UAA in RNA. In some embodiments, the ADAR2 based RNA
editing system causes point mutations at one or more adenosines (A)
in the nonsense mutation. In some embodiments, the ADAR2 based RNA
editing system converts UAA to UIA (read as UGA). In further
embodiments, the ADAR2 based RNA editing system converts UIA (read
as UGA) to UT (read as UGG). In some embodiments, the ADAR2 based
RNA editing system converts UAA to UAI (read as UAG). In some
embodiments, the method further comprises administering a tRNA,
such as one disclosed hereinabove, that recognizes the codon
encoded by the ADAR2 edited sequence. In some embodiments, the tRNA
is a modified endogenous tRNA charged with a canonical amino acid.
In some embodiments, the canonical amino acid is serine. In some
embodiments, the tRNA is an orthogonal tRNA charged with a
non-canonical amino acid. In some embodiments, the orthogonal tRNA
has a corresponding synthetase. In some embodiments, the
corresponding synthetase is E. coli Glutaminyl-tRNA synthetase. In
some embodiments, the non-canonical amino acid is introduced to the
subject (e.g. through food), allowing for the induction of the
orthogonal tRNA activity. In some embodiments, the non-canonical
amino acid is pyrrolysine. In some embodiments, the tRNA targets an
amber codon. In some embodiments, the tRNA targets an ochre codon.
In some embodiments, the tRNA targets an opal codon. In some
embodiments, the protein deficiency is a dystrophin deficiency. In
some embodiments, the disease, disorder, or condition is muscular
dystrophy. In some embodiments, the muscular dystrophy is Duchene
muscular dystrophy.
[0017] Further aspects disclosed herein relate to methods of a
disease, disorder, or condition characterized by a protein
deficiency in a subject in need thereof comprising administering an
ADAR2 based RNA editing system comprising an ADAR2, one or more
forward guide RNAs for the ADAR2 ("adRNAs"), and one or more
corresponding reverse guide RNAs for the ADAR2 ("radRNAs") to the
subject, wherein the ADAR2 based RNA editing system specifically
edits a mutation in an RNA sequence encoding the protein or one or
more vectors encoding said ADAR2, adRNAs, radRNAs. In some
embodiments, the ADAR2 based RNA editing system changes adenosine
(A) to inosine (I), which is read during translation as guanosine
(G). In some embodiments, the mutation is a nonsense mutation. In
some embodiments, the nonsense mutation is TAA. In some
embodiments, the ADAR2 based RNA editing system causes point
mutations at one or more adenosines (A) in the nonsense mutation.
In some embodiments, the ADAR2 based RNA editing system converts
UAA to UIA (read as UGA). In further embodiments, the ADAR2 based
RNA editing system converts UIA (read as UGA) to UT (read as UGG).
In some embodiments, the ADAR2 based RNA editing system converts
UAA to UAI (read as UAG). In some embodiments, the method further
comprises administering a tRNA, such as one disclosed hereinabove,
that recognizes the codon encoded by the ADAR2 edited sequence. In
some embodiments, the tRNA is a modified endogenous tRNA charged
with a canonical amino acid. In some embodiments, the canonical
amino acid is serine. In some embodiments, the tRNA is an
orthogonal tRNA charged with a non-canonical amino acid. In some
embodiments, the orthogonal tRNA has a corresponding synthetase. In
some embodiments, the corresponding synthetase is E. coli
Glutaminyl-tRNA synthetase. In some embodiments, the non-canonical
amino acid is introduced to the subject (e.g. through food),
allowing for the induction of the orthogonal tRNA activity. In some
embodiments, the non-canonical amino acid is pyrrolysine. In some
embodiments, the tRNA targets an amber codon. In some embodiments,
the tRNA targets an ochre codon. In some embodiments, the tRNA
targets an opal codon. In some embodiments, the protein deficiency
is a dystrophin deficiency. In some embodiments, the disease,
disorder, or condition is muscular dystrophy. In some embodiments,
the muscular dystrophy is Duchene muscular dystrophy.
[0018] Other aspects relate to a recombinant expression system
comprising one or more vectors encoding an ADAR2 based RNA editing
system comprising one or more of an ADAR2, one or more forward
guide RNAs for the ADAR2 ("adRNAs"), and one or more corresponding
reverse guide RNAs for the ADAR2 ("radRNAs"), wherein the ADAR2
based RNA editing system specifically edits a mutation in an RNA
sequence encoding a protein. In some embodiments, the ADAR2 changes
adenosine (A) to inosine (I), which is read during translation as
guanosine (G). In some embodiments, one adRNA/radRNA pair guides
the conversion of UAA to UIA (read as UGA). In further embodiments,
a second adRNA/radRNA pair guides the conversion of UIA (read as
UGA) to UT (read as UGG). In some embodiments, one adRNA/radRNA
pair guides the conversion of UAA to UAI (read as UAG). In some
embodiments, the one or more vectors or an additional vector
further encodes a tRNA, such as one disclosed hereinabove, that
recognizes the codon encoded by the ADAR2 edited sequence. In some
embodiments, the tRNA is a modified endogenous tRNA charged with a
canonical amino acid. In some embodiments, the canonical amino acid
is serine. In some embodiments, the tRNA is an orthogonal tRNA
charged with a non-canonical amino acid. In some embodiments, the
orthogonal tRNA has a corresponding synthetase. In some
embodiments, the corresponding synthetase is E. coli
Glutaminyl-tRNA synthetase. In some embodiments, the non-canonical
amino acid is introduced to the subject (e.g. through food),
allowing for the induction of the orthogonal tRNA activity. In some
embodiments, the non-canonical amino acid is pyrrolysine. In some
embodiments, the tRNA targets an amber codon. In some embodiments,
the tRNA targets an ochre codon. In some embodiments, the tRNA
targets an opal codon. In some embodiments, the protein is
dystrophin. In some embodiments, the mutation is a nonsense
mutation. In some embodiments, the vector is an Adeno-Associated
Virus (AAV) vector. In some embodiments, the AAV vector is an AAV8
vector.
[0019] Additional aspects of this disclosure relate to on-demand,
in vivo production of therapeutic proteins, such as, but not
limited to, (i) insulin; (ii) neutralizing antibodies for viruses
(e.g. HIV, HCV, HPV, influenza) and bacteria (e.g. Staph Aureus;
drug resistant strains). Such method aspects comprise administering
to a subject a vector encoding the therapeutic protein with a
mutation in its sequence and an ADAR2 based RNA editing system
comprising an ADAR2, one or more forward guide RNAs for the ADAR2
("adRNAs"), and one or more corresponding reverse guide RNAs for
the ADAR2 ("radRNAs"), wherein the ADAR2 based RNA editing system
specifically edits a mutation in an RNA sequence encoding the
protein or one or more vectors encoding said ADAR2, adRNAs,
radRNAs. Accordingly, any of the methods and vectors disclosed
hereinabove relating to an ADAR2 based RNA editing system
specifically edits a mutation in an RNA sequence encoding the
protein or a vector encoding one or more vectors encoding said
ADAR2, adRNAs, radRNAs.
TABLE-US-00001 PARTIAL SEQUENCE LISTING mU6, tRNA(U25C) Amber (SEQ
ID NO: 1)
tcccggggtttccgccaTTTTTTGGTACTGAGtCGCCCaGTCTCAGATAGATCCGACGCCGCC
ATCTCTAGGCCCGCGCCGGCCCCCTCGCACAGACTTGTGGGAGAAGCTCGGCTAC
TCCCCTGCCCCGGTTAATTTGCATATAATATTTCCTAGTAACTATAGAGGCTTAAT
GTGCGATAAAAGACAGATAATCTGTTCTTTTTAATACTAGCTACATTTTACATGA
TAGGCTTGGATTTCTATAAGAGATACAAATACTAAATTATTATTTTAAAAAACAG
CACAAAAGGAAACTCACCCTAACTGTAAAGTAATTGTGTGTTTTGAGACTATAAA
TATCCCTTGGAGAAAAGCCTTGTTTGggaaacctgatcatgtagatcgaaCggactCTAaatccgttcagc
cgggttagattcccggggtttccgccaTTTTTTCCTAGACCCAGCTTTCTTGTACAAAGTTGG
mU6, tRNA(U25C) Ochre (SEQ ID NO: 2)
tcccggggtttccgccaTTTTTTGGTACTGAGtCGCCCaGTCTCAGATAGATCCGACGCCGCC
ATCTCTAGGCCCGCGCCGGCCCCCTCGCACAGACTTGTGGGAGAAGCTCGGCTAC
TCCCCTGCCCCGGTTAATTTGCATATAATATTTCCTAGTAACTATAGAGGCTTAAT
GTGCGATAAAAGACAGATAATCTGTTCTTTTTAATACTAGCTACATTTTACATGA
TAGGCTTGGATTTCTATAAGAGATACAAATACTAAATTATTATTTTAAAAAACAG
CACAAAAGGAAACTCACCCTAACTGTAAAGTAATTGTGTGTTTTGAGACTATAAA
TATCCCTTGGAGAAAAGCCTTGTTTGggaaacctgatcatgtagatcgaaCggactTTAaatccgttcagc
cgggttagattcccggggtttccgccaTTTTTTCCTAGACCCAGCTTTCTTGTACAAAGTTGG
mU6, tRNA(U25C) Opal (SEQ ID NO: 3)
tcccggggtttccgccaTTTTTTGGTACTGAGtCGCCCaGTCTCAGATAGATCCGACGCCGCC
ATCTCTAGGCCCGCGCCGGCCCCCTCGCACAGACTTGTGGGAGAAGCTCGGCTAC
TCCCCTGCCCCGGTTAATTTGCATATAATATTTCCTAGTAACTATAGAGGCTTAAT
GTGCGATAAAAGACAGATAATCTGTTCTTTTTAATACTAGCTACATTTTACATGA
TAGGCTTGGATTTCTATAAGAGATACAAATACTAAATTATTATTTTAAAAAACAG
CACAAAAGGAAACTCACCCTAACTGTAAAGTAATTGTGTGTTTTGAGACTATAAA
TATCCCTTGGAGAAAAGCCTTGTTTGggaaacctgatcatgtagatcgaaCggactTCAaatccgttcagc
cgggttagattcccggggtttccgccaTTTTTTCCTAGACCCAGCTTTCTTGTACAAAGTTGG
MmPyIRS (AfIII) (SEQ ID NO: 4)
CAGCCTCCGGACTCTAGAGGATCGAACCCTTAAGgccaccATGGATAAGAAACCTTT
GAACACTCTCATTAGTGCGACAGGGCTCTGGATGTCCCGAACGGGGACTATACA
CAAGATAAAACACCATGAGGTCTCAAGGAGCAAAATCTATATCGAGATGGCATG
CGGCGACCATCTTGTGGTAAATAATAGTAGGTCCTCCAGGACGGCAAGAGCACT
CCGACATCACAAGTACAGAAAAACCTGCAAACGGTGTAGGGTATCCGACGAAGA
CTTGAACAAATTTTTGACTAAGGCCAACGAGGATCAAACTTCTGTCAAAGTGAAA
GTGGTTTCTGCTCCTACCCGAACTAAGAAGGCCATGCCCAAGTCCGTGGCAAGGG
CACCCAAGCCACTCGAAAATACTGAGGCCGCTCAGGCCCAACCATCCGGTAGTA
AGTTCAGTCCAGCCATACCCGTAAGTACCCAAGAATCTGTCAGTGTGCCGGCCTC
AGTTTCCACATCTATAAGTTCAATTTCTACAGGAGCGACGGCCTCCGCCCTCGTC
AAGGGTAACACAAACCCGATAACTTCTATGAGTGCCCCCGTACAGGCATCCGCA
CCAGCACTGACGAAGTCTCAAACTGATAGGCTGGAAGTGCTCTTGAATCCGAAG
GACGAGATATCTCTTAACTCCGGTAAACCTTTCCGGGAGCTGGAAAGTGAACTTC
TCAGCCGGCGAAAAAAAGACCTCCAGCAAATTTACGCAGAGGAAAGGGAGAAC
TATCTGGGGAAGTTGGAACGAGAGATCACCCGATTCTTTGTCGATCGCGGATTTT
TGGAGATTAAAAGCCCAATTCTCATCCCCCTTGAATATATCGAACGAATGGGAAT
CGACAATGATACGGAGTTGTCCAAGCAGATTTTCCGCGTAGACAAGAACTTTTGT
CTTCGACCCATGCTCGCTCCGAACCTCTACAATTACTTGAGAAAGTTGGACAGAG
CGCTCCCGGACCCGATCAAGATATTTGAGATCGGTCCTTGTTATAGAAAGGAGAG
TGATGGAAAAGAACACCTCGAAGAGTTCACGATGCTGAACTTCTGCCAAATGGG
TTCTGGCTGCACACGGGAGAATCTCGAAAGCATCATTACAGATTTCCTTAACCAT
CTGGGGATAGACTTTAAAATAGTGGGTGACAGCTGTATGGTATACGGAGATACC
TTGGACGTAATGCACGGGGATCTTGAGCTTTCCTCCGCCGTGGTTGGACCTATAC
CGTTGGACCGGGAGTGGGGAATCGACAAACCGTGGATAGGCGCCGGTTTCGGCC
TTGAAAGACTCCTCAAAGTCAAGCATGATTTCAAAAACATAAAACGGGCTGCTC
GCTCCGAATCTTATTACAACGGTATAAGTACGAACCTGTGATAATAGCTTAAGGG
TTCGATCCCTACtGGTTAGTAATGAGTTTA tRNAs Amber suppression: (SEQ ID NO:
5)
ggaaacctgatcatgtagatcgaatggactctaaatccgttcagccgggttagattcccggggtttccgcca
Amber suppression (2): (SEQ ID NO: 6)
ggggggtggatcgaatagatcacacggactctaaattcgtgcaggcgggtgaaactcccgtactccccgcca
Ochre suppression (SEQ ID NO: 7)
ggaaacctgatcatgtagatcgaatggaattaaatccgttcagccgggttagattcccggggtttccgcca
Opal suppression: (SEQ ID NO: 8)
ggaaacctgatcatgtagatcgaatggacttcaaatccgttcagccgggttagattcccggggtttccgcca
Synthetase: (SEQ ID NO: 9)
ATGGATAAAAAACCATTAGATTTTTAATATCTGCGACCGGGCTCTGGATGTCCA
GGACTGGCACGCTCCACAAAATCAAGCACCATGAGGTCTCAAGAAGTAAAATAT
ACATTGAAATGGCGTGTGGAGACCATCTTGTTGTGAATAATTCCAGGAGTTGTAG
AACAGCCAGAGCATTCAGACATCATAAGTACAGAAAAACCTGCAAACGATGTAG
GGTTTCGGACGAGGATATCAATAATTTTCTCACAAGATCAACCGAAAGCAAAAA
CAGTGTGAAAGTTAGGGTAGTTTCTGCTCCAAAGGTCAAAAAAGCTATGCCGAA
ATCAGTTTCAAGGGCTCCGAAGCCTCTGGAAAATTCTGTTTCTGCAAAGGCATCA
ACGAACACATCCAGATCTGTACCTTCGCCTGCAAAATCAACTCCAAATTCGTCTG
TTCCCGCATCGGCTCCTGCTCCCACTTACAAGAAGCCAGCTTGATAGGGTTGA
GGCTCTCTTAAGTCCAGAGGATAAAATTTCTCTAAATATGGCAAAGCCTTTCAGG
GAACTTGAGCCTGAACTTGTGACAAGAAGAAAAAACGATTTTCAGCGGCTCTAT
ACCAATGATAGAGAAGACTACCTCGGTAAACTCGAACGTGATATTACGAAATTTT
TCGTAGACCGGGGTTTTCTGGAGATAAAGTCTCCTATCCTTATTCCGGCGGAATA
CGTGGAGAGAATGGGTATTAATAATGATACTGAACTTTCAAAACAGATCTTCCGG
GTGGATAAAAATCTCTGCTTGAGGCCAATGCTTGCCCCGACTCTTTACAACTATC
TGCGAAAACTCGATAGGATTTTACCAGGCCCAATAAAAATTTTCGAAGTCGGACC
TTGTTACCGGAAAGAGTCTGACGGCAAAGAGCACCTGGAAGAATTTACTATGGT
GAACTTCTGTCAGATGGGTTCGGGATGTACTCGGGAAAATCTTGAAGCTCTCATC
AAAGAGTTTCTGGACTATCTGGAAATCGACTTCGAAATCGTAGGAGATTCCTGTA
TGGTCTTTGGGGATACTCTTGATATAATGCACGGGGACCTGGAGCTTrCTTCGGC
AGTCGTCGGGCCAGTTTCTCTTGATAGAGAATGGGGTATTGACAAACCATGGATA
GGTGCAGGTTTTGGTCTTGAACGCTTGCTCAAGGTTATGCACGGTTTAAAAACA
TTAAGAGGGCATCAAGGTCCGAATCTTACTATAATGGGATTTCAACCAATCTGTA A EGFP:
(SEQ ID NO: 10)
atggtgagcaagggcgaggagctgttcaccggggtggtgcccatcctggtcgagctggacggcgacgtaaacgg-
ccacaagttca
gcgtgtccggcgagggcgagggcgatgccacctacggcaagctgaccctgaagttcatctgcaccaccggcaag-
ctgcccgtgcc
ctggcccaccctcgtgaccaccctgacctacggcgtgcagtgcttcagccgctaccccgaccacatgaagcagc-
acgacttcttcaa
gtccgccatgcccgaaggctacgtccaggagcgcaccatcttcttcaaggacgacggcaactacaagacccgcg-
ccgaggtgaagt
tcgagggcgacaccctggtgaaccgcatcgagctgaagggcatcgacttcaaggaggacggcaacatcctgggg-
cacaagctgga
gtacaactacaacagccacaacgtctatatcatggccgacaagcagaagaacggcatcaaggtgaacttcaaga-
tccgccacaacat
cgaggacggcagcgtgcagctcgccgaccactaccagcagaacacccccatcggcgacggccccgtgctgctgc-
ccgacaacca
ctacctgagcacccagtccgccctgagcaaagaccccaacganagegcgatcacatggtcctactggagttcgt-
aaccgccgccg ggatcactctcggcatggacgagctgtacaagtaa EGFP Amber: (SEQ ID
NO: 11)
Atggtgagcaagggcgaggagctgttcaccggggtggtgcccatcctggtcgagctggacggcgacgtaaacgg-
ccacaagttca
gcgtgtccaacgaaaacgaaaacgatgccacctagggcaagctgaccctgaagttcatctacaccaccaacaag-
ctacccgtgcc
ctggcccaccctcgtgaccaccctgacctacggcgtgcagtgcttcagccgctaccccgaccacatgaagcagc-
acgacttcttcaa
gtccgccatgcccgaaggctacgtccaggaacgcaccatcttcttcaaggacaacaacaactacaagacccgcg-
ccgaaatgaagt
tcgagggcgacaccctggtgaaccgcatcgagctgaagggcatcgacttcaaggaggacggcaacatcctgggg-
cacaagctgga
gtacaactacaacagccacaacgtctatatcatggccgacaagcagaagaacggcatcaaggtgaacttcaaga-
tccgccacaacat
cgaggacggcagcgtgcagctcgccgaccactaccagcagaacacccccatcggcgacggccccgtgctgctgc-
ccgacaacca
ctacctgagcacccagtccgccctgagcaaagaccccaacgagaagcgcgatcacatggtcctgctggagttcg-
tgaccgccgccg ggatcactctcggcatggacgagctgtacaagtaatga EGFP Ochre:
(SEQ ID NO: 12)
atggtaagcaaggacgaggagctgttcaccggggtagtgcccatcctggtcgaactgaacggcgacgtaaacaa-
ccacaagttca
gcgtgtccggcgagggcgagggcgatgccacctaaggcaagctgaccctgaagttcatctgcaccaccggcaag-
ctgcccgtgcc
ctagcccaccctcgtgaccaccctgacctacggcatgcagtgcttcagccgctaccccgaccacatgaaacaac-
acgacttcttcaa
gtccgccatgcccgaaggctacgtccaggagcgcaccatcttcttcaaggacgacggcaactacaagacccgcg-
ccgaggtgaagt
tcgaaggcgacaccctggtaaaccgcatcaagctgaagggcatcaacttcaaggaggacagcaacatcctgggg-
cacaagctgga
gtacaactacaacagccacaacgtctatatcatggccgacaagcagaagaacggcatcaaggtgaacttcaaga-
tccgccacaacat
cgaggacggcagcgtgcagctcgccgaccactaccagcagaacacccccatcggcgacggccccgtgctgctgc-
ccgacaacca
ctacctgagcacccagtccgccctgagcaaagaccccaacgagaagcgcgatcacatggtcctgctggagttcg-
tgaccgccgccg ggatcactctcggcatggacgagctgtacaagtaatga EGFP Opal: (SEQ
ID NO: 13)
Atggtgagcaagggcgaggagctgttcaccggggtggtgcccatcctggtcgagctggacggcgacgtaaacgg-
ccacaagttca
gcgtgtccggcaagggcaagggcaatgccacctgaaacaagctaaccctaaaattcatctgcaccaccggcaag-
ctgcccgtgcc
aggcccaccctcgtgaccaccctgacctacggegtgcagtgcttcagccgctaccecgaccacatgaagcagca-
cgacttettcaa
gtccaccatgcccgaaggctacgtccaaaagcacaccatatcttcaaggacgacggcaactacaaaacccgcgc-
caaggtaaagt
icgagggcgacaccctggtgaaccgcatcgagetgaagggcategacttcaaggaggacggcaacatectgggg-
cacaagctgga
gtacaactacaacagccacaacgtctatatcataaccaacaagcagaagaacggcatcaaaatgaacttcaaga-
tccgccacaacat
cgaggacggcagcgtgcagctcgccgaccactaccagcagaacacccccatcggcgacggccccgtgctgctgc-
ccgacaacca
ctacctgagcacccaatccgccctgagcaaagaccccaacaagaagcgcgatcacataatcctgaggaattcgt-
gaccgccgccg ggatcactctcggcatggacgagctgtacaagtaatga MbPy1RS (SEQ ID
NO: 14) 10 20 30 40 50 MDKKPLDVLI SATGLUMSRT GTLHKIKHHE VSRSKIYIEM
ACGDHLVVNN 60 70 80 90 100 SRSCRTARAF RHHKYRKTCK RCRVSDEDIN
NFLTRSTESK NSVKVRVVSA 110 120 130 140 150 PKVKKAMPKS VSRAPKPLEN
SVSAKASTNT SRSVPSPARS TPNSSVPASA 160 170 180 190 200 PAPSLTRSQL
DRVEALLSPE DKISLNMAKP FRELEPELVT RRKNDFORLY 210 220 230 240 250
TNDREDYLGK LERDITKFFV DRGFLEIKSP ILIPAEYVER MGINNDTELS 260 270 280
290 800 KQIERVDKNL CLRPMLAPTL YNYLRKLDRI LPGPIKIFEV GPCYRKESDG 310
320 330 340 350 KEHLEEFTMV NFCQMGSGCT RENLEALIKE FLDYLEIDFE
IVGDSCMVYG 360 370 380 390 400 DTLDIMHGUL ELSSAVVGPV SLDREWGIDK
PWIGAGFGLE RLLKVMHGFK 410 NIKRASRSES YYNGISTML MmPy1RS (unip rot)
(SEQ ID NO: 15) 10 20 30 40 50 MDKNPLNTLI SATGLWMSRT GTIHKIKHHE
VSRSKTYIEM ACGDHLVVNN 60 70 80 90 100 SRSSRTARAL RHHKYRKTCK
RCRVSDEDLM KFLTKANEDQ TSVKVEVVSA 110 120 130 140 150 PTRTKNAMPK
SVARATKPLE NTEAAQAQPS GSNESPAIPV STQESVSVPA 160 170 180 190 200
SVSTSISSIS TGATASALVK GNTNPITSMS APVQASAPAL TKSQTDRLEV 210 220 230
240 250 LLNPKDEISL NSGKPFRELE SELLSRRKKD LQQIYAEERE NYLGKLEREI 260
270 280 290 300 TRFFVDRGEL EIKSPILIPL EYIERMGIDN DTELSKQIFR
VDKNFCLRPM 310 320 330 340 350 LAPNLYNYLR KLDRALPDPI KIFEIGPCYR
KESDGKEHLE EFTMLNECQM 360 370 380 390 400 GSGCTRENLE SIITDFLNHL
GIDFKIVGDS CMVYGDTLDV MHGDLELSSA 410 420 430 440 450 VVGPIPLDRE
WGIDKPWIGA GFGLERLLKV KHDFKNIKRA ARSESYYNGI STNL PylT* (Amber) (SEQ
ID NO: 16)
ggaaacctgatcatgtagatcgaaCggactCTAaatccgttcagccgggtagattcccggggtttccgcca
TTTTTT PylT* (Ochre) (SEQ ID NO: 17)
ggaaacctgatcatgtagatcgaaCggactTTAaatccgttcagccgggttagattcccggggtttccgcca
TTTTTT PylT* (Opal) (SEQ ID NO: 18)
ggaaacctgatcatgtagatcgaaCggactTCAaatccgttcagccgggtagattcccggggtttccgcca
TTTTTT Mouse U6 primers (SEQ ID NO: 19)
tcccggggtttccgccaTTTTTTGGTACTGAGtCGCCCaGTCTCAGAT (SEQ ID NO: 20)
CAAACAAGGCTTTTCTCCAAGGGATAT tRNA (U25C) Amber_F: (SEQ ID NO: 21)
CCTTGGAGAAAAGCCTTGTTTGggaaacctgatcatgtagatcgaacggactCTAaatccgttcagccggg
Common reverse: PylT (SEQ ID NO: 22)
ggaaacctgatcatgtagatcgaatggactCTAaatccgttcagccgggttagattcccggggtttccgcca
Py1T*(U25C) (SEQ ID NO: 23)
ggaaacctgatcatgtagatcgaaCggactCTAaatccgttcagccgggttagattcccggggtttccgcca
1. Arg tRNA (opal) (E-Cadherin paper) (SEQ ID NO: 24)
GGCCGCGTGGCCTAATGGATAAGGCGTCTGACT GATCAAAGATTGCAG
GTTCGAGTCCTGCCGCGGTCG 2. Arg tRNA (opal) (Xeroderma paper) (SEQ ID
NO: 25) GACCACGTGGCCTAATGGATAAGGCGTCTGACTTCAGA GAAGATTGAGG
GTTCGAATCCCTTCGTGGTTA 3. Serine tRNA (amber) (SEQ ID NO: 26)
GTAGTCGTGGCCGAGTGGTTAAGGCGATGGACT AATCCATTGGGGTTTCC
CCGCGCAGGTTCGAATCCTGCCGACTACG 4. Leucine tRNA (amber) (SEQ ID NO:
27) GTCAGGATGGCCGACTTGGTCTAAGGCGCCAGACT CTTTCTGGTCTCCAATG
GAGGCGTGGGTTCGAATCCCACTTCTGACA Forward: (SEQ ID NO: 28)
TTGTGGAAAGGACGAAACACC Reverse: (SEQ ID NO: 29)
ACAAGAAAGCTGGGTCTAGGCTAGCAAAAAA tRNA_Leu_Am_F (overlaps with
vector, bold; anti-codon sequences, bold underline): (SEQ ID NO:
30) TTGTGGAAAGGACGAAACACCGGTCAGGATGGCCGAGTGGTCTAAGGCGCCAG ACT
GTTCTGGTCTCCAATGG tRNA_Leu_Oc_F (overlaps with vector, bold;
anti-codon sequences, bold underline): (SEQ ID NO: 31)
TTGTGGAAAGGACGAAACACCGGTCAGGATGGCCGAGTGGTCTAAGGCGCCAG ACT
GTTCTGGTCTCCAATGG tRNA Leu Op F (overlaps with vector, bold;
anti-codon sequences, bold underline): (SEQ ID NO: 32)
TTGTGGAAAGGACGAAACACCGGTCAGGATGGCCGAGTGGTCTAAGGCGCCAG ACT
GTTCTGGTCTCCAATGG tRNA Leu R (overlaps with vector, bold;
anti-codon sequences, bold underline): (SEQ ID NO: 33)
ACAAGAAAGCTGGGTCTAGGCTAGCAAAAAATGTCAGAAGTGGGATTCGAAC
CCACGCCTCCATTGGAGACCAGAAC tRNA_Ser_Am_F (overlaps with vector,
bold; anti-codon sequences, bold underline): (SEQ ID NO: 34)
TTGTGGAAAGGACGAAACACCGGTAGTCGTGGCCGAGTGGTTAAGGCGATGGA CT
AATCCATTGGGGTTTCC tRNA Ser Oc F (overlaps with vector, bold;
anti-codon sequences, bold underline): (SEQ ID NO: 35)
TTGTGGAAAGGACGAAACACCGGTAGTCGTGGCCGAGTGGTTAAGGCGATGGA CTTTA
ATCCATTGGGGTTTCC tRNA Ser Op (overlaps with vector, bold;
anti-codon sequences, bold underline)F: (SEQ ID NO: 36)
TTGTGGAAAGGACGAAACACCGGTAGTCGTGGCCGAGTGGTTAAGGCGATGGA CTTCA
ATCCATTGGGGTTTCC tRNA Ser R (overlaps with vector, bold; anti-codon
sequences, bold underline): (SEQ ID NO: 37)
ACAAGAAAGCTGGGTCTAGGCTAGCAAAAAACGTAGTCGGCAGGATTCGAAC
CTGCGCGGGGAAACCCCAATGGATT tRNA Arg Am F (overlaps with vector,
bold; anti-codon sequences, bold underline): (SEQ ID NO: 38)
TTGTGGAAAGGACGAAACACCGGACCACGTGGCCTAATGGATAAGGCGTCTGA CT
GATCAGAAGATTGAGGGTT tRNA Arg Oc F (overlaps with vector, bold;
anti-codon sequences, bold underline): (SEQ ID NO: 39)
TTGTGGAAAGGACGAAACACCGGACCACGTGGCCTAATGGATAAGGCGTCTGA CT
GATCAGAAGATTGAGGGTT tRNA Arg Op F (overlaps with vector, bold;
anti-codon sequences, bold underline): (SEQ ID NO: 40)
TTGTGGAAAGGACGAAACACCGGACCACGTGGCCTAATGGATAAGGCGTCTGA CT
GATCAGAAGATTGAGGGTT tRNA_Arg _R (overlaps with vector, bold;
anti-codon sequences, bold underline):
(SEQ ID NO: 41)
ACAAGAAAGCTGGGTCTAGGCTAGCAAAAAATAACCACGAAGGGATTCGAAC
CCTCAATCTTCTGATC mU6_tRNA_ser_oc: (SEQ ID NO: 42)
GTACTGAGtCGCCCaGTCTCAGATAGATCCGACGCCGCCATCTCTAGGCCCGCGCC
GGCCCCCTCGCACAGACTTGTGGGAGAAGCTCGGCTACTCCCCTGCCCCGGTTAA
TTTGCATATAATATTTCCTAGTAACTATAGAGGCTTAATGTGCGATAAAAGACAG
ATAATCTGTTCTTTTTAATACTAGCTACATTTTACATGATAGGCTTGGATTTCTAT
AAGAGATACAAATACTAAATTATTATTTTAAAAAACAGCACAAAAGGAAACTCA
CCCTAACTGTAAAGTAATTGTGTGTTTTGAGACTATAAATATCCCTTGGAGAAAA
GCCTTGTTTGGTAGTCGTGGCCGAGTGGTTAAGGCGATGGACTTTAAATCCATTG
GGGTTTCCCCGCGCAGGTTCGAATCCTGCCGACTACGTTTTTT
mU6_tRNA_ser_oc_Nhe1_insert_F: (SEQ ID NO: 43)
AATCCTGCCGACTACGTTTTTTGTACTGAGtCGCCCAGTCT adRNA (premature stop
codon target, bold; edited bases, bold underline): Sequential
edits: (SEQ ID NO: 44) TTTGAAAGAGCAATAAAAT (SEQ ID NO: 45)
CTTTGAAAGAGCAATAGAA Dual edits: (SEQ ID NO: 46) TTTGAAAGAGCAATAAAAT
radRNA (premature stop codon target, bold; edited bases, bold
underline): Sequential edits: (SEQ ID NO: 47) AtaaAATGGCTTCAACTAT
(SEQ ID NO: 48) AAtagAATGGCTTCAACTA Dual edits: (SEQ ID NO: 49)
AAtaaAATGGCTTCAACTA OTC target (edited bases, bold): (SEQ ID NO:
50) TCACAGACACCGCTCAGTTTGT Optimization of the length of adRNA and
distance of the edit from the ADAR2 recruiting domain (Length of
adRNA - distance of edit from ADAR2 recruiting domain): (SEQ ID NO:
51) 16-5: atgccaccTGGggcaa (SEQ ID NO: 52) 16-6: tgccaccTGGggcaag
(SEQ ID NO: 53) 16-7: gccaccTGGggcaagc (SEQ ID NO: 54) 18-6:
gatgccaccTGGggcaag (SEQ ID NO: 55) 20-6: gcgatgccaccTGGggcaag ADAR2
recruiting region v1: (SEQ ID NO: 56)
GGGTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCA CCT ADAR2 recruiting
region v2: (SEQ ID NO: 57)
GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCAC (SEQ ID NO: 58)
Hairpin (3') (FIG. 8): GGGCCCTCTTCAGGGCCCTCTAGA (SEQ ID NO: 59)
Hairpin (3') (FIG. 10): atcgccctgaaaag (SEQ ID NO: 60) Toe hold
(5'): gccaccTGGgg
[0020] List of suppressor tRNA sequences:
TABLE-US-00002 Suppressor tRNAs Sequence (5' to 3') Serine
GTAGTCGTGGCCGAGTGGTTAAGGCGATGGACTNNN
AATCCATTGGGGTTTCCCCGCGCAGGTTCGAATCCT GCCGACTACG (SEQ ID NO: 61)
Leucine GTCAGGATGGCCGAGTGGTCTAAGGCGCCAGACTNN
NGTTCTGGTCTCCAATGGAGGCGTGGGTTCGAATCC CACTTCTGACA (SEQ ID NO:62)
Arginine GACCACGTGGCCTAATGGATAAGGCGTCTGACTNNN
GATCAGAAGATTGAGGGTTCGAATCCCTTCGTGGTT A (SEQ ID NO: 63)
[0021] NNN--anticodon
[0022] In endogenous tRNA, the tRNA is modified to recognize the
codon comprising the point mutation by including the complementary
sequence at the NNN position noted herein above. As clarified in
more detail below, the NNN sequences in amber, ochre, and opal tRNA
are as follows: Amber: NNN=CTA; Ochre: NNN=TCA; Opal: NNN=TTA.
[0023] List of primers for next generation sequencing (NGS)
analyses.
TABLE-US-00003 Name Sequence (5' to 3') NGS_DMD_F1
GTGTTACTGAATATGAAATAATGGAGGA (SEQ ID NO: 64) NGS_DMD_R1
ATTTCTGGCATATTTCTGAAGGTG (SEQ ID NO: 65) NGS_DMD_F2
CTCTCTGTACCTTATCTTAGTGTTACTGA (SEQ ID NO: 66) NGS_DMD_R2
CTCTTCAAATTCTGACAGATATTTCTGGC (SEQ ID NO: 67) NGS_OTC_F
ACCCTTCCTTTCTTACCACACA (SEQ ID NO: 68) NGS_OTC_R
CAGGGTGTCCAGATCTGATTGTT (SEQ ID NO: 69) NGS_OTC_R2
CTTCTCTTTTAAACTAACCCATCAGAGTT (SEQ ID NO: 70)
[0024] List of adRNA antisense sequences and corresponding ADAR2
recruiting scaffold used for in vivo RNA editing studies. In some
embodiments, the recruiting scaffold v2--disclosed in paragraph
[0084], is used with these sequences.
