U.S. patent application number 17/483331 was filed with the patent office on 2022-05-12 for targeting nuclear-encoded recombinant proteins to the chloroplast in microalgae.
The applicant listed for this patent is TOTAL RAFFINAGE CHIMIE. Invention is credited to Mariette BEDHOMME, Severine COLLIN, Giovanni FINAZZI, Laurent FOURAGE, Frederic LAEUFFER, Leonardo MAGNECHI, Eric MARECHAL.
Application Number | 20220145313 17/483331 |
Document ID | / |
Family ID | 1000006108374 |
Filed Date | 2022-05-12 |
United States Patent
Application |
20220145313 |
Kind Code |
A1 |
MAGNECHI; Leonardo ; et
al. |
May 12, 2022 |
Targeting Nuclear-Encoded Recombinant Proteins to the Chloroplast
in Microalgae
Abstract
The application generally relates to chloroplast targeting of
nuclear-encoded proteins of interest in microalgae. Provided herein
are expression cassettes comprising a nucleotide sequence encoding
a chloroplast targeting peptide operably linked to a nucleotide
sequence encoding a protein of interest, wherein said chloroplast
targeting peptide comprises the bipartite targeting sequence of the
phosphoribulokinase of Nannochloropsis gaditana (NgPRK BTS). The
invention further provides vectors comprising the expression
cassettes, and microalgae having stably incorporated or transiently
expressed into their nuclear genomes an expression cassette
described above. Methods are also provided for the production of a
protein of interest in the chloroplast of a microalga, as well as
methods for modulating chloroplast pathways.
Inventors: |
MAGNECHI; Leonardo;
(Edinburgh, GB) ; MARECHAL; Eric; (Grenoble,
FR) ; FINAZZI; Giovanni; (Fontaine, FR) ;
BEDHOMME; Mariette; (Vif, FR) ; COLLIN; Severine;
(Sassenage, FR) ; LAEUFFER; Frederic; (Paris,
FR) ; FOURAGE; Laurent; (Suresnes, FR) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
TOTAL RAFFINAGE CHIMIE |
Courbevoie |
|
FR |
|
|
Family ID: |
1000006108374 |
Appl. No.: |
17/483331 |
Filed: |
September 23, 2021 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16465599 |
May 31, 2019 |
11162107 |
|
|
PCT/EP2017/081451 |
Dec 5, 2017 |
|
|
|
17483331 |
|
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 14/405 20130101;
C12N 15/8214 20130101; C12N 15/8221 20130101; C07K 2319/08
20130101; A01G 33/00 20130101; C12N 15/8257 20130101; C12N 5/04
20130101; C12N 9/1205 20130101 |
International
Class: |
C12N 15/82 20060101
C12N015/82; A01G 33/00 20060101 A01G033/00; C07K 14/405 20060101
C07K014/405; C12N 5/04 20060101 C12N005/04; C12N 9/12 20060101
C12N009/12 |
Foreign Application Data
Date |
Code |
Application Number |
Dec 5, 2016 |
EP |
16290225.8 |
Claims
1.-15. (canceled)
16. An isolated nucleic acid comprising: (a) a first nucleotide
sequence having at least 98% sequence identity to SEQ ID NO: 9,
wherein said first nucleotide sequence encodes a chloroplast
targeting peptide; and, operably linked to the first nucleotide
sequence, (b) a second nucleotide sequence encoding a protein of
interest, wherein the protein of interest is not Nannochloropsis
gaditana phoshoribulokinase (PRK), wherein the protein of interest
is selected from the group comprising a chloroplast transporter, a
protein of transcription or translation machinery, a transcription
factors/enhancer/silencer, a nuclease, and a chaperone.