TABLE-US-00004 Name adRNA antisense sequence (3' to 5') OTC
TGTCTGTGGCGAGCCAAACA (SEQ ID NO: 71) DMD ACTTTCTCGTTACCTTACCG (SEQ
ID NO: 72) MCP-Linker-ADAR1-NLS (optional sequence in brackets)
(SEQ ID NO: 73)
MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSA
QNRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPS
AIAANSGIYGGSGSGAGSGSPAGGGAPGSGGGSKAERMGFTEVTPVTGASLRRTML
LLSRSPEAQPKTLPLTGSTFHDQIAMLSHRCFNTLTNSFQPSLLGRKILAAIIMKKDSE
DMGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEIISRRGFIRFLYSELMKYNSQTAK
DSIFEPAKGGEKLQIKKTVSFHLYISTAPCGDGALFDKSCSDRAMESTESRHYPVFEN
PKQGKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGA
LLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVTRDGSAFEDGLRHPFIVNHPKVGRV
SIYDSKRQSGKTKETSVNWCLADGYDLEILDGTRGTVDGPRNELSRVSKKNIFLLFK
KLCSFRYRRDLLRLSYGEAKKAARDYETAKNYFKKGLKDMGYGNWISKPQEEKNF
YLCPVGSGSGSGPKKRKV[AA]* MCP-Linker-ADAR2 (optional sequence in
brackets) (SEQ ID NO: 74)
MGPKKKRKVAAGSGSGSMASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSN
SRSQAYKVTCSVRQSSAQKRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNME
LTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIYGGSGGSGGSMLHLDQTP
SRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTD
VKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYTQLELYLNNKDD
QKRSIFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEPILEEPADRHPNRKARGQ
LRTKIESGEGTIPVRSNASIQTWDGVLQGERLLTMSCSDKIARWNVVGIQGSLLSIFVE
PIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLYTLNKPLLSGISNAEARQPGKAPNF
SVNVVTVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITK
PNVYHESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLT[P]*
N22p-Linker-ADAR1-NLS (optional sequence in brackets) (SEQ ID NO:
75) MGNARTRRRERRAEKQAQWKAANGGGGTSGSGSGSPAGGGAPGSGGGSKAER
MGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTFHDQIAMLSHRCFNTLTNSF
QPSLLGRKILAAIIMKKDSEDMGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEIISRR
GFIRFLYSELMKYNSQTAKDSIFEPAKGGEKLQIKKTVSFHLYISTAPCGDGALFDKS
CSDRAMESTESRHYPVFENPKQGKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRT
MSCSDKILRWNVLGLQGALLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVTRDGSA
FEDGLRHPFIVNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYDLEILDGTRGTVD
GPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDYETAKNYFKKGLK
DMGYGNWISKPQEEKNFYLCPVGSGSGSGPKKRKV[AA]* Nuclear Localization
Sequence-Linker-N22p-Linker-ADAR2 (optional sequence in brackets)
(SEQ ID NO: 76)
[MG]PKKKRKVAAGSGSGSMGNARTRRRERRAEKQAQWKAANGGGGTSGSGSG
SPAGGGAPGSGGGSMLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTD
NFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAE
IISRRSLLRFLYTQLELYLNNKDDQKRSIFQKSERGGFRLKENVQFHLYISTSPCGDAR
IFSPHEPILEEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGERLLTM
SCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLY
TLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHA
LYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGA
WVEKPTEQDQFSLT[P]* MCP-Linker-ADAR1 (E1008Q)-NLS (optional sequence
in brackets) (SEQ ID NO: 77)
MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSA
QNRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPS
AIAANSGIYGGSGSGAGSGSPAGGGAPGSGGGSKAERMGFTEVTPVTGASLRRTML
LLSRSPEAQPKTLPLTGSTFHDQIAMLSHRCFNTLTNSFQPSLLGRKILAAIIMKKDSE
DMGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEIISRRGFIRFLYSELMKYNSQTAK
DSIFEPAKGGEKLQIKKTVSFHLYISTAPCGDGALFDKSCSDRAMESTESRHYPVFEN
PKQGKLRTKVENGQGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGA
LLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVTRDGSAFEDGLRHPFIVNHPKVGRV
SIYDSKRQSGKTKETSVNWCLADGYDLEILDGTRGTVDGPRNELSRVSKKNIFLLFK
KLCSFRYRRDLLRLSYGEAKKAARDYETAKNYFKKGLKDMGYGNWISKPQEEKNF
YLCPVGSGSGSGPKKRKV[AA]* Nuclear Localization
Sequence-Linker-MCP-Linker-ADAR2 (E488Q) (optional sequence in
brackets) (SEQ ID NO: 78)
[MG]PKKKRKVAAGSGSGSMASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISS
NSRSQAYKVTCSVRQSSAQKRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNM
ELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIYGGSGGSGGSMLHLDQT
PSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGT
DVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYTQLELYLNNKD
DQKRSIFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEPILEEPADRHPNRKARG
QLRTKIESGQGTIPVRSNASIQTWDGVLQGERLLTMSCSDKIARWNVVGIQGSLLSIF
VEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLYTLNKPLLSGISNAEARQPGKAP
NFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKI
TKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLT[P]*
N22p-Linker-ADAR1 (E1008Q) (optional sequence in brackets) (SEQ ID
NO: 79) MGNARTRRRERRAEKQAQWKAANGGGGTSGSGSGSPAGGGAPGSGGGSKAER
MGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTFHDQIAMLSHRCFNTLTNSF
QPSLLGRKILAAIIMKKDSEDMGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEIISRR
GFIRFLYSELMKYNSQTAKDSIFEPAKGGEKLQIKKTVSFHLYISTAPCGDGALFDKS
CSDRAMESTESRHYPVFENPKQGKLRTKVENGQGTIPVESSDIVPTWDGIRLGERLRT
MSCSDKILRWNVLGLQGALLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVTRDGSA
FEDGLRHPFIVNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYDLEILDGTRGTVD
GPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDYETAKNYFKKGLK
DMGYGNWISKPQEEKNFYLCPVGSGSGSGPKKRKV[AA]* Nuclear Localization
Sequence-Linker-N22p-Linker-ADAR2 (E488Q) (SEQ ID NO: 80)
[MG]PKKKRKVAAGSGSGSMGNARTRRRERRAEKQAQWKAANGGGGTSGSGSG
SPAGGGAPGSGGGSMLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTD
NFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAE
IISRRSLLRFLYTQLELYLNNKDDQKRSIFQKSERGGFRLKENVQFHLYISTSPCGDAR
IFSPHEPILEEPADRHPNRKARGQLRTKIESGQGTIPVRSNASIQTWDGVLQGERLLTM
SCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLY
TLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHA
LYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGA
WVEKPTEQDQFSLT[P]* Nuclear Localization
Sequence-Linker-MCP-Linker-hAPOPEC1 (SEQ ID NO: 81)
[MG]PKKKRKVAAGSGSGSMASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISS
NSRSQAYKVTCSVRQSSAQKRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNM
ELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIYGGSGGSGGSMTSEKGP
STGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEV
NFIKKFTSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWH
MDQQNRQGLRDLVNSGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMM
LYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR*
Nuclear Localization Sequence-Linker-MCP-Linker-rAPOBEC1 (SEQ ID
NO: 82) [MG]PKKKRKVAAGSGSGSMASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISS
NSRSQAYKVTCSVRQSSAQKRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNM
ELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIYGGSGGSGGSMSSETGP
VAVDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSIWRHTSQNTNKHVEV
NFIEKFTTERYFCPNTRCSITWFLSWSPCGECSRAITEFLSRYPHVTLFIYIARLYHHAD
PRNRQGLRDLISSGVTIQIMTEQESGYCWRNFVNYSPSNEAHWPRYPHLWVRLYVLE
LYCIILGLPPCLNILRRKQPQLTFFTIALQSCHYQRLPPHILWATGLK*
dsRBD-Linker-rAPOBEC1 (SEQ ID NO: 83)
MDIEDEENMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRP
LEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYTLLSQTGPVHAP
LFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLS
VNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPAS
LAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDG
QFFEGSGRNKKLAKARAAQSALAAIFNGGSGGSGGSMSSETGPVAVDPTLRRRIEP
HEFEVFFDPRELRKETCLLYEINWGGRHSIWRHTSQNTNKHVEVNFIEKFTTERYFCP
NTRCSITWFLSWSPCGECSRAITEFLSRYPHVTLFIYIARLYHHADPRNRQGLRDLISS
GVTIQIMTEQESGYCWRNFVNYSPSNEAHWPRYPHLWVRLYVLELYCIILGLPPCLNI
LRRKQPQLTFFTIALQSCHYQRLPPHILWATGLK* dsRBD-Linker-hAPOBEC1 (SEQ ID
NO: 84) MDIEDEENMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRP
LEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYTLLSQTGPVHAP
LFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLS
VNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPAS
LAQPPLPVLPPFPPPSGKINPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDG
QFFEGSGRNKKLAKARAAQSALAAIFNGGSGGSGGSMTSEKGPSTGDPTLRRRIEP
WEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKFTSERDFH
PSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDL
VNSGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLP
PCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR*
MCP-Linker-ADAR1-NES (SEQ ID NO: 85)
MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSA
QNRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPS
AIAANSGIYGGSGSGAGSGSPAGGGAPGSGGGSKAERMGFTEVTPVTGASLRRTML
LLSRSPEAQPKTLPLTGSTFHDQIAMLSHRCFNTLTNSFQPSLLGRKILAAIIMKKDSE
DMGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEIISRRGFIRFLYSELMKYNSQTAK
DSIFEPAKGGEKLQIKKTVSFHLYISTAPCGDGALFDKSCSDRAMESTESRHYPVFEN
PKQGKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGA
LLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVTRDGSAFEDGLRHPFIVNHPKVGRV
SIYDSKRQSGKTKETSVNWCLADGYDLEILDGTRGTVDGPRNELSRVSKKNIFLLFK
KLCSFRYRRDLLRLSYGEAKKAARDYETAKNYFKKGLKDMGYGNWISKPQEEKNF
YLCPVGSGSGSLPPLERLTL* MCP-Linker-ADAR2-NLS (SEQ ID NO: 86)
MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSA
QNRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPS
AIAANSGIYGGSGSGAGSGSPAGGGAPGSGGGSQLHLPQVLADAVSRLVLGKFGDL
TDNFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCH
AEIISRRSLLRFLYTQLELYLNNKDDQKRSIFQKSERGGFRLKENVQFHLYISTSPCGD
ARIFSPHEPILEEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGERLL
TMSCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPP
LYTLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCK
HALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLG
AWVEKPTEQDQFSLTGSGSGSPKKKRKV* MCP-Linker-ADAR2-NES (SEQ ID NO: 87)
MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSA
QNRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPS
AIAANSGIYGGSGSGAGSGSPAGGGAPGSGGGSQLHLPQVLADAVSRLVLGKFGDL
TDNFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCH
AEIISRRSLLRFLYTQLELYLNNKDDQKRSIFQKSERGGFRLKENVQFHLYISTSPCGD
ARIFSPHEPILEEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGERLL
TMSCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPP
LYTLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCK
HALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLG
AWVEKPTEQDQFSLTGSGSGSLPPLERLTL* MCP-Linker-rAPOBEC1-NLS (SEQ ID NO:
88) MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSA
QNRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPS
AIAANSGIYGGSGSGAGSGSPAGGGAPGSGGGSSGSETPGTSESATPESMSSETGPVA
VDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSIWRHTSQNTNKHVEVNFI EKFT
TERYFCPNTRCSITWFLSWSPCGECSRAITEFLSRYPHVTLFIYIARLYHHADPRNRQG
LRDLISSGVTIQIMTEQESGYCWRNFVNYSPSNEAHWPRYPHLWVRLYVLELYCIILG
LPPCLNILRRKQPQLTFFTIALQSCHYQRLPPHILWATGLKGSGSGSPKKKRKV*
MCP-Linker-rAPOBEC1-NES (SEQ ID NO: 89)
MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSA
QNRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPS
AIAANSGIYGGSGSGAGSGSPAGGGAPGSGGGSSGSETPGTSESATPESMSSETGPVA
VDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSIWRHTSQNTNKHVEVNFI
EKFTTERYFCPNTRCSITWFLSWSPCGECSRAITEFLSRYPHVTLFIYIARLYHHADPR
NRQGLRDLISSGVTIQIMTEQESGYCWRNFVNYSPSNEAHWPRYPHLWVRLYVLEL
YCIILGLPPCLNILRRKQPQLTFFTIALQSCHYQRLPPHILWATGLKGSGSGSLPPLERL TL*
MCP-Linker-hAPOBEC1-NLS (SEQ ID NO: 90)
MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSA
QNRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPS
AIAANSGIYGGSGSGAGSGSPAGGGAPGSGGGSSGSETPGTSESATPESMTSEKGPST
GDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNF
IKKFTSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMD
QQNRQGLRDLVNSGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLY
ALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWRGS
GSGSPKKKRKV* MCP-Linker-hAPOBEC1-NES (SEQ ID NO: 91)
MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSA
QNRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPS
AIAANSGIYGGSGSGAGSGSPAGGGAPGSGGGSSGSETPGTSESATPESMTSEKGPST
GDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNF
IKKFTSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMD
QQNRQGLRDLVNSGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLY
ALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWRGS
GSGSLPPLERLTL* Alternate spacer (can be used in place of GGSGGSGGS
(SEQ ID NO: 92)): (SEQ ID NO: 93) SGSETPGTSESATPES
3XNLS-4x1N-cdADAR2 (SEQ ID NO: 94)
MPKKKRKVDPKKKRKVDPKKKRKVGSYPYDVPDYAGSNARTRRRERRAEKQA
QWKAANGGGGSGGGGSGGGGSNARTRRRERRAEKQAQWKAANGGGGSGGG
GSGGGGSNARTRRRERRAEKQAQWKAANGGGGSGGGGSGGGGSNARTRRRE
RRAEKQAQWKAANLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTD
NFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAE
IISRRSLLRFLYTQLELYLNNKDDQKRSIFQKSERGGFRLKENVQFHLYISTSPCGDAR
IFSPHEPILEEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGERLLTM
SCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLY
TLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHA
LYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGA
WVEKPTEQDQFSLTP N22p-hAPOBEC1 (SEQ ID NO: 95)
MPKKKRKVDGSGNARTRRRERRAEKQAQWKAANGGGGTSGSGSGSPAGGGA
PGSGGGSMTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKI
WRSSGKNTTNHVEVNFIKKFTSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHP
GVTLVIYVARLFWHMDQQNRQGLRDLVNSGVTIQIMRASEYYHCWRNFVNYPPGD
EAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPH
ILLATGLIHPSVAWR 3XNLS-4x1N-hAPOBEC1 (SEQ ID NO: 96)
MPKKKRKVDPKKKRKVDPKKKRKVGSYPYDVPDYAGSNARTRRRERRAEKQA
QWKAANGGGGSGGGGSGGGGSNARTRRRERRAEKQAQWKAANGGGGSGGG
GSGGGGSNARTRRRERRAEKQAQWKAANGGGGSGGGGSGGGGSNARTRRRE
RRAEKQAQWKAANMTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIK
WGMSRKIWRSSGKNTTNHVEVNFIKKFTSERDFHPSMSCSITWFLSWSPCWECSQAI
REFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLVNSGVTIQIMRASEYYHCWRNF
VNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNC
HYQTIPPHILLATGLIHPSVAWR C-terminal ADAR2 (residues 1-138 deleted)
(SEQ ID NO: 97)
MLRSFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGS
NGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLS
ESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFNLHLDQTPSRQPI
PSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTDVKDA
KVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYTQLELYLNNKDDQKRS
IFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEPILEEPADRHPNRKARGQLRTKI
ESGEGTIPVRSNASIQTWDGVLQGERLLTMSCSDKIARWNVVGIQGSLLSIFVEPIYFS
SIILGSLYHGDHLSRAMYQRISNIEDLPPLYTLNKPLLSGISNAEARQPGKAPNFSVNW
TVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVY
HESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLTP* MS2-RNA: Single: (SEQ
ID NO: 98) NNNNNNNNNNNNNNNNNNNNggccAACATGAGGATCACCCATGTCTGCAGggcc
Dual: (SEQ ID NO: 99)
aACATGAGGATCACCCATGTcNNNNNNNNNNNNNNNNNNNNaACATGAGGATCA CCCATGTc
BoxB RNA: Single: (SEQ ID NO: 100)
NNNNNNNNNNNNNNNNNNNNgggccctgaagaagggccc Dual: (SEQ ID NO: 101)
ggGCCCTGAAGAAGGGCccNNNNNNNNNNNNNNNNNNNNggGCCCTGAAGAAGG GCcc
PP7-RNA: (SEQ ID NO: 102)
NNNNNNNNNNNNNNNNNNNNccggagcagacgatatggcgtcgctccgg Dual Hairpin RNA:
(SEQ ID NO: 103)
TGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACNNNNNNNNNNNNNNNNNNNN
GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCA C A-U to G-C
substitutions in adRNA (SEQ ID NO: 104) vi:
GGGTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACCT (SEQ ID NO: 105)
v2 : GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCAC (SEQ ID NO: 106)
v3: NNNNNNNNNNNNNN (SEQ ID NO: 107) v4: NNNNNNNNNNNNN (SEQ ID NO:
108) v5: (SEQ ID NO: 109) v6: (SEQ ID NO: 110) v7: NNNNNNNNNNNNNN
(SEQ ID NO: 111) v8: NNNNNNNNNNNNNNN (SEQ ID NO: 112) v9:
NNNNNNNNNNNNNN (SEQ ID NO: 113) v10: (SEQ ID NO: 114) v11:
GGTGTCGAGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCTCGACAC C (SEQ ID
NO: 115) v12: GGTGTCGAGAAGAGGAGAACAATATGCTAAATGTTGTTCTCGTCTCCTCGACA
CC (SEQ ID NO: 116) v13:
GGTGTCGAGAASAGGASAACAATAGGCTAAACGTTGTTCTCGTCTCCTCGACA CC
dCas9Cj-NES-Linker-cdADAR2(E488Q) (SEQ ID NO: 117)
MARILAFAIGISSIGWAFSENDELKDCGVRIFTKVENPKTGESLALPRRLARSAR
KRLARRKARLNHLKHLIANEFKLNYEDYQSFDESLAKAYKGSLISPYELRFRAL
NELLSKQDFARVILHIAKRRGYDDIKNSDDKEKGAILKAIKQNEEKLANYQSVG
EYLYKEYFQKFKENSKEFTNYRNKKESYERCIAQSFLKDELKLIFIREFGFSF
SKKFEEEVLSVAFYKRALKDFSHLVGNCSFFTDEKRAPKNSPLAFMFVALTRIM
LLNNLKINTEGILYTKDDLNALLNEVLKNGTLTYKQTKKLLGLSDDYEFKGEKG
TYFIEFKKYKEFIKALGEHNLSQDDLNEIAKDITLIKDEIKLKKALAKYDLNQNQ
IDSLSKLEFKDHLNISFKALKLVTPLMLEGKKYDEACNELNLKVAINEDKKDFL
PAFNETYYKDEVTNPVVLRAIKEYRKVLNALLKKYGKVHKINIELAREVGKNHS
QRAKIEKEQNENYKAKKDAELECEKLGLKINSKNILKLRLFKEQKEFCAYSGEK
IKISDLQDEKMLEIDAIYPYSRSFDDSYMNKVLVFTKQNQEKLNQTPFEAFGNDS
AKWQKIEVLAKNLPTKKQKRILDKNYKDKEQKNFKDRNLNDTRYIARLVLNYT
KDYLDFLPLSDDENTKLNDTQKGSKVHVEAKSGMLTSALRHTWGFSAKDRNN
HLHHAIDAVHAYANNSIVKAFSDFKKEQESNSAELYAKKISELDYKNKRKFFEPF
SGFRQKVLDKIDEIFVSKPERKKPSGALHEETFRKEEEFYQSYGGKEGVLKALE
LGKIRKVNGKIVKINGDMFRVDIFKHKKTNKFYAVPIYTMDFALKVLPNKAVAR
SKKGEIKDWILMDENYEFCFSLYKDSLILIQTKDMQEPEFVYYNAFTSSTVSLIVS
KHDNKFETLSKNQKILFKNANEKEVIAKSIGIQNLKVFEKYIVSALGEVTKAEFR
QREDFKKSGLPPLERLTLGSGGGGSQLHLPQVLADAVSRLVLGKFGDLTDNFSSPH
ARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSL
LRFLYTQLELYLNNKDDQKRSIFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEP
ILEEPADRHPNRKARGQLRTKIESGQGTIPVRSNASIQTWDGVLQGERLLTMSCSDKI
ARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLYTLNKPL
LSGISNAEARQPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRW
MRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPT EQDQFSLT
Single and dual ADAR2 recruiting domain: Single: (SEQ ID NO: 118)
GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACACAAACC GAGCGGTGTCTGT
Dual 1: (SEQ ID NO: 119)
GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACCAAACCG
AGCGGTGTCTGTGGTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTAT CCCAC Dual 2:
(SEQ ID NO: 120)
GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACTACAAAC
CGAGCGGTGTCTGGTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTAT CCCAC Dual 3:
(SEQ ID NO: 121)
GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACTTTACAAA
CCGAGCGGTGTCGTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATC CCAC Dual 4:
(SEQ ID NO: 122)
GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACGTTTTACA
AACCGAGCGGTGGTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTAT CCCAC Dual 5:
(SEQ ID NO: 123)
GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACAAGTTTTA
CAAACCGAGCGGGTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTAT CCCAC
indicates data missing or illegible when filed
BRIEF DESCRIPTION OF THE DRAWINGS
[0025] FIG. 1 is a schematic of the vector constructs developed for
the delivery of the modified endogenous or orthogonal tRNA.
[0026] FIG. 2A-B show suppression efficiencies of the tRNA
constructs: (FIG. 2A) Relative efficiencies of the suppressor tRNAs
derived from arginine, serine and leucine towards the amber, ochre
and opal stop codons; Representative images showing the restoration
of GFP expression in the presence of the Ser tRNAAmber (FIG. 2B)
Comparison of the suppression efficiencies of the single or dual
pyrrolysyl tRNAs towards amber, ochre and opal stop codons in the
presence of 2 mM UAA; Representative images showing the relative
GFP restoration using single and dual pyrrolysyl tRNAAmber in the
presence of 2 mM UAA.
[0027] FIG. 3 shows the GFP reporter results for dystrophin with
various tRNA and amino acids.
[0028] FIG. 4 shows the results of the dystrophin restoration
experiments performed in mdx mice.
[0029] FIG. 5 shows sequences used to generate the ADAR2 constructs
(SEQ ID NOS 164-166, respectively, in order of appearance).
[0030] FIG. 6 shows non-limiting examples of RNA level point
mutations to a codon that can be made by ADAR2.
[0031] FIG. 7 shows exemplary schematics of constructs that may be
used in an ADAR2 based RNA editing system.
[0032] FIG. 8 shows the results of optimization of the length of
adRNA and distance of the edit from the ADAR2 recruiting domain.
The first number in the shorthand for each category on the Y-axis
is the length of adRNA and the second number (following the dash)
is the distance of edit from ADAR2 recruiting domain. 20-6 with
ADAR2 recruiting region v2 gave us the best results.
[0033] FIG. 9 shows in vitro restoration of GFP expression using
the editing systems described herein.
[0034] FIG. 10 shows the results of optimization of hairpins with
mismatches (SEQ ID NOS 167-172, respectively, in order of
appearance). The first number in the shorthand for each category on
the Y-axis is the number of mismatches and the second number is the
number of bases it is from the target. For example, 13 is 1
mismatch, 3 bases away from the target.
[0035] FIG. 11 shows the results of varying lengths of toe hold,
guide RNA sequences with no mismatches to the target.
[0036] FIG. 12A-C show results of (FIG. 12A) immunostaining, (FIG.
12B) Western blot, and (FIG. 12C) in vitro OTC mRNA editing assays
(SEQ ID NOS 173-174, respectively, in order of appearance).
[0037] FIG. 13 is a Western blot that shows the restoration of
dystrophin expression using suppressor tRNA, in comparison with the
Cas9 based approaches.
[0038] FIG. 14 shows normalized dystrophin mRNA levels.
[0039] FIG. 15 shows results of immunostaining.
[0040] FIG. 16A-D shows in vitro suppression and editing of stop
codons in GFP reporter mRNA: (FIG. 16A) Activity of arginine,
serine and leucine suppressor tRNAs targeting amber, ochre and opal
stop codons (n=3 independent replicates). (FIG. 16B) Orthogonal
tRNA/aaRS (MbPy1RS) based suppression of amber, ochre and opal stop
codons in the presence of one or two copies of the pyrrolysyl-tRNA
delivered via an AAV vector and in the presence of 1 mM
N.epsilon.-Boc-L-Lysine (n=3 independent replicates) (p-values
0.022, 0.002, 0.027 respectively). (FIG. 16C) ADAR2 based RNA
editing efficiencies of amber and ochre stop codons, in one-step,
two-steps, or in combination with suppressor tRNAs (n=3 independent
replicates). (FIG. 16D) ADAR2 based RNA editing efficiencies of
amber and ochre stop codons in the presence of one or two copies of
the adRNA, delivered via an AAV vector (n=3 or 6 independent
replicates) (p-values 0.0003, 0.0001, 0.0015 respectively).
[0041] FIG. 17A-E shows in vivo RNA targeting in mouse models of
human disease: (FIG. 17A) Schematic of the DNA and RNA targeting
approaches to restore dystrophin expression in mdx mice: (i) a dual
gRNA-CRISPR based approach leading to in frame excision of exon 23;
(ii) tRNA suppression of the ochre codon; and (iii) ADAR2 based
editing of the ochre codon. (FIG. 17B) Immunofluorescence staining
for dystrophin and nNOS in controls and treated samples (scale bar:
250 .mu.m). (FIG. 17C) In vivo TAA->TGG/TAG/TGA RNA editing
efficiencies in corresponding treated adult mdx mice (n=3 or 4
mice). (FIG. 17D) Schematic of the OTC locus in spf.sup.ash mice
which have a G->A point mutation at a donor splice site or
missense in the last nucleotide of exon 4, and approach for
correction of mutant OTC mRNA via ADAR2 mediated RNA editing (FIG.
17E) In vivo A->G RNA editing efficiencies in corresponding
treated adult spf.sup.ash mice (n=3 or 4 mice).
[0042] FIG. 18A-B show in vitro tRNA suppression evaluation and
optimization: (FIG. 18A) Specificity of modified serine suppressor
tRNAs for ochre and opal stop codons (n=3 independent replicates).
(FIG. 18B) Ochre stop codon suppression efficiency utilizing three
different aaRS: MbPy1RS, MmPy1RS and AcKRS, and two or four copies
of the pyrroysyl-tRNA, or serine suppressor tRNA, all delivered
using an AAV vector. MbPy1RS, MmPy1RS: 1 mM
N.epsilon.-Boc-L-Lysine; AcKRS: 1 or 10 mM
N.epsilon.-Acetyl-L-Lysine (n=3 independent replicates).
[0043] FIG. 19A-C shows in vitro ADAR2 mediated site-specific RNA
editing evaluation and optimization: (FIG. 19A) GFP expression is
restored when adRNA/radRNA has two mismatches corresponding to the
two adenosines in the ochre stop codon. Presence of a single
mismatch results in the formation of an amber or opal stop codon
(n=3 independent replicates) (SEQ ID NOS 175-179, respectively, in
order of appearance). (FIG. 19B) Panel of adRNA designs used (SEQ
ID NOS 180-181, respectively, in order of appearance). (FIG. 19C)
Optimization of adRNA antisense region using adRNA design 1: length
and distance from the ADAR2 recruiting region were systematically
varied, and editing efficiency calculated as a ratio of Sanger peak
heights G/(A+G) (n=3 independent replicates) (SEQ ID NOS 182-206,
respectively, in order of appearance).
[0044] FIG. 20A-C shows in vivo targeting of dystrophin mRNA via
suppressor tRNAs: (FIG. 20A) Progressively increasing restoration
of dystrophin expression over time in mdx mice treated with
AAV8-dual-serine-ochre-tRNA. (FIG. 20B) UAA inducible nNOS
localization in mdx mice treated with
AAV8-dual-pyrrolysine-ochre-tRNA-MbPy1RS. (FIG. 20C) Western blot
for dystrophin shows partial recovery of dystrophin expression in
the mdx mice treated with a serine tRNA ochre, the pyrrolysyl-tRNA
ochre and administered with the UAA, as well as in Cas9/gRNAs
treated samples.
[0045] FIG. 21A-D show in vitro and in vivo editing of dystrophin
and OTC mRNA: (FIG. 21A) Representative Sanger sequencing plot
showing 12.7% editing of the ochre stop codon (TAA->TGG) in a
fragment of the mdx dystrophin mRNA expressed in HEK 293T cells
(quantified using NGS) (SEQ ID NOS 207-208, respectively, in order
of appearance). (FIG. 21B) Representative example of in vivo RNA
editing analyses of treated mdx mouse (quantified using NGS) (SEQ
ID NOS 209-216, respectively, in order of appearance). (FIG. 21C)
Representative Sanger sequencing plot showing 29.7% correction of
the point mutation in a fragment of the spf.sup.ash OTC mRNA
expressed in HEK 293T cells (quantified using NGS) (SEQ ID NOS
217-218, respectively, in order of appearance). (FIG. 21D)
Representative example of in vivo RNA editing analyses of treated
spf.sup.ash mouse (quantified using NGS) (SEQ ID NOS 219-226,
respectively, in order of appearance).
[0046] FIG. 22A-B show in vitro editing efficiency of ADAR2-E488Q.
ADAR2-E488Q enables higher efficiency than the ADAR2 in the in
vitro editing of: (FIG. 22A) a fragment of spf.sup.ash OTC mRNA
expressed in HEK293T cells (n=3 independent replicates) (p-value
0.037), and (FIG. 22B) a fragment of mdx dystrophin mRNA expressed
in HEK293T cells (n=3 independent replicates) (p-values 0.048,
0.012 respectively). Efficiency was calculated as a ratio of Sanger
peak heights G/(A+G).
[0047] FIG. 23A-D show schematics of (FIG. 23A) MCP or N22 fusions
with ADAR1 or ADAR2, (FIG. 23B) recruitment of APOBEC by adRNA,
(FIG. 23C) a more general adRNA architecture, and (FIG. 23D) the
structure of the v2 adRNA scaffold after folding (SEQ ID NO:
227).
[0048] FIG. 24A-B show schematics of optional embodiments in which
(FIG. 24A) endogenous ADAR2 can be used in the methods disclosed
herein in tissues with high endogenous ADAR2, e.g., brain, lung,
and spleen and (FIG. 24B) ADAR1 and/or ADAR2 levels can be
increased in tissues with low levels of endogenous ADAR1 and ADAR2.
Clockwise from the left, (1) delivery of adRNA and ADAR2 would
result in high levels of RNA editing, (2) delivery of adRNA alone
is likely to bring about little or no editing due to the low levels
of endogenous ADAR1 and ADAR2, (3) treatment of cells with IFNs
will lead to an increase in the ADAR1 (p150) levels but is unlikely
to bring about any editing of the RNA target in the absence of the
adRNA; (4) treatment of cells with IFNs with the addition of adRNA
will lead to elevated levels of ADAR1 (p150) and in the presence of
adRNA, is likely to lead to high levels of target RNA editing, (5)
treatment of cells with IFNs with the addition of adRNA and ADAR2
will lead to elevated levels of ADAR1 expression, and high levels
of RNA editing.
[0049] FIG. 25 shows the rate of UAA to UAG conversion. The UAA is
converted to UAG via ADAR2 based editing and addition of suppressor
tRNA targeting the UAG stop codon led to partial restoration of GFP
expression
[0050] FIG. 26 shows the results of in vivo RNA editing in the mdx
mouse model of muscular dystrophy.
[0051] FIG. 27 shows the resulting edited sequences resulting from
use of the promiscuous C-terminal ADAR2 (SEQ ID NOS 228-264,
respectively, in order of appearance).
[0052] FIG. 28 shows editing efficiency of the stabilized scaffolds
(SEQ ID NOS 104-113, respectively, in order of appearance).
[0053] FIG. 29 shows the fraction of edited mRNA with single versus
dual ADAR2 recruiting domains and the corresponding sequences (SEQ
ID NOS 118-123, respectively, in order of appearance).
[0054] FIG. 30 shows the fraction of edited mRNA with various
MCP-ADAR scaffolds (SEQ ID NOS 265-269, respectively, in order of
appearance).
[0055] FIG. 31 shows alternative splice variants of OTC and is
taken from Hodges, P. E. & Rosenberg, L. E. The spfash mouse: a
missense mutation in the ornithine transcarbamylase gene also
causes aberrant mRNA splicing. Proc. Natl. Acad. Sci. U.S.A. 86,
4142-4146 (1989) (SEQ ID NOS 270-275, respectively, in order of
appearance).
DETAILED DESCRIPTION
[0056] Unless defined otherwise, all technical and scientific terms
used herein have the same meanings as commonly understood by one of
ordinary skill in the art to which this invention belongs. All
nucleotide sequences provided herein are presented in the 5' to 3'
direction. Although any methods and materials similar or equivalent
to those described herein can be used in the practice or testing of
the present invention, the preferred methods, devices, and
materials are now described. All technical and patent publications
cited herein are incorporated herein by reference in their
entirety. Nothing herein is to be construed as an admission that
the invention is not entitled to antedate such disclosure by virtue
of prior invention.
[0057] The practice of the present technology will employ, unless
otherwise indicated, conventional techniques of tissue culture,
immunology, molecular biology, microbiology, cell biology, and
recombinant DNA, which are within the skill of the art. See, e.g.,
Sambrook and Russell eds. (2001) Molecular Cloning: A Laboratory
Manual, 3rd edition; the series Ausubel et al. eds. (2007) Current
Protocols in Molecular Biology; the series Methods in Enzymology
(Academic Press, Inc., N.Y.); MacPherson et al. (1991) PCR 1: A
Practical Approach (IRL Press at Oxford University Press);
MacPherson et al. (1995) PCR 2: A Practical Approach; Harlow and
Lane eds. (1999) Antibodies, A Laboratory Manual; Freshney (2005)
Culture of Animal Cells: A Manual of Basic Technique, 5th edition;
Gait ed. (1984) Oligonucleotide Synthesis; U.S. Pat. No. 4,683,195;
Hames and Higgins eds. (1984) Nucleic Acid Hybridization; Anderson
(1999) Nucleic Acid Hybridization; Hames and Higgins eds. (1984)
Transcription and Translation; Immobilized Cells and Enzymes (IRL
Press (1986)); Perbal (1984) A Practical Guide to Molecular
Cloning; Miller and Calos eds. (1987) Gene Transfer Vectors for
Mammalian Cells (Cold Spring Harbor Laboratory); Makrides ed.
(2003) Gene Transfer and Expression in Mammalian Cells; Mayer and
Walker eds. (1987) Immunochemical Methods in Cell and Molecular
Biology (Academic Press, London); and Herzenberg et al. eds (1996)
Weir's Handbook of Experimental Immunology.
[0058] The terminology used in the description herein is for the
purpose of describing particular embodiments only and is not
intended to be limiting of the invention. All publications, patent
applications, patents and other references mentioned herein are
incorporated by reference in their entirety.
[0059] All numerical designations, e.g., pH, temperature, time,
concentration, and molecular weight, including ranges, are
approximations which are varied (+) or (-) by increments of 1.0 or
0.1, as appropriate or alternatively by a variation of +/-15%, or
alternatively 10% or alternatively 5% or alternatively 2%. It is to
be understood, although not always explicitly stated, that all
numerical designations are preceded by the term "about". It also is
to be understood, although not always explicitly stated, that the
reagents described herein are merely exemplary and that equivalents
of such are known in the art.
[0060] Unless the context indicates otherwise, it is specifically
intended that the various features of the invention described
herein can be used in any combination. Moreover, the disclosure
also contemplates that in some embodiments, any feature or
combination of features set forth herein can be excluded or
omitted. To illustrate, if the specification states that a complex
comprises components A, B and C, it is specifically intended that
any of A, B or C, or a combination thereof, can be omitted and
disclaimed singularly or in any combination.
[0061] Unless explicitly indicated otherwise, all specified
embodiments, features, and terms intend to include both the recited
embodiment, feature, or term and biological equivalents thereof
[0062] Definitions
[0063] As used in the specification and claims, the singular form
"a", "an" and "the" include plural references unless the context
clearly dictates otherwise. For example, the term "a polypeptide"
includes a plurality of polypeptides, including mixtures
thereof.
[0064] The term "about," as used herein when referring to a
measurable value such as an amount or concentration and the like,
is meant to encompass variations of 20%, 10%, 5%, 1%, 0.5%, or even
0.1% of the specified amount.
[0065] As used herein, the term "comprising" is intended to mean
that the compositions and methods include the recited elements, but
do not exclude others. "Consisting essentially of" when used to
define compositions and methods, shall mean excluding other
elements of any essential significance to the combination for the
intended use. Thus, a composition consisting essentially of the
elements as defined herein would not exclude trace contaminants
from the isolation and purification method and pharmaceutically
acceptable carriers, such as phosphate buffered saline,
preservatives, and the like. "Consisting of" shall mean excluding
more than trace elements of other ingredients and substantial
method steps for administering the compositions of this invention.
Embodiments defined by each of these transition terms are within
the scope of this invention.
[0066] A "subject" of diagnosis or treatment is a cell or an animal
such as a mammal, or a human. Non-human animals subject to
diagnosis or treatment and are those subject to infections or
animal models, for example, simians, murines, such as, rats, mice,
chinchilla, canine, such as dogs, leporids, such as rabbits,
livestock, sport animals, and pets.
[0067] The term "protein", "peptide" and "polypeptide" are used
interchangeably and in their broadest sense to refer to a compound
of two or more subunit amino acids, amino acid analogs or
peptidomimetics. The subunits may be linked by peptide bonds. In
another embodiment, the subunit may be linked by other bonds, e.g.,
ester, ether, etc. A protein or peptide must contain at least two
amino acids and no limitation is placed on the maximum number of
amino acids which may comprise a protein's or peptide's sequence.
As used herein the term "amino acid" refers to either natural
and/or unnatural or synthetic amino acids, including glycine and
both the D and L optical isomers, amino acid analogs and
peptidomimetics. As used herein, the term "fusion protein" refers
to a protein comprised of domains from more than one naturally
occurring or recombinantly produced protein, where generally each
domain serves a different function. In this regard, the term
"linker" refers to a protein fragment that is used to link these
domains together--optionally to preserve the conformation of the
fused protein domains and/or prevent unfavorable interactions
between the fused protein domains which may compromise their
respective functions.
[0068] The terms "polynucleotide" and "oligonucleotide" are used
interchangeably and refer to a polymeric form of nucleotides of any
length, either deoxyribonucleotides or ribonucleotides or analogs
thereof. Polynucleotides can have any three-dimensional structure
and may perform any function, known or unknown. The following are
non-limiting examples of polynucleotides: a gene or gene fragment
(for example, a probe, primer, EST or SAGE tag), exons, introns,
messenger RNA (mRNA), transfer RNA, ribosomal RNA, RNAi, ribozymes,
cDNA, recombinant polynucleotides, branched polynucleotides,
plasmids, vectors, isolated DNA of any sequence, isolated RNA of
any sequence, nucleic acid probes and primers. A polynucleotide can
comprise modified nucleotides, such as methylated nucleotides and
nucleotide analogs. If present, modifications to the nucleotide
structure can be imparted before or after assembly of the
polynucleotide. The sequence of nucleotides can be interrupted by
non-nucleotide components. A polynucleotide can be further modified
after polymerization, such as by conjugation with a labeling
component. The term also refers to both double- and single-stranded
molecules. Unless otherwise specified or required, any embodiment
of this invention that is a polynucleotide encompasses both the
double-stranded form and each of two complementary single-stranded
forms known or predicted to make up the double-stranded form.
[0069] A polynucleotide is composed of a specific sequence of four
nucleotide bases: adenine (A); cytosine (C); guanine (G); thymine
(T); and uracil (U) for thymine when the polynucleotide is RNA. In
some embodiments, the polynucleotide may comprise one or more other
nucleotide bases, such as inosine (I), a nucleoside formed when
hypoxanthine is attached to ribofuranose via a .beta.-N9-glycosidic
bond, resulting in the chemical structure:
##STR00001##
Inosine is read by the translation machinery as guanine (G). The
term "polynucleotide sequence" is the alphabetical representation
of a polynucleotide molecule. This alphabetical representation can
be input into databases in a computer having a central processing
unit and used for bioinformatics applications such as functional
genomics and homology searching.
[0070] As used herein, "expression" refers to the process by which
polynucleotides are transcribed into mRNA and/or the process by
which the transcribed mRNA is subsequently being translated into
peptides, polypeptides, or proteins. If the polynucleotide is
derived from genomic DNA, expression may include splicing of the
mRNA in a eukaryotic cell.
[0071] The terms "equivalent" or "biological equivalent" are used
interchangeably when referring to a particular molecule,
biological, or cellular material and intend those having minimal
homology while still maintaining desired structure or
functionality.
[0072] The term "encode" as it is applied to polynucleotides refers
to a polynucleotide which is said to "encode" a polypeptide if, in
its native state or when manipulated by methods well known to those
skilled in the art, it can be transcribed and/or translated to
produce the mRNA for the polypeptide and/or a fragment thereof. The
antisense strand is the complement of such a nucleic acid, and the
encoding sequence can be deduced therefrom.
[0073] As used herein, the term "functional" may be used to modify
any molecule, biological, or cellular material to intend that it
accomplishes a particular, specified effect.
[0074] As used herein, the terms "treating," "treatment" and the
like are used herein to mean obtaining a desired pharmacologic
and/or physiologic effect. The effect may be prophylactic in terms
of completely or partially preventing a disease, disorder, or
condition or sign or symptom thereof, and/or may be therapeutic in
terms of a partial or complete cure for a disorder and/or adverse
effect attributable to the disorder.
[0075] "Administration" can be effected in one dose, continuously
or intermittently throughout the course of treatment. Methods of
determining the most effective means and dosage of administration
are known to those of skill in the art and will vary with the
composition used for therapy, the purpose of the therapy, the
target cell being treated, and the subject being treated. Single or
multiple administrations can be carried out with the dose level and
pattern being selected by the treating physician. Suitable dosage
formulations and methods of administering the agents are known in
the art. Route of administration can also be determined and method
of determining the most effective route of administration are known
to those of skill in the art and will vary with the composition
used for treatment, the purpose of the treatment, the health
condition or disease stage of the subject being treated, and target
cell or tissue. Non-limiting examples of route of administration
include oral administration, nasal administration, injection, and
topical application.
[0076] The term "effective amount" refers to a quantity sufficient
to achieve a desired effect. In the context of therapeutic or
prophylactic applications, the effective amount will depend on the
type and severity of the condition at issue and the characteristics
of the individual subject, such as general health, age, sex, body
weight, and tolerance to pharmaceutical compositions. In the
context of an immunogenic composition, in some embodiments the
effective amount is the amount sufficient to result in a protective
response against a pathogen. In other embodiments, the effective
amount of an immunogenic composition is the amount sufficient to
result in antibody generation against the antigen. In some
embodiments, the effective amount is the amount required to confer
passive immunity on a subject in need thereof. With respect to
immunogenic compositions, in some embodiments the effective amount
will depend on the intended use, the degree of immunogenicity of a
particular antigenic compound, and the health/responsiveness of the
subject's immune system, in addition to the factors described
above. The skilled artisan will be able to determine appropriate
amounts depending on these and other factors.
[0077] In the case of an in vitro application, in some embodiments
the effective amount will depend on the size and nature of the
application in question. It will also depend on the nature and
sensitivity of the in vitro target and the methods in use. The
skilled artisan will be able to determine the effective amount
based on these and other considerations. The effective amount may
comprise one or more administrations of a composition depending on
the embodiment.
[0078] The term "Cas9" refers to a CRISPR associated endonuclease
referred to by this name (for example, UniProtKB G3ECR1
(CAS9_STRTR)) as well as dead Cas9 or dCas9, which lacks
endonuclease activity (e.g., with mutations in both the RuvC and
HNH domain). The term "Cas9" may further refer to equivalents of
the referenced Cas9 having at least about 60%, 65%, 70%, 75%, 80%,
85%, 90%, 95%, or 99% identity thereto, including but not limited
to other large Cas9 proteins. In some embodiments, the Cas9 is
derived from Campylobacter jejuni or another Cas9 orthologue 1000
amino acids or less in length.
[0079] The term "vector" refers to a polynucleotide (usually DNA)
used to artificially carry foreign genetic material to another cell
where it can be replicated or expressed. Non-limiting exemplary
vectors include plasmids, viral vectors, cosmids, and artificial
chromosomes. Such vectors may be derived from a variety of sources,
including bacterial and viral sources. A non-limiting exemplary
viral source for a plasmid is adeno-associated virus.
[0080] As used herein, the term "recombinant expression system"
refers to a genetic construct or constructs for the expression of
certain genetic material formed by recombination; the term
"construct" in this regard is interchangeable with the term
"vector" as defined herein.
[0081] The term "adeno-associated virus" or "AAV" as used herein
refers to a member of the class of viruses associated with this
name and belonging to the genus dependoparvovirus, family
Parvoviridae. Multiple serotypes of this virus are known to be
suitable for gene delivery; all known serotypes can infect cells
from various tissue types. At least 11, sequentially numbered, are
disclosed in the prior art. Non-limiting exemplary serotypes useful
for the purposes disclosed herein include any of the 11 serotypes,
e.g., AAV2 and AAV8.
[0082] The term "lentivirus" as used herein refers to a member of
the class of viruses associated with this name and belonging to the
genus lentivirus, family Retroviridae. While some lentiviruses are
known to cause diseases, other lentivirus are known to be suitable
for gene delivery. See, e.g., Tomas et al. (2013) Biochemistry,
Genetics and Molecular Biology: "Gene Therapy--Tools and Potential
Applications," ISBN 978-953-51-1014-9, DOI: 10.5772/52534.
[0083] As used herein the term "restoring" in relation to
expression of a protein refers to the ability to establish
expression of full length protein where previously protein
expression was truncated due to mutation.
[0084] The term "mutation" as used herein, refers to an alteration
to a nucleic acid sequence encoding a protein relative to the
consensus sequence of said protein. "Missense" mutations result in
the substitution of one codon for another; "nonsense" mutations
change a codon from one encoding a particular amino acid to a stop
codon. Nonsense mutations often result in truncated translation of
proteins. "Silent" mutations are those which have no effect on the
resulting protein. As used herein the term "point mutation" refers
to a mutation affecting only one nucleotide in a gene sequence.
"Splice site mutations" are those mutations present pre-mRNA (prior
to processing to remove introns) resulting in mistranslation and
often truncation of proteins from incorrect delineation of the
splice site.
[0085] "Messenger RNA" or "mRNA" is a nucleic acid molecule that is
transcribed from DNA and then processed to remove non-coding
sections known as introns. The resulting mRNA is exported from the
nucleus (or another locus where the DNA is present) and translated
into a protein. The term "pre-mRNA" refers to the strand prior to
processing to remove non-coding sections.
[0086] "Transfer ribonucleic acid" or "tRNA" is a nucleic acid
molecule that helps translate mRNA to protein. tRNA have a
distinctive folded structure, comprising three hairpin loops; one
of these loops comprises a "stem" portion that encodes an
anticodon. The anticodon recognizes the corresponding codon on the
mRNA. Each tRNA is "charged with" an amino acid corresponding to
the mRNA codon; this "charging" is accomplished by the enzyme tRNA
synthetase. Upon tRNA recognition of the codon corresponding to its
anticodon, the tRNA transfers the amino acid with which it is
charged to the growing amino acid chain to form a polypeptide or
protein. Endogenous tRNA can be charged by endogenous tRNA
synthetase. Accordingly, endogenous tRNA are typically charged with
canonical amino acids. Orthogonal tRNA, derived from an external
source, require a corresponding orthogonal tRNA synthetase. Such
orthogonal tRNAs may be charged with both canonical and
non-canonical amino acids. In some embodiments, the amino acid with
which the tRNA is charged may be detectably labeled to enable
detection in vivo. Techniques for labeling are known in the art and
include, but are not limited to, click chemistry wherein an
azide/alkyne containing unnatural amino acid is added by the
orthogonal tRNA/synthetase pair and, thus, can be detected using
alkyne/azide comprising fluorophore or other such molecule.
[0087] The term "stop codon" intends a three nucleotide contiguous
sequence within messenger RNA that signals a termination of
translation. Non-limiting examples include in RNA, UAG, UAA, UGA
and in DNA TAG, TAA or TGA. Unless otherwise noted, the term also
includes nonsense mutations within DNA or RNA that introduce a
premature stop codon, causing any resulting protein to be
abnormally shortened. tRNA that correspond to the various stop
codons are known by specific names: amber (UAG), ochre (UAA), and
opal (UGA).
[0088] "Canonical amino acids" refer to those 20 amino acids found
naturally in the human body shown in the table below with each of
their three letter abbreviations, one letter abbreviations,
structures, and corresponding codons:
TABLE-US-00005 non-polar, aliphatic residues Glycine Gly G
##STR00002## GGU GGC GGA GGG Alanine Ala A ##STR00003## GCU GCC GCA
GCG Valine Val V ##STR00004## GUU GUC GUA GUG Leucine Leu L
##STR00005## UUA UUG CUU CUC CUA CUG Isoleucine Ile I ##STR00006##
AUU AUC AUA Proline Pro P ##STR00007## CCU CCC CCA CCG aromatic
residues Phenylalanine Phe F ##STR00008## UUU UUC Tyrosine Tyr Y
##STR00009## UAU UAC Tryptophan Trp W ##STR00010## UGG polar,
non-charged residues Serine Ser S ##STR00011## UCU UCC UCA UCG AGU
AGC Threonine Thr T ##STR00012## ACU ACC ACA ACG Cysteine Cys C
##STR00013## UGU UGC Methionine Met M ##STR00014## AUG Asparagine
Ans N ##STR00015## AAU AAC Glutamine Gln Q ##STR00016## CAA CAG
positively charged residues Lysine Lys K ##STR00017## AAA AAG
Arginine Arg R ##STR00018## CGU CGC CGA CGG AGA AGG Histidine His H
##STR00019## CAU CAC negatively charged residues Aspartate Asp D
##STR00020## GAU GAC Glutamate Glu E ##STR00021## GAA GAG
[0089] The term "non-canonical amino acids" refers to those
synthetic or otherwise modified amino acids that fall outside this
group, typically generated by chemical synthesis or modification of
canonical amino acids (e.g. amino acid analogs). The present
disclosure employs proteinogenic non-canonical amino acids in some
of the methods and vectors disclosed herein. A non-limiting
exemplary non-canonical amino acid is pyrrolysine (Pyl or O), the
chemical structure of which is provided below:
##STR00022##
Inosine (I) is another exemplary non-canonical amino acid, which is
commonly found in tRNA and is essential for proper translation
according to "wobble base pairing." The structure of inosine is
provided above.
[0090] The term "ADAR" as used herein refers to an adenosine
deaminase that can convert adenosines (A) to inosines (I) in an RNA
sequence. ADAR1 and ADAR2 are two exemplary species of ADAR that
are involved in mRNA editing in vivo. Non-limiting exemplary
sequences for ADAR1 may be found under the following reference
numbers: HGNC: 225; Entrez Gene: 103; Ensembl: ENSG 00000160710;
OMIM: 146920; UniProtKB: P55265; and GeneCards: GC01M154554, as
well as biological equivalents thereof. Non-limiting exemplary
sequences for ADAR2 may be found under the following reference
numbers: HGNC: 226; Entrez Gene: 104; Ensembl: ENSG00000197381;
OMIM: 601218; UniProtKB: P78563; and GeneCards: GC21P045073, as
well as biological equivalents thereof. Further non-limited
exemplary sequences of the catalytic domain are provided
hereinabove. The forward and reverse RNA used to direct
site-specific ADAR editing are known as "adRNA" and "radRNA,"
respectively. The catalytic domains of ADAR1 and ADAR2 are
comprised in the sequences provided herein below.
TABLE-US-00006 ADAR1 catalytic domain: (SEQ ID NO: 124)
KAERMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTFHDQIAML
SHRCFNTLTNSFQPSLLGRKILAAIIMKKDSEDMGVVVSLGTGNRCVKGD
SLSLKGETVNDCHAEIISRRGFIRFLYSELMKYNSQTAKDSIFEPAKGGE
KLQIKKTVSFHLYISTAPCGDGALFDKSCSDRAMESTESRHYPVFENPKQ
GKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLG
LQGALLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVTRDGSAFEDGLRH
PFIVNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYDLEILDGTRGTVD
GPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDYETAKN
YFKKGLKDMGYGNWISKPQEEKNFYLCPV ADAR2 catalytic domain: (SEQ ID NO:
125) QLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTDVKD
AKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYTQLELYL
NNKDDQKRSIFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEPILE
EPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGERLLTMS
CSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRIS
NIEDLPPLYTLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINAT
TGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAA
KEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLT
[0091] The double stranded RNA binding domains (dsRBD) of an ADAR
is comprised in the sequence provided herein below.
TABLE-US-00007 ADAR dsRBD: (SEQ ID NO: 126)
MDIEDEENMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPG
RKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYTLLSQ
TGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASE
AHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSF
SSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYD
FLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFN
[0092] It is appreciated that further mutations can be made to the
sequence of the ADAR and/or its various domains. For example,
Applicants have generated E488Q and E1008Q mutants of both ADAR1
and ADAR2, as well as a "promiscuous" variant of ADAR2--resulting
from a C-terminal deletion. This "promiscuous" variant is known as
such because it demonstrated promiscuity in edited reads with
several As close to a target sequence showing an A to G conversion
(verified across 2 different loci). The sequence of this variant is
provided herein below.
TABLE-US-00008 "Promiscuous" ADAR2 variant: (SEQ ID NO: 127)
MLRSFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKAE
PPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPV
MILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKAR
AAQSALAAIFNLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGD
LTDNFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRG
LALNDCHAEIISRRSLLRFLYTQLELYLNNKDDQKRSIFQKSERGGFRLK
ENVQFHLYISTSPCGDARIFSPHEPILEEPADRHPNRKARGQLRTKIESG
EGTIPVRSNASIQTWDGVLQGERLLTMSCSDKIARWNVVGIQGSLLSIFV
EPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLYTLNKPLLSGISNA
EARQPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWM
RVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGAW
VEKPTEQDQFSLTP*
Not to be bound by theory, a C-terminal deletion in ADAR1 may
produce the same or similar effect.
[0093] The term "deficiency" as used herein refers to lower than
normal (physiologically acceptable) levels of a particular agent.
In context of a protein, a deficiency refers to lower than normal
levels of the full length protein.
[0094] The term "dystrophin" as used herein refers to the protein
corresponding with that name and encoded by the gene Dmd; a
non-limiting example of which is found under UniProt Reference
Number P11532 (for humans) and P11531 (for mice).
[0095] The term "ornithine transcarbamylase" or "OTC" as used
herein refers to the protein corresponding with that name and
encoded by the gene Otc; a non-limiting example of which is found
under UniProt Reference Number P00480 (for humans) and P11725 (for
mice). OTC deficiency is an X-linked genetic condition resulting in
high concentrations of ammonia in blood. In some cases, OTC
deficiency is caused by a G->A splice site mutation in the donor
splice site of exon 4 that results in mis-splicing of the pre-mRNA.
This mutation results in the formation of a protein that either is
elongated or bears a point mutation. There is a 15-20 fold
reduction in the OTC protein levels. The FIG. 31 (taken from
Hodges, P. E. & Rosenberg, L. E. The spfash mouse: a missense
mutation in the ornithine transcarbamylase gene also causes
aberrant mRNA splicing. Proc. Natl. Acad. Sci. U.S.A. 86, 4142-4146
(1989)) shows the alternative forms produced. The sequences thereof
are provided below:
TABLE-US-00009 OTC pre-mRNA(wild type): (SEQ ID NO: 128) . . .
CTCACAGACACCGCTCGGTTTGTAAAACTTTTCTTC . . . OTC pre-mRNA(mutant):
(SEQ ID NO: 129) . . . CTCACAGACACCGCTC GTTTGTAAAACTTTTCTTC . . .
OTC mRNA (incorrectly spliced, mutant): (SEQ ID NO: 130) . . .
CTCACAGACACCGCTCAGTTTGTAAAACTTTTCTTC . . . OTC mRNA (correctly
spliced, mutant): (SEQ ID NO: 131) . . .