17. A nucleic acid expression cassette comprising (a) a first
nucleotide sequence encoding a chloroplast targeting peptide
operably linked to a second nucleotide sequence encoding a protein
of interest that is not Nannochloropsis gaditana PRK and (b) a
promoter and a terminator operably linked to the first and second
nucleotide sequences, wherein the chloroplast targeting peptide
comprises SEQ ID NO: 8, and wherein the expression cassette ensures
expression of the first and second nucleotide sequences in the
nucleus of a host cell transformed with said expression cassette.
wherein the protein of interest is selected from the group
comprising a chloroplast transporter, a protein of transcription or
translation machinery, a transcription factors/enhancer/silencer, a
nuclease, and a chaperone.
18. A vector comprising the expression cassette according to claim
17.
19. A recombinant host cell which has been transformed with the
expression cassette according to claim 17 or the vector according
to claim 18, wherein said host cell is a microalga.
20. The host cell according to claim 19, wherein said microalga is
a heterokont microalga selected from the group consisting of a
Nannochloropsis species, a Phaeodactylum species, and combinations
thereof.
21. The host cell according to claim 19, wherein said microalga is
the diatom Nannochloropsis gaditana.
Description
[0001] This application is a divisional of U.S. patent application
Ser. No. 16/465,599, filed May 31, 2019, which claims the benefit
of PCT/EP2017/081451 filed Dec. 5, 2017, which claims priority from
EP 16290225.8 filed Dec. 5, 2016, which are incorporated herein by
reference in their entireties for all purposes.
TECHNICAL FIELD
[0002] The application generally relates to the field of genetic
engineering, more particularly to genetic engineering of
microalgae, in particular to target nuclear-encoded recombinant
proteins to the chloroplast.
BACKGROUND
[0003] Microalgae are increasingly being used in industry for the
biosynthesis of high-value products such as lipid products. Their
ability to accumulate large amounts of lipids in the form of
triacylglycerol (TAG), in particular when depriving nitrogen from
their culture medium, has triggered their exploitation as host for
fatty acid production, e.g. for biofuel production, for chemical
applications or in food industry.
[0004] Microalgae can also be used as very efficient producing
tools for heterologous proteins such as therapeutic proteins and
industrial enzymes. Plastids are ideal subcellular hosts for
storage of recombinant proteins as compared to the cytoplasm since
adverse effects due to over-accumulation can be avoided and the
recombinant proteins are protected from proteolytic
degradation.
[0005] The insertion of transgenes into the plastid genome has
proven to be an effective alternative to nuclear transformation for
the production of recombinant proteins in plants (De Marchis et al.
2012 Plant Physiol. 160:571-581). In algae, it has been documented
for the green alga Chlamydomonas reinhardtii (Muto et al. 2009 BMC
Biotechnol. 9:26), the red alga Porphyridium sp. (Lapidot et al.
2002 Plant Physiol. 129:7-12), the euglenoid Euglena gracilis
(Doetsch et al. 2001 Curr Genet. 39:49-60) and the diatom
Phaeodactylum tricornutum (Xie et al. 2014 March Biotechnol (NY).
16:538-46). But for some algae, including Nannochloropsis species,
chloroplast transformation has not been reported yet, and
biotechnological applications are limited to nuclear transformation
in these organisms. The nuclear-encoded recombinant proteins need
then be targeted to the chloroplast. Microalgae harbor a unique
plastid surrounded by four membranes, with the outermost membrane
being interconnected with the endoplasmatic reticulum. To
translocate across the multiple membranes of the microalgal
plastids, host-encoded chloroplast proteins require a bipartite
targeting sequence (BTS), with the N-terminal domain functioning as
an ER signal sequence (Bhaya and Grossman 1991 Mol Gen Genet.
229:400-4) and the C-terminus acting as a transit peptide-like
domain (Lang et al. 1998 J Biol Chem. 273:30973-8). Heterologous
plastid pre-sequences are able to direct fluorescent markers into
the plastids of cryptophytes, dinoflagellates and diatoms,
stressing similarities in plastid protein import machinery across
different phyla (Gruber et al. 2007 Plant Mol Biol. 64:519-30).