CTCACAGACACCGCTCATGTCTTATCTAGCATGACA . . . OTC mRNA (correctly
spliced, wild type): (SEQ ID NO: 132) . . .
CTCACAGACACCGCTCGTGTCTTATCTAGCATGACA . . .
As shown above, a correct splice variant may be produced when the
mutation is present; however, such production results in a missense
mutation, which also can contribute to OTC deficiency.
[0096] The terms "hairpin," "hairpin loop," "stem loop," and/or
"loop" used alone or in combination with "motif" is used in context
of an oligonucleotide to refer to a structure formed in single
stranded oligonucleotide when sequences within the single strand
which are complementary when read in opposite directions base pair
to form a region whose conformation resembles a hairpin or
loop.
[0097] As used herein, the term "domain" refers to a particular
region of a protein or polypeptide and is associated with a
particular function. For example, "a domain which associates with
an RNA hairpin motif" refers to the domain of a protein that binds
one or more RNA hairpin. This binding may optionally be specific to
a particular hairpin. For example, the M2 bacteriophage coat
protein (MCP) is capable of specifically binding to particular
stem-loop structures, including but not limited to the MS2 stem
loop. See, e.g. Peabody, D.S., "The RNA binding site of
bacteriophage MS2 coat protein." EMBO J. 12(2):595-600 (1993);
Corrigan and Chubb, "Biophysical Methods in Cell Biology"Methods in
Cell Biology (2015). Similarly, .lamda. N22--referred to herein as
"N22 peptide" is capable of specifically binding to particular
stem-loop structures, including but not limited to BoxB stem loops.
See, e.g., Cilley and Williamson, "Analysis of bacteriophage N
protein and peptide binding to boxB RNA using polyacrylamide gel
coelectrophoresis (PACE)." RNA 3(1):57-67 (1997). The sequences of
both MCP and MS2 stem loop and N22 peptide and BoxB loop are
provided hereinabove in context of fusion proteins with an ADAR
(MCP, N22 peptide) and use in adRNA (MS2 stem loop, BoxB loop),
respectively.
[0098] The term "APOBEC" as used herein refers to any protein that
falls within the family of evolutionarily conserved cytidine
deaminases involved in mRNA editing--catalyzing a C to U
conversion--and equivalents thereof. In some aspects, the term
APOBEC refers to any one of APOBEC1, APOBEC2, APOBEC3A, APOBEC3B,
APOBEC3C, APOBEC3E, APOBEC3F, APOBEC3G, APOBEC3H, APOBEC4, or
equivalents each thereof. Non-limiting exemplary sequences of
fusion proteins comprising one or more APOBEC domains are provided
herein both fused to an ADAR domain or fused to alternative domains
to render them suitable for use in an RNA editing system. To this
end, APOBECs can be considered an equivalent of ADAR--catalyzing
editing albeit by a different conversion. Thus, not to be bound by
theory, Applicants believe that all embodiments contemplated herein
for use with an ADAR based editing system may be adapted for use in
an APOBEC based RNA editing system.
[0099] As used herein, the term "interferon" refers to a group of
signaling proteins known to be associated with the immune response.
In context of this application, the interferons of interest are
those that result in enhanced expression of an ADAR. The
correlation between interferon .alpha. and ADAR1 is well known,
and, thus, the present disclosure contemplates use of interferon
.alpha. as a means of increasing endogenous ADAR1 expression.
Commercial sources of isolated or recombinant interferon a include
but are not limited to Sigma-Aldrich, R&D Systems, Abcam, and
Thermo Fisher Scientific. Alternatively, interferon a may be
produced using a known vector and given protein sequence,
e.g.Q6QNB6 (human IFNA).
[0100] It is to be inferred without explicit recitation and unless
otherwise intended, that when the present disclosure relates to a
polypeptide, protein, polynucleotide or antibody, an equivalent or
a biologically equivalent of such is intended within the scope of
this disclosure. As used herein, the term "biological equivalent
thereof" is intended to be synonymous with "equivalent thereof"
when referring to a reference protein, antibody, polypeptide or
nucleic acid, intends those having minimal homology while still
maintaining desired structure or functionality. Unless specifically
recited herein, it is contemplated that any polynucleotide,
polypeptide or protein mentioned herein also includes equivalents
thereof. For example, an equivalent intends at least about 70%
homology or identity, or at least 80% homology or identity and
alternatively, or at least about 85%, or alternatively at least
about 90%, or alternatively at least about 95%, or alternatively
98% percent homology or identity and exhibits substantially
equivalent biological activity to the reference protein,
polypeptide or nucleic acid. Alternatively, when referring to
polynucleotides, an equivalent thereof is a polynucleotide that
hybridizes under stringent conditions to the reference
polynucleotide or its complement.
[0101] Applicants have provided herein the polypeptide and/or
polynucleotide sequences for use in gene and protein transfer and
expression techniques described below. It should be understood,
although not always explicitly stated that the sequences provided
herein can be used to provide the expression product as well as
substantially identical sequences that produce a protein that has
the same biological properties. These "biologically equivalent" or
"biologically active" polypeptides are encoded by equivalent
polynucleotides as described herein. They may possess at least 60%,
or alternatively, at least 65%, or alternatively, at least 70%, or
alternatively, at least 75%, or alternatively, at least 80%, or
alternatively at least 85%, or alternatively at least 90%, or
alternatively at least 95% or alternatively at least 98%, identical
primary amino acid sequence to the reference polypeptide when
compared using sequence identity methods run under default
conditions. Specific polypeptide sequences are provided as examples
of particular embodiments. Modifications to the sequences to amino
acids with alternate amino acids that have similar charge.
Additionally, an equivalent polynucleotide is one that hybridizes
under stringent conditions to the reference polynucleotide or its
complement or in reference to a polypeptide, a polypeptide encoded
by a polynucleotide that hybridizes to the reference encoding
polynucleotide under stringent conditions or its complementary
strand. Alternatively, an equivalent polypeptide or protein is one
that is expressed from an equivalent polynucleotide.
[0102] "Hybridization" refers to a reaction in which one or more
polynucleotides react to form a complex that is stabilized via
hydrogen bonding between the bases of the nucleotide residues. The
hydrogen bonding may occur by Watson-Crick base pairing, Hoogstein
binding, or in any other sequence-specific manner. The complex may
comprise two strands forming a duplex structure, three or more
strands forming a multi-stranded complex, a single self-hybridizing
strand, or any combination of these. A hybridization reaction may
constitute a step in a more extensive process, such as the
initiation of a PC reaction, or the enzymatic cleavage of a
polynucleotide by a ribozyme.
[0103] Examples of stringent hybridization conditions include:
incubation temperatures of about 25.degree. C. to about 37.degree.
C.; hybridization buffer concentrations of about 6.times. SSC to
about 10.times. SSC; formamide concentrations of about 0% to about
25%; and wash solutions from about 4.times. SSC to about 8.times.
SSC. Examples of moderate hybridization conditions include:
incubation temperatures of about 40.degree. C. to about 50.degree.
C.; buffer concentrations of about 9.times. SSC to about 2.times.
SSC; formamide concentrations of about 30% to about 50%; and wash
solutions of about 5.times. SSC to about 2.times. SSC. Examples of
high stringency conditions include: incubation temperatures of
about 55.degree. C. to about 68.degree. C.; buffer concentrations
of about lx SSC to about 0.1.times. SSC; formamide concentrations
of about 55% to about 75%; and wash solutions of about 1.times.
SSC, 0.1.times. SSC, or deionized water. In general, hybridization
incubation times are from 5 minutes to 24 hours, with 1, 2, or more
washing steps, and wash incubation times are about 1, 2, or 15
minutes. SSC is 0.15 M NaCl and 15 mM citrate buffer. It is
understood that equivalents of SSC using other buffer systems can
be employed.
[0104] "Homology" or "identity" or "similarity" refers to sequence
similarity between two peptides or between two nucleic acid
molecules. Homology can be determined by comparing a position in
each sequence which may be aligned for purposes of comparison. When
a position in the compared sequence is occupied by the same base or
amino acid, then the molecules are homologous at that position. A
degree of homology between sequences is a function of the number of
matching or homologous positions shared by the sequences. An
"unrelated" or "non-homologous" sequence shares less than 40%
identity, or alternatively less than 25% identity, with one of the
sequences of the present invention.
Modes of Carrying Out the Disclosure
[0105] Point mutations underlie many genetic diseases. In this
regard, while programmable DNA nucleases have been used to repair
mutations, their use for gene therapy poses multiple challenges:
one, efficiency of homologous recombination is typically low in
cells; two, an active nuclease presents a risk of introducing
permanent off-target mutations; and three, prevalent programmable
nucleases typically comprise elements of non-human origin raising
the potential of in vivo immunogenicity. In light of these,
approaches to instead directly target RNA, and use of molecular
machinery native to the host would be highly desirable. Towards
this, Applicants have engineered and optimized two complementary
approaches, referred together hereon as tRiAD, based on the use of
tRNAs in codon suppression and adenosine deaminases in RNA editing.
Specifically, by delivering modified endogenous tRNAs or the RNA
editing enzyme ADAR and an associated guiding RNA (adRNA) via
adeno-associated viruses, Applicants enabled premature stop codon
read-through and correction in the mdx mouse model of muscular
dystrophy that harbors a nonsense mutation in the dystrophin gene.
Additionally, Applicants engineered ADAR2 mediated correction of a
point mutation in liver RNA of the spf.sup.ash mouse model of
ornithine transcarbamylase (OTC) deficiency. Taken together, the
results disclosed herein establish the use of suppressor tRNAs and
ADAR2 for in vivo RNA targeting, and this integrated tRiAD approach
is robust, genomically scarless, and potentially non-immunogenic,
as it utilizes effector RNAs and human proteins.
[0106] Aspects of the disclosure relate to a tRNA based protein
editing system optionally alone or in combination with an ADAR
based RNA editing system comprising one or more forward guide RNAs
for the ADAR ("adRNAs") and one or more corresponding reverse guide
RNAs for the ADAR ("radRNAs") to the subject, wherein the ADAR
based RNA editing system specifically edits a point mutation in an
RNA sequence encoding a gene.
[0107] The tRNA based protein editing system may comprise
endogenous modified tRNA and/or orthogonal tRNA in order to prevent
off target editing of proteins. In this regard, systems for the
control of these tRNA are disclosed herein below.
[0108] The adRNA architecture for use in the ADAR based RNA editing
system is relatively simple, comprising a RNA targeting domain,
complementary to the target and, optionally, one or two recruiting
domains (also referred to as aptamers) that recruit RNA binding
domains of various proteins. The optional recruiting domains are
positioned at the 5' and/or 3' ends of the RNA targeting domain. A
schematic of adRNA bound to its mRNA target is provided in FIG.
23C. In some embodiments, the adRNA features an A-C mismatch, which
prompts editing function of the ADAR. A similar framework can be
used to target pre-mRNA, prior to intron processing by adapting the
scaffold to target the pre-mRNA present in the nucleus. This
approach is taken in the non-limiting exemplary methods involving
OTC deficiency--involving a splice site mutation, whereas an mRNA
editing approach is taken in the non-limiting exemplary methods
involving dystrophin deficiency--involving a nonsense mutation.
[0109] Applicants tested a series of scaffolds, shown in FIG. 19C,
to recruit RNA binding domains of the ADARs. The sequences provided
in the figure represent the recruiting domain and the italicized Ns
represent the nucleotides complimentary to the target. The C is the
mismatch that prompts the editing function. Sequences of varying
length and mismatch position may be tested to determine the best
adRNA for the desired target. For example, residues in the
recruiting domain of the adRNAs generated by Applicants were
modified as follows (5'-3'):
TABLE-US-00010 v1: (SEQ ID NO: 104)
GGGTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACCT
NNNCNNNNNNNNNNNNNNN v2: (SEQ ID NO: 105)
GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCAC NNNNNNCNNNNNNNNNNNNNN
v3: (SEQ ID NO: 106) GTGGAAGAGGAGAACAATATGCTAAATGTTGTTCTCGTCTCCCACT
NNN NNNCNNNNNNNNNNNNNN v4: (SEQ ID NO: 107)
GGGTGGAAGAGGAGAACAATATGCTAAATGTTGTTCTCGTCTCCCACCT
NNNCNNNNNNNNNNNNNNN v5: (SEQ ID NO: 108)
GGTGAAGAGGAGAACAATATGCTAAATGTTGTTCTCGTCTCCACC NNNN
NNCNNNNNNNNNNNNNN v6: (SEQ ID NO: 109)
GGTGAAGAGCAGAACAATATGCTAAATGTTGTTCTCGTCTCCACC NNNN
NNNCNNNNNNNNNNNNN V7: (SEQ ID NO: 110)
GTGGAAGAGGAGAACAATAGGCTAAACGTTGTTCTCGTCTCCCAC NNNN
NNCNNNNNNNNNNNNNN v8: (SEQ ID NO: 111)
GGGTGGAAGAGGAGAACAATAGGCTAAACGTTGTTCTCGTCTCCCACCT
NNNCNNNNNNNNNNNNNNN v9: (SEQ ID NO: 112)
GGTGAAGAGGAGAACAATAGGCTAAACGTTGTTCTCGTCTCCACC NNNN
NNCNNNNNNNNNNNNNN v10: (SEQ ID NO: 113)
GGTGAAGAGGAGAACAATAGGCTAAACGTTGTTCTCGTCTCCACC NNNN
NNNCNNNNNNNNNNNNN v11: (SEQ ID NO: 114)
GGTGTCGAGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCTCG ACACC
NNNNNNNCNNNNNNNNNN v12: (SEQ ID NO: 115)
GGTGTCGAGAAGAGGAGAACAATATGCTAAATGTTGTTCTCGTCTCCTCG ACACC
NNNNNNNCNNNNNNNNNN v13: (SEQ ID NO: 116)
GGTGTCGAGAAGAGGAGAACAATAGGCTAAACGTTGTTCTCGTCTCCTCG ACACC
NNNNNNNCNNNNNNNNNN
[0110] The structure of V2 after folding is provided as FIG. 23D.
And the corresponding radRNAs were generated as follows:
TABLE-US-00011 (SEQ ID NO: 133)
NNNNNNNNNNNNNNNCNNNTCCACCCTATGATATTGTTGTAAATCGTATA
ACAATATGATAAGGTGGG (SEQ ID NO: 134)
NNNNNNNNNNNNNCNNNNNNCACCCTATGATATTGTTGTAAATCGTATAA CAATATGATAAGGTG
(SEQ ID NO: 135) NNNNNNNNNNNNNNCNNNNNNCACCCTCTGCTCTTGTTGTAAATCGTATA
ACAAGAGGAGAAGGTG (SEQ ID NO: 136)
NNNNNNNNNNNNNNNCNNNTCCACCCTCTGCTCTTGTTGTAAATCGTATA
ACAAGAGGAGAAGGTGGG (SEQ ID NO: 137)
NNNNNNNNNNNNNNCNNNNNNCCACCTCTGCTCTTGTTGTAAATCGTATA ACAAGAGGAGAAGTGG
(SEQ ID NO: 138) NNNNNNNNNNNNNCNNNNNNNCCACCTCTGCTCTTGTTGTAAATCGTATA
ACAAGAGGAGAAGTGG (SEQ ID NO: 139)
NNNNNNNNNNNNNNCNNNNNNCACCCTCTGCTCTTGTTGCAAATCGGATA ACAAGAGGAGAAGGTG
(SEQ ID NO: 140) NNNNNNNNNNNNNNNCNNNTCCACCCTCTGCTCTTGTTGCAAATCGGATA
ACAAGAGGAGAAGGTGGG (SEQ ID NO: 141)
NNNNNNNNNNNNNNCNNNNNNCCACCTCTGCTCTTGTTGCAAATCGGATA ACAAGAGGAGAAGTGG
(SEQ ID NO: 142) NNNNNNNNNNNNNCNNNNNNNCCACCTCTGCTCTTGTTGCAAATCGGATA
ACAAGAGGAGAAGTGG (SEQ ID NO: 143)
NNNNNNNNNNCNNNNNNNCCACAGCTCCTCTGCTCTTGTTGCAAATCGGA
TAACAAGAGGAGAAGAGCTGTGG (SEQ ID NO: 144)
NNNNNNNNNNCNNNNNNNCCACAGCTCCTCTGCTCTTGTTGTAAATCGTA
TAACAAGAGGAGAAGAGCTGTGG (SEQ ID NO: 145)
NNNNNNNNNNCNNNNNNNCCACAGCTCCTATGATATTGTTGTAAATCGTA
TAACAATATGATAAGAGCTGTGG
[0111] A schematic of the resulting adRNA and radRNA pairings to
the target mRNA is shown in FIG. 16C.
[0112] An alternative scaffold framework was also applied by
Applicants using two ADAR recruiting domains (black font) on either
side of the targeting domain while varying the position of the C
mismatch in the targeting domain (italicized Ns).
TABLE-US-00012 (SEQ ID NO: 146)
TGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACNNNNNN
NNNNNNNNNNNNNNGTGGAATAGTATAACAATATGCTAAATGTTGTTATA GTATCCCAC
[0113] These non-limiting exemplary scaffolds provide a template
for the engineering of adRNA and radRNA for particular targets and
may be optimized based on comparative efficacy studies carried out
according to the exemplary methods disclosed herein.
[0114] In some embodiments, the ADAR based editing system further
comprises ADAR1, ADAR2, the E488Q and E100Q mutants each thereof, a
fusion protein comprising the catalytic domain of an ADAR and a
domain which associates with an RNA hairpin motif, a fusion protein
comprising the catalytic domain of an ADAR and a dead Cas9, or a
fusion protein comprising the double stranded binding domain of an
ADAR and an APOBEC. In further embodiments, the domain which
associates with an RNA hairpin motif is selected from the group of
an MS2 bacteriophage coat protein (MCP) and an N22 peptide. In some
embodiments, the adRNA comprises one or more RNA hairpin motifs. In
some embodiments, the one or more RNA hairpin motifs are selected
from the group of an MS2 stem loop and a BoxB loop.
[0115] Not to be bound by theory, Applicants believe the double
stranded RNA binding motif from ADARs may bind to several double
stranded RNA sequences and could thus have possible off target
effects. To avoid such effects, Applicants contemplate the use of
exogenous protein domains to recognize RNA hairpin motifs in the
adRNA. Both ADAR1 and ADAR2 consist of RNA binding domains and a
catalytic domain that catalyzes the conversion of adenosine to
inosine. The catalytic domain can be uncoupled from the RNA binding
domain. Our aim is to achieve high editing efficiency of the
targeted adenosine while reducing off target effects and thus are
exploring alternative RNA binding domains. Applicants have fused
the catalytic domain of the ADAR1 or ADAR2 to different RNA binding
domains such as the MCP, N22 or a dead CjCas9 (or other RNA
targeting CRISPRs such as from SaCas9, CRISPR-Cas13 etc.). Upon the
addition of appropriate guide RNAs (adRNAs), the fusion proteins
are recruited to the target, further catalyzing an adenosine to
inosine change. The dead CjCas9 (and other CRISPRs by extension) in
this case basically serves as a RNA binding domain that can in turn
be tethered to effectors.
[0116] The domains are fused to the ADAR catalytic domain to
generate ADAR specifically targeting the particular adRNA
comprising the RNA hairpin motifs. For example, Applicants have
used a MS2 bacteriophage coat protein (MCP) fused to either the
catalytic domain of ADAR1 or ADAR2 and their respective mutants
E488Q and E1008Q, while using a MS2 stem loop on the RNA to recruit
the fusion protein (FIG. 23A). Analogous to this system, Applicants
have also utilized a N22 peptide fused to the catalytic domains of
ADAR1 or ADAR2 (and their mutants) while making use of a boxB
aptamer to recruit the fusion protein. Thus, one or two copies of
ADAR may be recruited based on the addition of single or dual
hairpins (MS2/BoxB loops) (FIG. 23A). PP7 hairpins are also
contemplated for use in the same manner.
[0117] A non-limiting framework sequence for the recruitment of
MCP-based fusion proteins, where the C mismatch may be varied
within the targeting domain, is provided herein below (with the
lower case letters representing those linkers that help stabilize
the underlined hairpins):
TABLE-US-00013 Single recruiting domain (underlined): (SEQ ID NO:
98) NNNNNNNNNNNNNNNNNNNNggccAACATGAGGATCACCCATGTCTGCAG ggcc Two
recruiting domains (underlined): (SEQ ID NO: 99)
aACATGAGGATCACCCATGTcNNNNNNNNNNNNNNNNNNNNaACATGAGG ATCACCCATGTc An
analogous non-limiting framework sequence is provided for the
N22-based fusion proteins: Single recruiting domain (underlined):
(SEQ ID NO: 100) NNNNNNNNNNNNNNNNNNNNgggccctgaagaagggccc Two
recruiting domains (underlined): (SEQ ID NO: 101)
ggGCCCTGAAGAAGGGCccNNNNNNNNNNNNNNNNNNNNggGCCCTGAAG AAGGGCcc
[0118] Another approach is to recruitment domains in the adRNA
associated with Cas9 and couple a dead Cas9 to the ADAR catalytic
domain, thus, rendering the same effect of specific recruitment. A
non-limiting framework sequence for the recruitment is provided for
Cas9-based fusion proteins:
TABLE-US-00014 Psp dCas13a recruitment (mismatch position can be
varied) (SEQ ID NO: 147)
CAACATTATCGGGGAGTTTTGACCTCCAAGGTGTTGNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN Cj dCas9 recruitment (mismatch
position can be varied) (SEQ ID NO: 148)
NNNNNNNNNNNNNNNNNNNNNNgttttagtccctgaaaagggactaaaat
aaagagtttgcgggactctgcggggttacaatcccctaaaaccgcttttt tt
[0119] APOBECs also have RNA editing function (FIG. 23B). Thus,
they may be used in the alternative or in addition to the ADAR
based editing system. For example, Applicants have created MCP/N22
peptide fusions with APOBECs to engineer targeted C->T RNA
editing. In addition, Applicants have fused the double stranded RNA
binding domains (dsRBD) of the ADAR2 with APOBECs as a result of
which the APOBECs can be recruited by the adRNA.
[0120] The addition of Nuclear Localization Signals (NLS) to the
fusion protein could help target nuclear RNA (i.e. pre-mRNA) while
addition of Nuclear Export Signals (NES) to the fusion protein
could help target cytoplasmic RNA in any of the embodiments
disclosed herein. This method is useful when editing for splice
site mutations, which result in incorrect processing of introns in
the pre-mRNA and, thus, results in incorrect mRNA for translation.
OTC deficiency is example where targeting pre-mRNA with adRNA
scaffolds can be useful, since the majority of aberrant OTC
expression comes from the splice site mutation resulting in a
truncated OTC protein. Further addition of RNA localization tags to
the adRNA will enable targeting RNA in specific cellular
compartments.
[0121] In further embodiments where the adRNA comprises one or more
RNA hairpin motifs, the one or more RNA hairpin motifs are
stabilized by replacing A-U with G-C. In some embodiments, the
adRNA is stabilized through the incorporation of one or more of
2'-O-methyl, 2'-O-methyl 3'phosphorothioate, or 2'-O-methyl
3'thioPACE at either or both termini of the adRNA.
[0122] More generally, can be appreciated that the RNA targeting
domains of adRNAs are designed such that they are complementary to
the target mRNA while containing C mismatch at the position of the
target adenosine. The recruiting domains of the adRNA are constant.
BY way of non-limiting example:
TABLE-US-00015 Example target: OTC mRNA(mutation underlined) (SEQ
ID NO: 149) 5'-AAAGTCTCACAGACACCGCTCAGTTTGTAAAACTTTTCTTC-3' adRNA
v2 (targeting domain length 20 bp, mismatch position after 6
bases): (SEQ ID NO: 149)
5'-AAAGTCTCACAGACACCGCTCAGTTTGTAAAACTTTTCTTC-3' (SEQ ID NO: 150)
5'-GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACTG
TCTGTGGCGAGCCAAACA-3' adRNA v2 (targeting domain length 21 bp,
mismatch position after 6 bases): (SEQ ID NO: 149)
5'-AAAGTCTCACAGACACCGCTCAGTTTGTAAAACTTTTCTTC-3' (SEQ ID NO: 151)
5'-GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACGT
GTCTGTGGCGAGCCAAACA-3' radRNA v2 (targeting domain length 20 bp,
mismatch position after 6 bases): (SEQ ID NO: 149)
3'-CTTCTTTTCAAAATGTTTGACTCGCCACAGACACTCTGAAA-5' (SEQ ID NO: 152)
5'-AAGTTTTACAAACCGAGCGGCACCCTATGATATTGTTGTAAATCGTA
TAACAATATGATAAGGTG-3' adRNA dual (targeting domain length 20 bp,
mis- match position after 5, 14 bases): (SEQ ID NO: 149)
3'-CTTCTTTTCAAAATGTTTGACTCGCCACAGACACTCTGAAA-5' (SEQ ID NO: 153)
5'-TGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACCAA
ACCGAGCGGTGTCTGTGGTGGAATAGTATAACAATATGCTAAATGTTGTT ATAGTATCCCAC-3'
adRNA MS2 (targeting domain length 20 bp, mismatch position after
14 bases) (SEQ ID NO: 149)
3'-CTTCTTTTCAAAATGTTTGACTCGCCACAGACACTCTGAAA-5' (SEQ ID NO: 154)
5'-CAAACCGAGCGGTGTCTGTGggccAACATGAGGATCACCCATGTCTG CAGggcc-3' adRNA
MS2 dual (targeting domain length 20 bp, mismatch position after 5,
14 bases) (SEQ ID NO: 149)
3'-CTTCTTTTCAAAATGTTTGACTCGCCACAGACACTCTGAAA-5' (SEQ ID NO: 155)
5'-aACATGAGGATCACCCATGTcCAAACCGAGCGGTGTCTGTGaACATG
AGGATCACCCATGTc-3' adRNA BoxB (targeting domain length 20 bp, mis-
match position after 14 bases) (SEQ ID NO: 149)
3'-CTTCTTTTCAAAATGTTTGACTCGCCACAGACACTCTGAAA-5' (SEQ ID NO: 156)
5'-CAAACCGAGCGGTGTCTGTGgggccctgaagaagggccc-3' adRNA BoxB dual
(targeting domain length 20 bp, mismatch position after 5, 14
bases) (SEQ ID NO: 149)
3'-CTTCTTTTCAAAATGTTTGACTCGCCACAGACACTCTGAAA-5' (SEQ ID NO: 157)
5'-ggGCCCTGAAGAAGGGCccCAAACCGAGCGGTGTCTGTGggGCCCTG
AAGAAGGGCcc-3'
[0123] A coordinate or alternate approach to prseventing off-target
effects is to make use of endogenous ADAR. ADAR2 is highly
expressed in tissues such as the brain, lung and spleen while ADAR1
is ubiquitously expressed with general expression levels being
higher than ADAR1. Thus, Applicants propose two avenues in order to
engineer RNA editing by endogenous ADARs. First, ADAR1 expression
can be stimulated by molecules such as interferons, e.g.,
interferon a. Second, scaffolds may be engineered specifically for
recruiting ADAR1 and are carrying out experiments with the vl-v13
scaffolds as well as some chemically modified scaffolds disclosed
herein above. Making use of the endogenous ADARs as opposed to
overexpression could help limit the off-target effects.
Recombinant Expression Systems and Vectors
[0124] Aspects of the disclosure relate to vectors and recombinant
expression systems.
[0125] For example, some aspects relate to a vector encoding one or
more tRNA having an anticodon sequence that recognizes a codon
comprising a point mutation in an RNA sequence encoding a protein,
optionally wherein the point mutation results in a premature stop
codon. In some embodiments, the point mutation results in a
nonsense mutation having the DNA sequence TAA and the RNA sequence
UAA. In some embodiments, the tRNA is an endogenous tRNA with a
modified anticodon stem recognizing the codon comprising the point
mutation. In further embodiments, the tRNA is charged with a
serine. In some embodiments, the tRNA is an orthogonal tRNA charged
with a non-canonical amino acid. In further embodiments, the vector
further comprises a corresponding tRNA synthetase. In some
embodiments, the corresponding synthetase is E. coli
Glutaminyl-tRNA synthetase. In some embodiments involving an
orthogonal tRNA, the non-canonical amino acid is pyrrolysine. In
some embodiments, the vector encodes two tRNA having an anticodon
sequence that recognizes the codon comprising the point mutation.
In some embodiments, the vector is an AAV vector, optionally an
AAV8 vector. In some embodiments, the protein is dystrophin.
[0126] Further aspects relate to a recombinant expression system
comprising one or more vectors encoding an ADAR based RNA editing
system comprising one or more forward guide RNAs for the ADAR
("adRNAs") and one or more corresponding reverse guide RNAs for the
ADAR ("radRNAs") to the subject, wherein the ADAR based RNA editing
system specifically edits a point mutation in an RNA sequence
encoding a protein. In some embodiments, the point mutation results
in a nonsense mutation, optionally a premature stop codon, having
the DNA sequence TAA and the RNA sequence UAA. In some embodiments,
the ADAR based RNA editing system converts UAA to UIA and,
optionally, further UIA to UII. In some embodiments, the ADAR based
RNA editing system converts UAA to UAI. In some embodiments, the
point mutation results in a splice site or missense mutation having
the DNA sequence CAG and the RNA sequence CAG. In some embodiments,
the ADAR based RNA editing system converts CAG to CIG. In further
embodiments, the one or more vector further encodes a tRNA that
targets an amber codon. In some embodiments, the ADAR based editing
system further comprises ADAR1, ADAR2, the E488Q and E100Q mutants
each thereof, a fusion protein comprising the catalytic domain of
an ADAR and a domain which associates with an RNA hairpin motif, a
fusion protein comprising the catalytic domain of an ADAR and a
dead Cas9, or a fusion protein comprising the double stranded
binding domain of an ADAR and an APOBEC. In further embodiments,
the domain which associates with an RNA hairpin motif is selected
from the group of an MS2 bacteriophage coat protein (MCP) and an
N22 peptide. In some embodiments, the adRNA comprises one or more
RNA hairpin motifs. In some embodiments, the one or more RNA
hairpin motifs are selected from the group of an MS2 stem loop and
a BoxB loop and/or are stabilized by replacing A-U with G-C. In
some embodiments, the adRNA is stabilized through the incorporation
of one or more of 2'-O-methyl, 2'-O-methyl 3'phosphorothioate, or
2'-O-methyl 3'thioPACE at either or both termini of the adRNA.
[0127] In general methods of packaging genetic material such as RNA
into one or more vectors is well known in the art. For example, the
genetic material may be packaged using a packaging vector and cell
lines and introduced via traditional recombinant methods.
[0128] In some embodiments, the packaging vector may include, but
is not limited to retroviral vector, lentiviral vector, adenoviral
vector, and adeno-associated viral vector (optionally AAV8). The
packaging vector contains elements and sequences that facilitate
the delivery of genetic materials into cells. For example, the
retroviral constructs are packaging plasmids comprising at least
one retroviral helper DNA sequence derived from a
replication-incompetent retroviral genome encoding in trans all
virion proteins required to package a replication incompetent
retroviral vector, and for producing virion proteins capable of
packaging the replication-incompetent retroviral vector at high
titer, without the production of replication-competent helper
virus. The retroviral DNA sequence lacks the region encoding the
native enhancer and/or promoter of the viral 5' LTR of the virus,
and lacks both the psi function sequence responsible for packaging
helper genome and the 3'LTR, but encodes a foreign polyadenylation
site, for example the SV40 polyadenylation site, and a foreign
enhancer and/or promoter which directs efficient transcription in a
cell type where virus production is desired. The retrovirus is a
leukemia virus such as a Moloney Murine Leukemia Virus (MMLV), the
Human Immunodeficiency Virus (HIV), or the Gibbon Ape Leukemia
virus (GALV). The foreign enhancer and promoter may be the human
cytomegalovirus (HCMV) immediate early (IE) enhancer and promoter,
the enhancer and promoter (U3 region) of the Moloney Murine Sarcoma
Virus (MMSV), the U3 region of Rous Sarcoma Virus (RSV), the U3
region of Spleen Focus Forming Virus (SFFV), or the HCMV IE
enhancer joined to the native Moloney Murine Leukemia Virus (MMLV)
promoter.
[0129] The retroviral packaging plasmid may consist of two
retroviral helper DNA sequences encoded by plasmid based expression
vectors, for example where a first helper sequence contains a cDNA
encoding the gag and pol proteins of ecotropic MMLV or GALV and a
second helper sequence contains a cDNA encoding the env protein.
The Env gene, which determines the host range, may be derived from
the genes encoding xenotropic, amphotropic, ecotropic, polytropic
(mink focus forming) or 10A1 murine leukemia virus env proteins, or
the Gibbon Ape Leukemia Virus (GALV env protein, the Human
Immunodeficiency Virus env (gp160) protein, the Vesicular
Stomatitus Virus (VSV) G protein, the Human T cell leukemia (HTLV)
type I and II env gene products, chimeric envelope gene derived
from combinations of one or more of the aforementioned env genes or
chimeric envelope genes encoding the cytoplasmic and transmembrane
of the aforementioned env gene products and a monoclonal antibody
directed against a specific surface molecule on a desired target
cell. Similar vector based systems may employ other vectors such as
sleeping beauty vectors or transposon elements.
[0130] The resulting packaged expression systems may then be
introduced via an appropriate route of administration, discussed in
detail with respect to the method aspects disclosed herein.
Compositions
[0131] Further aspects relate to a composition comprising any one
or more of the vectors disclosed herein. In some embodiments, the
composition further comprises an effective amount of an interferon
to enhance endogenous ADAR1 expression. In still further
embodiments, the interferon is interferon .alpha..
[0132] Briefly, pharmaceutical compositions of the present
disclosure including but not limited to any one of the claimed
compositions may comprise a target cell population as described
herein, in combination with one or more pharmaceutically or
physiologically acceptable carriers, diluents or excipients.
[0133] Examples of well-known carriers include glass, polystyrene,
polypropylene, polyethylene, dextran, nylon, amylases, natural and
modified celluloses, polyacrylamides, agaroses and magnetite. The
nature of the carrier can be either soluble or insoluble for
purposes of the disclosure. Those skilled in the art will know of
other suitable carriers for binding antibodies, or will be able to
ascertain such, using routine experimentation.
[0134] Such compositions may also comprise buffers such as neutral
buffered saline, phosphate buffered saline and the like;
carbohydrates such as glucose, mannose, sucrose or dextrans,
mannitol; proteins; polypeptides or amino acids such as glycine;
antioxidants; chelating agents such as EDTA or glutathione;
adjuvants (e.g., aluminum hydroxide); and preservatives.
Compositions of the present disclosure may be formulated for oral,
intravenous, topical, enteral, and/or parenteral administration. In
certain embodiments, the compositions of the present disclosure are
formulated for intravenous administration.
[0135] Administration of the compositions can be effected in one
dose, continuously or intermittently throughout the course of
treatment. Methods of determining the most effective means and
dosage of administration are known to those of skill in the art and
will vary with the composition used for therapy, the purpose of the
therapy and the subject being treated. Single or multiple
administrations can be carried out with the dose level and pattern
being selected by the treating physician. Suitable dosage
formulations and methods of administering the agents are known in
the art. In a further aspect, the cells and composition of the
disclosure can be administered in combination with other
treatments.
[0136] The vectors, recombinant expression systems, and/or
compositions are administered to the host using methods known in
the art. This administration of the compositions of the disclosure
can be done to generate an animal model of the desired disease,
disorder, or condition for experimental and screening assays.
[0137] Briefly, pharmaceutical compositions of the present
disclosure including but not limited to any one of the claimed
compositions may comprise one or more vectors or recombinant
expression systems as described herein, in combination with one or
more pharmaceutically or physiologically acceptable carriers,
diluents or excipients. Such compositions may comprise buffers such
as neutral buffered saline, phosphate buffered saline and the like;
carbohydrates such as glucose, mannose, sucrose or dextrans,
mannitol; proteins; polypeptides or amino acids such as glycine;
antioxidants; chelating agents such as EDTA or glutathione;
adjuvants (e.g., aluminum hydroxide); and preservatives.
Compositions of the present disclosure may be formulated for oral,
intravenous, topical, enteral, and/or parenteral administration. In
certain embodiments, the compositions of the present disclosure are
formulated for intravenous administration.
[0138] Pharmaceutical compositions of the present disclosure may be
administered in a manner appropriate to the disease, disorder, or
condition to be treated or prevented. The quantity and frequency of
administration will be determined by such factors as the condition
of the patient, and the type and severity of the patient's disease,
although appropriate dosages may be determined by clinical
trials.
Methods of Restoring Protein Expression
[0139] Aspects of the disclosure relate to methods of restoring
protein expression.
[0140] For example, some aspects of the disclosure relate to a
method for restoring expression of a protein comprising a point
mutation in an RNA sequence encoding the protein in a subject in
need thereof comprising administering a vector encoding one or more
tRNA having an anticodon sequence that recognizes a codon
comprising the point mutation to the subject, optionally wherein
the point mutation results in a premature stop codon. In some
embodiments, the point mutation results in a nonsense mutation
having the DNA sequence TAA and the RNA sequence UAA. In some
embodiments, the tRNA is an endogenous tRNA with a modified
anticodon stem recognizing the codon comprising the point mutation.
In further embodiments, the tRNA is charged with a serine. In some
embodiments, the tRNA is an orthogonal tRNA charged with a
non-canonical amino acid. In further embodiments, the vector
further comprises a corresponding tRNA synthetase. In some
embodiments, the corresponding synthetase is E. coli
Glutaminyl-tRNA synthetase. In some embodiments involving an
orthogonal tRNA, the non-canonical amino acid is pyrrolysine. In
further embodiments, the pyrrolysine is introduced in the diet of
the subject. In some embodiments, the vector encodes two tRNA
having an anticodon sequence that recognizes the codon comprising
the point mutation. In some embodiments, the protein is
dystrophin.
[0141] Other aspects relate to a recombinant expression system
comprising one or more vectors encoding an ADAR based RNA editing
system comprising one or more forward guide RNAs for the ADAR
("adRNAs") and one or more corresponding reverse guide RNAs for the
ADAR ("radRNAs") to the subject, wherein the ADAR based RNA editing
system specifically edits a point mutation in an RNA sequence
encoding a protein. In some embodiments, the point mutation results
in a nonsense mutation, optionally a premature stop codon, having
the DNA sequence TAA and the RNA sequence UAA. In some embodiments,
the ADAR based RNA editing system converts UAA to UIA and,
optionally, further UIA to UII In some embodiments, the ADAR based
RNA editing system converts UAA to UAI. In some embodiments,
optionally those involving nonsense or missense mutations, the RNA
targeted in mRNA. In further embodiments, the one or more vector
further encodes a tRNA that targets an amber codon. In some
embodiments, the protein is dystrophin. In some embodiments, the
point mutation results in a splice site or missense mutation having
the DNA sequence CAG and the RNA sequence CAG. In some embodiments,
the ADAR based RNA editing system converts CAG to CIG. In some
embodiments, optionally those involving splice site mutations, the
RNA targeted is pre-mRNA. In some embodiments, the ADAR based
editing system further comprises ADAR1, ADAR2, the E488Q and E100Q
mutants each thereof, a fusion protein comprising the catalytic
domain of an ADAR and a domain which associates with an RNA hairpin
motif, a fusion protein comprising the catalytic domain of an ADAR
and a dead Cas9, or a fusion protein comprising the double stranded
binding domain of an ADAR and an APOBEC. In further embodiments,
the domain which associates with an RNA hairpin motif is selected
from the group of an MS2 bacteriophage coat protein (MCP) and an
N22 peptide. In some embodiments, the adRNA comprises one or more
RNA hairpin motifs. In some embodiments, the one or more RNA
hairpin motifs are selected from the group of an MS2 stem loop and
a BoxB loop and/or are stabilized by replacing A-U with G-C. In
some embodiments, the adRNA is stabilized through the incorporation
of one or more of 2'-O-methyl, 2'-O-methyl 3'phosphorothioate, or
2'-O-methyl 3'thioPACE at either or both termini of the adRNA.
[0142] In either case, the assessment of whether protein expression
is "restored" is achieved through any means of protein
quantification when compared to a baseline. The baseline may
optionally be calculated based on a prior level in the subject or
as the normal level in the population, adjusted for the subject's
age, ethnicity, and other relevant demographic information.
Techniques of quantifying protein expression are well known in the
art and may, optionally, utilize a control or a threshold value for
comparison to the baseline value. Methods known in the art for such
studies include but are not limited to qRTPCR, ELISA, Western blot,
protein immunostaining, spectroscopy and/or spectrometry based
methods, and other assays typically conducted to determine the
amount of protein expression in a sample from the subject.
Alternatively, the "restoration" effect may be determined based on
a clinical outcome. For example, aberrant dystrophin levels are
linked to muscular dystrophy symptoms. Thus, the restoration of
expression may be outwardly determined based on clinical signals
such as a reduction or reversal of these symptoms. For dystrophin,
improvement in muscle strength can be one such indicator. Thus,
physicians may carry out strength measurements to determine
outcome. Another example is ornithine transcarbamylase (OTC);
aberrant OTC levels are a result of a rare X-linked genetic
disorder resulting in excessive accumulation of ammonia in the
blood (due to nitrogen accumulation). Thus, a relevant clinical
outcome would be a decrease in ammonia in a biological sample, such
as blood or urine. Similarly, clinical signals associated with and
expression of proteins downstream of the protein of interest may be
relevant indicators of "restoration" where the protein of interest
is involved in a particular pathway.
Methods of Treatment
[0143] Point mutations are implicated in a number of diseases,
disorders, and conditions. Non-limiting examples are provided in
Table 1 below.
TABLE-US-00016 TABLE 1 Protein/Disease, Disorder, or Condition
Associated Point Mutation G to A point mutations or premature stop
codons Dihydropyrimidine dehydrogenase deficiency
NM_000110.3(DPYD): c.1905+1G > A Noonan syndrome
NM_005633.3(SOS1): c.2536G > A (p.Glu846Lys) Lynch syndrome
NM_000251.2(MSH2): c.212-1G > A Breast-ovarian cancer, familial
1 NM_007294.3(BRCA1): c.963G > A (p.Trp321Ter) Cystic fibrosis
NM_000492.3(CFTR): c.57G > A (p.Trp19Ter) Anemia, due to G6PD
deficiency NM_000402.4(G6PD): c.292G > A (p.Val98Met) AVPR2
Nephrogenic diabetes insipidus, X-linked NM_000054.4(AVPR2): c.878G
> A (p.Trp293Ter) FANCC Fanconi anemia, complementation group C
NM_000054.4(AVPR2): c.878G > A (p.Trp293Ter) FANCC Fanconi
anemia, complementation group C NM_000136.2(FANCC): c.1517G > A
(p.Trp506Ter) IL2RG X-linked severe combined NM_000206.2(IL2RG):
c.710G > A (p.Trp237Ter) immunodeficiency F8 Hereditary factor
VIII deficiency disease NM_000132.3(F8): c.3144G > A
(p.Trp1048Ter) LDLR Familial hypercholesterolemia
NM_000527.4(LDLR): c.1449G > A (p.Trp483Ter) CBS Homocystinuria
due to CBS deficiency NM_000071.2(CBS): c.162G > A (p.Trp54Ter)
HBB betaThalassemia NM_000518.4(HBB): c.114G > A (p.Trp38Ter)
ALDOB Hereditary fructosuria NM_000035.3(ALDOB): c.888G > A
(p.Trp296Ter) DMD Duchenne muscular dystrophy NM_004006.2(DMD):
c.3747G > A (p.Trp1249Ter) SMAD4 Juvenile polyposis syndrome
NM_005359.5(SMAD4): c.906G > A (p.Trp302Ter) BRCA2 Familial
cancer of breast|Breast-ovarian NM_000059.3(BRCA2): c.582G > A
(p.Trp194Ter) cancer, familial 2 GRIN2A Epilepsy, focal, with
speech disorder and NM_000833.4(GRIN2A): c.3813G > A
(p.Trp1271Ter) with or without mental retardation SCN9A
Indifference to pain, congenital, autosomal NM_002977.3(SCN9A):
c.2691G > A (p.Trp897Ter) recessive TARDBP Amyotrophic lateral
sclerosis type 10 NM_007375.3(TARDBP): c.943G > A (p.Ala315Thr)
CFTR Cystic fibrosis|Hereditary pancreatitis|not NM_000492.3(CFTR):
c.3846G > A (p.Trp1282Ter) provided|ataluren response - Efficacy
UBE3A Angelman syndrome NM_130838.1(UBE3A): c.2304G > A
(p.Trp768Ter) SMPD1 Niemann-Pick disease, type A
NM_000543.4(SMPD1): c.168G > A (p.Trp56Ter) USH2A Usher
syndrome, type 2A NM_206933.2(USH2A): c.9390G > A (p.Trp3130Ter)
MEN1 Hereditary cancer-predisposing syndrome NM_130799.2(MEN1):
c.1269G > A (p.Trp423Ter) C8orf37 Retinitis pigmentosa 64
NM_177965.3(C8orf37): c.555G > A (p.Trp185Ter) MLH1 Lynch
syndrome NM_000249.3(MLH1): c.1998G > A (p.Trp666Ter) TSC2
Tuberous sclerosis 2|Tuberous sclerosis NM_000548.4(TSC2): c.2108G
> A (p.Trp703Ter) syndrome 46 NF1 Neurofibromatosis, type 1
NM_000267.3(NF1): c.7044G > A (p.Trp2348Ter) MSH6 Lynch syndrome
NM_000179.2(MSH6): c.3020G > A (p.Trp1007Ter) SMN1 Spinal
muscular atrophy, type II|Kugelberg- NM_000344.3(SMN1): c.305G >
A (p.Trp102Ter) Welander disease SH3TC2 Charcot-Marie-Tooth
disease, type 4C NM_024577.3(SH3TC2): c.920G > A (p.Trp307Ter)
DNAH5 Primary ciliary dyskinesia NM_001369.2(DNAH5): c.8465G > A
(p.Trp2822Ter) MECP2 Rett syndrome NM_004992.3(MECP2): c.311G >
A (p.Trp104Ter) ADGRV1 Usher syndrome, type 2C NM_032119.3(ADGRV1):
c.7406G > A (p.Trp2469Ter) AHI1 Joubert syndrome 3
NM_017651.4(AHI1): c.2174G > A (p.Trp725Ter) PRKN Parkinson
disease 2 NM_004562.2(PRKN): c.1358G > A (p.Trp453Ter) COL3A1
Ehlers-Danlos syndrome, type 4 NM_000090.3(COL3A1): c.3833G > A
(p.Trp1278Ter) BRCA1 Familial cancer of breast|Breast-ovarian
NM_007294.3(BRCA1): c.5511G > A (p.Trp1837Ter) cancer, familial
1 MYBPC3 Primary familial hypertrophic NM_000256.3(MYBPC3): c.3293G
> A cardiomyopathy (p.Trp1098Ter) APC Familial adenomatous
polyposis 1 NM_000038.5(APC): c.1262G > A (p.Trp421Ter) BMPR2
Primary pulmonary hypertension NM_001204.6(BMPR2): c.893G > A
(p.W298*) T to C point mutations Wilson disease NM_000053.3(ATP7B):
c.3443T > C (p.Ile1148Thr) Leukodystrophy, hypomyelinating, 2
NM_020435.3(GJC2): c.857T > C (p.Met286Thr) Alport syndrome,
X-linked recessive NM_000495.4(COL4A5): c.438+2T > C Leigh
disease NC_012920.1: m.9478T > C Gaucher disease, type 1
NM_001005741.2(GBA): c.751T > C (p.Tyr251His) Renal dysplasia,
retinal pigmentary dystrophy, NM_014714.3(IFT140): c.4078T > C
(p.Cys1360Arg) cerebellar ataxia and skeletal dysplasia Marfan
syndrome NM_000138.4(FBN1): c.3793T > C (p.Cys1265Arg)
Deficiency of UDPglucose-hexose-1-phosphate NM_000155.3(GALT):
c.482T > C (p.Leu161Pro) uridylyltransferase Familial
hypercholesterolemia NM_000527.4(LDLR): c.694+2T > C Episodic
pain syndrome, familial, 3 NM_001287223.1(SCN11A): c.1142T > C
(p.Ile381Thr) Navajo neurohepatopathy NM_002437.4(MPV17): c.186+2T
> C Congenital muscular dystrophy, LMNA-related
NM_170707.3(LMNA): c.1139T > C (p.Leu380Ser) Hereditary factor
VIII deficiency disease NM_000132.3(F8): c.5372T > C
(p.Met1791Thr) Insulin-dependent diabetes mellitus secretory
NM_014009.3(FOXP3): c.970T > C (p.Phe324Leu) diarrhea syndrome
Hereditary factor IX deficiency disease NM_000133.3(F9): c.1328T
> C (p.Ile443Thr) Familial cancer of breast, Breast-ovarian
cancer, NM_000059.3(BRCA2): c.316+2T > C familial 2, Hereditary
cancerpredisposing syndrome Cardiac arrhythmia NM_000238.3(KCNH2):
c.1945+6T > C Tangier disease NM_005502.3(ABCA1): c.4429T > C
(p.Cys1477Arg) Dilated cardiomyopathy 1AA NM_001103.3(ACTN2):
c.683T > C (p.Met228Thr) Mental retardation 3, X-linked
NM_005334.2(HCFC1): c.-970T > C Limb-girdle muscular dystrophy,
type 2B NM_003494.3(DYSF): c.1284+2T > C Macular dystrophy,
vitelliform, 5 NM_016247.3(IMPG2): c.370T > C (p.Phe124Leu)
Retinitis pigmentosa NM_000322.4(PRPH2): c.736T > C
(p.Trp246Arg)
[0144] Further non-limiting examples include Ornithine
Transcarbamylase Deficiency, Nougaret night blindness, Usher
syndrome, Atrial Fibrillation, Duchenne Muscular Dystrophy, Wilson
disease, hereditary tyrosinemia, and some cancers carrying a
A->G mutation in genes such as B-catenin.