These BTS, however, are highly variable with respect to their amino
acid sequence, but a conserved "ASA-FAP" motif was observed in the
BTS of diatoms and cryptophytes (Gruber et al. 2007). So far, only
few BTS sequences of nuclear-encoded plastid proteins of
chromophytic algae have been published, with one example in
Nannochloropsis (Moog et al. 2015. Protist 166:161-71).
[0006] Besides promoting chloroplast localization in vivo, however,
nothing is still known about the features that these BTS carry with
respect to their effect on protein stability and responses to
nutrient conditions.
[0007] Accordingly, there is a need for systems and methods for
chloroplast targeting of nuclear-encoded recombinant proteins in
microalgae, preferably which allow robust protein production under
different culture conditions.
SUMMARY OF THE INVENTION
[0008] The present invention is based, at least in part, on the
identification of new bipartite targeting sequences (BTS), such as
from the phosphoribulokinase (PRK) of N. gaditana. This BTS was
found to efficiently target nuclear-encoded recombinant proteins to
the chloroplast in a host cell, and to promote robust accumulation
of the recombinant proteins in the chloroplast. Moreover, it was
determined that this chloroplast targeting was efficient under
different nutrient conditions, including nitrogen starvation.
Furthermore, protein expression was found to be uniform in host
cells, allowing for reproducible genome engineering, such as for
microalgae.
[0009] Accordingly, compositions and methods for chloroplast
targeting of a nuclear-encoded proteins of interest are provided.
More particularly, these compositions and methods are suitable for
use in microalgae. Exemplary compositions comprise one or more
expression cassettes comprising a nucleotide sequence encoding a
chloroplast targeting peptide according to the invention operably
linked to a nucleotide sequence encoding a protein of interest. The
invention further provides vectors comprising the expression
cassettes, and host cells, in particular microalgae, having such
expression cassettes stably incorporated or transiently expressed
into their nuclear genomes. Methods are also provided for
production of a protein of interest in a microalgal cell. Also
provided herein are methods for modulating chloroplast
pathways.
[0010] The present invention is in particular captured by any one
or any combination of one or more of the below numbered aspects and
embodiments (i) to (xv) wherein:
[0011] (i) An isolated nucleic acid comprising a nucleotide
sequence showing at least 70% sequence identity to SEQ ID NO: 9,
wherein said nucleotide sequence encodes a chloroplast targeting
peptide.
[0012] (ii) A nucleic acid expression cassette comprising a
nucleotide sequence encoding a chloroplast targeting peptide
operably linked to a nucleotide sequence encoding a protein of
interest, wherein the chloroplast targeting peptide comprises the
bipartite targeting sequence (BTS) of the phoshoribulokinase (PRK)
of Nannochloropsis gaditana (NgPRK BTS) of SEQ ID NO: 8, and
wherein the expression cassette ensures expression of the coding
sequences in the nucleus of a host cell transformed with said
expression cassette.
[0013] (iii) The expression cassette according to (ii), further
comprising a promoter and a terminator operably linked to the
nucleotide sequences encoding the chloroplast targeting peptide and
the protein of interest.
[0014] (iv) The expression cassette according to any one of (ii) or
(iii), wherein the protein of interest is a protein which is not
said Nannochloropsis gaditana PRK, more particularly which is
heterologous to Nannochloropsis gaditana.
[0015] (v) The expression cassette according to any one of (ii) to
(iv), wherein the protein of interest is an enzyme or a modulator
of an enzyme which can ensure a biochemical reaction or pathway in
the chloroplast.
[0016] (vi) The expression cassette according to (v), wherein the
protein of interest is an enzyme or a modulator of an enzyme
involved in lipid biosynthesis such as TAG biosynthesis and
storage, and fatty acid biosynthesis, or involved in
chrysolaminarin or starch accumulation.
[0017] (vii) The expression cassette according to any one of (ii)
to (iv), wherein the protein of interest is selected from the group
comprising a chloroplast transporter, a protein of transcription or
translation machinery, a transcription factors/enhancer/silencer, a
nuclease, and a chaperone.
[0018] (viii) A vector comprising the expression cassette according
to any one of (ii) to (vii).