[0145] Thus, aspects of this disclosure relate to the treatment of
certain diseases, disorders, and conditions involving point
mutations.
[0146] For example, some method aspects relate to a treating a
disease, disorder, or condition characterized by the presence of a
point mutation in an RNA sequence encoding a protein associated
with the disease, disorder, or condition in a subject in need
thereof comprising administering a vector encoding one or more tRNA
having an anticodon sequence that recognizes a codon comprising the
point mutation to the subject, optionally wherein the point
mutation results in a premature stop codon. In some embodiments,
the point mutation results in a nonsense mutation having the DNA
sequence TAA and the RNA sequence UAA. In some embodiments, the
tRNA is an endogenous tRNA with a modified anticodon stem
recognizing the codon comprising the point mutation. In further
embodiments, the tRNA is charged with a serine. In some
embodiments, the tRNA is an orthogonal tRNA charged with a
non-canonical amino acid. In further embodiments, the vector
further comprises a corresponding tRNA synthetase. In some
embodiments, the corresponding synthetase is E. coli
Glutaminyl-tRNA synthetase. In some embodiments involving an
orthogonal tRNA, the non-canonical amino acid is pyrrolysine. In
further embodiments, the pyrrolysine is introduced in the diet of
the subject. In some embodiments, the vector encodes two tRNA
having an anticodon sequence that recognizes the codon comprising
the point mutation. In some embodiments, the disease, disorder, or
condition is selected from the group consisting of the diseases,
disorders, and conditions listed in Table 1, optionally
characterized by the presence of a nonsense mutation and/or a
premature stop codon. In some embodiments, the protein is
dystrophin. In further embodiments, the disease, disorder, or
condition is muscular dystrophy. In still further embodiments, the
disease disorder or condition is Duchenne muscular dystrophy.
[0147] Additional method aspects relate to a method of treating a
disease, disorder, or condition by the presence of a point mutation
in an RNA sequence encoding a protein associated with the disease,
disorder, or condition in a subject in need thereof comprising
administering one or more vectors encoding an ADAR based RNA
editing system comprising one or more forward guide RNAs for the
ADAR ("adRNAs") and one or more corresponding reverse guide RNAs
for the ADAR ("radRNAs") to the subject, wherein the ADAR based RNA
editing system specifically edits the point mutation. In some
embodiments, the point mutation results in a nonsense mutation,
optionally a premature stop codon, having the DNA sequence TAA and
the RNA sequence UAA. In some embodiments, the ADAR based RNA
editing system converts UAA to UIA and, optionally, further UIA to
UII In some embodiments, the ADAR based RNA editing system converts
UAA to UAI. In some embodiments, optionally those involving
nonsense or missense mutations, the RNA targeted in mRNA. In
further embodiments, the one or more vector further encodes a tRNA
that targets an amber codon. In some embodiments, the protein is
dystrophin. In some embodiments, the point mutation results in a
splice site or missense mutation having the DNA sequence CAG and
the RNA sequence CAG. In some embodiments, the ADAR based RNA
editing system converts CAG to CIG. In some embodiments, optionally
those involving splice site mutations, the RNA targeted is
pre-mRNA. In some embodiments, the ADAR based editing system
further comprises ADAR1, ADAR2, the E488Q and E100Q mutants each
thereof, a fusion protein comprising the catalytic domain of an
ADAR and a domain which associates with an RNA hairpin motif, a
fusion protein comprising the catalytic domain of an ADAR and a
dead Cas9, or a fusion protein comprising the double stranded
binding domain of an ADAR and an APOBEC. In further embodiments,
the domain which associates with an RNA hairpin motif is selected
from the group of an MS2 bacteriophage coat protein (MCP) and an
N22 peptide. In some embodiments, the method further comprises
administering an effective amount of an interferon to enhance
endogenous ADAR1 expression. In still further embodiments, the
interferon is interferon a. In some embodiments, the adRNA
comprises one or more RNA hairpin motifs. In some embodiments, the
one or more RNA hairpin motifs are selected from the group of an
MS2 stem loop and a BoxB loop and/or are stabilized by replacing
A-U with G-C. In some embodiments, the adRNA is stabilized through
the incorporation of one or more of 2'-O-methyl, 2'-O-methyl
3'phosphorothioate, or 2'-O-methyl 3'thioPACE at either or both
termini of the adRNA. In some embodiments, the disease, disorder,
or condition is selected from the group consisting of the diseases,
disorders, and conditions listed in Table 1. In further
embodiments, the protein is dystrophin and the disease, disorder,
or condition is muscular dystrophy. In still further embodiments,
the disease disorder or condition is Duchenne muscular
dystrophy.
[0148] An ordinary skilled artisan will appreciate that the doses
and route of administration employed in these methods may vary
based on the subject and the disease, disorder, or condition to be
treated. Based on knowledge in the art such suitable doses and
routes may be selected based on the subject's age, ethnicity, and
other relevant demographic factors.
Kits
[0149] In one particular aspect, the present disclosure provides
kits for performing any of the methods disclosed herein as well as
instructions for carrying out the methods of the present disclosure
and/or administering the vectors, recombinant expression systems,
and compositions disclosed herein.
[0150] The kit can also comprise agents necessary for the
preservation of those components comprised therein, e.g., a
buffering agent, a preservative or a protein-stabilizing agent. The
kit can further comprise components necessary for detecting the
detectable-label, e.g., an enzyme or a substrate. The kit can also
contain a control sample or a series of control samples, which can
be assayed and compared to the test sample. Each component of the
kit can be enclosed within an individual container and all of the
various containers can be within a single package, along with
instructions for interpreting the results of the assays performed
using the kit. The kits of the present disclosure may contain a
written product on or in the kit container. The written product
describes how to use the reagents contained in the kit.
[0151] As amenable, these suggested kit components can be packaged
in a manner customary for use by those of skill in the art. For
example, these suggested kit components may be provided in solution
or as a liquid dispersion or the like.
EXAMPLES
[0152] The following examples are non-limiting and illustrative of
procedures which can be used in various instances in carrying the
disclosure into effect. Additionally, all reference disclosed
herein are incorporated by reference in their entirety.
Example 1--Design of tRNA Constructs
[0153] The tRNA constructs were designed along the lines of the
schematics in FIG. 1 to recognize the nonsense mutation TAA. Both
modified endogenous and orthogonal tRNA were generated. The
constructs were validated in vitro using a GFP harboring nonsense
mutation. It was determined that two copies of the tRNA should be
include in each AAV vector for both modified endogenous and
orthogonal tRNAs. MbPyl sythetase was selected for use with the
orthogonal tRNA. The AAV vectors were generated comprising the tRNA
and GFP (as well as the synthetase, where orthogonal tRNA was
used). The sequences used in these constructs are provided in the
Sequence Listing above.
Example 2--Restoration of Full Length Dystrophin in mdx Mice
[0154] The anticodon stem of the human serine tRNA is modified such
that it recognizes the nonsense codon (TAA). No endogenous tRNA can
recognize a stop codon and translation terminates when the ribosome
reaches a stop codon. Mdx mice bear a nonsense mutation (TAA) in
the gene coding for dystrophin as a result of which they lack full
length dystrophin expression. AAVs are used to deliver two copies
of the modified tRNAs into the mouse muscle which in turn allows
for the stop codon read-through enabling the expression of full
length dystrophin.
[0155] The calf muscles of mdx mice were injected with 1E12
particles of AAV8 carrying 2 copies of the modified serine tRNA and
a GFP gene. These mice were then sacrificed after a month and the
calf muscles were harvested. The muscles were sectioned and stained
with an antibody against dystrophin. A clear restoration of
dystrophin expression was noticed. In addition, the muscle
morphology improved too.
[0156] Applicants have, thus, demonstrated activity of our vectors
in vitro using a GFP gene harboring a stop codon. In addition
Applicants have demonstrated restoration of dystrophin expression
in mdx mouse muscles. Within a span of one month after injecting
the mdx mice with AAVs carrying two copies of the serine tRNA,
Applicants observed restoration of dystrophin expression in the
calf muscle via Immunohistochemistry. Applicants also noted an
improved muscle morphology.
[0157] This experiment is repeated with the orthogonal tRNA,
introducing the pyrrolysine through the mouse feed, and is again
replicated with both tRNAs in a larger population of mice.
Example 3--Diet Regulable Production of Therapeutic Proteins
[0158] Applicants aim at achieving on-demand, in vivo production of
therapeutics such as (i) insulin; (ii) neutralizing antibodies for
viruses (e.g. HIV, HCV, HPV, influenza) and bacteria (e.g. staph
aureus; drug resistant strains) by the skeletal muscle.
[0159] The desired transgenes are delivered to the muscle via AAVs
(or lentiviruses) along with an orthogonal tRNA/tRNA synthetase
pair. These transgenes contain a premature termination codon (stop
codon) that will prevent the full length protein from being
expressed. For an on demand synthesis of the therapeutics, an
appropriate unnatural amino acid is consumed in the diet, which in
turn is incorporated by the orthogonal tRNA/tRNA synthetase at the
premature termination site, enabling synthesis of the desired
therapeutics.
Example 4--ADAR2 Based RNA Editing
[0160] Applicants suspected that ADAR2 (adenosine deaminase that
acts on RNA) to correct mutations at the mRNA level. Applicants
used Adeno-Associated Viruses to deliver the ADAR2 and a adRNA
(forward ADAR2 guide) or radRNA (reverse ADAR2 guide) that direct
the enzyme to the mutation in an attempt to restore the expression
of dystrophin in the mdx mouse models of DMD, by editing the
nonsense mutation. Applicants also applied this technology to the
mouse model of the metabolic disorder Ornithine Transcarbamylase
(OTC) deficiency.
[0161] As compared to nucleases, ADARs make site specific Adenosine
to Inosine (A->I) changes in the mRNA with Inosine being read as
a Guanosine (G) during translation and are thereby safe from
creating permanent off target effects. Also, since they make edits
at the mRNA level, the altered proteins are expressed only
transiently. The use of nucleases in adult OTC-deficient mice led
to large deletions that proved to be lethal to the animals. The use
of ADARs might circumvent this problem. This could be a readily
translatable solution for several disorders characterized by point
mutations. In addition, the origin of the ADAR2 is human, thereby
minimizing the immune response generated by the body against it.
Applicants also combine the idea of tRNA suppression with ADAR2
based RNA editing. In addition, Applicants designed hairpin loops
(3' overlap) and toe-holds (5' overlap) that help improve the
specificity of the adRNA/radRNA. Applicants also go on to optimize
the lengths of the adRNA for efficient A->I editing as well as
the ADAR2 recruiting domain of the adRNA/radRNA.
[0162] Existing studies have made use of nucleases such as Cas9 to
delete the mutated region of the Dystrophin/OTC genes and replaced
it with a functional copy, for the treatment of DMD or OTC
deficiency caused by a point mutation. For DMD, existing therapies
include the use of corticosteroids that delay the symptoms of the
disorder. Other strategies include the premature stop codon
read-through by making use of drugs such as Ataluren or Gentamycin.
Another strategy is that of exon skipping which results in a
truncated protein, however able to reduce the severity of the DMD
phenotype. Another approach is the delivery of a u-dystrophin gene.
Clinical trials for OTC deficiency have been attempted making use
of adenoviral vectors to deliver OTC cDNA in patients. Other
avenues for treatment include use of sodium phenylbutyrate which
helps increase the waste nitrogen excretion.
[0163] The use of ADAR2 as an engineered RNA editing enzyme has
been demonstrated only in vitro.
[0164] Applicants utilized adRNAs and radRNAs comprised of two
domains, one complementary to the target sequence and the other an
ADAR2 recruiting domain. Applicants utilized AAVs to deliver these
adRNAs/radRNAs along with the ADAR2 enzyme. Mdx mice bear a
nonsense mutation (TAA) in the gene coding for dystrophin.
Applicants packaged two copies of the adRNAs/radRNAs or a
combination of adRNA/radRNA+tRNA along with the ADAR2 enzyme into
the AAV and deliver it into the Tibialis Anterior (TA) muscle.
Applicants utilized three alternative strategies to restore
dystrophin expression:
[0165] (1) adRNAs/radRNAs that can edit both the adenosines in the
`TAA` to inosines;
[0166] (2) a sequential approach whereby the first adRNA/radRNA
converts TAA ->TGA and the next adRNA/radRNA converts it to TGG,
restoring expression; and
[0167] (3) a combination of adRNAs/radRNAs and a tRNA whereby the
adRNA/radRNA converts the TAA into TAG and the tRNA suppression of
the amber codon (TAG) restores dystrophin expression.
[0168] Applicants also delivered two copies of the adRNA targeting
the OTC G->A mutation in spf-ash mice along with the ADAR2 to
the liver via retro-orbital injections.
[0169] The system works by editing an Adenosine to Inosine which is
read as a Guanosine during translation. This can be used to correct
point mutations as well as restore expression by editing premature
stop codons. In FIG. 6: A. An Amber stop codon can be converted to
a tryptophan codon by a single edit. B. Ochre stop codon--both
edits made in a single step. C. Ochre stop codon--Sequential
editing. D. Ochre stop codon--ADAR2 editing in combination with
suppressor tRNA.
[0170] The following 10 steps represent the workflow to test these
constructs: [0171] 1. Design and clone ADAR2 constructs--adRNA and
radRNA. [0172] 2. In vitro validation of constructs using a GFP
harboring a nonsense mutation. [0173] 3. Modification of
constructs--decision to clone two copies of the adRNA/radRNA.
Creation of vectors harboring one copy of a adRNA/radRNA and a copy
of a serine suppressor tRNA. [0174] 4. Generation of AAV8 vectors
carrying ADAR2 and adRNAs/radRNAs or suppressor tRNAs. [0175] 6.
TA/Gastrocnemius injections of mdx mice--1E12 particles of AAV8
carrying the ADAR2 and with adRNAs/radRNAs or suppressor tRNA were
injected. [0176] 7. The mice were sacrificed 6 weeks after
injections and the TA/gastrocnemimus were harvested.
Immunohistochemistry performed to detect dystrophin. Some evidence
of restoration of dystrophin. [0177] 8. qPCR, Western blots and NGS
were carried out. [0178] 9. Vectors were optimized to improve
efficiency. adRNA lengths varied, location of the edit varied.
[0179] 10. Steps 4-8 repeated with optimized vectors.
[0180] Applicants designed adRNA and radRNAs against a premature
stop codon in GFP and demonstrated robust restoration of expression
(FIG. 5). For the ochre stop codon (TAA), two A->G edits are
needed to restore expression. Applicants constructed a single
ad/radRNA targeting both As or a two ad/radRNAs that target a
single A in a sequential manner. Applicants also constructed an
adRNA/radRNA+suppressor tRNA vector combining RNA editing with tRNA
suppression.
[0181] In vitro RNA editing showed robust restoration of GFP
expression after which AAVs bearing the ADAR2 and adRNA/radRNAs
were generated to target the nonsense mutation in dystrophin in mdx
mice.
[0182] The Tibialis Anterior (TA) or gastrocnemius muscles of mdx
mice were injected with 1E12 particles of AAV8 carrying ADAR2 and
two copies of the adRNA/radRNA or one copy of the adRNA/radRNA and
a suppressor tRNA. These mice were sacrificed after 6 weeks and the
appropriate muscles were harvested. The muscles were sectioned and
stained with an antibody against dystrophin. Partial restoration of
dystrophin expression was noticed.
[0183] In general, Applicants noticed a fractional restoration of
dystrophin expression via Immunostaining. However, western blots
and NGS did not show any evidence of editing/restoration of
dystrophin expression.
[0184] Potential applications of the system include targeting point
mutations for the treatment of disorders such as but not restricted
to DMD, OTC deficiency, Wilson's disease and hereditary tysosinemia
type 1. It could also be used to create alternate start codons,
enabling the co-existence of a protein and its N-terminal truncated
form.
Example 5--ADAR Editing in Mouse Models
[0185] Genome engineering methodologies coupled with rapidly
advancing synthetic biology toolsets are enabling powerful
capabilities to perturb genomes for deciphering function,
programming novel function, and repairing aberrant function. In
particular, programmable DNA nucleases, such as meganucleases, zinc
finger nucleases (ZFNs), transcription activator-like effector
nucleases (TALENs), and CRISPR-Cas, have been widely used to
engineer genomes across a range of organisms. Their use in gene
therapy however poses at least three major challenges: one, the
efficiency of homologous recombination versus non-homologous end
joining is typically low, particularly in post-mitotic cells that
comprise the vast majority of the adult body; two, an active
nuclease always poses the threat of introducing permanent
off-target mutations, thus presenting formidable challenges in both
engineering exquisite nuclease specificity without compromising
activity, as well as ensuring tight regulation of the nuclease dose
and duration in target cells; and three, prevalent programmable
nucleases are of prokaryotic origin or bear domains that are of
non-human origin raising a significant risk of immunogenicity in in
vivo therapeutic applications. The recent advent of base editing
approaches is opening an exciting alternative strategy for gene
targeting, but demonstrated approaches rely on CRISPR-Cas systems
that are of prokaryotic origin. Thus for genomic mutations that
lead to alteration in protein function, such as in disease causing
gene mutations, approaches to instead directly target RNA would be
highly desirable. Leveraging the aspect that single-stranded RNA as
compared to double-stranded DNA, is generally more accessible to
oligonucleotide mediated targeting without a need for additional
enabling proteins, and building on the advances in tRNA mediated
codon suppression and genetic code expansion, as well as adenosine
deaminase mediated RNA editing, Applicants have engineered and
optimized an integrated platform for RNA targeting, and demonstrate
its efficacy in in vitro and in vivo applications.
Vector Design and Construction
[0186] To construct the GFP reporters--GFP-Amber, GFP-Ochre and
GFP-Opal, three gene blocks were synthesized with `TAG`, `TAA` and
`TGA` respectively replacing the Y39 residue of the wild type GFP
and were cloned downstream of a CAG promoter. One, two, or four
copies of the endogenous suppressor tRNAs were cloned into an AAV
vector containing a human U6 and mouse U6 promoter. Pyrrolysyl
tRNAs and adRNAs/radRNAs were similarly cloned into an AAV vector
containing a human U6 and mouse U6 promoter along with a CMV
promoter driving the expression of MbPy1RS/MmPy1RS/AcKRS or hADAR2
respectively.
Mammalian Cell Culture and Transfection
[0187] All HEK 293T cells were grown in Dulbecco's Modified Eagle
Medium supplemented with 10% FBS and 1% Antibiotic-Antimycotic
(Thermo Fisher) in an incubator at 37.degree. C. and 5% CO.sub.2
atmosphere. All in vitro transfection experiments were carried out
in HEK 293T cells using the commercial transfection reagent
Lipofectamine 2000 (Thermo Fisher). All in vitro suppression and
editing experiments were carried out in 24 well plates using 500ng
of reporter plasmid and 1000ng of the suppressor tRNA/aaRS plasmid
or the adRNA/ADAR2 plasmid. Cells were transfected at 30%
confluence. Cells were harvested 48 and 72 hours post transfection
for quantification of suppression and editing respectively. The
UAAs N.epsilon.-Boc-L-Lysine (Chemimpex) and
N.epsilon.-Acetyl-L-Lysine (Sigma) were added to the media at the
desired concentration before transfection.
Production of AAV Vectors
[0188] Virus was prepared using the protocol from the Gene
Transfer, Targeting and Therapeutics (GT3) core at the Salk
Institute of Biological Studies (La Jolla, Calif.). AAV8 particles
were produced using HEK 293T cells via the triple transfection
method and purified via an iodixanol gradient. Confluency at
transfection was about 80%. Two hours prior to transfection, DMEM
supplemented with 10% FBS was added to the HEK 293T cells. Each
virus was produced in 5.times.15 cm plates, where each plate was
transfected with 7.5 ug of pXR-8, 7.5 of ug recombinant transfer
vector, 7.5 ug of pHelper vector using PEI (1 ug/uL linear PEI in
1.times. DPBS pH 4.5, using HCl) at a PEI:DNA mass ratio of 4:1.
The mixture was incubated for 10 minutes at RT and then applied
dropwise onto the cell media. The virus was harvested after 72
hours and purified using an iodixanol density gradient
ultracentrifugation method. The virus was then dialyzed with
1.times. PBS (pH 7.2) supplemented with 50 mM NaCl and 0.0001% of
Pluronic F68 (Thermo Fisher) using 50 kDA filters (Millipore), to a
final volume of .about.1 mL and quantified by qPCR using primers
specific to the ITR region, against a standard (ATCC VR-1616).
TABLE-US-00017 (SEQ ID NO: 158) AAV-ITR-F: 5'-CGGCCTCAGTGAGCGA-3'
and (SEQ ID NO: 159) AAV-ITR-R: 5'-GGAACCCCTAGTGATGGAGTT-3'.
RNA Isolation and Next Generation Sequencing Library
Preparation
[0189] RNA from gastrocnemius or TA muscles of mdx mice or livers
of spf.sup.ash mice was extracted using the RNeasy Plus Universal
Mini Kit (Qiagen), according to the manufacturer's protocol. Next
generation sequencing libraries were prepared as follows. cDNA was
synthesized using the Protoscript II First Strand cDNA synthesis
Kit (New England Biolabs). Briefly, 500 ng of input cDNA was
amplified by PCR with primers that amplify 150 bp surrounding the
sites of interest using KAPA Hifi HotStart PCR Mix (Kapa
Biosystems). PCR products were gel purified (Qiagen Gel Extraction
kit), and further purified (Qiagen PCR Purification Kit) to
eliminate byproducts. Library construction was done with NEBNext
Multiplex Oligos for Illumina kit (NEB). 10 ng of input DNA was
amplified with indexing primers. Samples were then pooled and
loaded on an Illumina Miseq (150 single-end run) at 5nM
concentrations. Data analysis was performed using CRISPResso.
Animal Experiments
[0190] AAV Injections: All animal procedures were performed in
accordance with protocols approved by the Institutional Animal Care
and Use Committee (IACUC) of the University of California, San
Diego. All mice were acquired from Jackson labs. AAVs were injected
into the gastrocnemius or TA muscle of mdx mice (6-10 weeks old)
using 2.5E+12 vg/muscle. AAVs were injected into spf.sup.ash (10-12
weeks old) mice via retro-orbital injections using 3E+12
vg/mouse.
[0191] UAA administration: Mice were fed water containing 20 mg/ml
N.epsilon.-Boc-L-Lysine (Chemimpex) for one month. Mice were also
administered the 30 mg N.epsilon.-Boc-L-Lysine via IP injections,
thrice a week.
Immunofluorescence
[0192] Harvested gastrocnemius or TA muscles were placed in molds
containing OCT compound (VWR) and flash frozen in liquid nitrogen.
20 .mu.m sections were cut onto pre-treated histological slides.
Slides were fixed using 4% Paraformaldehyde. Dystrophin was
detected with a rabbit polyclonal antibody against the N-terminal
domain of dystrophin (1:100, Abcam 15277) followed by a donkey
anti-rabbit Alexa 546 secondary antibody (1:250, Thermo
Fisher).
Statistical Analysis
[0193] All statistical analyses were performed using the software
Graphpad Prism and p-values were computed by unpaired two-tailed t
tests.
Results
[0194] Applicants focused first on establishing the system for
targeting nonsense mutations. This was motivated by the fact that
nonsense mutations are responsible for 11% of all described gene
lesions causing inheritable human disease, and close to 20% of
disease-associated single base substitutions that affect the coding
regions of genes. Specifically, we explored two independent but
complementary approaches to directly target nonsense mutations.
First, Applicants focused on engineering robust nonsense codon
suppression via suppressor tRNAs. Although the use of suppressor
tRNAs for premature stop codon read-through of endogenous non-sense
mutations has been attempted in vivo in mice, these prior studies
relied only on plasmid delivery and the use of robust and optimized
delivery formats was not explored. Additionally, the potential use
of un-natural amino acid (UAA) based inducible in vivo suppression
of a disease-causing endogenous nonsense mutation has not been
explored either. Towards this, Applicants first modified the
anticodon stems of serine, arginine and leucine tRNAs to create
suppressor tRNAs targeting all three stop codons, amber, opal and
ochre, and evaluated these constructs in cells using GFP reporters
harboring corresponding nonsense mutations. Among these, the serine
suppressor tRNA demonstrated the most consistent and robust results
(FIG. 16A, FIG. 18A). To also engineer UAA mediated inducible codon
suppression, we next utilized the pyrrolysyl-tRNA/aminoacyl tRNA
synthetase (aaRS) pair from Methanosarcina barkeri
(MbPy1RS).sup.32,33 and cloned it into AAV vectors. This enabled
programmable incorporation of UAAs at a stop codon. Notably,
Applicants found that adding a second copy of the tRNA into the
expression vector significantly boosted suppression efficiencies
(FIG. 18B). Applicants further systematically evaluated additional
aminoacyl tRNA synthetases from Methanosarcina mazei
(MmPy1RS).sup.34 and an N.epsilon.-acetyl-lysyl-tRNA synthetase
(AcKRS), and also explored varying the number of tRNAs copies per
vector to up to four (FIG. 18B).
[0195] As suppressor tRNA based approaches can lead to the
read-through of other non-target stop codons, concurrently
Applicants also engineered a system for sequence-specific targeted
RNA editing via adenosine deaminase enzymes. Specifically,
adenosine to inosine (A to I) editing is a common
post-transcriptional modification in RNA, catalyzed by adenosine
deaminases acting on RNA (ADARs). Inosine is a deaminated form of
adenosine and is biochemically recognized as guanine. Recently,
multiple studies have demonstrated the engineering of ADAR2
mediated targeting in vitro, and a study also demonstrated
correction of the nonsense mutation in CFTR in xenopus oocytes.
Building on this, Applicants engineered here a system for
sequence-specific targeted RNA editing in vitro and in vivo,
utilizing the human ADAR2 enzyme and an associated ADAR2 guide RNA
(adRNAs) engineered from its naturally occurring substrate GluR2
pre-mRNA. This ADAR2 guiding RNA comprises an ADAR-recruiting
domain and a programmable antisense region that is complementary to
a specified target RNA sequence. Applicants first evaluated the RNA
editing efficiency of this system in vitro by co-transfecting the
constructs with GFP reporters harboring a non-sense amber or ochre
mutation at Y39. Specifically, Applicants utilized two editing
approaches to engineer the editing of both adenosines in the ochre
stop codon: a one-step mechanism where both the adenosines are
edited simultaneously or a two-step mechanism wherein editing takes
place sequentially. In addition, we also explored the possibility
of conversion of an ochre codon to an amber codon followed by amber
suppression to restore GFP expression. All three approaches enabled
restoration of GFP expression (FIG. 16C, FIG. 19A). Applicants next
constructed AAV vectors to deliver the adRNA or a reverse oriented
adRNA (radRNA) along with the ADAR2 enzyme. Similar to tRNA
mediated codon suppression, addition of a second copy of the
adRNA/radRNA significantly improved the targeting efficiency (FIG.
19D). Applicants further systematically evaluated modified ADAR
recruiting domains, and a range of RNA targeting antisense designs
of varying lengths and the number of nucleotides intervening the
target A and the R/G motif of the adRNA.sup.26, yielding a panel of
efficient adRNA designs (FIG. 19B-C).
[0196] Based on the above in vitro optimizations, Applicants next
tested the system for in vivo RNA targeting. Applicants focused
first on the mdx mouse model for Duchenne muscular dystrophy
(DMD).sup.35 which bears an ochre stop site in exon 23 of the
dystrophin gene. Recent studies utilizing the CRISPR-Cas9 system
have shown promising results in the prevention.sup.38 and partial
functional recovery of DMD by making changes in exon 23 at the DNA
level in the mdx mouse. We thus concurrently evaluated three
approaches (FIG. 17A): one, suppressor tRNAs derived from modified
endogenous tRNAs or pyrrolysyl tRNAs for nonsense codon
suppression; two, ADAR2 based correction of the nonsense mutation;
and, three, CRISPR-Cas9 based genome targeting to benchmark the RNA
targeting approaches.
[0197] Corresponding, Applicants first designed an AAV carrying two
copies of the serine suppressor tRNA targeting the ochre stop
codon, and the tibalis anterior (TA) or gastrocnemius of mdx mice
were injected with the same. Mice muscles were harvested after 2,
4, and 8 weeks. Progressively improved restoration of dystrophin
expression was seen over time, with the mice harvested after 8
weeks showing the greatest degree of restoration (FIG. 17B, FIG.
20A). In addition, neuronal nitric oxide synthase (nNOS) activity
was restored at the sarcolemma which is absent in mdx mice due to
the absence of the nNOS binding site in the mutant dystrophin
protein (FIG. 17B). To further make the system inducible, a vector
carrying two copies of the pyrrolysyl-tRNA targeting the ochre stop
codon and MbPy1RS was also constructed and injected into the TA or
gastrocnemius of mdx mice, and the mice were divided into two
groups: one that was administered the pyrrolysine UAA and a control
group that was not. Expectedly only mice that were provided the UAA
showed nNOS localization at the sarcolemma (FIG. 20B), and
restoration of dystrophin expression (FIG. 20C).
[0198] Next, Applicants evaluated the ADAR2 based site-specific RNA
editing approach in this mouse model. To test the efficiency of
this system in editing both adenosines in the ochre stop codon in
mdx DMD mRNA, Applicants first optimized the constructs in vitro
with a reporter plasmid bearing a fragment of the mdx DMD mRNA in
HEK293T cells. Sanger sequencing and NGS analysis confirmed
successful targeting (FIG. 21A). Applicants next packaged the
optimized constructs into AAV8, and injected the tibialis anterior
(TA) or gastrocnemius of mdx mice. Eight weeks post injection, TA
and gastrocnemius muscles were collected from mdx mice, wild type
mice, and mice treated with adRNA targeting and non-targeting
controls. IHC revealed clear restoration of dystrophin expression
(FIG. 17B). In addition, nNOS activity was also restored at the
sarcolemma (FIG. 17B). RNA editing rates (TAA->TGG/TAG/TGA) of
0.5-0.7% were observed in treated mice (FIG. 17C, FIG. 21B).
Applicants also note that the mdx mice showed no mRNA with a
TAA->TGG change while the treated mice showed up to 0.42%
TAA->TGG edited mRNA. Applicants note that corresponding DNA
editing rates via CRISPR-Cas9 in published in vivo targeting
studies were about 2%.sup.39. To further benchmark the tRiAD
approach, we thus also targeted the mdx mice via CRISPR based
genome editing of the nonsense mutation. Applicants injected
vectors bearing dual-gRNAs to excise exon 23 codon, and expectedly,
this led to restoration of dystrophin expression in a subset of the
muscle cells (FIG. 17B).
[0199] Finally, we also evaluated the ADAR2 mediated RNA editing
approach in an independent mouse model of human disease.
Specifically, we focused on the male sparse fur ash (spf.sup.ash)
mouse model of ornithine transcarbamylase (OTC) deficiency. The
spf.sup.ash mice have a G->A point mutation in the last
nucleotide of the fourth exon of the OTC gene, which leads to OTC
mRNA deficiency and production of mutant protein.sup.43. Recent
studies have demonstrated the use of CRISPR-Cas9 and homologous
recombination based strategies for robust correction of this
mutation in neonatal mice. However, gene correction via
homology-directed repair (HDR) in adult mice was inefficient and
led to genomic deletions which proved to be lethal as they
compromised liver function in targeted mice. To test the
effectiveness of the system in editing the point mutation in
spf.sup.ash OTC mRNA (FIG. 17D), Applicants first evaluated our
constructs in vitro with a plasmid bearing a fragment of the
spf.sup.ash OTC mRNA in HEK293T cells. Sanger sequencing and next
generation sequencing (NGS) analysis confirmed robust RNA editing
efficiencies (FIG. 21C). Applicants next packaged the constructs
into AAV8, which has high liver tropism.sup.44, and injected 10-12
week old spf.sup.ash mice. Four weeks post injection, Applicants
collected liver samples from spf.sup.ash, wild-type litter mates,
and spf.sup.ash mice treated with the ADAR2 targeting and
non-targeting vectors and evaluated editing efficiency via NGS.
Notably, significant RNA editing rates in the range of 0.8-4.2%
were observed in treated mice in the spliced OTC mRNA (FIG. 17E,
FIG. 21D), further confirming the utility of this approach for in
vivo editing of endogenous RNA in adult mice.
[0200] Taken together, Applicants' results establish the use of
suppressor tRNAs and ADAR2 as potential strategies for in vivo RNA
targeting of point mutations. Specifically, by optimizing delivery,
Applicants first demonstrated robust and inducible stop codon
read-through via the use of suppressor tRNAs. The delivery of
modified endogenous suppressor tRNAs for premature stop
read-through has several potential advantages: it lacks the
toxicity associated with read-through drugs such as gentamycin and
can be used to bring about efficient stop codon read-through in
post-mitotic cells. In addition, being of endogenous origin, it is
not likely to elicit a strong immune response. Additionally, the
inducibility enabled by the UAA based systems, albeit non-native,
could provide tight regulation over the expression of genes.
Localized injections of the UAA into the target muscle could
further help improve the efficiency of the system in future
studies. Notably, Applicants did not observe any overt toxicity via
this approach in the mdx targeting studies. Applicants however note
too that an important caveat to this strategy, analogous to the
read-through drugs, is that suppressor tRNA based approaches will
lead to the read-through of other non-target stop codons. In this
regard, Applicants thus also demonstrated ADAR2 based site-specific
correction of point mutations in RNA in two independent mouse
models. Applicants note that potential off-targets in RNA are
limited as compared to DNA, as the transcriptome is only a small
subset of the genome. Secondly, even if off-targets exist, the
presence of an A within the target window is required for the
enzyme to create an off-target A->G change. Lastly, the
off-target effects will be transient. Thus, overall off-target
effects due to a RNA editing enzyme such as ADAR2 are likely to be
limited, although enzyme processivity, promiscuity, and off-target
hybridization of the antisense domain of the adRNA need to be
studied thoroughly. ADAR2 being of human origin is also less likely
to elicit an immune response, while enabling more site-specific
editing of RNA compared to the suppressor tRNA approach.
[0201] Applicants also note that compared to the tRiAD based RNA
targeting approaches above, CRISPR based genome targeting
approaches currently show faster kinetics and greater degree of
mutant protein restoration. Applicants however anticipate that
systematic engineering and directed evolution of the ADAR2 could
help improve the editing efficiency and also eliminate the
intrinsic biases of the ADAR2 for certain sequences, coupled with
insights from studies unearthing novel regulators of ADAR2
providing cues to improve its stability. In this regard, Applicants
tested the ADAR2-E488Q mutant and noted that it enabled higher
editing efficiency than the wild type ADAR2 for both the DMD and
OTC mRNA fragments expressed in vitro (FIG. 22). The demonstration
of site-specific A->G mRNA editing in vivo also opens up the
door to future site-specific C->T editing via targeted
recruitment of cytosine deaminases, thereby potentially expanding
the repertoire of RNA editing tools. However, an important
consideration while targeting RNA for gene therapy via the use of
non-integrating vectors such as AAVs, is the necessity for periodic
re-administration of the effector constructs due to the typically
limited half-life of edited mRNAs. Secondly, RNA folding, intrinsic
half-life, localization, and RNA binding proteins might also impact
accessibility of target sites in the RNA. For instance, in this
example, the short half-life of mutant dystrophin RNA, and the need
to target the transient pre-mRNA in OTC potentially negatively
impact overall editing efficiencies. Chemical and structural
modifications in tRNAs and adRNAs while taking cues from the
specificity studies on sgRNAs.sup.49, or coupling of shielding
proteins, or recently demonstrated programmable RNA binding
proteins and RNA-targeting CRISPR-Cas systems, might help improve
RNA stability and specificity, and improve the efficiency of the
above approaches. With progressive improvements, Applicants thus
anticipate this integrated tRiAD toolset will have broad
implications in both applied life sciences as well as fundamental
research.
Example 6--ADAR and APOBEC Editing Efficacy
[0202] A number of ADAR scaffolds--both dual and single--were
tested for efficacy in recruiting ADAR in a cell line where ADAR2
was overexpressed (FIG. 28 and FIG. 29). Further assessments were
made for MCP-ADAR fusion scaffolds (FIG. 30). Endogenous mRNA
target editing efficiency was assessed using scaffold v2. SEQ ID
NOS 160-163 are disclosed below.
TABLE-US-00018 mRNA Target #1 #2 #3 Average RAB7A
GGGAAATCCAGCTAGCGGCA 32.0% 34.1% 30.2% 32.1% RAB7A
GGGAAAACTGTCTAGTTCCC 28.2% 27.5% 23.0% 26.2% CCNB1
TAATTGACTGGCTAGTACAG 23.8% 17.2% 21.1% 20.7% CCNB1
GAGCTTTTTGCTTAGCACTG 15.1% 18.4% 17.4% 17.0%
Equivalents
[0203] Unless otherwise defined, all technical and scientific terms
used herein have the same meaning as commonly understood by one of
ordinary skill in the art to which this technology belongs.
[0204] The present technology illustratively described herein may
suitably be practiced in the absence of any element or elements,
limitation or limitations, not specifically disclosed herein. Thus,
for example, the terms "comprising," "including," "containing,"
etc. shall be read expansively and without limitation.
Additionally, the terms and expressions employed herein have been
used as terms of description and not of limitation, and there is no
intention in the use of such terms and expressions of excluding any
equivalents of the features shown and described or portions
thereof, but it is recognized that various modifications are
possible within the scope of the present technology claimed.
[0205] Thus, it should be understood that the materials, methods,
and examples provided here are representative of preferred aspects,
are exemplary, and are not intended as limitations on the scope of
the present technology.
[0206] The present technology has been described broadly and
generically herein. Each of the narrower species and sub-generic
groupings falling within the generic disclosure also form part of
the present technology. This includes the generic description of
the present technology with a proviso or negative limitation
removing any subject matter from the genus, regardless of whether
or not the excised material is specifically recited herein.
[0207] In addition, where features or aspects of the present
technology are described in terms of Markush groups, those skilled
in the art will recognize that the present technology is also
thereby described in terms of any individual member or subgroup of
members of the Markush group.
[0208] All publications, patent applications, patents, and other
references mentioned herein are expressly incorporated by reference
in their entirety, to the same extent as if each were incorporated
by reference individually. In case of conflict, the present
specification, including definitions, will control.
[0209] Other aspects are set forth within the following claims.
REFERENCES
[0210] Welch, E. M. et al. PTC124 targets genetic disorders caused
by nonsense mutations. Nature 447, 87-91 (2007).
[0211] Mah, J. Current and emerging treatment strategies for
Duchenne muscular dystrophy. Neuropsychiatr. Dis. Treat. Volume
12,1795-1807 (2016).
[0212] Tabebordbar, M. et al. In vivo gene editing in dystrophic
mouse muscle and muscle stem cells. Science (80.). 351,407-411
(2016).
[0213] Nelson, C. E. et al. In vivo genome editing improves muscle
function in a mouse model of Duchenne muscular dystrophy. Science
(80.). 351, (2016).
[0214] Cirak, S. et al. Exon skipping and dystrophin restoration in
patients with Duchenne muscular dystrophy after systemic
phosphorodiamidate morpholino oligomer treatment: an open label,
phase 2, dose escalation study. Lancet 378,595-605 (2011).
[0215] Malik, V. et al. Gentamicin induced readthrough of stop
codons in Duchenne muscular dystrophy. Ann. Neurol. 67, NANA
(2010).
[0216] Wagner, K. R. et al. Gentamicin treatment of Duchenne and
Becker muscular dystrophy due to nonsense mutations. Ann. Neurol.
49,706-11 (2001).
[0217] Yang, Y. et al. A dual AAV system enables the Cas9-mediated
correction of a metabolic liver disease in newborn mice. Nat.
Biotechnol. 34,334-338 (2016).
[0218] Wettengel, J. et al. Harnessing human ADAR2 for RNA
repair--Recoding a PINK1 mutation rescues mitophagy. Nucleic Acids
Res. gkw911 (2016).
[0219] Fukuda, M. et al. Construction of a guide-RNA for
site-directed RNA mutagenesis utilising intracellular A-to-I RNA
editing 1-49.
[0220] Hendel, A. et al. Chemically modified guide RNAs enhance
CRISPR-Cas genome editing in human primary cells. Nature
Biotechnology, 33(9), pp.985-989 (2015).
[0221] Jinek, M. et al. A Programmable Dual-RNA-Guided DNA
Endonuclease in Adaptive Bacterial Immunity. Science (80-.).
337,816-821 (2012).
[0222] Christian, M. et al. Targeting DNA Double-Strand Breaks with
TAL Effector Nucleases. Genetics 186,757-761 (2010).
[0223] Urnov, F. D. et al. Highly efficient endogenous human gene
correction using designed zinc-finger nucleases. Nature 435,646-651
(2005).
[0224] Urnov, F. D., Rebar, E. J., Holmes, M. C., Zhang, H. S.
& Gregory, P. D. Genome editing with engineered zinc finger
nucleases. Nat. Rev. Genet. 11,636-646 (2010).
[0225] Mali, P. et al. RNA-guided human genome engineering via
Cas9. Science 339, 823-6 (2013).
[0226] Cong, L., Ran, F., Cox, D., Lin, S. & Barretto, R.
Multiplex Genome Engineering Using CRISPR/Cas Systems. Science
(80). 819, (2013).
[0227] Mario, R. et al. Altering the genome by Homologous
Recombination. Sci. Virol. Sci. Theor. Appl. Genet. Arch. Tierz.
Kexue Tongbao K. Ozato al. Cell Differ. Aquac. Trans. Am. Fish. Soc
244,1288-1292 (1989).
[0228] Takata, M. et al. Homologous recombination and
non-homologous end-joining pathways of DNA double-strand break
repair have overlapping roles in the maintenance of chromosomal
integrity in vertebrate cells. EMBO J. 17,5497-508 (1998).
[0229] Cho, S. W. et al. Analysis of off-target effects of
CRISPR/Cas-derived RNA-guided endonucleases and nickases. Genome
Res. 24,132-41 (2014).
[0230] Schaefer, K. A. et al. Unexpected mutations after
CRISPR--Cas9 editing in vivo
[0231] Digenome-seq web tool for profiling CRISPR specificity.
Nature 14,547-548 (2017).
[0232] Wang, D. et al. Adenovirus-Mediated Somatic Genome Editing
of Pten by CRISPR/Cas9 in Mouse Liver in Spite of Cas9-Specific
Immune Responses. Hum. Gene Ther. 26,432-42 (2015).
[0233] Chew, W. L. et al. A multifunctional AAV-CRISPR-Cas9 and its
host response. Nat. Methods 13,868-874 (2016).
[0234] Komor, A. C., Kim, Y. B., Packer, M. S., Zuris, J. A. &
Liu, D. R. Programmable editing of a target base in genomic DNA
without double-stranded DNA cleavage. Nature 533,420-424
(2016).
[0235] Gaudelli, N. M. et al. Programmable base editing of A.T to
G. C. in genomic DNA without DNA cleavage. (2017).
doi:10.1038/nature24644
[0236] Kim, K. et al. Highly efficient RNA-guided base editing in
mouse embryos. Nat. Biotechnol. 9,12-15 (2017).
[0237] Capone, J. P., Sharp, P. A. & RajBhandary, U. L. Amber,
ochre and opal suppressor tRNA genes derived from a human serine
tRNA gene. EMBO J. 4,213-21 (1985).
[0238] Geslain, R. & Pan, T. Functional analysis of human tRNA
isodecoders. doi:10.1016/j.jmb.2009.12.018
[0239] Panchal, R. G., Wang, S., Mcdermott, J. & Link, C. J.
Partial Functional Correction of Xeroderma Pigmentosum Group A
Cells by Suppressor tRNA. Hum. Gene Ther. 10, 2209-2219 (1999).
[0240] Buvoli, M., Buvoli, A. & Leinwand, L. A. Suppression of
nonsense mutations in cell culture and mice by multimerized
suppressor tRNA genes. Mol. Cell. Biol. 20, 3116-24 (2000).
[0241] Wang, L., Brock, A., Herberich, B. & Schultz, P. G.
Expanding the Genetic Code of Escherichia coli. Science (80-.).
292, (2001).
[0242] Ernst, R. J. et al. Genetic code expansion in the mouse
brain. 1-5 (2016). doi:10.1038/nchembio.2160
[0243] Han, S. et al. Expanding the genetic code of Mus musculus.
Nat. Commun. 8, 14568 (2017).
[0244] Melcher, T. et al. A mammalian RNA editing enzyme. Nature
379, 460-464 (1996).
[0245] Rueter, S. M., Burns, C. M., Coode, S. A., Mookherjee, P.
& Emeson, R. B. Glutamate receptor RNA editing in vitro by
enzymatic conversion of adenosine to inosine. Science 267, 1491-4
(1995).
[0246] Montiel-Gonzalez, M. F., Vallecillo-Viejo, I., Yudowski, G.
A. & Rosenthal, J. J. C. Correction of mutations within the
cystic fibrosis transmembrane conductance regulator by
site-directed RNA editing. Proc. Natl. Acad. Sci. U. S. A. 110,
18285-90 (2013).
[0247] Wettengel, J., Reautschnig, P., Geisler, S., Kahle, P. J.
& Stafforst, T. Harnessing human ADAR2 for RNA repair--Recoding
a PINK' mutation rescues mitophagy. Nucleic Acids Res. gkw911
(2016). doi:10.1093/nar/gkw911
[0248] Fukuda, M. et al. Construction of a guide-RNA for
site-directed RNA mutagenesis utilising intracellular A-to-I RNA
editing. Sci. Rep. 7, 41478 (2017).
[0249] Mort, M., Ivanov, D., Cooper, D. N. & Chuzhanova, N. A.
A meta-analysis of nonsense mutations causing human genetic
disease. Hum. Mutat. 29, 1037-1047 (2008).
[0250] Bidou, L., Allamand, V., Rousset, J.-P. & Namy, O. Sense
from nonsense: therapies for premature stop codon diseases. Trends
Mol. Med. 18, 679-688 (2012).
[0251] Li, K. et al. OCHRE SUPPRESSOR TRANSFER RNA RESTORED
DYSTROPHIN EXPRESSION IN MDX MICE. Life Sci. 61, PL205-PL209
(1997).
[0252] Kiselev, A. V. et al. Suppression of nonsense mutations in
the Dystrophin gene by a suppressor tRNA gene Ispol'zovanie gena
supressornoi tRNK dlia ispravleniia nonsens-mutatsii v gene
distrofina. Mol. Biol. 36, 43-47 (2002).
[0253] Gautier, A. et al. Genetically Encoded Photocontrol of
Protein Localization in Mammalian Cells. J. Am. Chem. Soc. 132,
4086-4088 (2010).
[0254] Chatterjee, A., Xiao, H., Bollong, M., Ai, H. & Schultz,
P. G. Efficient viral delivery system for unnatural amino acid
mutagenesis in mammalian cells. 110, 11803-11808 (2013).
[0255] Greiss, S. & Chin, J. W. Expanding the Genetic Code of
an Animal. 2, 14196-14199 (2011).
[0256] Robinson-Hamm, J. N. & Gersbach, C. A. Gene therapies
that restore dystrophin expression for the treatment of Duchenne
muscular dystrophy. Hum. Genet. 135, 1029-1040 (2016).
[0257] Bulfield, G., Siller, W. G., Wight, P. A. & Moore, K. J.
X chromosome-linked muscular dystrophy (mdx) in the mouse. Proc.
Natl. Acad. Sci. U. S. A. 81, 1189-92 (1984).
[0258] Sicinski, P. et al. The molecular basis of muscular
dystrophy in the mdx mouse: a point mutation. Science 244, 1578-80
(1989).
[0259] Long, C. et al. Prevention of muscular dystrophy in mice by
CRISPR/Cas9-mediated editing of germline DNA. Science (80-.). 345,
1184-1188 (2014).
[0260] Nelson, C. E. et al. In vivo genome editing improves muscle
function in a mouse model of Duchenne muscular dystrophy. Science
(80-.). 351, (2016).
[0261] Tabebordbar, M. et al. In vivo gene editing in dystrophic
mouse muscle and muscle stem cells. Science (80-.). 351, 407-411
(2016).
[0262] Long, C. et al. Postnatal genome editing partially restores
dystrophin expression in a mouse model of muscular dystrophy.
Science (80-.). 351, 400-403 (2016).
[0263] Bengtsson, N. E. et al. Muscle-specific CRISPR/Cas9
dystrophin gene editing ameliorates pathophysiology in a mouse
model for Duchenne muscular dystrophy. Nat. Commun. 8, 14454
(2017).
[0264] Hodges, P. E. & Rosenberg, L. E. The spfash mouse: a
missense mutation in the ornithine transcarbamylase gene also
causes aberrant mRNA splicing. Proc. Natl. Acad. Sci. U.S.A. 86,
4142-4146 (1989).
[0265] Yang, Y. et al. A dual AAV system enables the Cas9-mediated
correction of a metabolic liver disease in newborn mice. Nat.
Biotechnol. 34, 334-338 (2016).
[0266] Kuttan, A. & Bass, B. L. Mechanistic insights into
editing-site specificity of ADARs. Proc. Natl. Acad. Sci. 109,
E3295-E3304 (2012).
[0267] Tan, M. H. et al. Dynamic landscape and regulation of RNA
editing in mammals. Nature 550, 249-254 (2017).
[0268] Varani, G., Cheong, C. & Tinoco, I. Structure of an
Unusually Stable RNA Hairpint. Biochemistry 30, 3280-3289
(1991).
[0269] Tuerk, C. et al. CUUCGG hairpins: Extraordinarily stable RNA
secondary structures associated with various biochemical processes
(hairpin stability/sequence analysis/reverse transcriptase).
Biochemistry 85, 1364-1368 (1988).
[0270] Fu, Y., Sander, J. D., Reyon, D., Cascio, V. M. & Joung,
J. K. Improving CRISPR-Cas nuclease specificity using truncated
guide RNAs. Nat. Biotechnol. 32, 279-84 (2014).
[0271] Adamala, K. P., Martin-Alarcon, D. A. & Boyden, E. S.
Programmable RNA-binding protein composed of repeats of a single
modular unit. Proc. Natl. Acad. Sci. 113, E2579-E2588 (2016).
[0272] East-Seletsky, A. et al. Two distinct RNase activities of
CRISPR-C2c2 enable guide-RNA processing and RNA detection. Nature
(2016). doi:10.1038/nature19802
[0273] Abudayyeh, O. O. et al. C2c2 is a single-component
programmable RNA-guided RNA-targeting CRISPR effector. Science 353,
aaf5573 1-9 (2016).
[0274] O'Connell, M. R. et al. Programmable RNA recognition and
cleavage by CRISPR/Cas9. Nature 516, 263-266 (2014).
[0275] Abudayyeh, O.O. et al. RNA targeting with CRISPR-Cas13.
Nature (2017). doi:10.1038/nature24049
[0276] Cox, D. B. T. et al. RNA editing with CRISPR-Cas13. Science
eaaq0180 (2017). doi:10.1126/science.aaq0180
[0277] Gootenberg, J. S. et al. Nucleic acid detection with
CRISPR-Cas13a/C2c2. Science (80-.). 356, 438-442 (2017).
[0278] East-Seletsky, A., O'Connell, M. R., Burstein, D., Knott, G.
J. & Doudna, J. A. RNA Targeting by Functionally Orthogonal
Type VI-A CRISPR-Cas Enzymes. Mol. Cell 66, 373-383.e3 (2017).
[0279] Grieger, J. C., Choi, V. W. & Samulski, R. J. Production
and characterization of adeno-associated viral vectors. Nat.
Protoc. 1, 1412-1428 (2006). Analyzing CRISPR genome-editing
experiments with CRISPResso. Nat. Biotechnol. 34, (2016).
Sequence CWU 1
1
2751473DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 1tcccggggtt tccgccattt tttggtactg
agtcgcccag tctcagatag atccgacgcc 60gccatctcta ggcccgcgcc ggccccctcg
cacagacttg tgggagaagc tcggctactc 120ccctgccccg gttaatttgc
atataatatt tcctagtaac tatagaggct taatgtgcga 180taaaagacag
ataatctgtt ctttttaata ctagctacat tttacatgat aggcttggat
240ttctataaga gatacaaata ctaaattatt attttaaaaa acagcacaaa
aggaaactca 300ccctaactgt aaagtaattg tgtgttttga gactataaat
atcccttgga gaaaagcctt 360gtttgggaaa cctgatcatg tagatcgaac
ggactctaaa tccgttcagc cgggttagat 420tcccggggtt tccgccattt
tttcctagac ccagctttct tgtacaaagt tgg 4732473DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
2tcccggggtt tccgccattt tttggtactg agtcgcccag tctcagatag atccgacgcc
60gccatctcta ggcccgcgcc ggccccctcg cacagacttg tgggagaagc tcggctactc
120ccctgccccg gttaatttgc atataatatt tcctagtaac tatagaggct
taatgtgcga 180taaaagacag ataatctgtt ctttttaata ctagctacat
tttacatgat aggcttggat 240ttctataaga gatacaaata ctaaattatt
attttaaaaa acagcacaaa aggaaactca 300ccctaactgt aaagtaattg
tgtgttttga gactataaat atcccttgga gaaaagcctt 360gtttgggaaa
cctgatcatg tagatcgaac ggactttaaa tccgttcagc cgggttagat
420tcccggggtt tccgccattt tttcctagac ccagctttct tgtacaaagt tgg
4733473DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 3tcccggggtt tccgccattt tttggtactg
agtcgcccag tctcagatag atccgacgcc 60gccatctcta ggcccgcgcc ggccccctcg
cacagacttg tgggagaagc tcggctactc 120ccctgccccg gttaatttgc
atataatatt tcctagtaac tatagaggct taatgtgcga 180taaaagacag
ataatctgtt ctttttaata ctagctacat tttacatgat aggcttggat
240ttctataaga gatacaaata ctaaattatt attttaaaaa acagcacaaa
aggaaactca 300ccctaactgt aaagtaattg tgtgttttga gactataaat
atcccttgga gaaaagcctt 360gtttgggaaa cctgatcatg tagatcgaac
ggacttcaaa tccgttcagc cgggttagat 420tcccggggtt tccgccattt
tttcctagac ccagctttct tgtacaaagt tgg 47341449DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
4cagcctccgg actctagagg atcgaaccct taaggccacc atggataaga aacctttgaa
60cactctcatt agtgcgacag ggctctggat gtcccgaacg gggactatac acaagataaa
120acaccatgag gtctcaagga gcaaaatcta tatcgagatg gcatgcggcg
accatcttgt 180ggtaaataat agtaggtcct ccaggacggc aagagcactc
cgacatcaca agtacagaaa 240aacctgcaaa cggtgtaggg tatccgacga
agacttgaac aaatttttga ctaaggccaa 300cgaggatcaa acttctgtca
aagtgaaagt ggtttctgct cctacccgaa ctaagaaggc 360catgcccaag
tccgtggcaa gggcacccaa gccactcgaa aatactgagg ccgctcaggc
420ccaaccatcc ggtagtaagt tcagtccagc catacccgta agtacccaag
aatctgtcag 480tgtgccggcc tcagtttcca catctataag ttcaatttct
acaggagcga cggcctccgc 540cctcgtcaag ggtaacacaa acccgataac
ttctatgagt gcccccgtac aggcatccgc 600accagcactg acgaagtctc
aaactgatag gctggaagtg ctcttgaatc cgaaggacga 660gatatctctt
aactccggta aacctttccg ggagctggaa agtgaacttc tcagccggcg
720aaaaaaagac ctccagcaaa tttacgcaga ggaaagggag aactatctgg
ggaagttgga 780acgagagatc acccgattct ttgtcgatcg cggatttttg
gagattaaaa gcccaattct 840catccccctt gaatatatcg aacgaatggg
aatcgacaat gatacggagt tgtccaagca 900gattttccgc gtagacaaga
acttttgtct tcgacccatg ctcgctccga acctctacaa 960ttacttgaga
aagttggaca gagcgctccc ggacccgatc aagatatttg agatcggtcc
1020ttgttataga aaggagagtg atggaaaaga acacctcgaa gagttcacga
tgctgaactt 1080ctgccaaatg ggttctggct gcacacggga gaatctcgaa
agcatcatta cagatttcct 1140taaccatctg gggatagact ttaaaatagt
gggtgacagc tgtatggtat acggagatac 1200cttggacgta atgcacgggg
atcttgagct ttcctccgcc gtggttggac ctataccgtt 1260ggaccgggag
tggggaatcg acaaaccgtg gataggcgcc ggtttcggcc ttgaaagact
1320cctcaaagtc aagcatgatt tcaaaaacat aaaacgggct gctcgctccg
aatcttatta 1380caacggtata agtacgaacc tgtgataata gcttaagggt
tcgatcccta ctggttagta 1440atgagttta 1449572DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 5ggaaacctga tcatgtagat cgaatggact ctaaatccgt
tcagccgggt tagattcccg 60gggtttccgc ca 72672DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 6ggggggtgga tcgaatagat cacacggact ctaaattcgt
gcaggcgggt gaaactcccg 60tactccccgc ca 72772DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 7ggaaacctga tcatgtagat cgaatggact ttaaatccgt
tcagccgggt tagattcccg 60gggtttccgc ca 72872DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 8ggaaacctga tcatgtagat cgaatggact tcaaatccgt
tcagccgggt tagattcccg 60gggtttccgc ca 7291260DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
9atggataaaa aaccattaga tgttttaata tctgcgaccg ggctctggat gtccaggact
60ggcacgctcc acaaaatcaa gcaccatgag gtctcaagaa gtaaaatata cattgaaatg
120gcgtgtggag accatcttgt tgtgaataat tccaggagtt gtagaacagc
cagagcattc 180agacatcata agtacagaaa aacctgcaaa cgatgtaggg
tttcggacga ggatatcaat 240aattttctca caagatcaac cgaaagcaaa
aacagtgtga aagttagggt agtttctgct 300ccaaaggtca aaaaagctat
gccgaaatca gtttcaaggg ctccgaagcc tctggaaaat 360tctgtttctg
caaaggcatc aacgaacaca tccagatctg taccttcgcc tgcaaaatca
420actccaaatt cgtctgttcc cgcatcggct cctgctcctt cacttacaag
aagccagctt 480gatagggttg aggctctctt aagtccagag gataaaattt
ctctaaatat ggcaaagcct 540ttcagggaac ttgagcctga acttgtgaca
agaagaaaaa acgattttca gcggctctat 600accaatgata gagaagacta
cctcggtaaa ctcgaacgtg atattacgaa atttttcgta 660gaccggggtt
ttctggagat aaagtctcct atccttattc cggcggaata cgtggagaga
720atgggtatta ataatgatac tgaactttca aaacagatct tccgggtgga
taaaaatctc 780tgcttgaggc caatgcttgc cccgactctt tacaactatc
tgcgaaaact cgataggatt 840ttaccaggcc caataaaaat tttcgaagtc
ggaccttgtt accggaaaga gtctgacggc 900aaagagcacc tggaagaatt
tactatggtg aacttctgtc agatgggttc gggatgtact 960cgggaaaatc
ttgaagctct catcaaagag tttctggact atctggaaat cgacttcgaa
1020atcgtaggag attcctgtat ggtctttggg gatactcttg atataatgca
cggggacctg 1080gagctttctt cggcagtcgt cgggccagtt tctcttgata
gagaatgggg tattgacaaa 1140ccatggatag gtgcaggttt tggtcttgaa
cgcttgctca aggttatgca cggctttaaa 1200aacattaaga gggcatcaag
gtccgaatct tactataatg ggatttcaac caatctgtaa 126010720DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
10atggtgagca agggcgagga gctgttcacc ggggtggtgc ccatcctggt cgagctggac
60ggcgacgtaa acggccacaa gttcagcgtg tccggcgagg gcgagggcga tgccacctac
120ggcaagctga ccctgaagtt catctgcacc accggcaagc tgcccgtgcc
ctggcccacc 180ctcgtgacca ccctgaccta cggcgtgcag tgcttcagcc
gctaccccga ccacatgaag 240cagcacgact tcttcaagtc cgccatgccc
gaaggctacg tccaggagcg caccatcttc 300ttcaaggacg acggcaacta
caagacccgc gccgaggtga agttcgaggg cgacaccctg 360gtgaaccgca
tcgagctgaa gggcatcgac ttcaaggagg acggcaacat cctggggcac
420aagctggagt acaactacaa cagccacaac gtctatatca tggccgacaa
gcagaagaac 480ggcatcaagg tgaacttcaa gatccgccac aacatcgagg
acggcagcgt gcagctcgcc 540gaccactacc agcagaacac ccccatcggc
gacggccccg tgctgctgcc cgacaaccac 600tacctgagca cccagtccgc
cctgagcaaa gaccccaacg agaagcgcga tcacatggtc 660ctgctggagt
tcgtgaccgc cgccgggatc actctcggca tggacgagct gtacaagtaa
72011723DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 11atggtgagca agggcgagga gctgttcacc
ggggtggtgc ccatcctggt cgagctggac 60ggcgacgtaa acggccacaa gttcagcgtg
tccggcgagg gcgagggcga tgccacctag 120ggcaagctga ccctgaagtt
catctgcacc accggcaagc tgcccgtgcc ctggcccacc 180ctcgtgacca
ccctgaccta cggcgtgcag tgcttcagcc gctaccccga ccacatgaag
240cagcacgact tcttcaagtc cgccatgccc gaaggctacg tccaggagcg
caccatcttc 300ttcaaggacg acggcaacta caagacccgc gccgaggtga
agttcgaggg cgacaccctg 360gtgaaccgca tcgagctgaa gggcatcgac
ttcaaggagg acggcaacat cctggggcac 420aagctggagt acaactacaa
cagccacaac gtctatatca tggccgacaa gcagaagaac 480ggcatcaagg
tgaacttcaa gatccgccac aacatcgagg acggcagcgt gcagctcgcc
540gaccactacc agcagaacac ccccatcggc gacggccccg tgctgctgcc
cgacaaccac 600tacctgagca cccagtccgc cctgagcaaa gaccccaacg
agaagcgcga tcacatggtc 660ctgctggagt tcgtgaccgc cgccgggatc
actctcggca tggacgagct gtacaagtaa 720tga 72312723DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
12atggtgagca agggcgagga gctgttcacc ggggtggtgc ccatcctggt cgagctggac
60ggcgacgtaa acggccacaa gttcagcgtg tccggcgagg gcgagggcga tgccacctaa
120ggcaagctga ccctgaagtt catctgcacc accggcaagc tgcccgtgcc
ctggcccacc 180ctcgtgacca ccctgaccta cggcgtgcag tgcttcagcc
gctaccccga ccacatgaag 240cagcacgact tcttcaagtc cgccatgccc
gaaggctacg tccaggagcg caccatcttc 300ttcaaggacg acggcaacta
caagacccgc gccgaggtga agttcgaggg cgacaccctg 360gtgaaccgca
tcgagctgaa gggcatcgac ttcaaggagg acggcaacat cctggggcac
420aagctggagt acaactacaa cagccacaac gtctatatca tggccgacaa
gcagaagaac 480ggcatcaagg tgaacttcaa gatccgccac aacatcgagg
acggcagcgt gcagctcgcc 540gaccactacc agcagaacac ccccatcggc
gacggccccg tgctgctgcc cgacaaccac 600tacctgagca cccagtccgc
cctgagcaaa gaccccaacg agaagcgcga tcacatggtc 660ctgctggagt
tcgtgaccgc cgccgggatc actctcggca tggacgagct gtacaagtaa 720tga
72313723DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 13atggtgagca agggcgagga gctgttcacc
ggggtggtgc ccatcctggt cgagctggac 60ggcgacgtaa acggccacaa gttcagcgtg
tccggcgagg gcgagggcga tgccacctga 120ggcaagctga ccctgaagtt
catctgcacc accggcaagc tgcccgtgcc ctggcccacc 180ctcgtgacca
ccctgaccta cggcgtgcag tgcttcagcc gctaccccga ccacatgaag
240cagcacgact tcttcaagtc cgccatgccc gaaggctacg tccaggagcg
caccatcttc 300ttcaaggacg acggcaacta caagacccgc gccgaggtga
agttcgaggg cgacaccctg 360gtgaaccgca tcgagctgaa gggcatcgac
ttcaaggagg acggcaacat cctggggcac 420aagctggagt acaactacaa
cagccacaac gtctatatca tggccgacaa gcagaagaac 480ggcatcaagg
tgaacttcaa gatccgccac aacatcgagg acggcagcgt gcagctcgcc
540gaccactacc agcagaacac ccccatcggc gacggccccg tgctgctgcc
cgacaaccac 600tacctgagca cccagtccgc cctgagcaaa gaccccaacg
agaagcgcga tcacatggtc 660ctgctggagt tcgtgaccgc cgccgggatc
actctcggca tggacgagct gtacaagtaa 720tga 72314419PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
14Met Asp Lys Lys Pro Leu Asp Val Leu Ile Ser Ala Thr Gly Leu Trp1
5 10 15Met Ser Arg Thr Gly Thr Leu His Lys Ile Lys His His Glu Val
Ser 20 25 30Arg Ser Lys Ile Tyr Ile Glu Met Ala Cys Gly Asp His Leu
Val Val 35 40 45Asn Asn Ser Arg Ser Cys Arg Thr Ala Arg Ala Phe Arg
His His Lys 50 55 60Tyr Arg Lys Thr Cys Lys Arg Cys Arg Val Ser Asp
Glu Asp Ile Asn65 70 75 80Asn Phe Leu Thr Arg Ser Thr Glu Ser Lys
Asn Ser Val Lys Val Arg 85 90 95Val Val Ser Ala Pro Lys Val Lys Lys
Ala Met Pro Lys Ser Val Ser 100 105 110Arg Ala Pro Lys Pro Leu Glu
Asn Ser Val Ser Ala Lys Ala Ser Thr 115 120 125Asn Thr Ser Arg Ser
Val Pro Ser Pro Ala Lys Ser Thr Pro Asn Ser 130 135 140Ser Val Pro
Ala Ser Ala Pro Ala Pro Ser Leu Thr Arg Ser Gln Leu145 150 155
160Asp Arg Val Glu Ala Leu Leu Ser Pro Glu Asp Lys Ile Ser Leu Asn
165 170 175Met Ala Lys Pro Phe Arg Glu Leu Glu Pro Glu Leu Val Thr
Arg Arg 180 185 190Lys Asn Asp Phe Gln Arg Leu Tyr Thr Asn Asp Arg
Glu Asp Tyr Leu 195 200 205Gly Lys Leu Glu Arg Asp Ile Thr Lys Phe
Phe Val Asp Arg Gly Phe 210 215 220Leu Glu Ile Lys Ser Pro Ile Leu
Ile Pro Ala Glu Tyr Val Glu Arg225 230 235 240Met Gly Ile Asn Asn
Asp Thr Glu Leu Ser Lys Gln Ile Phe Arg Val 245 250 255Asp Lys Asn
Leu Cys Leu Arg Pro Met Leu Ala Pro Thr Leu Tyr Asn 260 265 270Tyr
Leu Arg Lys Leu Asp Arg Ile Leu Pro Gly Pro Ile Lys Ile Phe 275 280
285Glu Val Gly Pro Cys Tyr Arg Lys Glu Ser Asp Gly Lys Glu His Leu
290 295 300Glu Glu Phe Thr Met Val Asn Phe Cys Gln Met Gly Ser Gly
Cys Thr305 310 315 320Arg Glu Asn Leu Glu Ala Leu Ile Lys Glu Phe
Leu Asp Tyr Leu Glu 325 330 335Ile Asp Phe Glu Ile Val Gly Asp Ser
Cys Met Val Tyr Gly Asp Thr 340 345 350Leu Asp Ile Met His Gly Asp
Leu Glu Leu Ser Ser Ala Val Val Gly 355 360 365Pro Val Ser Leu Asp
Arg Glu Trp Gly Ile Asp Lys Pro Trp Ile Gly 370 375 380Ala Gly Phe
Gly Leu Glu Arg Leu Leu Lys Val Met His Gly Phe Lys385 390 395
400Asn Ile Lys Arg Ala Ser Arg Ser Glu Ser Tyr Tyr Asn Gly Ile Ser
405 410 415Thr Asn Leu15454PRTMethanosarcina mazei 15Met Asp Lys
Lys Pro Leu Asn Thr Leu Ile Ser Ala Thr Gly Leu Trp1 5 10 15Met Ser
Arg Thr Gly Thr Ile His Lys Ile Lys His His Glu Val Ser 20 25 30Arg
Ser Lys Ile Tyr Ile Glu Met Ala Cys Gly Asp His Leu Val Val 35 40
45Asn Asn Ser Arg Ser Ser Arg Thr Ala Arg Ala Leu Arg His His Lys
50 55 60Tyr Arg Lys Thr Cys Lys Arg Cys Arg Val Ser Asp Glu Asp Leu
Asn65 70 75 80Lys Phe Leu Thr Lys Ala Asn Glu Asp Gln Thr Ser Val
Lys Val Lys 85 90 95Val Val Ser Ala Pro Thr Arg Thr Lys Lys Ala Met
Pro Lys Ser Val 100 105 110Ala Arg Ala Pro Lys Pro Leu Glu Asn Thr
Glu Ala Ala Gln Ala Gln 115 120 125Pro Ser Gly Ser Lys Phe Ser Pro
Ala Ile Pro Val Ser Thr Gln Glu 130 135 140Ser Val Ser Val Pro Ala
Ser Val Ser Thr Ser Ile Ser Ser Ile Ser145 150 155 160Thr Gly Ala
Thr Ala Ser Ala Leu Val Lys Gly Asn Thr Asn Pro Ile 165 170 175Thr
Ser Met Ser Ala Pro Val Gln Ala Ser Ala Pro Ala Leu Thr Lys 180 185
190Ser Gln Thr Asp Arg Leu Glu Val Leu Leu Asn Pro Lys Asp Glu Ile
195 200 205Ser Leu Asn Ser Gly Lys Pro Phe Arg Glu Leu Glu Ser Glu
Leu Leu 210 215 220Ser Arg Arg Lys Lys Asp Leu Gln Gln Ile Tyr Ala
Glu Glu Arg Glu225 230 235 240Asn Tyr Leu Gly Lys Leu Glu Arg Glu
Ile Thr Arg Phe Phe Val Asp 245 250 255Arg Gly Phe Leu Glu Ile Lys
Ser Pro Ile Leu Ile Pro Leu Glu Tyr 260 265 270Ile Glu Arg Met Gly
Ile Asp Asn Asp Thr Glu Leu Ser Lys Gln Ile 275 280 285Phe Arg Val
Asp Lys Asn Phe Cys Leu Arg Pro Met Leu Ala Pro Asn 290 295 300Leu
Tyr Asn Tyr Leu Arg Lys Leu Asp Arg Ala Leu Pro Asp Pro Ile305 310
315 320Lys Ile Phe Glu Ile Gly Pro Cys Tyr Arg Lys Glu Ser Asp Gly
Lys 325 330 335Glu His Leu Glu Glu Phe Thr Met Leu Asn Phe Cys Gln
Met Gly Ser 340 345 350Gly Cys Thr Arg Glu Asn Leu Glu Ser Ile Ile
Thr Asp Phe Leu Asn 355 360 365His Leu Gly Ile Asp Phe Lys Ile Val
Gly Asp Ser Cys Met Val Tyr 370 375 380Gly Asp Thr Leu Asp Val Met
His Gly Asp Leu Glu Leu Ser Ser Ala385 390 395 400Val Val Gly Pro
Ile Pro Leu Asp Arg Glu Trp Gly Ile Asp Lys Pro 405 410 415Trp Ile
Gly Ala Gly Phe Gly Leu Glu Arg Leu Leu Lys Val Lys His 420 425
430Asp Phe Lys Asn Ile Lys Arg Ala Ala Arg Ser Glu Ser Tyr Tyr Asn
435 440 445Gly Ile Ser Thr Asn Leu 4501678DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 16ggaaacctga tcatgtagat cgaacggact ctaaatccgt
tcagccgggt tagattcccg 60gggtttccgc catttttt 781778DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 17ggaaacctga tcatgtagat cgaacggact ttaaatccgt
tcagccgggt tagattcccg 60gggtttccgc catttttt 781878DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 18ggaaacctga tcatgtagat cgaacggact tcaaatccgt
tcagccgggt tagattcccg 60gggtttccgc catttttt 781948DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
19tcccggggtt tccgccattt tttggtactg agtcgcccag tctcagat
482027DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer
20caaacaaggc ttttctccaa gggatat 272171DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 21ccttggagaa aagccttgtt tgggaaacct gatcatgtag
atcgaacgga ctctaaatcc 60gttcagccgg g 712272DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 22ggaaacctga tcatgtagat cgaatggact ctaaatccgt
tcagccgggt tagattcccg 60gggtttccgc ca 722372DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 23ggaaacctga tcatgtagat cgaacggact ctaaatccgt
tcagccgggt tagattcccg 60gggtttccgc ca 722473DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 24ggccgcgtgg cctaatggat aaggcgtctg acttcagatc
agaagattgc aggttcgagt 60cctgccgcgg tcg 732573DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 25gaccacgtgg cctaatggat aaggcgtctg acttcagatc
agaagattga gggttcgaat 60cccttcgtgg tta 732682DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 26gtagtcgtgg ccgagtggtt aaggcgatgg actctaaatc
cattggggtt tccccgcgca 60ggttcgaatc ctgccgacta cg
822783DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 27gtcaggatgg ccgagtggtc taaggcgcca
gactctagtt ctggtctcca atggaggcgt 60gggttcgaat cccacttctg aca
832821DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 28ttgtggaaag gacgaaacac c
212931DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 29acaagaaagc tgggtctagg ctagcaaaaa a
313076DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 30ttgtggaaag gacgaaacac cggtcaggat
ggccgagtgg tctaaggcgc cagactctag 60ttctggtctc caatgg
763176DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 31ttgtggaaag gacgaaacac cggtcaggat
ggccgagtgg tctaaggcgc cagactttag 60ttctggtctc caatgg
763276DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 32ttgtggaaag gacgaaacac cggtcaggat
ggccgagtgg tctaaggcgc cagacttcag 60ttctggtctc caatgg
763377DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 33acaagaaagc tgggtctagg ctagcaaaaa
atgtcagaag tgggattcga acccacgcct 60ccattggaga ccagaac
773475DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 34ttgtggaaag gacgaaacac cggtagtcgt
ggccgagtgg ttaaggcgat ggactctaaa 60tccattgggg tttcc
753575DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 35ttgtggaaag gacgaaacac cggtagtcgt
ggccgagtgg ttaaggcgat ggactttaaa 60tccattgggg tttcc
753675DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 36ttgtggaaag gacgaaacac cggtagtcgt
ggccgagtgg ttaaggcgat ggacttcaaa 60tccattgggg tttcc
753777DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 37acaagaaagc tgggtctagg ctagcaaaaa
acgtagtcgg caggattcga acctgcgcgg 60ggaaacccca atggatt
773877DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 38ttgtggaaag gacgaaacac cggaccacgt
ggcctaatgg ataaggcgtc tgacttcaga 60tcagaagatt gagggtt
773977DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 39ttgtggaaag gacgaaacac cggaccacgt
ggcctaatgg ataaggcgtc tgactttaga 60tcagaagatt gagggtt
774077DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 40ttgtggaaag gacgaaacac cggaccacgt
ggcctaatgg ataaggcgtc tgacttcaga 60tcagaagatt gagggtt
774168DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 41acaagaaagc tgggtctagg ctagcaaaaa
ataaccacga agggattcga accctcaatc 60ttctgatc 6842429DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
42gtactgagtc gcccagtctc agatagatcc gacgccgcca tctctaggcc cgcgccggcc
60ccctcgcaca gacttgtggg agaagctcgg ctactcccct gccccggtta atttgcatat
120aatatttcct agtaactata gaggcttaat gtgcgataaa agacagataa
tctgttcttt 180ttaatactag ctacatttta catgataggc ttggatttct
ataagagata caaatactaa 240attattattt taaaaaacag cacaaaagga
aactcaccct aactgtaaag taattgtgtg 300ttttgagact ataaatatcc
cttggagaaa agccttgttt ggtagtcgtg gccgagtggt 360taaggcgatg
gactttaaat ccattggggt ttccccgcgc aggttcgaat cctgccgact 420acgtttttt
4294341DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 43aatcctgccg actacgtttt ttgtactgag
tcgcccagtc t 414419DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 44tttgaaagag caataaaat
194519DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 45ctttgaaaga gcaatagaa
194619DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 46tttgaaagag caataaaat
194719DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 47ataaaatggc ttcaactat
194819DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 48aatagaatgg cttcaacta
194919DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 49aataaaatgg cttcaacta
195022DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 50tcacagacac cgctcagttt gt
225116DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 51atgccacctg gggcaa 165216DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 52tgccacctgg ggcaag 165316DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 53gccacctggg gcaagc 165418DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 54gatgccacct ggggcaag 185520DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 55gcgatgccac ctggggcaag 205649DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 56gggtggaata gtataacaat atgctaaatg ttgttatagt
atcccacct 495745DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 57gtggaatagt ataacaatat
gctaaatgtt gttatagtat cccac 455824DNAArtificial SequenceDescription
of Artificial Sequence Synthetic oligonucleotide 58gggccctctt
cagggccctc taga 245914DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 59atcgccctga aaag
146011DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 60gccacctggg g 116182DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotidemodified_base(34)..(36)a, c, t, g, unknown or other
61gtagtcgtgg ccgagtggtt aaggcgatgg actnnnaatc cattggggtt tccccgcgca
60ggttcgaatc ctgccgacta cg 826283DNAArtificial SequenceDescription
of Artificial Sequence Synthetic
oligonucleotidemodified_base(35)..(37)a, c, t, g, unknown or other
62gtcaggatgg ccgagtggtc taaggcgcca gactnnngtt ctggtctcca atggaggcgt
60gggttcgaat cccacttctg aca 836373DNAArtificial SequenceDescription
of Artificial Sequence Synthetic
oligonucleotidemodified_base(34)..(36)a, c, t, g, unknown or other
63gaccacgtgg cctaatggat aaggcgtctg actnnngatc agaagattga gggttcgaat
60cccttcgtgg tta 736428DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 64gtgttactga atatgaaata
atggagga 286524DNAArtificial SequenceDescription of Artificial
Sequence Synthetic primer 65atttctggca tatttctgaa ggtg
246629DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 66ctctctgtac cttatcttag tgttactga
296729DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 67ctcttcaaat tctgacagat atttctggc
296822DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 68acccttcctt tcttaccaca ca 226923DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
69cagggtgtcc agatctgatt gtt 237029DNAArtificial SequenceDescription
of Artificial Sequence Synthetic primer 70cttctctttt aaactaaccc
atcagagtt 297120DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 71tgtctgtggc gagccaaaca
207220DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 72actttctcgt taccttaccg
2073585PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptideMISC_FEATURE(584)..(585)May or may not be
present 73Met Ala Ser Asn Phe Thr Gln Phe Val Leu Val Asp Asn Gly
Gly Thr1 5 10 15Gly Asp Val Thr Val Ala Pro Ser Asn Phe Ala Asn Gly
Ile Ala Glu 20 25 30Trp Ile Ser Ser Asn Ser Arg Ser Gln Ala Tyr Lys
Val Thr Cys Ser 35 40 45Val Arg Gln Ser Ser Ala Gln Asn Arg Lys Tyr
Thr Ile Lys Val Glu 50 55 60Val Pro Lys Gly Ala Trp Arg Ser Tyr Leu
Asn Met Glu Leu Thr Ile65 70 75 80Pro Ile Phe Ala Thr Asn Ser Asp
Cys Glu Leu Ile Val Lys Ala Met 85 90 95Gln Gly Leu Leu Lys Asp Gly
Asn Pro Ile Pro Ser Ala Ile Ala Ala 100 105 110Asn Ser Gly Ile Tyr
Gly Gly Ser Gly Ser Gly Ala Gly Ser Gly Ser 115 120 125Pro Ala Gly
Gly Gly Ala Pro Gly Ser Gly Gly Gly Ser Lys Ala Glu 130 135 140Arg
Met Gly Phe Thr Glu Val Thr Pro Val Thr Gly Ala Ser Leu Arg145 150
155 160Arg Thr Met Leu Leu Leu Ser Arg Ser Pro Glu Ala Gln Pro Lys
Thr 165 170 175Leu Pro Leu Thr Gly Ser Thr Phe His Asp Gln Ile Ala
Met Leu Ser 180 185 190His Arg Cys Phe Asn Thr Leu Thr Asn Ser Phe
Gln Pro Ser Leu Leu 195 200 205Gly Arg Lys Ile Leu Ala Ala Ile Ile
Met Lys Lys Asp Ser Glu Asp 210 215 220Met Gly Val Val Val Ser Leu
Gly Thr Gly Asn Arg Cys Val Lys Gly225 230 235 240Asp Ser Leu Ser
Leu Lys Gly Glu Thr Val Asn Asp Cys His Ala Glu 245 250 255Ile Ile
Ser Arg Arg Gly Phe Ile Arg Phe Leu Tyr Ser Glu Leu Met 260 265
270Lys Tyr Asn Ser Gln Thr Ala Lys Asp Ser Ile Phe Glu Pro Ala Lys
275 280 285Gly Gly Glu Lys Leu Gln Ile Lys Lys Thr Val Ser Phe His
Leu Tyr 290 295 300Ile Ser Thr Ala Pro Cys Gly Asp Gly Ala Leu Phe
Asp Lys Ser Cys305 310 315 320Ser Asp Arg Ala Met Glu Ser Thr Glu
Ser Arg His Tyr Pro Val Phe 325 330 335Glu Asn Pro Lys Gln Gly Lys
Leu Arg Thr Lys Val Glu Asn Gly Glu 340 345 350Gly Thr Ile Pro Val
Glu Ser Ser Asp Ile Val Pro Thr Trp Asp Gly 355 360 365Ile Arg Leu
Gly Glu Arg Leu Arg Thr Met Ser Cys Ser Asp Lys Ile 370 375 380Leu
Arg Trp Asn Val Leu Gly Leu Gln Gly Ala Leu Leu Thr His Phe385 390
395 400Leu Gln Pro Ile Tyr Leu Lys Ser Val Thr Leu Gly Tyr Leu Phe
Ser 405 410 415Gln Gly His Leu Thr Arg Ala Ile Cys Cys Arg Val Thr
Arg Asp Gly 420 425 430Ser Ala Phe Glu Asp Gly Leu Arg His Pro Phe
Ile Val Asn His Pro 435 440 445Lys Val Gly Arg Val Ser Ile Tyr Asp
Ser Lys Arg Gln Ser Gly Lys 450 455 460Thr Lys Glu Thr Ser Val Asn
Trp Cys Leu Ala Asp Gly Tyr Asp Leu465 470 475 480Glu Ile Leu Asp
Gly Thr Arg Gly Thr Val Asp Gly Pro Arg Asn Glu 485 490 495Leu Ser
Arg Val Ser Lys Lys Asn Ile Phe Leu Leu Phe Lys Lys Leu 500 505
510Cys Ser Phe Arg Tyr Arg Arg Asp Leu Leu Arg Leu Ser Tyr Gly Glu
515 520 525Ala Lys Lys Ala Ala Arg Asp Tyr Glu Thr Ala Lys Asn Tyr
Phe Lys 530 535 540Lys Gly Leu Lys Asp Met Gly Tyr Gly Asn Trp Ile
Ser Lys Pro Gln545 550 555 560Glu Glu Lys Asn Phe Tyr Leu Cys Pro
Val Gly Ser Gly Ser Gly Ser 565 570 575Gly Pro Lys Lys Arg Lys Val
Ala Ala 580 58574560PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptideMISC_FEATURE(560)..(560)May or may
not be present 74Met Gly Pro Lys Lys Lys Arg Lys Val Ala Ala Gly
Ser Gly Ser Gly1 5 10 15Ser Met Ala Ser Asn Phe Thr Gln Phe Val Leu
Val Asp Asn Gly Gly 20 25 30Thr Gly Asp Val Thr Val Ala Pro Ser Asn
Phe Ala Asn Gly Val Ala 35 40 45Glu Trp Ile Ser Ser Asn Ser Arg Ser
Gln Ala Tyr Lys Val Thr Cys 50 55 60Ser Val Arg Gln Ser Ser Ala Gln
Lys Arg Lys Tyr Thr Ile Lys Val65 70 75 80Glu Val Pro Lys Val Ala
Thr Gln Thr Val Gly Gly Val Glu Leu Pro 85 90 95Val Ala Ala Trp Arg