[0019] (ix) A recombinant host cell which has been transformed with
the expression cassette according to any one of (ii) to (vii) or
the vector according to (viii), wherein said host cell is a
microalga.
[0020] (x) The host cell according to (ix), wherein said microalga
is a heterokont microalga, preferably selected from the group
comprising Nannochloropsis and Phaeodactylum species.
[0021] (xi) The host cell according to (ix) or (x), wherein said
microalga is the diatom Nannochloropsis gaditana.
[0022] (xii) A method for producing a protein of interest in the
chloroplast of a microalga, said method comprising:
[0023] culturing a recombinant microalga that has been transformed
with a nucleic acid comprising a nucleotide sequence encoding a
chloroplast targeting peptide operably linked to a nucleotide
sequence encoding the protein of interest, wherein the chloroplast
targeting peptide comprises the bipartite targeting sequence (BTS)
of the phoshoribulokinase (PRK) of Nannochloropsis gaditana (NgPRK
BTS) of SEQ ID NO: 8.
[0024] (xiii) The method according to (xii) further comprising the
steps of: [0025] harvesting the chloroplast from the microalga; and
[0026] purifying the protein of interest from the chloroplast.
[0027] (xiv) The method according to (xii) or (xiii), wherein the
recombinant microalga is cultured under conditions of nitrogen
depletion.
[0028] (xv) Use of the recombinant host cell according to any one
of (ix) to (xi) for introducing or modulating a biochemical
reaction or a pathway in the chloroplast, wherein the protein of
interest in said recombinant host cell is an enzyme or a modulator
of an enzyme involved in said biochemical reaction or pathway.
BRIEF DESCRIPTION OF THE FIGURES
[0029] The teaching of the application is illustrated by the
following Figures which are to be considered as illustrative only
and do not in any way limit the scope of the claims.
[0030] FIGS. 1A-1B: (FIG. 1A) Gene sequence of Nannochloropsis
gaditana phosphoribulokinase (NgPRK) (SEQ ID NO:1). The coding
sequence is underlined. (FIG. 1B) In silico protein sequence of
NgPRK (SEQ ID NO:2). The "AF" motif is underlined.
[0031] FIG. 2: Prediction of a signal peptide sequence in the in
silico protein sequence of NgPRK by SignalP.
[0032] FIGS. 3A-3F: Protein sequences of phosphoribulokinases
(PRKs) of Arabidopsis thaliana (AT1G32060.1, SEQ ID NO: 3) (FIG.
3A), Spinacea oleracea (Spinach_P09559, SEQ ID NO:4) (FIG. 3B),
Phaeodactylum tricornutum (Pt_CCAP1055/1, SEQ ID NO:5) (FIG. 3C),
Chlamydomonas reinhardtii (Cr_XP_001694038, SEQ ID NO:6) (FIG. 3D),
Oryza sativa (Os02g0698000, SEQ ID NO:7) (FIG. 3E). Raw protein
sequences are shown; experimentally characterized transit peptides
are underlined. (FIG. 3F) Multisequence alignment of different
plant and algal PRK.
[0033] FIG. 4: Secondary structure prediction of the in silico
protein sequence of NgPRK by CFSSP (available on the world wide web
at biogem.org/tool/chou-fasman/). The identified BTS is underlined
(SEQ ID NO: 8).
[0034] FIGS. 5A-5H: DNA sequences (FIGS. 5A-5D, SEQ ID NO:13-16) of
the recipient PCT2Ng vector (FIGS. 5A and 5E) and the constructed
cassettes for pCT55 (FIGS. 5B and 5F), pCT56 (FIGS. 5C and 5G) and
pCT59 (FIGS. 5D and 5H) and corresponding vector maps (FIGS.
5E-5H). EcoRl/Ndel restriction sites are highlighted in bold,
whereas the used BTS sequences are underlined in the DNA sequences.
UEP: ubiquitin extension protein promoter; fcpA Term: fucoxanthin
chlorophyll binding protein terminator; MCS: multi cloning site.
shBle Ng: Nannochloropsis codon-optimized selectable marker
conferring resistance to Zeocin.
[0035] FIGS. 6A-6C: Representative FACS analysis of wild-type N.
gaditana (FIG. 6A, Sample ID: WT), and negative (FIG. 6B, Sample
ID: 55.3) and positive (FIG. 6C, Sample ID:55.7) pCT55 clones.
eYFP-expressing cells were gated in the M2 part of the graph,
whereas cells gated to the M1 were considered negative (see WT as a
reference). M2-gated cutoff was chosen at 10% for identifying
positive clones.
[0036] FIGS. 7A-7C: Representative FACS analysis of wild-type N.
gaditana (FIG. 7A, Sample ID: WT), and negative (FIG. 7B, Sample
ID: 56.1) and positive (FIG. 7C, Sample ID:56.2) pCT56 clones.
eYFP-expressing cells were gated in the M2 part of the graph,
whereas cells gated to the M1 were considered negative (see WT as a
reference). M2-gated cutoff was chosen at 10% for identifying
positive clones.
[0037] FIGS. 8A-8B: Representative FACS analysis of wild-type N.
gaditana (FIG. 8A, Sample ID: WT), and a positive (FIG. 8B, Sample
ID: 59.10) pCT59 clone that expresses eYFP in the cytosol.
eYFP-expressing cells were gated in the M2 part of the graph,
whereas cells gated to the M1 were considered negative (see WT as a
reference). M2-gated cutoff was chosen at 10% for identifying
positive clones.
[0038] FIG. 9: Representative confocal microscopy images of
positive pCT59, pCT55 and pCT56 clones showing highest eYFP
expression. YFP: eYFP signal; CHL: chlorophyll fluorescence. A
wild-type (WT) strain was used to set the background for eYFP
detection, whereas an eYFP control was used as a marker for
cytosolic localization.
[0039] FIGS. 10A-10B: Assessment of eYFP expression levels in pCT56
and pCT59 strains. (FIG. 10A) Western Blot analysis on three pCT56
and pCT59 clones (top) and stain free control of gel loading
(bottom). (FIG. 10B) Quantification of western blots bands
intensity by the Image Lab 5.1 software (Biorad); values are
relative to the highest intensity band of pCT56-10, which was set
to 100. AVG: averaged band intensity of pCT56 and pCT59 clones.
[0040] FIGS. 11A-11B: Assessment of eYFP expression levels in
pCT56-10 and pCT59-10 strains under nitrogen deplete (-N) and
nitrogen replete (+N) media conditions. (FIG. 11A) Western Blot
analysis on pCT56-10 and pCT59-10 clones (top) and stain free
control of gel loading (bottom). WT was used as a negative control.
(FIG. 11B) Quantification of western blots bands reported in (A) by
the Image Lab 5.1 software (Bio-Rad). Reduction in band intensity
was calculated as a percentage of the "-N" band intensity relative
to the "+N" band within the same clone.
DETAILED DESCRIPTION OF THE INVENTION
[0041] Unless otherwise defined, all terms used in disclosing the
invention, including technical and scientific terms, have the
meaning as commonly understood by one of ordinary skill in the art
to which this invention belongs. By means of further guidance, term
definitions are included to better appreciate the teaching of the
present invention.
[0042] As used herein, the singular forms "a", "an", and "the"
include both singular and plural referents unless the context
clearly dictates otherwise.
[0043] The terms "comprising", "comprises" and "comprised of" as
used herein are synonymous with "including", "includes" or
"containing", "contains", and are inclusive or open-ended and do
not exclude additional, non-recited members, elements or method
steps. Where reference is made to embodiments as comprising certain
elements or steps, this encompasses also embodiments which consist
essentially of the recited elements or steps.
[0044] The recitation of numerical ranges by endpoints includes all
numbers and fractions subsumed within the respective ranges, as
well as the recited endpoints.