Ser Tyr Leu Asn Met Glu Leu Thr Ile Pro Ile 100 105 110Phe Ala Thr
Asn Ser Asp Cys Glu Leu Ile Val Lys Ala Met Gln Gly 115 120 125Leu
Leu Lys Asp Gly Asn Pro Ile Pro Ser Ala Ile Ala Ala Asn Ser 130 135
140Gly Ile Tyr Gly Gly Ser Gly Gly Ser Gly Gly Ser Met Leu His
Leu145 150 155 160Asp Gln Thr Pro Ser Arg Gln Pro Ile Pro Ser Glu
Gly Leu Gln Leu 165 170 175His Leu Pro Gln Val Leu Ala Asp Ala Val
Ser Arg Leu Val Leu Gly 180 185 190Lys Phe Gly Asp Leu Thr Asp Asn
Phe Ser Ser Pro His Ala Arg Arg 195 200 205Lys Val Leu Ala Gly Val
Val Met Thr Thr Gly Thr Asp Val Lys Asp 210 215 220Ala Lys Val Ile
Ser Val Ser Thr Gly Thr Lys Cys Ile Asn Gly Glu225 230 235 240Tyr
Met Ser Asp Arg Gly Leu Ala Leu Asn Asp Cys His Ala Glu Ile 245 250
255Ile Ser Arg Arg Ser Leu Leu Arg Phe Leu Tyr Thr Gln Leu Glu Leu
260 265 270Tyr Leu Asn Asn Lys Asp Asp Gln Lys Arg Ser Ile Phe Gln
Lys Ser 275 280 285Glu Arg Gly Gly Phe Arg Leu Lys Glu Asn Val Gln
Phe His Leu Tyr 290 295 300Ile Ser Thr Ser Pro Cys Gly Asp Ala Arg
Ile Phe Ser Pro His Glu305
310 315 320Pro Ile Leu Glu Glu Pro Ala Asp Arg His Pro Asn Arg Lys
Ala Arg 325 330 335Gly Gln Leu Arg Thr Lys Ile Glu Ser Gly Glu Gly
Thr Ile Pro Val 340 345 350Arg Ser Asn Ala Ser Ile Gln Thr Trp Asp
Gly Val Leu Gln Gly Glu 355 360 365Arg Leu Leu Thr Met Ser Cys Ser
Asp Lys Ile Ala Arg Trp Asn Val 370 375 380Val Gly Ile Gln Gly Ser
Leu Leu Ser Ile Phe Val Glu Pro Ile Tyr385 390 395 400Phe Ser Ser
Ile Ile Leu Gly Ser Leu Tyr His Gly Asp His Leu Ser 405 410 415Arg
Ala Met Tyr Gln Arg Ile Ser Asn Ile Glu Asp Leu Pro Pro Leu 420 425
430Tyr Thr Leu Asn Lys Pro Leu Leu Ser Gly Ile Ser Asn Ala Glu Ala
435 440 445Arg Gln Pro Gly Lys Ala Pro Asn Phe Ser Val Asn Trp Thr
Val Gly 450 455 460Asp Ser Ala Ile Glu Val Ile Asn Ala Thr Thr Gly
Lys Asp Glu Leu465 470 475 480Gly Arg Ala Ser Arg Leu Cys Lys His
Ala Leu Tyr Cys Arg Trp Met 485 490 495Arg Val His Gly Lys Val Pro
Ser His Leu Leu Arg Ser Lys Ile Thr 500 505 510Lys Pro Asn Val Tyr
His Glu Ser Lys Leu Ala Ala Lys Glu Tyr Gln 515 520 525Ala Ala Lys
Ala Arg Leu Phe Thr Ala Phe Ile Lys Ala Gly Leu Gly 530 535 540Ala
Trp Val Glu Lys Pro Thr Glu Gln Asp Gln Phe Ser Leu Thr Pro545 550
555 56075492PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptideMISC_FEATURE(491)..(492)May or may
not be present 75Met Gly Asn Ala Arg Thr Arg Arg Arg Glu Arg Arg
Ala Glu Lys Gln1 5 10 15Ala Gln Trp Lys Ala Ala Asn Gly Gly Gly Gly
Thr Ser Gly Ser Gly 20 25 30Ser Gly Ser Pro Ala Gly Gly Gly Ala Pro
Gly Ser Gly Gly Gly Ser 35 40 45Lys Ala Glu Arg Met Gly Phe Thr Glu
Val Thr Pro Val Thr Gly Ala 50 55 60Ser Leu Arg Arg Thr Met Leu Leu
Leu Ser Arg Ser Pro Glu Ala Gln65 70 75 80Pro Lys Thr Leu Pro Leu
Thr Gly Ser Thr Phe His Asp Gln Ile Ala 85 90 95Met Leu Ser His Arg
Cys Phe Asn Thr Leu Thr Asn Ser Phe Gln Pro 100 105 110Ser Leu Leu
Gly Arg Lys Ile Leu Ala Ala Ile Ile Met Lys Lys Asp 115 120 125Ser
Glu Asp Met Gly Val Val Val Ser Leu Gly Thr Gly Asn Arg Cys 130 135
140Val Lys Gly Asp Ser Leu Ser Leu Lys Gly Glu Thr Val Asn Asp
Cys145 150 155 160His Ala Glu Ile Ile Ser Arg Arg Gly Phe Ile Arg
Phe Leu Tyr Ser 165 170 175Glu Leu Met Lys Tyr Asn Ser Gln Thr Ala
Lys Asp Ser Ile Phe Glu 180 185 190Pro Ala Lys Gly Gly Glu Lys Leu
Gln Ile Lys Lys Thr Val Ser Phe 195 200 205His Leu Tyr Ile Ser Thr
Ala Pro Cys Gly Asp Gly Ala Leu Phe Asp 210 215 220Lys Ser Cys Ser
Asp Arg Ala Met Glu Ser Thr Glu Ser Arg His Tyr225 230 235 240Pro
Val Phe Glu Asn Pro Lys Gln Gly Lys Leu Arg Thr Lys Val Glu 245 250
255Asn Gly Glu Gly Thr Ile Pro Val Glu Ser Ser Asp Ile Val Pro Thr
260 265 270Trp Asp Gly Ile Arg Leu Gly Glu Arg Leu Arg Thr Met Ser
Cys Ser 275 280 285Asp Lys Ile Leu Arg Trp Asn Val Leu Gly Leu Gln
Gly Ala Leu Leu 290 295 300Thr His Phe Leu Gln Pro Ile Tyr Leu Lys
Ser Val Thr Leu Gly Tyr305 310 315 320Leu Phe Ser Gln Gly His Leu
Thr Arg Ala Ile Cys Cys Arg Val Thr 325 330 335Arg Asp Gly Ser Ala
Phe Glu Asp Gly Leu Arg His Pro Phe Ile Val 340 345 350Asn His Pro
Lys Val Gly Arg Val Ser Ile Tyr Asp Ser Lys Arg Gln 355 360 365Ser
Gly Lys Thr Lys Glu Thr Ser Val Asn Trp Cys Leu Ala Asp Gly 370 375
380Tyr Asp Leu Glu Ile Leu Asp Gly Thr Arg Gly Thr Val Asp Gly
Pro385 390 395 400Arg Asn Glu Leu Ser Arg Val Ser Lys Lys Asn Ile
Phe Leu Leu Phe 405 410 415Lys Lys Leu Cys Ser Phe Arg Tyr Arg Arg
Asp Leu Leu Arg Leu Ser 420 425 430Tyr Gly Glu Ala Lys Lys Ala Ala
Arg Asp Tyr Glu Thr Ala Lys Asn 435 440 445Tyr Phe Lys Lys Gly Leu
Lys Asp Met Gly Tyr Gly Asn Trp Ile Ser 450 455 460Lys Pro Gln Glu
Glu Lys Asn Phe Tyr Leu Cys Pro Val Gly Ser Gly465 470 475 480Ser
Gly Ser Gly Pro Lys Lys Arg Lys Val Ala Ala 485
49076469PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptideMISC_FEATURE(1)..(2)May or may not be
presentMISC_FEATURE(469)..(469)May or may not be present 76Met Gly
Pro Lys Lys Lys Arg Lys Val Ala Ala Gly Ser Gly Ser Gly1 5 10 15Ser
Met Gly Asn Ala Arg Thr Arg Arg Arg Glu Arg Arg Ala Glu Lys 20 25
30Gln Ala Gln Trp Lys Ala Ala Asn Gly Gly Gly Gly Thr Ser Gly Ser
35 40 45Gly Ser Gly Ser Pro Ala Gly Gly Gly Ala Pro Gly Ser Gly Gly
Gly 50 55 60Ser Met Leu His Leu Asp Gln Thr Pro Ser Arg Gln Pro Ile
Pro Ser65 70 75 80Glu Gly Leu Gln Leu His Leu Pro Gln Val Leu Ala
Asp Ala Val Ser 85 90 95Arg Leu Val Leu Gly Lys Phe Gly Asp Leu Thr
Asp Asn Phe Ser Ser 100 105 110Pro His Ala Arg Arg Lys Val Leu Ala
Gly Val Val Met Thr Thr Gly 115 120 125Thr Asp Val Lys Asp Ala Lys
Val Ile Ser Val Ser Thr Gly Thr Lys 130 135 140Cys Ile Asn Gly Glu
Tyr Met Ser Asp Arg Gly Leu Ala Leu Asn Asp145 150 155 160Cys His
Ala Glu Ile Ile Ser Arg Arg Ser Leu Leu Arg Phe Leu Tyr 165 170
175Thr Gln Leu Glu Leu Tyr Leu Asn Asn Lys Asp Asp Gln Lys Arg Ser
180 185 190Ile Phe Gln Lys Ser Glu Arg Gly Gly Phe Arg Leu Lys Glu
Asn Val 195 200 205Gln Phe His Leu Tyr Ile Ser Thr Ser Pro Cys Gly
Asp Ala Arg Ile 210 215 220Phe Ser Pro His Glu Pro Ile Leu Glu Glu
Pro Ala Asp Arg His Pro225 230 235 240Asn Arg Lys Ala Arg Gly Gln
Leu Arg Thr Lys Ile Glu Ser Gly Glu 245 250 255Gly Thr Ile Pro Val
Arg Ser Asn Ala Ser Ile Gln Thr Trp Asp Gly 260 265 270Val Leu Gln
Gly Glu Arg Leu Leu Thr Met Ser Cys Ser Asp Lys Ile 275 280 285Ala
Arg Trp Asn Val Val Gly Ile Gln Gly Ser Leu Leu Ser Ile Phe 290 295
300Val Glu Pro Ile Tyr Phe Ser Ser Ile Ile Leu Gly Ser Leu Tyr
His305 310 315 320Gly Asp His Leu Ser Arg Ala Met Tyr Gln Arg Ile
Ser Asn Ile Glu 325 330 335Asp Leu Pro Pro Leu Tyr Thr Leu Asn Lys
Pro Leu Leu Ser Gly Ile 340 345 350Ser Asn Ala Glu Ala Arg Gln Pro
Gly Lys Ala Pro Asn Phe Ser Val 355 360 365Asn Trp Thr Val Gly Asp
Ser Ala Ile Glu Val Ile Asn Ala Thr Thr 370 375 380Gly Lys Asp Glu
Leu Gly Arg Ala Ser Arg Leu Cys Lys His Ala Leu385 390 395 400Tyr
Cys Arg Trp Met Arg Val His Gly Lys Val Pro Ser His Leu Leu 405 410
415Arg Ser Lys Ile Thr Lys Pro Asn Val Tyr His Glu Ser Lys Leu Ala
420 425 430Ala Lys Glu Tyr Gln Ala Ala Lys Ala Arg Leu Phe Thr Ala
Phe Ile 435 440 445Lys Ala Gly Leu Gly Ala Trp Val Glu Lys Pro Thr
Glu Gln Asp Gln 450 455 460Phe Ser Leu Thr Pro46577585PRTArtificial
SequenceDescription of Artificial Sequence Synthetic
polypeptideMISC_FEATURE(584)..(585)May or may not be present 77Met
Ala Ser Asn Phe Thr Gln Phe Val Leu Val Asp Asn Gly Gly Thr1 5 10
15Gly Asp Val Thr Val Ala Pro Ser Asn Phe Ala Asn Gly Ile Ala Glu
20 25 30Trp Ile Ser Ser Asn Ser Arg Ser Gln Ala Tyr Lys Val Thr Cys
Ser 35 40 45Val Arg Gln Ser Ser Ala Gln Asn Arg Lys Tyr Thr Ile Lys
Val Glu 50 55 60Val Pro Lys Gly Ala Trp Arg Ser Tyr Leu Asn Met Glu
Leu Thr Ile65 70 75 80Pro Ile Phe Ala Thr Asn Ser Asp Cys Glu Leu
Ile Val Lys Ala Met 85 90 95Gln Gly Leu Leu Lys Asp Gly Asn Pro Ile
Pro Ser Ala Ile Ala Ala 100 105 110Asn Ser Gly Ile Tyr Gly Gly Ser
Gly Ser Gly Ala Gly Ser Gly Ser 115 120 125Pro Ala Gly Gly Gly Ala
Pro Gly Ser Gly Gly Gly Ser Lys Ala Glu 130 135 140Arg Met Gly Phe
Thr Glu Val Thr Pro Val Thr Gly Ala Ser Leu Arg145 150 155 160Arg
Thr Met Leu Leu Leu Ser Arg Ser Pro Glu Ala Gln Pro Lys Thr 165 170
175Leu Pro Leu Thr Gly Ser Thr Phe His Asp Gln Ile Ala Met Leu Ser
180 185 190His Arg Cys Phe Asn Thr Leu Thr Asn Ser Phe Gln Pro Ser
Leu Leu 195 200 205Gly Arg Lys Ile Leu Ala Ala Ile Ile Met Lys Lys
Asp Ser Glu Asp 210 215 220Met Gly Val Val Val Ser Leu Gly Thr Gly
Asn Arg Cys Val Lys Gly225 230 235 240Asp Ser Leu Ser Leu Lys Gly
Glu Thr Val Asn Asp Cys His Ala Glu 245 250 255Ile Ile Ser Arg Arg
Gly Phe Ile Arg Phe Leu Tyr Ser Glu Leu Met 260 265 270Lys Tyr Asn
Ser Gln Thr Ala Lys Asp Ser Ile Phe Glu Pro Ala Lys 275 280 285Gly
Gly Glu Lys Leu Gln Ile Lys Lys Thr Val Ser Phe His Leu Tyr 290 295
300Ile Ser Thr Ala Pro Cys Gly Asp Gly Ala Leu Phe Asp Lys Ser
Cys305 310 315 320Ser Asp Arg Ala Met Glu Ser Thr Glu Ser Arg His
Tyr Pro Val Phe 325 330 335Glu Asn Pro Lys Gln Gly Lys Leu Arg Thr
Lys Val Glu Asn Gly Gln 340 345 350Gly Thr Ile Pro Val Glu Ser Ser
Asp Ile Val Pro Thr Trp Asp Gly 355 360 365Ile Arg Leu Gly Glu Arg
Leu Arg Thr Met Ser Cys Ser Asp Lys Ile 370 375 380Leu Arg Trp Asn
Val Leu Gly Leu Gln Gly Ala Leu Leu Thr His Phe385 390 395 400Leu
Gln Pro Ile Tyr Leu Lys Ser Val Thr Leu Gly Tyr Leu Phe Ser 405 410
415Gln Gly His Leu Thr Arg Ala Ile Cys Cys Arg Val Thr Arg Asp Gly
420 425 430Ser Ala Phe Glu Asp Gly Leu Arg His Pro Phe Ile Val Asn
His Pro 435 440 445Lys Val Gly Arg Val Ser Ile Tyr Asp Ser Lys Arg
Gln Ser Gly Lys 450 455 460Thr Lys Glu Thr Ser Val Asn Trp Cys Leu
Ala Asp Gly Tyr Asp Leu465 470 475 480Glu Ile Leu Asp Gly Thr Arg
Gly Thr Val Asp Gly Pro Arg Asn Glu 485 490 495Leu Ser Arg Val Ser
Lys Lys Asn Ile Phe Leu Leu Phe Lys Lys Leu 500 505 510Cys Ser Phe
Arg Tyr Arg Arg Asp Leu Leu Arg Leu Ser Tyr Gly Glu 515 520 525Ala
Lys Lys Ala Ala Arg Asp Tyr Glu Thr Ala Lys Asn Tyr Phe Lys 530 535
540Lys Gly Leu Lys Asp Met Gly Tyr Gly Asn Trp Ile Ser Lys Pro
Gln545 550 555 560Glu Glu Lys Asn Phe Tyr Leu Cys Pro Val Gly Ser
Gly Ser Gly Ser 565 570 575Gly Pro Lys Lys Arg Lys Val Ala Ala 580
58578560PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptideMISC_FEATURE(1)..(2)May or may not be
presentMISC_FEATURE(560)..(560)May or may not be present 78Met Gly
Pro Lys Lys Lys Arg Lys Val Ala Ala Gly Ser Gly Ser Gly1 5 10 15Ser
Met Ala Ser Asn Phe Thr Gln Phe Val Leu Val Asp Asn Gly Gly 20 25
30Thr Gly Asp Val Thr Val Ala Pro Ser Asn Phe Ala Asn Gly Val Ala
35 40 45Glu Trp Ile Ser Ser Asn Ser Arg Ser Gln Ala Tyr Lys Val Thr
Cys 50 55 60Ser Val Arg Gln Ser Ser Ala Gln Lys Arg Lys Tyr Thr Ile
Lys Val65 70 75 80Glu Val Pro Lys Val Ala Thr Gln Thr Val Gly Gly
Val Glu Leu Pro 85 90 95Val Ala Ala Trp Arg Ser Tyr Leu Asn Met Glu
Leu Thr Ile Pro Ile 100 105 110Phe Ala Thr Asn Ser Asp Cys Glu Leu
Ile Val Lys Ala Met Gln Gly 115 120 125Leu Leu Lys Asp Gly Asn Pro
Ile Pro Ser Ala Ile Ala Ala Asn Ser 130 135 140Gly Ile Tyr Gly Gly
Ser Gly Gly Ser Gly Gly Ser Met Leu His Leu145 150 155 160Asp Gln
Thr Pro Ser Arg Gln Pro Ile Pro Ser Glu Gly Leu Gln Leu 165 170
175His Leu Pro Gln Val Leu Ala Asp Ala Val Ser Arg Leu Val Leu Gly
180 185 190Lys Phe Gly Asp Leu Thr Asp Asn Phe Ser Ser Pro His Ala
Arg Arg 195 200 205Lys Val Leu Ala Gly Val Val Met Thr Thr Gly Thr
Asp Val Lys Asp 210 215 220Ala Lys Val Ile Ser Val Ser Thr Gly Thr
Lys Cys Ile Asn Gly Glu225 230 235 240Tyr Met Ser Asp Arg Gly Leu
Ala Leu Asn Asp Cys His Ala Glu Ile 245 250 255Ile Ser Arg Arg Ser
Leu Leu Arg Phe Leu Tyr Thr Gln Leu Glu Leu 260 265 270Tyr Leu Asn
Asn Lys Asp Asp Gln Lys Arg Ser Ile Phe Gln Lys Ser 275 280 285Glu
Arg Gly Gly Phe Arg Leu Lys Glu Asn Val Gln Phe His Leu Tyr 290 295
300Ile Ser Thr Ser Pro Cys Gly Asp Ala Arg Ile Phe Ser Pro His
Glu305 310 315 320Pro Ile Leu Glu Glu Pro Ala Asp Arg His Pro Asn
Arg Lys Ala Arg 325 330 335Gly Gln Leu Arg Thr Lys Ile Glu Ser Gly
Gln Gly Thr Ile Pro Val 340 345 350Arg Ser Asn Ala Ser Ile Gln Thr
Trp Asp Gly Val Leu Gln Gly Glu 355 360 365Arg Leu Leu Thr Met Ser
Cys Ser Asp Lys Ile Ala Arg Trp Asn Val 370 375 380Val Gly Ile Gln
Gly Ser Leu Leu Ser Ile Phe Val Glu Pro Ile Tyr385 390 395 400Phe
Ser Ser Ile Ile Leu Gly Ser Leu Tyr His Gly Asp His Leu Ser 405 410
415Arg Ala Met Tyr Gln Arg Ile Ser Asn Ile Glu Asp Leu Pro Pro Leu
420 425 430Tyr Thr Leu Asn Lys Pro Leu Leu Ser Gly Ile Ser Asn Ala
Glu Ala 435 440 445Arg Gln Pro Gly Lys Ala Pro Asn Phe Ser Val Asn
Trp Thr Val Gly 450 455 460Asp Ser Ala Ile Glu Val Ile Asn Ala Thr
Thr Gly Lys Asp Glu Leu465 470 475 480Gly Arg Ala Ser Arg Leu Cys
Lys His Ala Leu Tyr Cys Arg Trp Met 485 490 495Arg Val His Gly Lys
Val Pro Ser His Leu Leu Arg Ser Lys Ile Thr 500 505 510Lys Pro Asn
Val Tyr His Glu Ser Lys Leu Ala Ala Lys Glu Tyr Gln 515 520 525Ala
Ala Lys Ala Arg Leu Phe Thr Ala Phe Ile Lys Ala Gly Leu Gly 530 535
540Ala Trp Val Glu Lys Pro Thr Glu Gln Asp Gln Phe Ser Leu Thr
Pro545 550 555 56079492PRTArtificial SequenceDescription of
Artificial Sequence Synthetic
polypeptideMISC_FEATURE(491)..(492)May or may not be present 79Met
Gly Asn Ala Arg Thr Arg Arg Arg Glu Arg Arg
Ala Glu Lys Gln1 5 10 15Ala Gln Trp Lys Ala Ala Asn Gly Gly Gly Gly
Thr Ser Gly Ser Gly 20 25 30Ser Gly Ser Pro Ala Gly Gly Gly Ala Pro
Gly Ser Gly Gly Gly Ser 35 40 45Lys Ala Glu Arg Met Gly Phe Thr Glu
Val Thr Pro Val Thr Gly Ala 50 55 60Ser Leu Arg Arg Thr Met Leu Leu
Leu Ser Arg Ser Pro Glu Ala Gln65 70 75 80Pro Lys Thr Leu Pro Leu
Thr Gly Ser Thr Phe His Asp Gln Ile Ala 85 90 95Met Leu Ser His Arg
Cys Phe Asn Thr Leu Thr Asn Ser Phe Gln Pro 100 105 110Ser Leu Leu
Gly Arg Lys Ile Leu Ala Ala Ile Ile Met Lys Lys Asp 115 120 125Ser
Glu Asp Met Gly Val Val Val Ser Leu Gly Thr Gly Asn Arg Cys 130 135
140Val Lys Gly Asp Ser Leu Ser Leu Lys Gly Glu Thr Val Asn Asp
Cys145 150 155 160His Ala Glu Ile Ile Ser Arg Arg Gly Phe Ile Arg
Phe Leu Tyr Ser 165 170 175Glu Leu Met Lys Tyr Asn Ser Gln Thr Ala
Lys Asp Ser Ile Phe Glu 180 185 190Pro Ala Lys Gly Gly Glu Lys Leu
Gln Ile Lys Lys Thr Val Ser Phe 195 200 205His Leu Tyr Ile Ser Thr
Ala Pro Cys Gly Asp Gly Ala Leu Phe Asp 210 215 220Lys Ser Cys Ser
Asp Arg Ala Met Glu Ser Thr Glu Ser Arg His Tyr225 230 235 240Pro
Val Phe Glu Asn Pro Lys Gln Gly Lys Leu Arg Thr Lys Val Glu 245 250
255Asn Gly Gln Gly Thr Ile Pro Val Glu Ser Ser Asp Ile Val Pro Thr
260 265 270Trp Asp Gly Ile Arg Leu Gly Glu Arg Leu Arg Thr Met Ser
Cys Ser 275 280 285Asp Lys Ile Leu Arg Trp Asn Val Leu Gly Leu Gln
Gly Ala Leu Leu 290 295 300Thr His Phe Leu Gln Pro Ile Tyr Leu Lys
Ser Val Thr Leu Gly Tyr305 310 315 320Leu Phe Ser Gln Gly His Leu
Thr Arg Ala Ile Cys Cys Arg Val Thr 325 330 335Arg Asp Gly Ser Ala
Phe Glu Asp Gly Leu Arg His Pro Phe Ile Val 340 345 350Asn His Pro
Lys Val Gly Arg Val Ser Ile Tyr Asp Ser Lys Arg Gln 355 360 365Ser
Gly Lys Thr Lys Glu Thr Ser Val Asn Trp Cys Leu Ala Asp Gly 370 375
380Tyr Asp Leu Glu Ile Leu Asp Gly Thr Arg Gly Thr Val Asp Gly
Pro385 390 395 400Arg Asn Glu Leu Ser Arg Val Ser Lys Lys Asn Ile
Phe Leu Leu Phe 405 410 415Lys Lys Leu Cys Ser Phe Arg Tyr Arg Arg
Asp Leu Leu Arg Leu Ser 420 425 430Tyr Gly Glu Ala Lys Lys Ala Ala
Arg Asp Tyr Glu Thr Ala Lys Asn 435 440 445Tyr Phe Lys Lys Gly Leu
Lys Asp Met Gly Tyr Gly Asn Trp Ile Ser 450 455 460Lys Pro Gln Glu
Glu Lys Asn Phe Tyr Leu Cys Pro Val Gly Ser Gly465 470 475 480Ser
Gly Ser Gly Pro Lys Lys Arg Lys Val Ala Ala 485
49080469PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptideMISC_FEATURE(1)..(2)May or may not be
presentMISC_FEATURE(469)..(469)May or may not be present 80Met Gly
Pro Lys Lys Lys Arg Lys Val Ala Ala Gly Ser Gly Ser Gly1 5 10 15Ser
Met Gly Asn Ala Arg Thr Arg Arg Arg Glu Arg Arg Ala Glu Lys 20 25
30Gln Ala Gln Trp Lys Ala Ala Asn Gly Gly Gly Gly Thr Ser Gly Ser
35 40 45Gly Ser Gly Ser Pro Ala Gly Gly Gly Ala Pro Gly Ser Gly Gly
Gly 50 55 60Ser Met Leu His Leu Asp Gln Thr Pro Ser Arg Gln Pro Ile
Pro Ser65 70 75 80Glu Gly Leu Gln Leu His Leu Pro Gln Val Leu Ala
Asp Ala Val Ser 85 90 95Arg Leu Val Leu Gly Lys Phe Gly Asp Leu Thr
Asp Asn Phe Ser Ser 100 105 110Pro His Ala Arg Arg Lys Val Leu Ala
Gly Val Val Met Thr Thr Gly 115 120 125Thr Asp Val Lys Asp Ala Lys
Val Ile Ser Val Ser Thr Gly Thr Lys 130 135 140Cys Ile Asn Gly Glu
Tyr Met Ser Asp Arg Gly Leu Ala Leu Asn Asp145 150 155 160Cys His
Ala Glu Ile Ile Ser Arg Arg Ser Leu Leu Arg Phe Leu Tyr 165 170
175Thr Gln Leu Glu Leu Tyr Leu Asn Asn Lys Asp Asp Gln Lys Arg Ser
180 185 190Ile Phe Gln Lys Ser Glu Arg Gly Gly Phe Arg Leu Lys Glu
Asn Val 195 200 205Gln Phe His Leu Tyr Ile Ser Thr Ser Pro Cys Gly
Asp Ala Arg Ile 210 215 220Phe Ser Pro His Glu Pro Ile Leu Glu Glu
Pro Ala Asp Arg His Pro225 230 235 240Asn Arg Lys Ala Arg Gly Gln
Leu Arg Thr Lys Ile Glu Ser Gly Gln 245 250 255Gly Thr Ile Pro Val
Arg Ser Asn Ala Ser Ile Gln Thr Trp Asp Gly 260 265 270Val Leu Gln
Gly Glu Arg Leu Leu Thr Met Ser Cys Ser Asp Lys Ile 275 280 285Ala
Arg Trp Asn Val Val Gly Ile Gln Gly Ser Leu Leu Ser Ile Phe 290 295
300Val Glu Pro Ile Tyr Phe Ser Ser Ile Ile Leu Gly Ser Leu Tyr
His305 310 315 320Gly Asp His Leu Ser Arg Ala Met Tyr Gln Arg Ile
Ser Asn Ile Glu 325 330 335Asp Leu Pro Pro Leu Tyr Thr Leu Asn Lys
Pro Leu Leu Ser Gly Ile 340 345 350Ser Asn Ala Glu Ala Arg Gln Pro
Gly Lys Ala Pro Asn Phe Ser Val 355 360 365Asn Trp Thr Val Gly Asp
Ser Ala Ile Glu Val Ile Asn Ala Thr Thr 370 375 380Gly Lys Asp Glu
Leu Gly Arg Ala Ser Arg Leu Cys Lys His Ala Leu385 390 395 400Tyr
Cys Arg Trp Met Arg Val His Gly Lys Val Pro Ser His Leu Leu 405 410
415Arg Ser Lys Ile Thr Lys Pro Asn Val Tyr His Glu Ser Lys Leu Ala
420 425 430Ala Lys Glu Tyr Gln Ala Ala Lys Ala Arg Leu Phe Thr Ala
Phe Ile 435 440 445Lys Ala Gly Leu Gly Ala Trp Val Glu Lys Pro Thr
Glu Gln Asp Gln 450 455 460Phe Ser Leu Thr Pro46581392PRTArtificial
SequenceDescription of Artificial Sequence Synthetic
polypeptideMISC_FEATURE(1)..(2)May or may not be present 81Met Gly
Pro Lys Lys Lys Arg Lys Val Ala Ala Gly Ser Gly Ser Gly1 5 10 15Ser
Met Ala Ser Asn Phe Thr Gln Phe Val Leu Val Asp Asn Gly Gly 20 25
30Thr Gly Asp Val Thr Val Ala Pro Ser Asn Phe Ala Asn Gly Val Ala
35 40 45Glu Trp Ile Ser Ser Asn Ser Arg Ser Gln Ala Tyr Lys Val Thr
Cys 50 55 60Ser Val Arg Gln Ser Ser Ala Gln Lys Arg Lys Tyr Thr Ile
Lys Val65 70 75 80Glu Val Pro Lys Val Ala Thr Gln Thr Val Gly Gly
Val Glu Leu Pro 85 90 95Val Ala Ala Trp Arg Ser Tyr Leu Asn Met Glu
Leu Thr Ile Pro Ile 100 105 110Phe Ala Thr Asn Ser Asp Cys Glu Leu
Ile Val Lys Ala Met Gln Gly 115 120 125Leu Leu Lys Asp Gly Asn Pro
Ile Pro Ser Ala Ile Ala Ala Asn Ser 130 135 140Gly Ile Tyr Gly Gly
Ser Gly Gly Ser Gly Gly Ser Met Thr Ser Glu145 150 155 160Lys Gly
Pro Ser Thr Gly Asp Pro Thr Leu Arg Arg Arg Ile Glu Pro 165 170
175Trp Glu Phe Asp Val Phe Tyr Asp Pro Arg Glu Leu Arg Lys Glu Ala
180 185 190Cys Leu Leu Tyr Glu Ile Lys Trp Gly Met Ser Arg Lys Ile
Trp Arg 195 200 205Ser Ser Gly Lys Asn Thr Thr Asn His Val Glu Val
Asn Phe Ile Lys 210 215 220Lys Phe Thr Ser Glu Arg Asp Phe His Pro
Ser Met Ser Cys Ser Ile225 230 235 240Thr Trp Phe Leu Ser Trp Ser
Pro Cys Trp Glu Cys Ser Gln Ala Ile 245 250 255Arg Glu Phe Leu Ser
Arg His Pro Gly Val Thr Leu Val Ile Tyr Val 260 265 270Ala Arg Leu
Phe Trp His Met Asp Gln Gln Asn Arg Gln Gly Leu Arg 275 280 285Asp
Leu Val Asn Ser Gly Val Thr Ile Gln Ile Met Arg Ala Ser Glu 290 295
300Tyr Tyr His Cys Trp Arg Asn Phe Val Asn Tyr Pro Pro Gly Asp
Glu305 310 315 320Ala His Trp Pro Gln Tyr Pro Pro Leu Trp Met Met
Leu Tyr Ala Leu 325 330 335Glu Leu His Cys Ile Ile Leu Ser Leu Pro
Pro Cys Leu Lys Ile Ser 340 345 350Arg Arg Trp Gln Asn His Leu Thr
Phe Phe Arg Leu His Leu Gln Asn 355 360 365Cys His Tyr Gln Thr Ile
Pro Pro His Ile Leu Leu Ala Thr Gly Leu 370 375 380Ile His Pro Ser
Val Ala Trp Arg385 39082385PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptideMISC_FEATURE(1)..(2)May or
may not be present 82Met Gly Pro Lys Lys Lys Arg Lys Val Ala Ala
Gly Ser Gly Ser Gly1 5 10 15Ser Met Ala Ser Asn Phe Thr Gln Phe Val
Leu Val Asp Asn Gly Gly 20 25 30Thr Gly Asp Val Thr Val Ala Pro Ser
Asn Phe Ala Asn Gly Val Ala 35 40 45Glu Trp Ile Ser Ser Asn Ser Arg
Ser Gln Ala Tyr Lys Val Thr Cys 50 55 60Ser Val Arg Gln Ser Ser Ala
Gln Lys Arg Lys Tyr Thr Ile Lys Val65 70 75 80Glu Val Pro Lys Val
Ala Thr Gln Thr Val Gly Gly Val Glu Leu Pro 85 90 95Val Ala Ala Trp
Arg Ser Tyr Leu Asn Met Glu Leu Thr Ile Pro Ile 100 105 110Phe Ala
Thr Asn Ser Asp Cys Glu Leu Ile Val Lys Ala Met Gln Gly 115 120
125Leu Leu Lys Asp Gly Asn Pro Ile Pro Ser Ala Ile Ala Ala Asn Ser
130 135 140Gly Ile Tyr Gly Gly Ser Gly Gly Ser Gly Gly Ser Met Ser
Ser Glu145 150 155 160Thr Gly Pro Val Ala Val Asp Pro Thr Leu Arg
Arg Arg Ile Glu Pro 165 170 175His Glu Phe Glu Val Phe Phe Asp Pro
Arg Glu Leu Arg Lys Glu Thr 180 185 190Cys Leu Leu Tyr Glu Ile Asn
Trp Gly Gly Arg His Ser Ile Trp Arg 195 200 205His Thr Ser Gln Asn
Thr Asn Lys His Val Glu Val Asn Phe Ile Glu 210 215 220Lys Phe Thr
Thr Glu Arg Tyr Phe Cys Pro Asn Thr Arg Cys Ser Ile225 230 235
240Thr Trp Phe Leu Ser Trp Ser Pro Cys Gly Glu Cys Ser Arg Ala Ile
245 250 255Thr Glu Phe Leu Ser Arg Tyr Pro His Val Thr Leu Phe Ile
Tyr Ile 260 265 270Ala Arg Leu Tyr His His Ala Asp Pro Arg Asn Arg
Gln Gly Leu Arg 275 280 285Asp Leu Ile Ser Ser Gly Val Thr Ile Gln
Ile Met Thr Glu Gln Glu 290 295 300Ser Gly Tyr Cys Trp Arg Asn Phe
Val Asn Tyr Ser Pro Ser Asn Glu305 310 315 320Ala His Trp Pro Arg
Tyr Pro His Leu Trp Val Arg Leu Tyr Val Leu 325 330 335Glu Leu Tyr
Cys Ile Ile Leu Gly Leu Pro Pro Cys Leu Asn Ile Leu 340 345 350Arg
Arg Lys Gln Pro Gln Leu Thr Phe Phe Thr Ile Ala Leu Gln Ser 355 360
365Cys His Tyr Gln Arg Leu Pro Pro His Ile Leu Trp Ala Thr Gly Leu
370 375 380Lys38583536PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 83Met Asp Ile Glu Asp Glu
Glu Asn Met Ser Ser Ser Ser Thr Asp Val1 5 10 15Lys Glu Asn Arg Asn
Leu Asp Asn Val Ser Pro Lys Asp Gly Ser Thr 20 25 30Pro Gly Pro Gly
Glu Gly Ser Gln Leu Ser Asn Gly Gly Gly Gly Gly 35 40 45Pro Gly Arg
Lys Arg Pro Leu Glu Glu Gly Ser Asn Gly His Ser Lys 50 55 60Tyr Arg
Leu Lys Lys Arg Arg Lys Thr Pro Gly Pro Val Leu Pro Lys65 70 75
80Asn Ala Leu Met Gln Leu Asn Glu Ile Lys Pro Gly Leu Gln Tyr Thr
85 90 95Leu Leu Ser Gln Thr Gly Pro Val His Ala Pro Leu Phe Val Met
Ser 100 105 110Val Glu Val Asn Gly Gln Val Phe Glu Gly Ser Gly Pro
Thr Lys Lys 115 120 125Lys Ala Lys Leu His Ala Ala Glu Lys Ala Leu
Arg Ser Phe Val Gln 130 135 140Phe Pro Asn Ala Ser Glu Ala His Leu
Ala Met Gly Arg Thr Leu Ser145 150 155 160Val Asn Thr Asp Phe Thr
Ser Asp Gln Ala Asp Phe Pro Asp Thr Leu 165 170 175Phe Asn Gly Phe
Glu Thr Pro Asp Lys Ala Glu Pro Pro Phe Tyr Val 180 185 190Gly Ser
Asn Gly Asp Asp Ser Phe Ser Ser Ser Gly Asp Leu Ser Leu 195 200
205Ser Ala Ser Pro Val Pro Ala Ser Leu Ala Gln Pro Pro Leu Pro Val
210 215 220Leu Pro Pro Phe Pro Pro Pro Ser Gly Lys Asn Pro Val Met
Ile Leu225 230 235 240Asn Glu Leu Arg Pro Gly Leu Lys Tyr Asp Phe
Leu Ser Glu Ser Gly 245 250 255Glu Ser His Ala Lys Ser Phe Val Met
Ser Val Val Val Asp Gly Gln 260 265 270Phe Phe Glu Gly Ser Gly Arg
Asn Lys Lys Leu Ala Lys Ala Arg Ala 275 280 285Ala Gln Ser Ala Leu
Ala Ala Ile Phe Asn Gly Gly Ser Gly Gly Ser 290 295 300Gly Gly Ser
Met Ser Ser Glu Thr Gly Pro Val Ala Val Asp Pro Thr305 310 315
320Leu Arg Arg Arg Ile Glu Pro His Glu Phe Glu Val Phe Phe Asp Pro
325 330 335Arg Glu Leu Arg Lys Glu Thr Cys Leu Leu Tyr Glu Ile Asn
Trp Gly 340 345 350Gly Arg His Ser Ile Trp Arg His Thr Ser Gln Asn
Thr Asn Lys His 355 360 365Val Glu Val Asn Phe Ile Glu Lys Phe Thr
Thr Glu Arg Tyr Phe Cys 370 375 380Pro Asn Thr Arg Cys Ser Ile Thr
Trp Phe Leu Ser Trp Ser Pro Cys385 390 395 400Gly Glu Cys Ser Arg
Ala Ile Thr Glu Phe Leu Ser Arg Tyr Pro His 405 410 415Val Thr Leu
Phe Ile Tyr Ile Ala Arg Leu Tyr His His Ala Asp Pro 420 425 430Arg
Asn Arg Gln Gly Leu Arg Asp Leu Ile Ser Ser Gly Val Thr Ile 435 440
445Gln Ile Met Thr Glu Gln Glu Ser Gly Tyr Cys Trp Arg Asn Phe Val
450 455 460Asn Tyr Ser Pro Ser Asn Glu Ala His Trp Pro Arg Tyr Pro
His Leu465 470 475 480Trp Val Arg Leu Tyr Val Leu Glu Leu Tyr Cys
Ile Ile Leu Gly Leu 485 490 495Pro Pro Cys Leu Asn Ile Leu Arg Arg
Lys Gln Pro Gln Leu Thr Phe 500 505 510Phe Thr Ile Ala Leu Gln Ser
Cys His Tyr Gln Arg Leu Pro Pro His 515 520 525Ile Leu Trp Ala Thr
Gly Leu Lys 530 53584543PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 84Met Asp Ile Glu Asp Glu
Glu Asn Met Ser Ser Ser Ser Thr Asp Val1 5 10 15Lys Glu Asn Arg Asn
Leu Asp Asn Val Ser Pro Lys Asp Gly Ser Thr 20 25 30Pro Gly Pro Gly
Glu Gly Ser Gln Leu Ser Asn Gly Gly Gly Gly Gly 35 40 45Pro Gly Arg
Lys Arg Pro Leu Glu Glu Gly Ser Asn Gly His Ser Lys 50 55 60Tyr Arg
Leu Lys Lys Arg Arg Lys Thr Pro Gly Pro Val Leu Pro Lys65 70 75
80Asn Ala Leu Met Gln Leu Asn Glu Ile Lys Pro Gly Leu Gln Tyr Thr
85 90 95Leu Leu Ser Gln Thr Gly Pro Val His Ala Pro Leu Phe Val Met
Ser 100 105 110Val Glu Val Asn Gly Gln Val Phe Glu Gly Ser Gly Pro
Thr Lys Lys 115 120 125Lys Ala
Lys Leu His Ala Ala Glu Lys Ala Leu Arg Ser Phe Val Gln 130 135
140Phe Pro Asn Ala Ser Glu Ala His Leu Ala Met Gly Arg Thr Leu
Ser145 150 155 160Val Asn Thr Asp Phe Thr Ser Asp Gln Ala Asp Phe
Pro Asp Thr Leu 165 170 175Phe Asn Gly Phe Glu Thr Pro Asp Lys Ala
Glu Pro Pro Phe Tyr Val 180 185 190Gly Ser Asn Gly Asp Asp Ser Phe
Ser Ser Ser Gly Asp Leu Ser Leu 195 200 205Ser Ala Ser Pro Val Pro
Ala Ser Leu Ala Gln Pro Pro Leu Pro Val 210 215 220Leu Pro Pro Phe
Pro Pro Pro Ser Gly Lys Asn Pro Val Met Ile Leu225 230 235 240Asn
Glu Leu Arg Pro Gly Leu Lys Tyr Asp Phe Leu Ser Glu Ser Gly 245 250
255Glu Ser His Ala Lys Ser Phe Val Met Ser Val Val Val Asp Gly Gln
260 265 270Phe Phe Glu Gly Ser Gly Arg Asn Lys Lys Leu Ala Lys Ala
Arg Ala 275 280 285Ala Gln Ser Ala Leu Ala Ala Ile Phe Asn Gly Gly
Ser Gly Gly Ser 290 295 300Gly Gly Ser Met Thr Ser Glu Lys Gly Pro
Ser Thr Gly Asp Pro Thr305 310 315 320Leu Arg Arg Arg Ile Glu Pro
Trp Glu Phe Asp Val Phe Tyr Asp Pro 325 330 335Arg Glu Leu Arg Lys
Glu Ala Cys Leu Leu Tyr Glu Ile Lys Trp Gly 340 345 350Met Ser Arg
Lys Ile Trp Arg Ser Ser Gly Lys Asn Thr Thr Asn His 355 360 365Val
Glu Val Asn Phe Ile Lys Lys Phe Thr Ser Glu Arg Asp Phe His 370 375
380Pro Ser Met Ser Cys Ser Ile Thr Trp Phe Leu Ser Trp Ser Pro
Cys385 390 395 400Trp Glu Cys Ser Gln Ala Ile Arg Glu Phe Leu Ser
Arg His Pro Gly 405 410 415Val Thr Leu Val Ile Tyr Val Ala Arg Leu
Phe Trp His Met Asp Gln 420 425 430Gln Asn Arg Gln Gly Leu Arg Asp
Leu Val Asn Ser Gly Val Thr Ile 435 440 445Gln Ile Met Arg Ala Ser
Glu Tyr Tyr His Cys Trp Arg Asn Phe Val 450 455 460Asn Tyr Pro Pro
Gly Asp Glu Ala His Trp Pro Gln Tyr Pro Pro Leu465 470 475 480Trp
Met Met Leu Tyr Ala Leu Glu Leu His Cys Ile Ile Leu Ser Leu 485 490
495Pro Pro Cys Leu Lys Ile Ser Arg Arg Trp Gln Asn His Leu Thr Phe
500 505 510Phe Arg Leu His Leu Gln Asn Cys His Tyr Gln Thr Ile Pro
Pro His 515 520 525Ile Leu Leu Ala Thr Gly Leu Ile His Pro Ser Val
Ala Trp Arg 530 535 54085585PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 85Met Ala Ser Asn Phe Thr
Gln Phe Val Leu Val Asp Asn Gly Gly Thr1 5 10 15Gly Asp Val Thr Val
Ala Pro Ser Asn Phe Ala Asn Gly Ile Ala Glu 20 25 30Trp Ile Ser Ser
Asn Ser Arg Ser Gln Ala Tyr Lys Val Thr Cys Ser 35 40 45Val Arg Gln
Ser Ser Ala Gln Asn Arg Lys Tyr Thr Ile Lys Val Glu 50 55 60Val Pro
Lys Gly Ala Trp Arg Ser Tyr Leu Asn Met Glu Leu Thr Ile65 70 75
80Pro Ile Phe Ala Thr Asn Ser Asp Cys Glu Leu Ile Val Lys Ala Met
85 90 95Gln Gly Leu Leu Lys Asp Gly Asn Pro Ile Pro Ser Ala Ile Ala
Ala 100 105 110Asn Ser Gly Ile Tyr Gly Gly Ser Gly Ser Gly Ala Gly
Ser Gly Ser 115 120 125Pro Ala Gly Gly Gly Ala Pro Gly Ser Gly Gly
Gly Ser Lys Ala Glu 130 135 140Arg Met Gly Phe Thr Glu Val Thr Pro
Val Thr Gly Ala Ser Leu Arg145 150 155 160Arg Thr Met Leu Leu Leu
Ser Arg Ser Pro Glu Ala Gln Pro Lys Thr 165 170 175Leu Pro Leu Thr
Gly Ser Thr Phe His Asp Gln Ile Ala Met Leu Ser 180 185 190His Arg
Cys Phe Asn Thr Leu Thr Asn Ser Phe Gln Pro Ser Leu Leu 195 200
205Gly Arg Lys Ile Leu Ala Ala Ile Ile Met Lys Lys Asp Ser Glu Asp
210 215 220Met Gly Val Val Val Ser Leu Gly Thr Gly Asn Arg Cys Val
Lys Gly225 230 235 240Asp Ser Leu Ser Leu Lys Gly Glu Thr Val Asn
Asp Cys His Ala Glu 245 250 255Ile Ile Ser Arg Arg Gly Phe Ile Arg
Phe Leu Tyr Ser Glu Leu Met 260 265 270Lys Tyr Asn Ser Gln Thr Ala
Lys Asp Ser Ile Phe Glu Pro Ala Lys 275 280 285Gly Gly Glu Lys Leu
Gln Ile Lys Lys Thr Val Ser Phe His Leu Tyr 290 295 300Ile Ser Thr
Ala Pro Cys Gly Asp Gly Ala Leu Phe Asp Lys Ser Cys305 310 315
320Ser Asp Arg Ala Met Glu Ser Thr Glu Ser Arg His Tyr Pro Val Phe
325 330 335Glu Asn Pro Lys Gln Gly Lys Leu Arg Thr Lys Val Glu Asn
Gly Glu 340 345 350Gly Thr Ile Pro Val Glu Ser Ser Asp Ile Val Pro
Thr Trp Asp Gly 355 360 365Ile Arg Leu Gly Glu Arg Leu Arg Thr Met
Ser Cys Ser Asp Lys Ile 370 375 380Leu Arg Trp Asn Val Leu Gly Leu
Gln Gly Ala Leu Leu Thr His Phe385 390 395 400Leu Gln Pro Ile Tyr
Leu Lys Ser Val Thr Leu Gly Tyr Leu Phe Ser 405 410 415Gln Gly His
Leu Thr Arg Ala Ile Cys Cys Arg Val Thr Arg Asp Gly 420 425 430Ser
Ala Phe Glu Asp Gly Leu Arg His Pro Phe Ile Val Asn His Pro 435 440
445Lys Val Gly Arg Val Ser Ile Tyr Asp Ser Lys Arg Gln Ser Gly Lys
450 455 460Thr Lys Glu Thr Ser Val Asn Trp Cys Leu Ala Asp Gly Tyr
Asp Leu465 470 475 480Glu Ile Leu Asp Gly Thr Arg Gly Thr Val Asp
Gly Pro Arg Asn Glu 485 490 495Leu Ser Arg Val Ser Lys Lys Asn Ile
Phe Leu Leu Phe Lys Lys Leu 500 505 510Cys Ser Phe Arg Tyr Arg Arg
Asp Leu Leu Arg Leu Ser Tyr Gly Glu 515 520 525Ala Lys Lys Ala Ala
Arg Asp Tyr Glu Thr Ala Lys Asn Tyr Phe Lys 530 535 540Lys Gly Leu
Lys Asp Met Gly Tyr Gly Asn Trp Ile Ser Lys Pro Gln545 550 555
560Glu Glu Lys Asn Phe Tyr Leu Cys Pro Val Gly Ser Gly Ser Gly Ser
565 570 575Leu Pro Pro Leu Glu Arg Leu Thr Leu 580
58586539PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 86Met Ala Ser Asn Phe Thr Gln Phe Val Leu Val
Asp Asn Gly Gly Thr1 5 10 15Gly Asp Val Thr Val Ala Pro Ser Asn Phe
Ala Asn Gly Ile Ala Glu 20 25 30Trp Ile Ser Ser Asn Ser Arg Ser Gln
Ala Tyr Lys Val Thr Cys Ser 35 40 45Val Arg Gln Ser Ser Ala Gln Asn
Arg Lys Tyr Thr Ile Lys Val Glu 50 55 60Val Pro Lys Gly Ala Trp Arg
Ser Tyr Leu Asn Met Glu Leu Thr Ile65 70 75 80Pro Ile Phe Ala Thr
Asn Ser Asp Cys Glu Leu Ile Val Lys Ala Met 85 90 95Gln Gly Leu Leu
Lys Asp Gly Asn Pro Ile Pro Ser Ala Ile Ala Ala 100 105 110Asn Ser
Gly Ile Tyr Gly Gly Ser Gly Ser Gly Ala Gly Ser Gly Ser 115 120
125Pro Ala Gly Gly Gly Ala Pro Gly Ser Gly Gly Gly Ser Gln Leu His
130 135 140Leu Pro Gln Val Leu Ala Asp Ala Val Ser Arg Leu Val Leu
Gly Lys145 150 155 160Phe Gly Asp Leu Thr Asp Asn Phe Ser Ser Pro
His Ala Arg Arg Lys 165 170 175Val Leu Ala Gly Val Val Met Thr Thr
Gly Thr Asp Val Lys Asp Ala 180 185 190Lys Val Ile Ser Val Ser Thr
Gly Thr Lys Cys Ile Asn Gly Glu Tyr 195 200 205Met Ser Asp Arg Gly
Leu Ala Leu Asn Asp Cys His Ala Glu Ile Ile 210 215 220Ser Arg Arg
Ser Leu Leu Arg Phe Leu Tyr Thr Gln Leu Glu Leu Tyr225 230 235
240Leu Asn Asn Lys Asp Asp Gln Lys Arg Ser Ile Phe Gln Lys Ser Glu
245 250 255Arg Gly Gly Phe Arg Leu Lys Glu Asn Val Gln Phe His Leu
Tyr Ile 260 265 270Ser Thr Ser Pro Cys Gly Asp Ala Arg Ile Phe Ser
Pro His Glu Pro 275 280 285Ile Leu Glu Glu Pro Ala Asp Arg His Pro
Asn Arg Lys Ala Arg Gly 290 295 300Gln Leu Arg Thr Lys Ile Glu Ser
Gly Glu Gly Thr Ile Pro Val Arg305 310 315 320Ser Asn Ala Ser Ile
Gln Thr Trp Asp Gly Val Leu Gln Gly Glu Arg 325 330 335Leu Leu Thr
Met Ser Cys Ser Asp Lys Ile Ala Arg Trp Asn Val Val 340 345 350Gly
Ile Gln Gly Ser Leu Leu Ser Ile Phe Val Glu Pro Ile Tyr Phe 355 360
365Ser Ser Ile Ile Leu Gly Ser Leu Tyr His Gly Asp His Leu Ser Arg
370 375 380Ala Met Tyr Gln Arg Ile Ser Asn Ile Glu Asp Leu Pro Pro
Leu Tyr385 390 395 400Thr Leu Asn Lys Pro Leu Leu Ser Gly Ile Ser
Asn Ala Glu Ala Arg 405 410 415Gln Pro Gly Lys Ala Pro Asn Phe Ser
Val Asn Trp Thr Val Gly Asp 420 425 430Ser Ala Ile Glu Val Ile Asn
Ala Thr Thr Gly Lys Asp Glu Leu Gly 435 440 445Arg Ala Ser Arg Leu
Cys Lys His Ala Leu Tyr Cys Arg Trp Met Arg 450 455 460Val His Gly
Lys Val Pro Ser His Leu Leu Arg Ser Lys Ile Thr Lys465 470 475
480Pro Asn Val Tyr His Glu Ser Lys Leu Ala Ala Lys Glu Tyr Gln Ala
485 490 495Ala Lys Ala Arg Leu Phe Thr Ala Phe Ile Lys Ala Gly Leu
Gly Ala 500 505 510Trp Val Glu Lys Pro Thr Glu Gln Asp Gln Phe Ser
Leu Thr Gly Ser 515 520 525Gly Ser Gly Ser Pro Lys Lys Lys Arg Lys
Val 530 53587541PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 87Met Ala Ser Asn Phe Thr Gln Phe
Val Leu Val Asp Asn Gly Gly Thr1 5 10 15Gly Asp Val Thr Val Ala Pro
Ser Asn Phe Ala Asn Gly Ile Ala Glu 20 25 30Trp Ile Ser Ser Asn Ser
Arg Ser Gln Ala Tyr Lys Val Thr Cys Ser 35 40 45Val Arg Gln Ser Ser
Ala Gln Asn Arg Lys Tyr Thr Ile Lys Val Glu 50 55 60Val Pro Lys Gly
Ala Trp Arg Ser Tyr Leu Asn Met Glu Leu Thr Ile65 70 75 80Pro Ile
Phe Ala Thr Asn Ser Asp Cys Glu Leu Ile Val Lys Ala Met 85 90 95Gln
Gly Leu Leu Lys Asp Gly Asn Pro Ile Pro Ser Ala Ile Ala Ala 100 105
110Asn Ser Gly Ile Tyr Gly Gly Ser Gly Ser Gly Ala Gly Ser Gly Ser
115 120 125Pro Ala Gly Gly Gly Ala Pro Gly Ser Gly Gly Gly Ser Gln
Leu His 130 135 140Leu Pro Gln Val Leu Ala Asp Ala Val Ser Arg Leu
Val Leu Gly Lys145 150 155 160Phe Gly Asp Leu Thr Asp Asn Phe Ser
Ser Pro His Ala Arg Arg Lys 165 170 175Val Leu Ala Gly Val Val Met
Thr Thr Gly Thr Asp Val Lys Asp Ala 180 185 190Lys Val Ile Ser Val
Ser Thr Gly Thr Lys Cys Ile Asn Gly Glu Tyr 195 200 205Met Ser Asp
Arg Gly Leu Ala Leu Asn Asp Cys His Ala Glu Ile Ile 210 215 220Ser
Arg Arg Ser Leu Leu Arg Phe Leu Tyr Thr Gln Leu Glu Leu Tyr225 230
235 240Leu Asn Asn Lys Asp Asp Gln Lys Arg Ser Ile Phe Gln Lys Ser
Glu 245 250 255Arg Gly Gly Phe Arg Leu Lys Glu Asn Val Gln Phe His
Leu Tyr Ile 260 265 270Ser Thr Ser Pro Cys Gly Asp Ala Arg Ile Phe
Ser Pro His Glu Pro 275 280 285Ile Leu Glu Glu Pro Ala Asp Arg His
Pro Asn Arg Lys Ala Arg Gly 290 295 300Gln Leu Arg Thr Lys Ile Glu
Ser Gly Glu Gly Thr Ile Pro Val Arg305 310 315 320Ser Asn Ala Ser
Ile Gln Thr Trp Asp Gly Val Leu Gln Gly Glu Arg 325 330 335Leu Leu
Thr Met Ser Cys Ser Asp Lys Ile Ala Arg Trp Asn Val Val 340 345
350Gly Ile Gln Gly Ser Leu Leu Ser Ile Phe Val Glu Pro Ile Tyr Phe
355 360 365Ser Ser Ile Ile Leu Gly Ser Leu Tyr His Gly Asp His Leu
Ser Arg 370 375 380Ala Met Tyr Gln Arg Ile Ser Asn Ile Glu Asp Leu
Pro Pro Leu Tyr385 390 395 400Thr Leu Asn Lys Pro Leu Leu Ser Gly
Ile Ser Asn Ala Glu Ala Arg 405 410 415Gln Pro Gly Lys Ala Pro Asn
Phe Ser Val Asn Trp Thr Val Gly Asp 420 425 430Ser Ala Ile Glu Val
Ile Asn Ala Thr Thr Gly Lys Asp Glu Leu Gly 435 440 445Arg Ala Ser
Arg Leu Cys Lys His Ala Leu Tyr Cys Arg Trp Met Arg 450 455 460Val
His Gly Lys Val Pro Ser His Leu Leu Arg Ser Lys Ile Thr Lys465 470
475 480Pro Asn Val Tyr His Glu Ser Lys Leu Ala Ala Lys Glu Tyr Gln
Ala 485 490 495Ala Lys Ala Arg Leu Phe Thr Ala Phe Ile Lys Ala Gly
Leu Gly Ala 500 505 510Trp Val Glu Lys Pro Thr Glu Gln Asp Gln Phe
Ser Leu Thr Gly Ser 515 520 525Gly Ser Gly Ser Leu Pro Pro Leu Glu
Arg Leu Thr Leu 530 535 54088399PRTArtificial SequenceDescription
of Artificial Sequence Synthetic polypeptide 88Met Ala Ser Asn Phe
Thr Gln Phe Val Leu Val Asp Asn Gly Gly Thr1 5 10 15Gly Asp Val Thr
Val Ala Pro Ser Asn Phe Ala Asn Gly Ile Ala Glu 20 25 30Trp Ile Ser
Ser Asn Ser Arg Ser Gln Ala Tyr Lys Val Thr Cys Ser 35 40 45Val Arg
Gln Ser Ser Ala Gln Asn Arg Lys Tyr Thr Ile Lys Val Glu 50 55 60Val
Pro Lys Gly Ala Trp Arg Ser Tyr Leu Asn Met Glu Leu Thr Ile65 70 75
80Pro Ile Phe Ala Thr Asn Ser Asp Cys Glu Leu Ile Val Lys Ala Met
85 90 95Gln Gly Leu Leu Lys Asp Gly Asn Pro Ile Pro Ser Ala Ile Ala
Ala 100 105 110Asn Ser Gly Ile Tyr Gly Gly Ser Gly Ser Gly Ala Gly
Ser Gly Ser 115 120 125Pro Ala Gly Gly Gly Ala Pro Gly Ser Gly Gly
Gly Ser Ser Gly Ser 130 135 140Glu Thr Pro Gly Thr Ser Glu Ser Ala
Thr Pro Glu Ser Met Ser Ser145 150 155 160Glu Thr Gly Pro Val Ala
Val Asp Pro Thr Leu Arg Arg Arg Ile Glu 165 170 175Pro His Glu Phe
Glu Val Phe Phe Asp Pro Arg Glu Leu Arg Lys Glu 180 185 190Thr Cys
Leu Leu Tyr Glu Ile Asn Trp Gly Gly Arg His Ser Ile Trp 195 200
205Arg His Thr Ser Gln Asn Thr Asn Lys His Val Glu Val Asn Phe Ile
210 215 220Glu Lys Phe Thr Thr Glu Arg Tyr Phe Cys Pro Asn Thr Arg
Cys Ser225 230 235 240Ile Thr Trp Phe Leu Ser Trp Ser Pro Cys Gly
Glu Cys Ser Arg Ala 245 250 255Ile Thr Glu Phe Leu Ser Arg Tyr Pro
His Val Thr Leu Phe Ile Tyr 260 265 270Ile Ala Arg Leu Tyr His His
Ala Asp Pro Arg Asn Arg Gln Gly Leu 275 280 285Arg Asp Leu Ile Ser
Ser Gly Val Thr Ile Gln Ile Met Thr Glu Gln 290 295 300Glu Ser Gly
Tyr Cys Trp Arg Asn Phe Val Asn Tyr Ser Pro Ser Asn305 310 315
320Glu Ala His Trp Pro Arg Tyr Pro His Leu Trp Val Arg Leu Tyr Val
325 330 335Leu Glu Leu Tyr Cys Ile Ile Leu Gly Leu Pro Pro Cys Leu
Asn Ile
340 345 350Leu Arg Arg Lys Gln Pro Gln Leu Thr Phe Phe Thr Ile Ala
Leu Gln 355 360 365Ser Cys His Tyr Gln Arg Leu Pro Pro His Ile Leu
Trp Ala Thr Gly 370 375 380Leu Lys Gly Ser Gly Ser Gly Ser Pro Lys
Lys Lys Arg Lys Val385 390 39589401PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
89Met Ala Ser Asn Phe Thr Gln Phe Val Leu Val Asp Asn Gly Gly Thr1
5 10 15Gly Asp Val Thr Val Ala Pro Ser Asn Phe Ala Asn Gly Ile Ala
Glu 20 25 30Trp Ile Ser Ser Asn Ser Arg Ser Gln Ala Tyr Lys Val Thr
Cys Ser 35 40 45Val Arg Gln Ser Ser Ala Gln Asn Arg Lys Tyr Thr Ile
Lys Val Glu 50 55 60Val Pro Lys Gly Ala Trp Arg Ser Tyr Leu Asn Met
Glu Leu Thr Ile65 70 75 80Pro Ile Phe Ala Thr Asn Ser Asp Cys Glu
Leu Ile Val Lys Ala Met 85 90 95Gln Gly Leu Leu Lys Asp Gly Asn Pro
Ile Pro Ser Ala Ile Ala Ala 100 105 110Asn Ser Gly Ile Tyr Gly Gly
Ser Gly Ser Gly Ala Gly Ser Gly Ser 115 120 125Pro Ala Gly Gly Gly
Ala Pro Gly Ser Gly Gly Gly Ser Ser Gly Ser 130 135 140Glu Thr Pro
Gly Thr Ser Glu Ser Ala Thr Pro Glu Ser Met Ser Ser145 150 155
160Glu Thr Gly Pro Val Ala Val Asp Pro Thr Leu Arg Arg Arg Ile Glu
165 170 175Pro His Glu Phe Glu Val Phe Phe Asp Pro Arg Glu Leu Arg
Lys Glu 180 185 190Thr Cys Leu Leu Tyr Glu Ile Asn Trp Gly Gly Arg
His Ser Ile Trp 195 200 205Arg His Thr Ser Gln Asn Thr Asn Lys His
Val Glu Val Asn Phe Ile 210 215 220Glu Lys Phe Thr Thr Glu Arg Tyr
Phe Cys Pro Asn Thr Arg Cys Ser225 230 235 240Ile Thr Trp Phe Leu
Ser Trp Ser Pro Cys Gly Glu Cys Ser Arg Ala 245 250 255Ile Thr Glu
Phe Leu Ser Arg Tyr Pro His Val Thr Leu Phe Ile Tyr 260 265 270Ile
Ala Arg Leu Tyr His His Ala Asp Pro Arg Asn Arg Gln Gly Leu 275 280
285Arg Asp Leu Ile Ser Ser Gly Val Thr Ile Gln Ile Met Thr Glu Gln
290 295 300Glu Ser Gly Tyr Cys Trp Arg Asn Phe Val Asn Tyr Ser Pro
Ser Asn305 310 315 320Glu Ala His Trp Pro Arg Tyr Pro His Leu Trp
Val Arg Leu Tyr Val 325 330 335Leu Glu Leu Tyr Cys Ile Ile Leu Gly
Leu Pro Pro Cys Leu Asn Ile 340 345 350Leu Arg Arg Lys Gln Pro Gln
Leu Thr Phe Phe Thr Ile Ala Leu Gln 355 360 365Ser Cys His Tyr Gln
Arg Leu Pro Pro His Ile Leu Trp Ala Thr Gly 370 375 380Leu Lys Gly
Ser Gly Ser Gly Ser Leu Pro Pro Leu Glu Arg Leu Thr385 390 395
400Leu90406PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 90Met Ala Ser Asn Phe Thr Gln Phe Val Leu Val
Asp Asn Gly Gly Thr1 5 10 15Gly Asp Val Thr Val Ala Pro Ser Asn Phe
Ala Asn Gly Ile Ala Glu 20 25 30Trp Ile Ser Ser Asn Ser Arg Ser Gln
Ala Tyr Lys Val Thr Cys Ser 35 40 45Val Arg Gln Ser Ser Ala Gln Asn
Arg Lys Tyr Thr Ile Lys Val Glu 50 55 60Val Pro Lys Gly Ala Trp Arg
Ser Tyr Leu Asn Met Glu Leu Thr Ile65 70 75 80Pro Ile Phe Ala Thr
Asn Ser Asp Cys Glu Leu Ile Val Lys Ala Met 85 90 95Gln Gly Leu Leu
Lys Asp Gly Asn Pro Ile Pro Ser Ala Ile Ala Ala 100 105 110Asn Ser
Gly Ile Tyr Gly Gly Ser Gly Ser Gly Ala Gly Ser Gly Ser 115 120
125Pro Ala Gly Gly Gly Ala Pro Gly Ser Gly Gly Gly Ser Ser Gly Ser
130 135 140Glu Thr Pro Gly Thr Ser Glu Ser Ala Thr Pro Glu Ser Met
Thr Ser145 150 155 160Glu Lys Gly Pro Ser Thr Gly Asp Pro Thr Leu
Arg Arg Arg Ile Glu 165 170 175Pro Trp Glu Phe Asp Val Phe Tyr Asp
Pro Arg Glu Leu Arg Lys Glu 180 185 190Ala Cys Leu Leu Tyr Glu Ile
Lys Trp Gly Met Ser Arg Lys Ile Trp 195 200 205Arg Ser Ser Gly Lys
Asn Thr Thr Asn His Val Glu Val Asn Phe Ile 210 215 220Lys Lys Phe
Thr Ser Glu Arg Asp Phe His Pro Ser Met Ser Cys Ser225 230 235
240Ile Thr Trp Phe Leu Ser Trp Ser Pro Cys Trp Glu Cys Ser Gln Ala
245 250 255Ile Arg Glu Phe Leu Ser Arg His Pro Gly Val Thr Leu Val
Ile Tyr 260 265 270Val Ala Arg Leu Phe Trp His Met Asp Gln Gln Asn
Arg Gln Gly Leu 275 280 285Arg Asp Leu Val Asn Ser Gly Val Thr Ile
Gln Ile Met Arg Ala Ser 290 295 300Glu Tyr Tyr His Cys Trp Arg Asn
Phe Val Asn Tyr Pro Pro Gly Asp305 310 315 320Glu Ala His Trp Pro
Gln Tyr Pro Pro Leu Trp Met Met Leu Tyr Ala 325 330 335Leu Glu Leu
His Cys Ile Ile Leu Ser Leu Pro Pro Cys Leu Lys Ile 340 345 350Ser
Arg Arg Trp Gln Asn His Leu Thr Phe Phe Arg Leu His Leu Gln 355 360
365Asn Cys His Tyr Gln Thr Ile Pro Pro His Ile Leu Leu Ala Thr Gly
370 375 380Leu Ile His Pro Ser Val Ala Trp Arg Gly Ser Gly Ser Gly
Ser Pro385 390 395 400Lys Lys Lys Arg Lys Val 40591408PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
91Met Ala Ser Asn Phe Thr Gln Phe Val Leu Val Asp Asn Gly Gly Thr1
5 10 15Gly Asp Val Thr Val Ala Pro Ser Asn Phe Ala Asn Gly Ile Ala
Glu 20 25 30Trp Ile Ser Ser Asn Ser Arg Ser Gln Ala Tyr Lys Val Thr
Cys Ser 35 40 45Val Arg Gln Ser Ser Ala Gln Asn Arg Lys Tyr Thr Ile
Lys Val Glu 50 55 60Val Pro Lys Gly Ala Trp Arg Ser Tyr Leu Asn Met
Glu Leu Thr Ile65 70 75 80Pro Ile Phe Ala Thr Asn Ser Asp Cys Glu
Leu Ile Val Lys Ala Met 85 90 95Gln Gly Leu Leu Lys Asp Gly Asn Pro
Ile Pro Ser Ala Ile Ala Ala 100 105 110Asn Ser Gly Ile Tyr Gly Gly
Ser Gly Ser Gly Ala Gly Ser Gly Ser 115 120 125Pro Ala Gly Gly Gly
Ala Pro Gly Ser Gly Gly Gly Ser Ser Gly Ser 130 135 140Glu Thr Pro
Gly Thr Ser Glu Ser Ala Thr Pro Glu Ser Met Thr Ser145 150 155
160Glu Lys Gly Pro Ser Thr Gly Asp Pro Thr Leu Arg Arg Arg Ile Glu
165 170 175Pro Trp Glu Phe Asp Val Phe Tyr Asp Pro Arg Glu Leu Arg
Lys Glu 180 185 190Ala Cys Leu Leu Tyr Glu Ile Lys Trp Gly Met Ser
Arg Lys Ile Trp 195 200 205Arg Ser Ser Gly Lys Asn Thr Thr Asn His
Val Glu Val Asn Phe Ile 210 215 220Lys Lys Phe Thr Ser Glu Arg Asp
Phe His Pro Ser Met Ser Cys Ser225 230 235 240Ile Thr Trp Phe Leu
Ser Trp Ser Pro Cys Trp Glu Cys Ser Gln Ala 245 250 255Ile Arg Glu
Phe Leu Ser Arg His Pro Gly Val Thr Leu Val Ile Tyr 260 265 270Val
Ala Arg Leu Phe Trp His Met Asp Gln Gln Asn Arg Gln Gly Leu 275 280
285Arg Asp Leu Val Asn Ser Gly Val Thr Ile Gln Ile Met Arg Ala Ser
290 295 300Glu Tyr Tyr His Cys Trp Arg Asn Phe Val Asn Tyr Pro Pro
Gly Asp305 310 315 320Glu Ala His Trp Pro Gln Tyr Pro Pro Leu Trp
Met Met Leu Tyr Ala 325 330 335Leu Glu Leu His Cys Ile Ile Leu Ser
Leu Pro Pro Cys Leu Lys Ile 340 345 350Ser Arg Arg Trp Gln Asn His
Leu Thr Phe Phe Arg Leu His Leu Gln 355 360 365Asn Cys His Tyr Gln
Thr Ile Pro Pro His Ile Leu Leu Ala Thr Gly 370 375 380Leu Ile His
Pro Ser Val Ala Trp Arg Gly Ser Gly Ser Gly Ser Leu385 390 395
400Pro Pro Leu Glu Arg Leu Thr Leu 405929PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 92Gly
Gly Ser Gly Gly Ser Gly Gly Ser1 59316PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 93Ser
Gly Ser Glu Thr Pro Gly Thr Ser Glu Ser Ala Thr Pro Glu Ser1 5 10
1594569PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 94Met Pro Lys Lys Lys Arg Lys Val Asp Pro Lys
Lys Lys Arg Lys Val1 5 10 15Asp Pro Lys Lys Lys Arg Lys Val Gly Ser
Tyr Pro Tyr Asp Val Pro 20 25 30Asp Tyr Ala Gly Ser Asn Ala Arg Thr
Arg Arg Arg Glu Arg Arg Ala 35 40 45Glu Lys Gln Ala Gln Trp Lys Ala
Ala Asn Gly Gly Gly Gly Ser Gly 50 55 60Gly Gly Gly Ser Gly Gly Gly
Gly Ser Asn Ala Arg Thr Arg Arg Arg65 70 75 80Glu Arg Arg Ala Glu
Lys Gln Ala Gln Trp Lys Ala Ala Asn Gly Gly 85 90 95Gly Gly Ser Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Asn Ala Arg 100 105 110Thr Arg
Arg Arg Glu Arg Arg Ala Glu Lys Gln Ala Gln Trp Lys Ala 115 120
125Ala Asn Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
130 135 140Ser Asn Ala Arg Thr Arg Arg Arg Glu Arg Arg Ala Glu Lys
Gln Ala145 150 155 160Gln Trp Lys Ala Ala Asn Leu His Leu Asp Gln
Thr Pro Ser Arg Gln 165 170 175Pro Ile Pro Ser Glu Gly Leu Gln Leu
His Leu Pro Gln Val Leu Ala 180 185 190Asp Ala Val Ser Arg Leu Val
Leu Gly Lys Phe Gly Asp Leu Thr Asp 195 200 205Asn Phe Ser Ser Pro
His Ala Arg Arg Lys Val Leu Ala Gly Val Val 210 215 220Met Thr Thr
Gly Thr Asp Val Lys Asp Ala Lys Val Ile Ser Val Ser225 230 235
240Thr Gly Thr Lys Cys Ile Asn Gly Glu Tyr Met Ser Asp Arg Gly Leu
245 250 255Ala Leu Asn Asp Cys His Ala Glu Ile Ile Ser Arg Arg Ser
Leu Leu 260 265 270Arg Phe Leu Tyr Thr Gln Leu Glu Leu Tyr Leu Asn
Asn Lys Asp Asp 275 280 285Gln Lys Arg Ser Ile Phe Gln Lys Ser Glu
Arg Gly Gly Phe Arg Leu 290 295 300Lys Glu Asn Val Gln Phe His Leu
Tyr Ile Ser Thr Ser Pro Cys Gly305 310 315 320Asp Ala Arg Ile Phe
Ser Pro His Glu Pro Ile Leu Glu Glu Pro Ala 325 330 335Asp Arg His
Pro Asn Arg Lys Ala Arg Gly Gln Leu Arg Thr Lys Ile 340 345 350Glu
Ser Gly Glu Gly Thr Ile Pro Val Arg Ser Asn Ala Ser Ile Gln 355 360
365Thr Trp Asp Gly Val Leu Gln Gly Glu Arg Leu Leu Thr Met Ser Cys
370 375 380Ser Asp Lys Ile Ala Arg Trp Asn Val Val Gly Ile Gln Gly
Ser Leu385 390 395 400Leu Ser Ile Phe Val Glu Pro Ile Tyr Phe Ser
Ser Ile Ile Leu Gly 405 410 415Ser Leu Tyr His Gly Asp His Leu Ser
Arg Ala Met Tyr Gln Arg Ile 420 425 430Ser Asn Ile Glu Asp Leu Pro
Pro Leu Tyr Thr Leu Asn Lys Pro Leu 435 440 445Leu Ser Gly Ile Ser
Asn Ala Glu Ala Arg Gln Pro Gly Lys Ala Pro 450 455 460Asn Phe Ser
Val Asn Trp Thr Val Gly Asp Ser Ala Ile Glu Val Ile465 470 475
480Asn Ala Thr Thr Gly Lys Asp Glu Leu Gly Arg Ala Ser Arg Leu Cys
485 490 495Lys His Ala Leu Tyr Cys Arg Trp Met Arg Val His Gly Lys
Val Pro 500 505 510Ser His Leu Leu Arg Ser Lys Ile Thr Lys Pro Asn
Val Tyr His Glu 515 520 525Ser Lys Leu Ala Ala Lys Glu Tyr Gln Ala
Ala Lys Ala Arg Leu Phe 530 535 540Thr Ala Phe Ile Lys Ala Gly Leu
Gly Ala Trp Val Glu Lys Pro Thr545 550 555 560Glu Gln Asp Gln Phe
Ser Leu Thr Pro 56595294PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 95Met Pro Lys Lys Lys Arg
Lys Val Asp Gly Ser Gly Asn Ala Arg Thr1 5 10 15Arg Arg Arg Glu Arg
Arg Ala Glu Lys Gln Ala Gln Trp Lys Ala Ala 20 25 30Asn Gly Gly Gly
Gly Thr Ser Gly Ser Gly Ser Gly Ser Pro Ala Gly 35 40 45Gly Gly Ala
Pro Gly Ser Gly Gly Gly Ser Met Thr Ser Glu Lys Gly 50 55 60Pro Ser
Thr Gly Asp Pro Thr Leu Arg Arg Arg Ile Glu Pro Trp Glu65 70 75
80Phe Asp Val Phe Tyr Asp Pro Arg Glu Leu Arg Lys Glu Ala Cys Leu
85 90 95Leu Tyr Glu Ile Lys Trp Gly Met Ser Arg Lys Ile Trp Arg Ser
Ser 100 105 110Gly Lys Asn Thr Thr Asn His Val Glu Val Asn Phe Ile
Lys Lys Phe 115 120 125Thr Ser Glu Arg Asp Phe His Pro Ser Met Ser
Cys Ser Ile Thr Trp 130 135 140Phe Leu Ser Trp Ser Pro Cys Trp Glu
Cys Ser Gln Ala Ile Arg Glu145 150 155 160Phe Leu Ser Arg His Pro
Gly Val Thr Leu Val Ile Tyr Val Ala Arg 165 170 175Leu Phe Trp His
Met Asp Gln Gln Asn Arg Gln Gly Leu Arg Asp Leu 180 185 190Val Asn
Ser Gly Val Thr Ile Gln Ile Met Arg Ala Ser Glu Tyr Tyr 195 200
205His Cys Trp Arg Asn Phe Val Asn Tyr Pro Pro Gly Asp Glu Ala His
210 215 220Trp Pro Gln Tyr Pro Pro Leu Trp Met Met Leu Tyr Ala Leu
Glu Leu225 230 235 240His Cys Ile Ile Leu Ser Leu Pro Pro Cys Leu
Lys Ile Ser Arg Arg 245 250 255Trp Gln Asn His Leu Thr Phe Phe Arg
Leu His Leu Gln Asn Cys His 260 265 270Tyr Gln Thr Ile Pro Pro His
Ile Leu Leu Ala Thr Gly Leu Ile His 275 280 285Pro Ser Val Ala Trp
Arg 29096402PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 96Met Pro Lys Lys Lys Arg Lys Val
Asp Pro Lys Lys Lys Arg Lys Val1 5 10 15Asp Pro Lys Lys Lys Arg Lys
Val Gly Ser Tyr Pro Tyr Asp Val Pro 20 25 30Asp Tyr Ala Gly Ser Asn
Ala Arg Thr Arg Arg Arg Glu Arg Arg Ala 35 40 45Glu Lys Gln Ala Gln
Trp Lys Ala Ala Asn Gly Gly Gly Gly Ser Gly 50 55 60Gly Gly Gly Ser
Gly Gly Gly Gly Ser Asn Ala Arg Thr Arg Arg Arg65 70 75 80Glu Arg
Arg Ala Glu Lys Gln Ala Gln Trp Lys Ala Ala Asn Gly Gly 85 90 95Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asn Ala Arg 100 105
110Thr Arg Arg Arg Glu Arg Arg Ala Glu Lys Gln Ala Gln Trp Lys Ala
115 120 125Ala Asn Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly
Gly Gly 130 135 140Ser Asn Ala Arg Thr Arg Arg Arg Glu Arg Arg Ala
Glu Lys Gln Ala145 150 155 160Gln Trp Lys Ala Ala Asn Met Thr Ser
Glu Lys Gly Pro Ser Thr Gly 165 170 175Asp Pro Thr Leu Arg Arg Arg
Ile Glu Pro Trp Glu Phe Asp Val Phe 180 185 190Tyr Asp Pro Arg Glu
Leu Arg Lys Glu Ala Cys Leu Leu Tyr Glu Ile 195 200 205Lys Trp Gly
Met Ser Arg Lys Ile Trp Arg Ser Ser Gly Lys Asn Thr 210 215 220Thr
Asn His
Val Glu Val Asn Phe Ile Lys Lys Phe Thr Ser Glu Arg225 230 235
240Asp Phe His Pro Ser Met Ser Cys Ser Ile Thr Trp Phe Leu Ser Trp
245 250 255Ser Pro Cys Trp Glu Cys Ser Gln Ala Ile Arg Glu Phe Leu
Ser Arg 260 265 270His Pro Gly Val Thr Leu Val Ile Tyr Val Ala Arg
Leu Phe Trp His 275 280 285Met Asp Gln Gln Asn Arg Gln Gly Leu Arg
Asp Leu Val Asn Ser Gly 290 295 300Val Thr Ile Gln Ile Met Arg Ala
Ser Glu Tyr Tyr His Cys Trp Arg305 310 315 320Asn Phe Val Asn Tyr
Pro Pro Gly Asp Glu Ala His Trp Pro Gln Tyr 325 330 335Pro Pro Leu
Trp Met Met Leu Tyr Ala Leu Glu Leu His Cys Ile Ile 340 345 350Leu
Ser Leu Pro Pro Cys Leu Lys Ile Ser Arg Arg Trp Gln Asn His 355 360
365Leu Thr Phe Phe Arg Leu His Leu Gln Asn Cys His Tyr Gln Thr Ile
370 375 380Pro Pro His Ile Leu Leu Ala Thr Gly Leu Ile His Pro Ser
Val Ala385 390 395 400Trp Arg97564PRTArtificial SequenceDescription
of Artificial Sequence Synthetic polypeptide 97Met Leu Arg Ser Phe
Val Gln Phe Pro Asn Ala Ser Glu Ala His Leu1 5 10 15Ala Met Gly Arg
Thr Leu Ser Val Asn Thr Asp Phe Thr Ser Asp Gln 20 25 30Ala Asp Phe
Pro Asp Thr Leu Phe Asn Gly Phe Glu Thr Pro Asp Lys 35 40 45Ala Glu
Pro Pro Phe Tyr Val Gly Ser Asn Gly Asp Asp Ser Phe Ser 50 55 60Ser
Ser Gly Asp Leu Ser Leu Ser Ala Ser Pro Val Pro Ala Ser Leu65 70 75
80Ala Gln Pro Pro Leu Pro Val Leu Pro Pro Phe Pro Pro Pro Ser Gly
85 90 95Lys Asn Pro Val Met Ile Leu Asn Glu Leu Arg Pro Gly Leu Lys
Tyr 100 105 110Asp Phe Leu Ser Glu Ser Gly Glu Ser His Ala Lys Ser
Phe Val Met 115 120 125Ser Val Val Val Asp Gly Gln Phe Phe Glu Gly
Ser Gly Arg Asn Lys 130 135 140Lys Leu Ala Lys Ala Arg Ala Ala Gln
Ser Ala Leu Ala Ala Ile Phe145 150 155 160Asn Leu His Leu Asp Gln
Thr Pro Ser Arg Gln Pro Ile Pro Ser Glu 165 170 175Gly Leu Gln Leu
His Leu Pro Gln Val Leu Ala Asp Ala Val Ser Arg 180 185 190Leu Val
Leu Gly Lys Phe Gly Asp Leu Thr Asp Asn Phe Ser Ser Pro 195 200
205His Ala Arg Arg Lys Val Leu Ala Gly Val Val Met Thr Thr Gly Thr
210 215 220Asp Val Lys Asp Ala Lys Val Ile Ser Val Ser Thr Gly Thr
Lys Cys225 230 235 240Ile Asn Gly Glu Tyr Met Ser Asp Arg Gly Leu
Ala Leu Asn Asp Cys 245 250 255His Ala Glu Ile Ile Ser Arg Arg Ser
Leu Leu Arg Phe Leu Tyr Thr 260 265 270Gln Leu Glu Leu Tyr Leu Asn
Asn Lys Asp Asp Gln Lys Arg Ser Ile 275 280 285Phe Gln Lys Ser Glu
Arg Gly Gly Phe Arg Leu Lys Glu Asn Val Gln 290 295 300Phe His Leu
Tyr Ile Ser Thr Ser Pro Cys Gly Asp Ala Arg Ile Phe305 310 315
320Ser Pro His Glu Pro Ile Leu Glu Glu Pro Ala Asp Arg His Pro Asn
325 330 335Arg Lys Ala Arg Gly Gln Leu Arg Thr Lys Ile Glu Ser Gly
Glu Gly 340 345 350Thr Ile Pro Val Arg Ser Asn Ala Ser Ile Gln Thr
Trp Asp Gly Val 355 360 365Leu Gln Gly Glu Arg Leu Leu Thr Met Ser
Cys Ser Asp Lys Ile Ala 370 375 380Arg Trp Asn Val Val Gly Ile Gln
Gly Ser Leu Leu Ser Ile Phe Val385 390 395 400Glu Pro Ile Tyr Phe
Ser Ser Ile Ile Leu Gly Ser Leu Tyr His Gly 405 410 415Asp His Leu
Ser Arg Ala Met Tyr Gln Arg Ile Ser Asn Ile Glu Asp 420 425 430Leu
Pro Pro Leu Tyr Thr Leu Asn Lys Pro Leu Leu Ser Gly Ile Ser 435 440
445Asn Ala Glu Ala Arg Gln Pro Gly Lys Ala Pro Asn Phe Ser Val Asn
450 455 460Trp Thr Val Gly Asp Ser Ala Ile Glu Val Ile Asn Ala Thr
Thr Gly465 470 475 480Lys Asp Glu Leu Gly Arg Ala Ser Arg Leu Cys
Lys His Ala Leu Tyr 485 490 495Cys Arg Trp Met Arg Val His Gly Lys
Val Pro Ser His Leu Leu Arg 500 505 510Ser Lys Ile Thr Lys Pro Asn
Val Tyr His Glu Ser Lys Leu Ala Ala 515 520 525Lys Glu Tyr Gln Ala
Ala Lys Ala Arg Leu Phe Thr Ala Phe Ile Lys 530 535 540Ala Gly Leu
Gly Ala Trp Val Glu Lys Pro Thr Glu Gln Asp Gln Phe545 550 555
560Ser Leu Thr Pro9854DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(1)..(20)a, c, t, g, unknown or other
98nnnnnnnnnn nnnnnnnnnn ggccaacatg aggatcaccc atgtctgcag ggcc
549962DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotidemodified_base(22)..(41)a, c, t, g, unknown
or other 99aacatgagga tcacccatgt cnnnnnnnnn nnnnnnnnnn naacatgagg
atcacccatg 60tc 6210039DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(1)..(20)a, c, t, g, unknown or other
100nnnnnnnnnn nnnnnnnnnn gggccctgaa gaagggccc 3910158DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotidemodified_base(20)..(39)a, c, t, g, unknown or other
101gggccctgaa gaagggcccn nnnnnnnnnn nnnnnnnnng ggccctgaag aagggccc
5810249DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotidemodified_base(1)..(20)a, c, t, g, unknown
or other 102nnnnnnnnnn nnnnnnnnnn ccggagcaga cgatatggcg tcgctccgg
49103109DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotidemodified_base(45)..(64)a, c, t, g, unknown
or other 103tggaatagta taacaatatg ctaaatgttg ttatagtatc ccacnnnnnn
nnnnnnnnnn 60nnnngtggaa tagtataaca atatgctaaa tgttgttata gtatcccac
10910468DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotidemodified_base(50)..(52)a, c, t, g, unknown
or othermodified_base(54)..(68)a, c, t, g, unknown or other
104gggtggaata gtataacaat atgctaaatg ttgttatagt atcccacctn
nncnnnnnnn 60nnnnnnnn 6810565DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(46)..(51)a, c, t, g, unknown or
othermodified_base(53)..(65)a, c, t, g, unknown or other
105gtggaatagt ataacaatat gctaaatgtt gttatagtat cccacnnnnn
ncnnnnnnnn 60nnnnn 6510666DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(46)..(51)a, c, t, g, unknown or
othermodified_base(53)..(66)a, c, t, g, unknown or other
106gtggaagagg agaacaatat gctaaatgtt gttctcgtct cccacnnnnn
ncnnnnnnnn 60nnnnnn 6610768DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(50)..(52)a, c, t, g, unknown or
othermodified_base(54)..(68)a, c, t, g, unknown or other
107gggtggaaga ggagaacaat atgctaaatg ttgttctcgt ctcccacctn
nncnnnnnnn 60nnnnnnnn 6810866DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(46)..(51)a, c, t, g, unknown or
othermodified_base(53)..(66)a, c, t, g, unknown or other
108ggtgaagagg agaacaatat gctaaatgtt gttctcgtct ccaccnnnnn
ncnnnnnnnn 60nnnnnn 6610966DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(46)..(52)a, c, t, g, unknown or
othermodified_base(54)..(66)a, c, t, g, unknown or other
109ggtgaagagg agaacaatat gctaaatgtt gttctcgtct ccaccnnnnn
nncnnnnnnn 60nnnnnn 6611066DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(46)..(51)a, c, t, g, unknown or
othermodified_base(53)..(66)a, c, t, g, unknown or other
110gtggaagagg agaacaatag gctaaacgtt gttctcgtct cccacnnnnn
ncnnnnnnnn 60nnnnnn 6611168DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(50)..(52)a, c, t, g, unknown or
othermodified_base(54)..(68)a, c, t, g, unknown or other
111gggtggaaga ggagaacaat aggctaaacg ttgttctcgt ctcccacctn
nncnnnnnnn 60nnnnnnnn 6811266DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(46)..(51)a, c, t, g, unknown or
othermodified_base(53)..(66)a, c, t, g, unknown or other
112ggtgaagagg agaacaatag gctaaacgtt gttctcgtct ccaccnnnnn
ncnnnnnnnn 60nnnnnn 6611366DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(46)..(52)a, c, t, g, unknown or
othermodified_base(54)..(66)a, c, t, g, unknown or other
113ggtgaagagg agaacaatag gctaaacgtt gttctcgtct ccaccnnnnn
nncnnnnnnn 60nnnnnn 6611473DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(56)..(62)a, c, t, g, unknown or
othermodified_base(64)..(73)a, c, t, g, unknown or other
114ggtgtcgaga atagtataac aatatgctaa atgttgttat agtatcctcg
acaccnnnnn 60nncnnnnnnn nnn 7311573DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotidemodified_base(56)..(62)a, c, t, g, unknown or
othermodified_base(64)..(73)a, c, t, g, unknown or other
115ggtgtcgaga agaggagaac aatatgctaa atgttgttct cgtctcctcg
acaccnnnnn 60nncnnnnnnn nnn 7311673DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotidemodified_base(56)..(62)a, c, t, g, unknown or
othermodified_base(64)..(73)a, c, t, g, unknown or other
116ggtgtcgaga agaggagaac aataggctaa acgttgttct cgtctcctcg
acaccnnnnn 60nncnnnnnnn nnn 731171387PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
117Met Ala Arg Ile Leu Ala Phe Ala Ile Gly Ile Ser Ser Ile Gly Trp1
5 10 15Ala Phe Ser Glu Asn Asp Glu Leu Lys Asp Cys Gly Val Arg Ile
Phe 20 25 30Thr Lys Val Glu Asn Pro Lys Thr Gly Glu Ser Leu Ala Leu
Pro Arg 35 40 45Arg Leu Ala Arg Ser Ala Arg Lys Arg Leu Ala Arg Arg
Lys Ala Arg 50 55 60Leu Asn His Leu Lys His Leu Ile Ala Asn Glu Phe
Lys Leu Asn Tyr65 70 75 80Glu Asp Tyr Gln Ser Phe Asp Glu Ser Leu
Ala Lys Ala Tyr Lys Gly 85 90 95Ser Leu Ile Ser Pro Tyr Glu Leu Arg
Phe Arg Ala Leu Asn Glu Leu 100 105 110Leu Ser Lys Gln Asp Phe Ala
Arg Val Ile Leu His Ile Ala Lys Arg 115 120 125Arg Gly Tyr Asp Asp
Ile Lys Asn Ser Asp Asp Lys Glu Lys Gly Ala 130 135 140Ile Leu Lys
Ala Ile Lys Gln Asn Glu Glu Lys Leu Ala Asn Tyr Gln145 150 155
160Ser Val Gly Glu Tyr Leu Tyr Lys Glu Tyr Phe Gln Lys Phe Lys Glu
165 170 175Asn Ser Lys Glu Phe Thr Asn Val Arg Asn Lys Lys Glu Ser
Tyr Glu 180 185 190Arg Cys Ile Ala Gln Ser Phe Leu Lys Asp Glu Leu
Lys Leu Ile Phe 195 200 205Lys Lys Gln Arg Glu Phe Gly Phe Ser Phe
Ser Lys Lys Phe Glu Glu 210 215 220Glu Val Leu Ser Val Ala Phe Tyr
Lys Arg Ala Leu Lys Asp Phe Ser225 230 235 240His Leu Val Gly Asn
Cys Ser Phe Phe Thr Asp Glu Lys Arg Ala Pro 245 250 255Lys Asn Ser
Pro Leu Ala Phe Met Phe Val Ala Leu Thr Arg Ile Ile 260 265 270Asn
Leu Leu Asn Asn Leu Lys Asn Thr Glu Gly Ile Leu Tyr Thr Lys 275 280
285Asp Asp Leu Asn Ala Leu Leu Asn Glu Val Leu Lys Asn Gly Thr Leu
290 295 300Thr Tyr Lys Gln Thr Lys Lys Leu Leu Gly Leu Ser Asp Asp
Tyr Glu305 310 315 320Phe Lys Gly Glu Lys Gly Thr Tyr Phe Ile Glu
Phe Lys Lys Tyr Lys 325 330 335Glu Phe Ile Lys Ala Leu Gly Glu His
Asn Leu Ser Gln Asp Asp Leu 340 345 350Asn Glu Ile Ala Lys Asp Ile
Thr Leu Ile Lys Asp Glu Ile Lys Leu 355 360 365Lys Lys Ala Leu Ala
Lys Tyr Asp Leu Asn Gln Asn Gln Ile Asp Ser 370 375 380Leu Ser Lys
Leu Glu Phe Lys Asp His Leu Asn Ile Ser Phe Lys Ala385 390 395
400Leu Lys Leu Val Thr Pro Leu Met Leu Glu Gly Lys Lys Tyr Asp Glu
405 410 415Ala Cys Asn Glu Leu Asn Leu Lys Val Ala Ile Asn Glu Asp
Lys Lys 420 425 430Asp Phe Leu Pro Ala Phe Asn Glu Thr Tyr Tyr Lys
Asp Glu Val Thr 435 440 445Asn Pro Val Val Leu Arg Ala Ile Lys Glu
Tyr Arg Lys Val Leu Asn 450 455 460Ala Leu Leu Lys Lys Tyr Gly Lys
Val His Lys Ile Asn Ile Glu Leu465 470 475 480Ala Arg Glu Val Gly
Lys Asn His Ser Gln Arg Ala Lys Ile Glu Lys 485 490 495Glu Gln Asn
Glu Asn Tyr Lys Ala Lys Lys Asp Ala Glu Leu Glu Cys 500 505 510Glu
Lys Leu Gly Leu Lys Ile Asn Ser Lys Asn Ile Leu Lys Leu Arg 515 520
525Leu Phe Lys Glu Gln Lys Glu Phe Cys Ala Tyr Ser Gly Glu Lys Ile
530 535 540Lys Ile Ser Asp Leu Gln Asp Glu Lys Met Leu Glu Ile Asp
Ala Ile545 550 555 560Tyr Pro Tyr Ser Arg Ser Phe Asp Asp Ser Tyr
Met Asn Lys Val Leu 565 570 575Val Phe Thr Lys Gln Asn Gln Glu Lys
Leu Asn Gln Thr Pro Phe Glu 580 585 590Ala Phe Gly Asn Asp Ser Ala
Lys Trp Gln Lys Ile Glu Val Leu Ala 595 600 605Lys Asn Leu Pro Thr
Lys Lys Gln Lys Arg Ile Leu Asp Lys Asn Tyr 610 615 620Lys Asp Lys
Glu Gln Lys Asn Phe Lys Asp Arg Asn Leu Asn Asp Thr625 630 635
640Arg Tyr Ile Ala Arg Leu Val Leu Asn Tyr Thr Lys Asp Tyr Leu Asp
645 650 655Phe Leu Pro Leu Ser Asp Asp Glu Asn Thr Lys Leu Asn Asp
Thr Gln 660 665 670Lys Gly Ser Lys Val His Val Glu Ala Lys Ser Gly
Met Leu Thr Ser 675 680 685Ala Leu Arg His Thr Trp Gly Phe Ser Ala
Lys Asp Arg Asn Asn His 690 695 700Leu His His Ala Ile Asp Ala Val
Ile Ile Ala Tyr Ala Asn Asn Ser705 710 715 720Ile Val Lys Ala Phe
Ser Asp Phe Lys Lys Glu Gln Glu Ser Asn Ser 725 730 735Ala Glu Leu
Tyr Ala Lys Lys Ile Ser Glu Leu Asp Tyr Lys Asn Lys 740 745 750Arg
Lys Phe Phe Glu Pro Phe Ser Gly Phe Arg Gln Lys Val Leu Asp 755 760
765Lys Ile Asp Glu Ile Phe Val Ser Lys Pro Glu Arg Lys Lys Pro Ser
770 775 780Gly Ala Leu His Glu Glu Thr Phe Arg Lys Glu Glu Glu Phe
Tyr Gln785 790 795 800Ser Tyr Gly Gly Lys Glu Gly Val Leu Lys Ala
Leu Glu Leu Gly Lys 805 810 815Ile Arg Lys Val Asn Gly Lys Ile Val
Lys Asn Gly Asp Met Phe Arg 820 825 830Val Asp Ile Phe Lys His Lys
Lys Thr Asn Lys Phe Tyr Ala Val Pro 835 840 845Ile Tyr Thr Met Asp
Phe Ala Leu Lys Val Leu Pro Asn Lys Ala Val 850 855 860Ala Arg
Ser
Lys Lys Gly Glu Ile Lys Asp Trp Ile Leu Met Asp Glu865 870 875
880Asn Tyr Glu Phe Cys Phe Ser Leu Tyr Lys Asp Ser Leu Ile Leu Ile
885 890 895Gln Thr Lys Asp Met Gln Glu Pro Glu Phe Val Tyr Tyr Asn
Ala Phe 900 905 910Thr Ser Ser Thr Val Ser Leu Ile Val Ser Lys His
Asp Asn Lys Phe 915 920 925Glu Thr Leu Ser Lys Asn Gln Lys Ile Leu
Phe Lys Asn Ala Asn Glu 930 935 940Lys Glu Val Ile Ala Lys Ser Ile
Gly Ile Gln Asn Leu Lys Val Phe945 950 955 960Glu Lys Tyr Ile Val
Ser Ala Leu Gly Glu Val Thr Lys Ala Glu Phe 965 970 975Arg Gln Arg
Glu Asp Phe Lys Lys Ser Gly Leu Pro Pro Leu Glu Arg 980 985 990Leu
Thr Leu Gly Ser Gly Gly Gly Gly Ser Gln Leu His Leu Pro Gln 995
1000 1005Val Leu Ala Asp Ala Val Ser Arg Leu Val Leu Gly Lys Phe
Gly 1010 1015 1020Asp Leu Thr Asp Asn Phe Ser Ser Pro His Ala Arg
Arg Lys Val 1025 1030 1035Leu Ala Gly Val Val Met Thr Thr Gly Thr
Asp Val Lys Asp Ala 1040 1045 1050Lys Val Ile Ser Val Ser Thr Gly
Thr Lys Cys Ile Asn Gly Glu 1055 1060 1065Tyr Met Ser Asp Arg Gly
Leu Ala Leu Asn Asp Cys His Ala Glu 1070 1075 1080Ile Ile Ser Arg
Arg Ser Leu Leu Arg Phe Leu Tyr Thr Gln Leu 1085 1090 1095Glu Leu
Tyr Leu Asn Asn Lys Asp Asp Gln Lys Arg Ser Ile Phe 1100 1105
1110Gln Lys Ser Glu Arg Gly Gly Phe Arg Leu Lys Glu Asn Val Gln
1115 1120 1125Phe His Leu Tyr Ile Ser Thr Ser Pro Cys Gly Asp Ala
Arg Ile 1130 1135 1140Phe Ser Pro His Glu Pro Ile Leu Glu Glu Pro
Ala Asp Arg His 1145 1150 1155Pro Asn Arg Lys Ala Arg Gly Gln Leu
Arg Thr Lys Ile Glu Ser 1160 1165 1170Gly Gln Gly Thr Ile Pro Val
Arg Ser Asn Ala Ser Ile Gln Thr 1175 1180 1185Trp Asp Gly Val Leu
Gln Gly Glu Arg Leu Leu Thr Met Ser Cys 1190 1195 1200Ser Asp Lys
Ile Ala Arg Trp Asn Val Val Gly Ile Gln Gly Ser 1205 1210 1215Leu
Leu Ser Ile Phe Val Glu Pro Ile Tyr Phe Ser Ser Ile Ile 1220 1225
1230Leu Gly Ser Leu Tyr His Gly Asp His Leu Ser Arg Ala Met Tyr
1235 1240 1245Gln Arg Ile Ser Asn Ile Glu Asp Leu Pro Pro Leu Tyr
Thr Leu 1250 1255 1260Asn Lys Pro Leu Leu Ser Gly Ile Ser Asn Ala
Glu Ala Arg Gln 1265 1270 1275Pro Gly Lys Ala Pro Asn Phe Ser Val
Asn Trp Thr Val Gly Asp 1280 1285 1290Ser Ala Ile Glu Val Ile Asn
Ala Thr Thr Gly Lys Asp Glu Leu 1295 1300 1305Gly Arg Ala Ser Arg
Leu Cys Lys His Ala Leu Tyr Cys Arg Trp 1310 1315 1320Met Arg Val
His Gly Lys Val Pro Ser His Leu Leu Arg Ser Lys 1325 1330 1335Ile
Thr Lys Pro Asn Val Tyr His Glu Ser Lys Leu Ala Ala Lys 1340 1345
1350Glu Tyr Gln Ala Ala Lys Ala Arg Leu Phe Thr Ala Phe Ile Lys
1355 1360 1365Ala Gly Leu Gly Ala Trp Val Glu Lys Pro Thr Glu Gln
Asp Gln 1370 1375 1380Phe Ser Leu Thr 138511865DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 118gtggaatagt ataacaatat gctaaatgtt gttatagtat
cccacacaaa ccgagcggtg 60tctgt 65119110DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
119gtggaatagt ataacaatat gctaaatgtt gttatagtat cccaccaaac
cgagcggtgt 60ctgtggtgga atagtataac aatatgctaa atgttgttat agtatcccac
110120110DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 120gtggaatagt ataacaatat gctaaatgtt
gttatagtat cccactacaa accgagcggt 60gtctggtgga atagtataac aatatgctaa
atgttgttat agtatcccac 110121110DNAArtificial SequenceDescription of
Artificial Sequence Synthetic polynucleotide 121gtggaatagt
ataacaatat gctaaatgtt gttatagtat cccactttac aaaccgagcg 60gtgtcgtgga
atagtataac aatatgctaa atgttgttat agtatcccac 110122110DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
122gtggaatagt ataacaatat gctaaatgtt gttatagtat cccacgtttt
acaaaccgag 60cggtggtgga atagtataac aatatgctaa atgttgttat agtatcccac