[0045] The term "about" as used herein when referring to a
measurable value such as a parameter, an amount, a temporal
duration, and the like, is meant to encompass variations of +/-10%
or less, preferably +/-5% or less, more preferably +/-1% or less,
and still more preferably +/-0.1% or less of and from the specified
value, insofar such variations are appropriate to perform in the
disclosed invention. It is to be understood that the value to which
the modifier "about" refers is itself also specifically, and
preferably, disclosed.
[0046] All documents cited in the present specification are hereby
incorporated by reference in their entirety.
[0047] The term "microalga" or "microalgae" (plural) as used herein
refers to microscopic alga(e). "Microalgae" encompass, without
limitation, organisms within (i) several eukaryotic phyla,
including the Rhodophyta (red algae), Chlorophyta (green algae),
Dinoflagellata, Haptophyta, (ii) several classes from the
eukaryotic phylum Heterokontophyta, and (iii) the prokaryotic
phylum Cyanobacteria (blue-green algae).
[0048] The term "heterokonts" or "stramenopiles" refer to the
microalgae within the eukaryotic phylum Heterokontophyta or
Stramenopila which includes, without limitation, the classes
Bacillariophycea (diatoms), Eustigmatophycea, Phaeophyceae (brown
algae), Xanthophyceae (yellow-green algae) and Chrysophyceae
(golden algae).
[0049] The term "transformation" as used herein refers to
introducing a recombinant nucleic acid into an organism in such a
way that that the nucleic acid is replicable, either as an
extrachromosomal element or by chromosomal integration.
[0050] The terms "genetically engineered" or "genetically modified"
or "recombinant" as used herein with reference to a host cell, in
particular a microalga or plant cell, denote a non-naturally
occurring host cell, as well as its recombinant progeny, that has
at least one genetic alteration not found in a naturally occurring
strain of the referenced species, including wild-type strains of
the referenced species. Such genetic modification is typically
achieved by technical means (i.e. non-naturally) through human
intervention and may include, e.g., the introduction of an
exogenous nucleic acid and/or the modification, over-expression, or
deletion of an endogenous nucleic acid.
[0051] The term "exogenous" or "foreign" as used herein is intended
to mean that the referenced molecule, in particular nucleic acid,
is not naturally present in the host cell.
[0052] The term "endogenous" or "native" as used herein denotes
that the referenced molecule, in particular nucleic acid, is
naturally present in the host cell.
[0053] By "recombinant nucleic acid" when referring to a nucleic
acid in a recombinant host cell, is meant that at least part of
said nucleic acid is not naturally present in the host cell in the
same genomic location. For instance a recombinant nucleic acid can
comprise a coding sequence naturally occurring in the host cell
under control of an exogenous promotor, or a recombinant nucleic
acid can comprise an exogenous coding sequence under the control of
an endogenous promoter. A recombinant host cell similarly refers to
a host cell comprising a recombinant nucleic acid, i.e. a nucleic
acid which does not naturally occur in that host cell in that
genomic location.
[0054] As used herein, the term `nucleic acid expression cassette`
refers to nucleic acid molecules that include one or more
transcriptional control elements (such as, but not limited to
promoters and/or enhancers, and transcription terminators) that
direct expression of a (trans)gene of interest in a host cell.
Typically, these contain a transgene, although it is also envisaged
that a nucleic acid expression cassette is used to direct
expression of an endogenous gene in a host cell into which the
nucleic acid cassette is inserted.
[0055] The term `operably linked` as used herein refers to the
arrangement of various nucleic acid molecule elements relative to
each such that the elements are functionally connected and are able
to interact with each other. Such elements may include, without
limitation, a promoter and/or an enhancer, a transcription
terminator, and a coding sequence of a gene of interest to be
expressed (i.e., the transgene). The nucleic acid sequence
elements, when properly oriented or operably linked, act together
to modulate the activity of one another, and ultimately may affect
the level of expression of the transgene. By modulate is meant
increasing, decreasing, or maintaining the level of activity of a
particular element. The position of each element relative to other
elements may be expressed in terms of the 5' terminus and the 3'
terminus of each element, and the distance between any particular
elements may be referenced by the number of intervening
nucleotides, or base pairs, between the elements. As understood by
the skilled person, operably linked implies functional activity,
and is not necessarily related to a natural positional link.