110123110DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 123gtggaatagt ataacaatat gctaaatgtt
gttatagtat cccacaagtt ttacaaaccg 60agcgggtgga atagtataac aatatgctaa
atgttgttat agtatcccac 110124429PRTUnknownDescription of Unknown
ADAR1 catalytic domain sequence 124Lys Ala Glu Arg Met Gly Phe Thr
Glu Val Thr Pro Val Thr Gly Ala1 5 10 15Ser Leu Arg Arg Thr Met Leu
Leu Leu Ser Arg Ser Pro Glu Ala Gln 20 25 30Pro Lys Thr Leu Pro Leu
Thr Gly Ser Thr Phe His Asp Gln Ile Ala 35 40 45Met Leu Ser His Arg
Cys Phe Asn Thr Leu Thr Asn Ser Phe Gln Pro 50 55 60Ser Leu Leu Gly
Arg Lys Ile Leu Ala Ala Ile Ile Met Lys Lys Asp65 70 75 80Ser Glu
Asp Met Gly Val Val Val Ser Leu Gly Thr Gly Asn Arg Cys 85 90 95Val
Lys Gly Asp Ser Leu Ser Leu Lys Gly Glu Thr Val Asn Asp Cys 100 105
110His Ala Glu Ile Ile Ser Arg Arg Gly Phe Ile Arg Phe Leu Tyr Ser
115 120 125Glu Leu Met Lys Tyr Asn Ser Gln Thr Ala Lys Asp Ser Ile
Phe Glu 130 135 140Pro Ala Lys Gly Gly Glu Lys Leu Gln Ile Lys Lys
Thr Val Ser Phe145 150 155 160His Leu Tyr Ile Ser Thr Ala Pro Cys
Gly Asp Gly Ala Leu Phe Asp 165 170 175Lys Ser Cys Ser Asp Arg Ala
Met Glu Ser Thr Glu Ser Arg His Tyr 180 185 190Pro Val Phe Glu Asn
Pro Lys Gln Gly Lys Leu Arg Thr Lys Val Glu 195 200 205Asn Gly Glu
Gly Thr Ile Pro Val Glu Ser Ser Asp Ile Val Pro Thr 210 215 220Trp
Asp Gly Ile Arg Leu Gly Glu Arg Leu Arg Thr Met Ser Cys Ser225 230
235 240Asp Lys Ile Leu Arg Trp Asn Val Leu Gly Leu Gln Gly Ala Leu
Leu 245 250 255Thr His Phe Leu Gln Pro Ile Tyr Leu Lys Ser Val Thr
Leu Gly Tyr 260 265 270Leu Phe Ser Gln Gly His Leu Thr Arg Ala Ile
Cys Cys Arg Val Thr 275 280 285Arg Asp Gly Ser Ala Phe Glu Asp Gly
Leu Arg His Pro Phe Ile Val 290 295 300Asn His Pro Lys Val Gly Arg
Val Ser Ile Tyr Asp Ser Lys Arg Gln305 310 315 320Ser Gly Lys Thr
Lys Glu Thr Ser Val Asn Trp Cys Leu Ala Asp Gly 325 330 335Tyr Asp
Leu Glu Ile Leu Asp Gly Thr Arg Gly Thr Val Asp Gly Pro 340 345
350Arg Asn Glu Leu Ser Arg Val Ser Lys Lys Asn Ile Phe Leu Leu Phe
355 360 365Lys Lys Leu Cys Ser Phe Arg Tyr Arg Arg Asp Leu Leu Arg
Leu Ser 370 375 380Tyr Gly Glu Ala Lys Lys Ala Ala Arg Asp Tyr Glu
Thr Ala Lys Asn385 390 395 400Tyr Phe Lys Lys Gly Leu Lys Asp Met
Gly Tyr Gly Asn Trp Ile Ser 405 410 415Lys Pro Gln Glu Glu Lys Asn
Phe Tyr Leu Cys Pro Val 420 425125385PRTUnknownDescription of
Unknown ADAR2 catalytic domain sequence 125Gln Leu His Leu Pro Gln
Val Leu Ala Asp Ala Val Ser Arg Leu Val1 5 10 15Leu Gly Lys Phe Gly
Asp Leu Thr Asp Asn Phe Ser Ser Pro His Ala 20 25 30Arg Arg Lys Val
Leu Ala Gly Val Val Met Thr Thr Gly Thr Asp Val 35 40 45Lys Asp Ala
Lys Val Ile Ser Val Ser Thr Gly Thr Lys Cys Ile Asn 50 55 60Gly Glu
Tyr Met Ser Asp Arg Gly Leu Ala Leu Asn Asp Cys His Ala65 70 75
80Glu Ile Ile Ser Arg Arg Ser Leu Leu Arg Phe Leu Tyr Thr Gln Leu
85 90 95Glu Leu Tyr Leu Asn Asn Lys Asp Asp Gln Lys Arg Ser Ile Phe
Gln 100 105 110Lys Ser Glu Arg Gly Gly Phe Arg Leu Lys Glu Asn Val
Gln Phe His 115 120 125Leu Tyr Ile Ser Thr Ser Pro Cys Gly Asp Ala
Arg Ile Phe Ser Pro 130 135 140His Glu Pro Ile Leu Glu Glu Pro Ala
Asp Arg His Pro Asn Arg Lys145 150 155 160Ala Arg Gly Gln Leu Arg
Thr Lys Ile Glu Ser Gly Glu Gly Thr Ile 165 170 175Pro Val Arg Ser
Asn Ala Ser Ile Gln Thr Trp Asp Gly Val Leu Gln 180 185 190Gly Glu
Arg Leu Leu Thr Met Ser Cys Ser Asp Lys Ile Ala Arg Trp 195 200
205Asn Val Val Gly Ile Gln Gly Ser Leu Leu Ser Ile Phe Val Glu Pro
210 215 220Ile Tyr Phe Ser Ser Ile Ile Leu Gly Ser Leu Tyr His Gly
Asp His225 230 235 240Leu Ser Arg Ala Met Tyr Gln Arg Ile Ser Asn
Ile Glu Asp Leu Pro 245 250 255Pro Leu Tyr Thr Leu Asn Lys Pro Leu
Leu Ser Gly Ile Ser Asn Ala 260 265 270Glu Ala Arg Gln Pro Gly Lys
Ala Pro Asn Phe Ser Val Asn Trp Thr 275 280 285Val Gly Asp Ser Ala
Ile Glu Val Ile Asn Ala Thr Thr Gly Lys Asp 290 295 300Glu Leu Gly
Arg Ala Ser Arg Leu Cys Lys His Ala Leu Tyr Cys Arg305 310 315
320Trp Met Arg Val His Gly Lys Val Pro Ser His Leu Leu Arg Ser Lys
325 330 335Ile Thr Lys Pro Asn Val Tyr His Glu Ser Lys Leu Ala Ala
Lys Glu 340 345 350Tyr Gln Ala Ala Lys Ala Arg Leu Phe Thr Ala Phe
Ile Lys Ala Gly 355 360 365Leu Gly Ala Trp Val Glu Lys Pro Thr Glu
Gln Asp Gln Phe Ser Leu 370 375
380Thr385126298PRTUnknownDescription of Unknown ADAR dsRBD sequence
126Met Asp Ile Glu Asp Glu Glu Asn Met Ser Ser Ser Ser Thr Asp Val1
5 10 15Lys Glu Asn Arg Asn Leu Asp Asn Val Ser Pro Lys Asp Gly Ser
Thr 20 25 30Pro Gly Pro Gly Glu Gly Ser Gln Leu Ser Asn Gly Gly Gly
Gly Gly 35 40 45Pro Gly Arg Lys Arg Pro Leu Glu Glu Gly Ser Asn Gly
His Ser Lys 50 55 60Tyr Arg Leu Lys Lys Arg Arg Lys Thr Pro Gly Pro
Val Leu Pro Lys65 70 75 80Asn Ala Leu Met Gln Leu Asn Glu Ile Lys
Pro Gly Leu Gln Tyr Thr 85 90 95Leu Leu Ser Gln Thr Gly Pro Val His
Ala Pro Leu Phe Val Met Ser 100 105 110Val Glu Val Asn Gly Gln Val
Phe Glu Gly Ser Gly Pro Thr Lys Lys 115 120 125Lys Ala Lys Leu His
Ala Ala Glu Lys Ala Leu Arg Ser Phe Val Gln 130 135 140Phe Pro Asn
Ala Ser Glu Ala His Leu Ala Met Gly Arg Thr Leu Ser145 150 155
160Val Asn Thr Asp Phe Thr Ser Asp Gln Ala Asp Phe Pro Asp Thr Leu
165 170 175Phe Asn Gly Phe Glu Thr Pro Asp Lys Ala Glu Pro Pro Phe
Tyr Val 180 185 190Gly Ser Asn Gly Asp Asp Ser Phe Ser Ser Ser Gly
Asp Leu Ser Leu 195 200 205Ser Ala Ser Pro Val Pro Ala Ser Leu Ala
Gln Pro Pro Leu Pro Val 210 215 220Leu Pro Pro Phe Pro Pro Pro Ser
Gly Lys Asn Pro Val Met Ile Leu225 230 235 240Asn Glu Leu Arg Pro
Gly Leu Lys Tyr Asp Phe Leu Ser Glu Ser Gly 245 250 255Glu Ser His
Ala Lys Ser Phe Val Met Ser Val Val Val Asp Gly Gln 260 265 270Phe
Phe Glu Gly Ser Gly Arg Asn Lys Lys Leu Ala Lys Ala Arg Ala 275 280
285Ala Gln Ser Ala Leu Ala Ala Ile Phe Asn 290
295127564PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 127Met Leu Arg Ser Phe Val Gln Phe Pro Asn
Ala Ser Glu Ala His Leu1 5 10 15Ala Met Gly Arg Thr Leu Ser Val Asn
Thr Asp Phe Thr Ser Asp Gln 20 25 30Ala Asp Phe Pro Asp Thr Leu Phe
Asn Gly Phe Glu Thr Pro Asp Lys 35 40 45Ala Glu Pro Pro Phe Tyr Val
Gly Ser Asn Gly Asp Asp Ser Phe Ser 50 55 60Ser Ser Gly Asp Leu Ser
Leu Ser Ala Ser Pro Val Pro Ala Ser Leu65 70 75 80Ala Gln Pro Pro
Leu Pro Val Leu Pro Pro Phe Pro Pro Pro Ser Gly 85 90 95Lys Asn Pro
Val Met Ile Leu Asn Glu Leu Arg Pro Gly Leu Lys Tyr 100 105 110Asp
Phe Leu Ser Glu Ser Gly Glu Ser His Ala Lys Ser Phe Val Met 115 120
125Ser Val Val Val Asp Gly Gln Phe Phe Glu Gly Ser Gly Arg Asn Lys
130 135 140Lys Leu Ala Lys Ala Arg Ala Ala Gln Ser Ala Leu Ala Ala
Ile Phe145 150 155 160Asn Leu His Leu Asp Gln Thr Pro Ser Arg Gln
Pro Ile Pro Ser Glu 165 170 175Gly Leu Gln Leu His Leu Pro Gln Val
Leu Ala Asp Ala Val Ser Arg 180 185 190Leu Val Leu Gly Lys Phe Gly
Asp Leu Thr Asp Asn Phe Ser Ser Pro 195 200 205His Ala Arg Arg Lys
Val Leu Ala Gly Val Val Met Thr Thr Gly Thr 210 215 220Asp Val Lys
Asp Ala Lys Val Ile Ser Val Ser Thr Gly Thr Lys Cys225 230 235
240Ile Asn Gly Glu Tyr Met Ser Asp Arg Gly Leu Ala Leu Asn Asp Cys
245 250 255His Ala Glu Ile Ile Ser Arg Arg Ser Leu Leu Arg Phe Leu
Tyr Thr 260 265 270Gln Leu Glu Leu Tyr Leu Asn Asn Lys Asp Asp Gln
Lys Arg Ser Ile 275 280 285Phe Gln Lys Ser Glu Arg Gly Gly Phe Arg
Leu Lys Glu Asn Val Gln 290 295 300Phe His Leu Tyr Ile Ser Thr Ser
Pro Cys Gly Asp Ala Arg Ile Phe305 310 315 320Ser Pro His Glu Pro
Ile Leu Glu Glu Pro Ala Asp Arg His Pro Asn 325 330 335Arg Lys Ala
Arg Gly Gln Leu Arg Thr Lys Ile Glu Ser Gly Glu Gly 340 345 350Thr
Ile Pro Val Arg Ser Asn Ala Ser Ile Gln Thr Trp Asp Gly Val 355 360
365Leu Gln Gly Glu Arg Leu Leu Thr Met Ser Cys Ser Asp Lys Ile Ala
370 375 380Arg Trp Asn Val Val Gly Ile Gln Gly Ser Leu Leu Ser Ile
Phe Val385 390 395 400Glu Pro Ile Tyr Phe Ser Ser Ile Ile Leu Gly
Ser Leu Tyr His Gly 405 410 415Asp His Leu Ser Arg Ala Met Tyr Gln
Arg Ile Ser Asn Ile Glu Asp 420 425 430Leu Pro Pro Leu Tyr Thr Leu
Asn Lys Pro Leu Leu Ser Gly Ile Ser 435 440 445Asn Ala Glu Ala Arg
Gln Pro Gly Lys Ala Pro Asn Phe Ser Val Asn 450 455 460Trp Thr Val
Gly Asp Ser Ala Ile Glu Val Ile Asn Ala Thr Thr Gly465 470 475
480Lys Asp Glu Leu Gly Arg Ala Ser Arg Leu Cys Lys His Ala Leu Tyr
485 490 495Cys Arg Trp Met Arg Val His Gly Lys Val Pro Ser His Leu
Leu Arg 500 505 510Ser Lys Ile Thr Lys Pro Asn Val Tyr His Glu Ser
Lys Leu Ala Ala 515 520 525Lys Glu Tyr Gln Ala Ala Lys Ala Arg Leu
Phe Thr Ala Phe Ile Lys 530 535 540Ala Gly Leu Gly Ala Trp Val Glu
Lys Pro Thr Glu Gln Asp Gln Phe545 550 555 560Ser Leu Thr
Pro12836DNAMus sp. 128ctcacagaca ccgctcggtt tgtaaaactt ttcttc
3612936DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide
129ctcacagaca ccgctcagtt tgtaaaactt ttcttc 3613036DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 130ctcacagaca ccgctcagtt tgtaaaactt ttcttc
3613136DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 131ctcacagaca ccgctcatgt cttatctagc
atgaca 3613236DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 132ctcacagaca ccgctcgtgt
cttatctagc atgaca 3613368DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(1)..(15)a, c, t, g, unknown or
othermodified_base(17)..(19)a, c, t, g, unknown or other
133nnnnnnnnnn nnnnncnnnt ccaccctatg atattgttgt aaatcgtata
acaatatgat 60aaggtggg 6813465DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(1)..(13)a, c, t, g, unknown or
othermodified_base(15)..(20)a, c, t, g, unknown or other
134nnnnnnnnnn nnncnnnnnn caccctatga tattgttgta aatcgtataa
caatatgata 60aggtg 6513566DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(1)..(14)a, c, t, g, unknown or
othermodified_base(16)..(21)a, c, t, g, unknown or other
135nnnnnnnnnn nnnncnnnnn ncaccctctg ctcttgttgt aaatcgtata
acaagaggag 60aaggtg 6613668DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(1)..(15)a, c, t, g, unknown or
othermodified_base(17)..(19)a, c, t, g, unknown or other
136nnnnnnnnnn nnnnncnnnt ccaccctctg ctcttgttgt aaatcgtata
acaagaggag 60aaggtggg 6813766DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(1)..(14)a, c, t, g, unknown or
othermodified_base(16)..(21)a, c, t, g, unknown or other
137nnnnnnnnnn nnnncnnnnn nccacctctg ctcttgttgt aaatcgtata
acaagaggag 60aagtgg 6613866DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(1)..(13)a, c, t, g, unknown or
othermodified_base(15)..(21)a, c, t, g, unknown or other
138nnnnnnnnnn nnncnnnnnn nccacctctg ctcttgttgt aaatcgtata
acaagaggag 60aagtgg 6613966DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(1)..(14)a, c, t, g, unknown or
othermodified_base(16)..(21)a, c, t, g, unknown or other
139nnnnnnnnnn nnnncnnnnn ncaccctctg ctcttgttgc aaatcggata
acaagaggag 60aaggtg 6614068DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(1)..(15)a, c, t, g, unknown or
othermodified_base(17)..(19)a, c, t, g, unknown or other
140nnnnnnnnnn nnnnncnnnt ccaccctctg ctcttgttgc aaatcggata
acaagaggag 60aaggtggg 6814166DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(1)..(14)a, c, t, g, unknown or
othermodified_base(16)..(21)a, c, t, g, unknown or other
141nnnnnnnnnn nnnncnnnnn nccacctctg ctcttgttgc aaatcggata
acaagaggag 60aagtgg 6614266DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(1)..(13)a, c, t, g, unknown or
othermodified_base(15)..(21)a, c, t, g, unknown or other
142nnnnnnnnnn nnncnnnnnn nccacctctg ctcttgttgc aaatcggata
acaagaggag 60aagtgg 6614373DNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(1)..(10)a, c, t, g, unknown or
othermodified_base(12)..(18)a, c, t, g, unknown or other
143nnnnnnnnnn cnnnnnnncc acagctcctc tgctcttgtt gcaaatcgga
taacaagagg 60agaagagctg tgg 7314473DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotidemodified_base(1)..(10)a, c, t, g, unknown or
othermodified_base(12)..(18)a, c, t, g, unknown or other
144nnnnnnnnnn cnnnnnnncc acagctcctc tgctcttgtt gtaaatcgta
taacaagagg 60agaagagctg tgg 7314573DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotidemodified_base(1)..(10)a, c, t, g, unknown or
othermodified_base(12)..(18)a, c, t, g, unknown or other
145nnnnnnnnnn cnnnnnnncc acagctccta tgatattgtt gtaaatcgta
taacaatatg 60ataagagctg tgg 73146109DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
polynucleotidemodified_base(45)..(64)a, c, t, g, unknown or other
146tggaatagta taacaatatg ctaaatgttg ttatagtatc ccacnnnnnn
nnnnnnnnnn 60nnnngtggaa tagtataaca atatgctaaa tgttgttata gtatcccac
10914786DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotidemodified_base(37)..(86)a, c, t, g, unknown
or other 147caacattatc ggggagtttt gacctccaag gtgttgnnnn nnnnnnnnnn
nnnnnnnnnn 60nnnnnnnnnn nnnnnnnnnn nnnnnn 86148102DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
polynucleotidemodified_base(1)..(22)a, c, t, g, unknown or other
148nnnnnnnnnn nnnnnnnnnn nngttttagt ccctgaaaag ggactaaaat
aaagagtttg 60cgggactctg cggggttaca atcccctaaa accgcttttt tt
10214941DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 149aaagtctcac agacaccgct cagtttgtaa
aacttttctt c 4115065DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 150gtggaatagt ataacaatat
gctaaatgtt gttatagtat cccactgtct gtggcgagcc 60aaaca
6515166DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 151gtggaatagt ataacaatat gctaaatgtt
gttatagtat cccacgtgtc tgtggcgagc 60caaaca 6615265DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 152aagttttaca aaccgagcgg caccctatga tattgttgta
aatcgtataa caatatgata 60aggtg 65153109DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
153tggaatagta taacaatatg ctaaatgttg ttatagtatc ccaccaaacc
gagcggtgtc 60tgtggtggaa tagtataaca atatgctaaa tgttgttata gtatcccac
10915454DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 154caaaccgagc ggtgtctgtg ggccaacatg
aggatcaccc atgtctgcag ggcc 5415562DNAArtificial SequenceDescription
of Artificial Sequence Synthetic oligonucleotide 155aacatgagga
tcacccatgt ccaaaccgag cggtgtctgt gaacatgagg atcacccatg 60tc
6215639DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 156caaaccgagc ggtgtctgtg gggccctgaa
gaagggccc 3915758DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 157gggccctgaa gaagggcccc
aaaccgagcg gtgtctgtgg ggccctgaag aagggccc 5815816DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
158cggcctcagt gagcga 1615921DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 159ggaaccccta gtgatggagt t
2116020DNAUnknownDescription of Unknown target sequence
160gggaaatcca gctagcggca 2016120DNAUnknownDescription of Unknown
target sequence 161gggaaaactg tctagttccc
2016220DNAUnknownDescription of Unknown target sequence
162taattgactg gctagtacag 2016320DNAUnknownDescription of Unknown
target sequence 163gagctttttg cttagcactg 201641884DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
164atggataaaa aaccattaga tgttttaata tctgcgaccg ggctctggat
gtccaggact 60ggcacgctcc acaaaatcaa gcaccatgag gtctcaagaa gtaaaatata
cattgaaatg 120gcgtgtggag accatcttgt tgtgaataat tccaggagtt
gtagaacagc cagagcattc 180agacatcata agtacagaaa aacctgcaaa
cgatgtaggg tttcggacga ggatatcaat 240aattttctca caagatcaac
cgaaagcaaa aacagtgtga aagttagggt agtttctgct 300ccaaaggtca
aaaaagctat gccgaaatca gtttcaaggg ctccgaagcc tctggaaaat
360tctgtttctg caaaggcatc aacgaacaca tccagatctg taccttcgcc
tgcaaaatca 420actccaaatt cgtctgttcc cgcatcggct cctgctcctt
cacttacaag aagccagctt 480gatagggttg aggctctctt aagtccagag
gataaaattt ctctaaatat ggcaaagcct 540ttcagggaac ttgagcctga
acttgtgaca agaagaaaaa acgattttca gcggctctat 600accaatgata
gagaagacta cctcggtaaa ctcgaacgtg atattacgaa atttttcgta
660gaccggggtt ttctggagat aaagtctcct atccttattc cggcggaata
cgtggagaga 720atgggtatta ataatgatac tgaactttca aaacagatct
tccgggtgga taaaaatctc 780tgcttgaggc caatgcttgc cccgactctt
tacaactatc tgcgaaaact cgataggatt 840ttaccaggcc caataaaaat
tttcgaagtc ggaccttgtt accggaaaga gtctgacggc 900aaagagcacc
tggaagaatt tactatggtg aacttctgtc agatgggttc gggatgtact
960cgggaaaatc ttgaagctct catcaaagag tttctggact atctggaaat
cgacttcgaa 1020atcgtaggag attcctgtat ggtctttggg gatactcttg
atataatgca cggggacctg 1080gagctttctt cggcagtcgt cgggccagtt
tctcttgata gagaatgggg tattgacaaa 1140ccatggatag gtgcaggttt
tggtcttgaa cgcttgctca aggttatgca cggctttaaa 1200aacattaaga
gggcatcaag gtccgaatct tactataatg ggatttcaac caatctgtta
1260taaagcggcc gcgtcgacgg gcccgcggaa ttccgccccc cccccctctc
cctccccccc 1320ccctaacgtt actggccgaa gccgcttgga ataaggccgg
tgtgcgtttg tctatatgtt 1380attttccacc atattgccgt cttttggcaa
tgtgagggcc cggaaacctg gccctgtctt 1440cttgacgagc attcctaggg
gtctttcccc tctcgccaaa ggaatgcaag gtctgttgaa 1500tgtcgtgaag
gaagcagttc ctctggaagc ttcttgaaga caaacaacgt ctgtagcgac
1560cctttgcagg cagcggaacc ccccacctgg cgacaggtgc ctctgcggcc
aaaagccacg 1620tgtataagat acacctgcaa aggcggcaca accccagtgc
cacgttgtga gttggatagt 1680tgtggaaaga gtcaaatggc tctcctcaag
cgtattcaac aaggggctga aggatgccca 1740gaaggtaccc cattgtatgg
gatctgatct ggggcctcgg tgcacatgct ttacatgtgt 1800ttagtcgagg
ttaaaaaaac gtctaggccc cccgaaccac ggggacgtgg ttttcctttg
1860aaaaacacga tgataatatg gcca 18841652106DNAArtificial
SequenceDescription of Artificial Sequence Synthetic polynucleotide
165atggatatag aagatgaaga aaacatgagt tccagcagca ctgatctgaa
ggaaaaccgc 60aatctggaca acgtgtcccc caaggatggc agcacacctg ggcctggcga
gggctctcag 120ctctccaatg ggggtggtgg tggccccggc agaaagcggc
ccctggagga gggcagcaat 180ggccactcca agtaccgcct gaagaaaagg
aggaaaacac cagggcccgt cctccccaag 240aacgccctga tgcagctgaa
tgagatcaag cctggtttgc agtacacact cctgtcccag 300actgggcccg
tgcacgcgcc tttgtttgtc atgtctgtgg aggtgaatgg ccaggttttt
360gagggctctg gtcccacaaa gaaaaaggca aaactccatg ctgctgagaa
ggccttgagg 420tctttcgttc agtttcctaa tgcctctgag gcccacctgg
ccatggggag gaccctgtct 480gtcaacacgg acttcacatc tgaccaggcc
gacttccctg acacgctctt caatggtttt 540gaaactcctg acaaggcgga
gcctcccttt tacgtgggct ccaatgggga tgactccttc 600agttccagcg
gggacctcag cttgtctgct tccccggtgc ctgccagcct agcccagcct
660cctctccctg tcttaccacc attcccaccc ccgagtggga agaatcccgt
gatgatcttg 720aacgaactgc gcccaggact caagtatgac ttcctctccg
agagcgggga gagccatgcc 780aagagcttcg tcatgtctgt ggtcgtggat
ggtcagttct ttgaaggctc ggggagaaac 840aagaagcttg ccaaggcccg
ggctgcgcag tctgccctgg ccgccatttt taacttgcac 900ttggatcaga
cgccatctcg ccagcctatt cccagtgagg gtcttcagct gcatttaccg
960caggttttag ctgacgctgt ctcacgcctg gtcctgggta agtttggtga
cctgaccgac 1020aacttctcct cccctcacgc tcgcagaaaa gtgctggctg
gagtcgtcat gacaacaggc 1080acagatgtta aagatgccaa ggtgataagt
gtttctacag gaacaaaatg tattaatggt 1140gaatacatga gtgatcgtgg
ccttgcatta aatgactgcc atgcagaaat aatatctcgg 1200agatccttgc
tcagatttct ttatacacaa cttgagcttt acttaaataa caaagatgat
1260caaaaaagat ccatctttca gaaatcagag cgaggggggt ttaggctgaa
ggagaatgtc 1320cagtttcatc tgtacatcag cacctctccc tgtggagatg
ccagaatctt ctcaccacat 1380gagccaatcc tggaagaacc agcagataga
cacccaaatc gtaaagcaag aggacagcta 1440cggaccaaaa tagagtctgg
tgaggggacg attccagtgc gctccaatgc gagcatccaa 1500acgtgggacg
gggtgctgca aggggagcgg ctgctcacca tgtcctgcag tgacaagatt
1560gcacgctgga acgtggtggg catccaggga tccctgctca gcattttcgt
ggagcccatt 1620tacttctcga gcatcatcct gggcagcctt taccacgggg
accacctttc cagggccatg 1680taccagcgga tctccaacat agaggacctg
ccacctctct acaccctcaa caagcctttg 1740ctcagtggca tcagcaatgc
agaagcacgg cagccaggga aggcccccaa cttcagtgtc 1800aactggacgg
taggcgactc cgctattgag gtcatcaacg ccacgactgg gaaggatgag
1860ctgggccgcg cgtcccgcct gtgtaagcac gcgttgtact gtcgctggat
gcgtgtgcac 1920ggcaaggttc cctcccactt actacgctcc aagattacca
agcccaacgt gtaccatgag 1980tccaagctgg cggcaaagga gtaccaggcc
gccaaggcgc gtctgttcac agccttcatc 2040aaggcggggc tgggggcctg
ggtggagaag cccaccgagc aggaccagtt ctcactcacg 2100ccctga
2106166632DNAArtificial SequenceDescription of Artificial Sequence
Synthetic polynucleotide 166accggtttta gtccctgaag gaagggacta
aaataaagag tttgcgggac tctgcggggt 60tacaatcccc taaaaccgct aaggctagtc
cgttatcaac ttgaaaaagt ggcaccgagt 120cggtgctttt ttgctagcct
agacccagct ttcttgtaca aagttggcat taatacgcgt 180tgacattgat
tattgactag ttattaatag taatcaatta cggggtcatt agttcatagc
240ccatatatgg agttccgcgt tacataactt acggtaaatg gcccgcctgg
ctgaccgccc 300aacgaccccc gcccattgac gtcaataatg acgtatgttc
ccatagtaac gccaataggg 360actttccatt gacgtcaatg ggtggagtat
ttacggtaaa ctgcccactt ggcagtacat 420caagtgtatc atatgccaag
tacgccccct attgacgtca atgacggtaa atggcccgcc 480tggcattatg
cccagtacat gaccttatgg gactttccta cttggcagta catctacgta
540ttagtcatcg ctattaccat ggtgatgcgg ttttggcagt acatcaatgg
gcgtggatag 600cggtttgact cacggggatt tccaagtctc ca
63216719DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 167agggcgatgc cacctgggg
1916819DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 168agggcgatgc gacctgggg
1916919DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 169agggcgatgg gacctgggg
1917031DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 170atcgccctga aaagggcgat gccacctggg g
3117131DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 171atcgccctga aaagggcgat gcgacctggg g
3117231DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 172atcgccctga aaagggcgat gggacctggg g
3117316DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotidemodified_base(13)..(13)a, c, t, g, unknown
or other 173accgctcagt ttntaa 1617416DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotidemodified_base(7)..(8)a, c, t, g, unknown or
othermodified_base(12)..(12)a, c, t, g, unknown or other
174ccgctcnntt tntaaa 1617531DNAUnknownDescription of Unknown target
sequence 175gggcgatgcc acctaaggca agctgaccct g 3117619DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 176gccctaggtg gcatcgccc 1917719DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 177cagggtcagc ttgccctag 1917819DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 178gccccaggtg gcatcgccc 1917919DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 179agggtcagct tgccccagg 1918066RNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotidemodified_base(46)..(51)a, c, u, g, unknown or
othermodified_base(53)..(66)a, c, u, g, unknown or other
180guggaauagu auaacaauau gcuaaauguu guuauaguau cccacnnnnn
ncnnnnnnnn 60nnnnnn 6618168RNAArtificial SequenceDescription of
Artificial Sequence Synthetic
oligonucleotidemodified_base(50)..(52)a, c, u, g, unknown or
othermodified_base(54)..(68)a, c, u, g, unknown or other
181ggguggaaua guauaacaau augcuaaaug uuguuauagu aucccaccun
nncnnnnnnn 60nnnnnnnn 6818224DNAUnknownDescription of Unknown
target sequence 182tcacagacac cgctcagttt gtaa 2418316DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 183caaaccgagc ggtgtc 1618416DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 184acaaaccgag cggtgt 1618516DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 185tacaaaccga gcggtg 1618616DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 186ttacaaaccg agcggt 1618717DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 187caaaccgagc ggtgtct 1718817DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 188acaaaccgag cggtgtc 1718917DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 189tacaaaccga gcggtgt 1719017DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 190ttacaaaccg agcggtg 1719118DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 191caaaccgagc ggtgtctg 1819218DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 192acaaaccgag cggtgtct 1819318DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 193tacaaaccga gcggtgtc 1819418DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 194ttacaaaccg agcggtgt 1819519DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 195caaaccgagc ggtgtctgt 1919619DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 196acaaaccgag cggtgtctg 1919719DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 197tacaaaccga gcggtgtct 1919819DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 198ttacaaaccg agcggtgtc 1919920DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 199caaaccgagc ggtgtctgtg 2020020DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 200acaaaccgag cggtgtctgt 2020120DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 201tacaaaccga gcggtgtctg 2020220DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 202ttacaaaccg agcggtgtct 2020321DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 203caaaccgagc ggtgtctgtg a 2120421DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 204acaaaccgag cggtgtctgt g 2120521DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 205tacaaaccga gcggtgtctg t 2120621DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 206ttacaaaccg agcggtgtct g 2120714DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 207agcaataaaa tggc 1420814DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 208agcaataaaa tggc 1420939DNAMus sp. 209gagcaataaa
atggcttcaa ctatctgagt gacactgtg 3921039DNAMus sp. 210gagcaataaa
atggcttcaa ctatctgagt gacactgtg 3921139DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 211gagccataaa atggcttcaa ctatctgagt gacactgtg
3921239DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 212gagcaataaa attgcttcaa ctatctgagt
gacactgtg 3921339DNAMus sp. 213gagcaataaa atggcttcaa ctatctgagt
gacactgtg 3921439DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 214gagcaatgga atggcttcaa
ctatctgagt gacactgtg 3921539DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 215gagccataaa
atggcttcaa ctatctgagt gacactgtg 3921639DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 216gagcaataaa attgcttcaa ctatctgagt gacactgtg
3921713DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotidemodified_base(12)..(12)a, c, t, g, unknown
or other 217ccgctcagtt tnt 1321813DNAArtificial SequenceDescription
of Artificial Sequence Synthetic
oligonucleotidemodified_base(7)..(8)a, c, t, g, unknown or
othermodified_base(12)..(12)a, c, t, g, unknown or other
218ccgctcnntt tnt 1321940DNAMus sp. 219tgaaagtctc acagacaccg
ctcatgtctt atctagcatg 4022040DNAMus sp. 220tgaaagtctc acagacaccg
ctcatgtctt atctagcatg 4022140DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 221tgaaagtctc
ccagacaccg ctcatgtctt atctagcatg 4022240DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 222tgcaagtctc acagacaccg ctcatgtctt atctagcatg
4022340DNAMus sp. 223tgaaagtctc acagacaccg ctcatgtctt atctagcatg
4022440DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 224tgaaagtctc acagacaccg ctcgtgtctt
atctagcatg 4022540DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 225tgaaagtctc ccagacaccg
ctcatgtctt atctagcatg 4022640DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 226tgcaagtctc
acagacaccg ctcatgtctt atctagcatg 4022766RNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotidemodified_base(46)..(51)a, c, u, g, unknown or
othermodified_base(53)..(66)a, c, u, g, unknown or other
227guggaauagu auaacaauau gcuaaauguu guuauaguau cccacnnnnn
ncnnnnnnnn 60nnnnnn 6622839DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 228gccacctgag
gcaagctgac cctgaagttc atctgcacc 3922939DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 229gccacctgag gcaagctgac cctgaagttc atctgcacc
3923039DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 230gccccctgag gcaagctgac cctgaagttc
atctgcacc 3923139DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 231gccacctgag gcaagctgac
cctgcagttc atctgcacc 3923239DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 232gccacctgag
gccagctgac cctgaagttc atctgcacc 3923339DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 233gccacctgag gcaggctgac cctgaagttc atctgcacc
3923439DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 234gccacctgag gcaagctgac cctgaagttc
atctgcacc 3923539DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 235gccacctgag gcaagctgac
cctgaggttc atctgcacc 3923639DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 236gccgcctgag
gcaagctgac cctgaagttc atctgcacc 3923739DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 237gccacctggg gcaagctgac cctgaagttc atctgcacc
3923839DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 238gccacctgag gcaggctgac cctgaagttc
atctgcacc 3923939DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 239gccacctgag gcgagctgac
cctgaagttc atctgcacc 3924039DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 240gccgcctgag
gcaagctgac cctgaggttc atctgcacc 3924139DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 241gccgcctgag gcaggctgac cctgaagttc atctgcacc
3924239DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 242gccacctgag gcaagctgac cctgaagttc
atctgcacc 3924339DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 243gccacctggg gcaagctgac
cctgaagttc atctgcacc 3924439DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 244gccacctgag
gccagctgac cctgaagttc atctgcacc 3924540DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 245cagacaccgc tcagtttgta aaacttttct tccttccaaa
4024640DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 246cagacaccgc tcagtttgta aaacttttct
tccttccaaa 4024740DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 247cagacaccgc tcagtttgta
aaacttttct tccttccaca 4024840DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 248cagacaccgc
tcagtttgta aaacttttct tccttccaac 4024940DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 249cagacaccgc tcagtttgtg aaacttttct tccttccaaa
4025040DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 250cagacaccgc tcagtttgta acacttttct
tccttccaaa 4025140DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 251cagacaccgc tcagtttgta
aaccttttct tccttccaaa 4025240DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 252cagacaccgc
tcagtttgta aaacttttct tccttccaaa 4025340DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 253cagacaccgc tcggtttgta aaacttttct tccttccaaa
4025440DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 254cagacaccgc tcagtttgtg aaacttttct
tccttccaaa 4025540DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 255cagacaccgc tcggtttgtg
aaacttttct tccttccaaa 4025640DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 256cagacaccgc
tcagtttgta gaacttttct tccttccaaa 4025740DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 257cagacaccgc tcagtttgta aaacttttct tccttccaga
4025840DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 258cagacaccgc tcagtttgta aaacttttct
tccttccaaa 4025940DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 259cagacaccgc tcggtttgta
aaacttttct tccttccaaa 4026040DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 260cagacaccgc
tcagtttgta aaacttttct tccttccaca 4026140DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 261cagacaccgc tcagtttgta aaacttttct tccttccaac
4026240DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 262cagacaccgc tcggtttgtg aaacttttct
tccttccaaa 4026340DNAArtificial SequenceDescription of Artificial
Sequence Synthetic oligonucleotide 263cagacaccgc tcagtttgta
acacttttct tccttccaaa 4026440DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 264cagacaccgc
tcagtttgtg aaacttttct tccttccaaa 4026562DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 265aacatgagga tcacccatgt ccaaaccgag cggtgtctgt
gaacatgagg atcacccatg 60tc 6226662DNAArtificial SequenceDescription
of Artificial Sequence Synthetic oligonucleotide 266aacatgagga
tcacccatgt ctacaaaccg agcggtgtct gaacatgagg atcacccatg 60tc
6226762DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 267aacatgagga tcacccatgt ctttacaaac
cgagcggtgt caacatgagg atcacccatg 60tc 6226862DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 268aacatgagga tcacccatgt cgttttacaa accgagcggt
gaacatgagg atcacccatg 60tc 6226962DNAArtificial SequenceDescription
of Artificial Sequence Synthetic oligonucleotide 269aacatgagga
tcacccatgt caagttttac aaaccgagcg gaacatgagg atcacccatg 60tc
622705PRTMus sp. 270Thr Ala Arg Val Leu1 527115DNAMus
sp.CDS(1)..(15) 271acc gct cgt gtc tta 15Thr Ala Arg Val Leu1
52725PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 272Thr Ala His Val Leu1 527315DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotideCDS(1)..(15) 273acc gct cat gtc tta 15Thr Ala His
Val Leu1 527421PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 274Thr Ala Gln Phe Val Lys Leu Phe Phe
Leu Pro Lys Phe Ile Ser Asn1 5 10 15Ser Asp Gly Val Leu
2027563DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotideCDS(1)..(63) 275acc gct cag ttt gta aaa
ctt ttc ttc ctt cca aag ttt att tca aac 48Thr Ala Gln Phe Val Lys
Leu Phe Phe Leu Pro Lys Phe Ile Ser Asn1 5 10 15tct gat ggt gtc tta
63Ser Asp Gly Val Leu 20
* * * * *