[0056] By "encoding" is meant that a nucleic acid sequence or
part(s) thereof corresponds, by virtue of the genetic code of an
organism in question, to a particular amino acid sequence, e.g.,
the amino acid sequence of a desired polypeptide or protein. By
means of example, nucleic acids "encoding" a particular polypeptide
or protein may encompass genomic, hnRNA, pre-mRNA, mRNA, cDNA,
recombinant or synthetic nucleic acids.
[0057] A nucleic acid encoding a particular peptide, polypeptide or
protein will comprise an open reading frame (ORF) encoding said
peptide, polypeptide or protein. An "open reading frame" or "ORF"
refers to a succession of coding nucleotide triplets (codons)
starting with a translation initiation codon and closing with a
translation termination codon known per se, and not containing any
internal in-frame translation termination codon, and potentially
capable of encoding a peptide, polypeptide or protein. Hence, the
term may be synonymous with "coding sequence" as used in the
art.
[0058] As used in the application, the term "promoter" refers to a
nucleic acid sequence capable of binding RNA polymerase and
initiating the transcription of one or more nucleic acid coding
sequences to which it is operably linked. A promoter is usually
located near the transcription start site of a (trans)gene on the
same strand and upstream on the nucleotide coding sequence (5' in
the sense strand). A promoter may function alone to regulate
transcription or may be further regulated by one or more regulatory
sequences (e.g. enhancers or silencers).
[0059] The term "transcription termination sequence" encompasses a
control sequence at the end of a transcriptional unit, which
signals 3' processing and termination of transcription.
[0060] The term "enhancer" as used herein refers to a nucleotide
sequence that acts to increase the transcription activity of a
promoter compared to that resulting from the promoter in the
absence of the enhancer.
[0061] As used herein, the term "selectable marker gene" includes
any gene, which confers a phenotype on a host cell in which it is
expressed to facilitate the identification and/or selection of host
cells which are transfected or transformed with a transgene.
[0062] By "nucleic acid" is meant oligomers and polymers of any
length composed essentially of nucleotides, e.g.,
deoxyribonucleotides and/or ribonucleotides. Nucleic acids can
comprise purine and/or pyrimidine bases and/or other natural (e.g.,
xanthine, inosine, hypoxanthine), chemically or biochemically
modified (e.g., methylated), non-natural, or derivatised nucleotide
bases. The backbone of nucleic acids can comprise sugars and
phosphate groups, as can typically be found in RNA or DNA, and/or
one or more modified or substituted sugars and/or one or more
modified or substituted phosphate groups. Modifications of
phosphate groups or sugars may be introduced to improve stability,
resistance to enzymatic degradation, or some other useful property.
A "nucleic acid" can be for example double-stranded, partly double
stranded, or single-stranded. Where single-stranded, the nucleic
acid can be the sense strand or the antisense strand. The "nucleic
acid" can be circular or linear. The term "nucleic acid" as used
herein preferably encompasses DNA and RNA, specifically including
genomic, hnRNA, pre-mRNA, mRNA, cDNA, recombinant or synthetic
nucleic acids, including vectors.
[0063] The terms "polypeptide" and "protein" are used
interchangeably herein and generally refer to a polymer of amino
acid residues linked by peptide bonds, and are not limited to a
minimum length of the product. Thus, peptides, oligopeptides,
polypeptides, dimers (hetero- and homo-), multimers (hetero- and
homo-), and the like, are included within the definition. Both
full-length proteins and fragments thereof are encompassed by the
definition. The terms also include post-expression modifications of
the polypeptide, for example, glycosylation, acetylation,
phosphorylation, etc. Furthermore, for purposes of the present
invention, the terms also refer to such when including
modifications, such as deletions, additions and substitutions
(e.g., conservative in nature), to the sequence of a native protein
or polypeptide.
[0064] The term "variant", when used in connection to a protein,
for example as in "a variant of protein X", refers to a protein
that is altered in its sequence compared to protein X, but that
retains the activity of protein X (i.e. a functional variant).
Preferably, such variant would show at least 80%, more preferably
at least 85%, even more preferably at least 90%, and yet more
preferably at least 95% such as at least 96%, at least 97%, at
least 98% or at least 99% sequence identity to the reference
protein, preferably calculated over the entire length of the
sequence. The sequence changes may be naturally occurring, for
example, due to the degeneracy of the genetic code, or may be
introduced artificially, for example by targeted mutagenesis of the
respective sequence. Such techniques are well known to the skilled
person.
[0065] As used herein, the terms "identity" and "identical" and the
like are used interchangeably with the terms "homology" and
"homologues" and the like herein and refer to the sequence
similarity between two polymeric molecules, e.g., between two
nucleic acid molecules or polypeptides. Methods for comparing
sequences and determining sequence identity are well known in the
art. By means of example, percentage of sequence identity refers to
a percentage of identical nucleic acids or amino acids between two
sequences after alignment of these sequences. Alignments and
percentages of identity can be performed and calculated with
various different programs and algorithms known in the art.
Preferred alignment algorithms include BLAST (Altschul, 1990;
available for instance at the NCBI website) and Clustal (reviewed
in Chenna, 2003; available for instance at the EBI website).
Preferably, BLAST is used to calculate the percentage of identity
between two sequences, such as the "Blast 2 sequences" algorithm
described by Tatusova and Madden 1999 (FEMS Microbiol Lett 174:
247-250), for example using the published default settings or other
suitable settings (such as, e.g., for the BLASTN algorithm: cost to
open a gap=5, cost to extend a gap=2, penalty for a mismatch=-2,
reward for a match=1, gap x_dropoff=50, expectation value=10.0,
word size=28; or for the BLASTP algorithm: matrix=Blosum62, cost to
open a gap=11, cost to extend a gap=1, expectation value=10.0, word
size=3).
[0066] The present application generally relates to genetic
engineering, more particularly to methods of targeting a
recombinant protein to the chloroplast. In particular embodiments,
methods and tools are provided for the genetic engineering of
microalgae, more particularly to chloroplast targeting of
recombinant proteins in microalgae.
[0067] Chloroplast Targeting Peptides
[0068] Chloroplasts (also referred to as plastids herein) are
organelles found in plant cells and algae that conduct
photosynthesis. Heterokonts contain a complex plastid, which
evolved via secondary endosymbiosis. During this process, a red
algal-like cell was engulfed by an eukaryotic host and subsequently
reduced to an organelle surrounded by four membranes. The outermost
membrane is connected to the nuclear envelope and endoplasmic
reticulum (ER) membrane and is called the chloroplast ER (cER)
membrane. The former plasma membrane and the cytoplasm of the
endosymbiont gave rise to the second outermost plastid membrane and
the periplastidal compartment (PPC), respectively. The PPC
surrounds the original primary plastid which itself possesses two
envelope membranes.
[0069] Targeting proteins into the complex plastid (i.e.
chloroplast targeting) typically requires at least an N-terminal
signal peptide (SP) for cER import and a transit peptide-like
sequence (TPL) for further transport across the PPM and beyond.
Both sequences build up a bipartite targeting sequence (BTS), which
is present at the N-terminus of host-encoded chloroplast
proteins.
[0070] The present inventors have identified a sequence of a
Nannochloropsis gaditana plastid protein which is capable of
targeting a heterologous protein to the chloroplast. In particular
embodiments, the application thus provides the BTS of the
phosphoribulokinase (PRK) of Nannochloropsis gaditana (NgPRK),
which is capable of targeting a heterologous protein to the
chloroplast. An exemplary amino acid sequence of NgPRK BTS is set
forth in SEQ ID NO:8. The NgPRK BTS is encoded by the nucleotide
sequence of SEQ ID NO:9 or variants thereof.
[0071] In particular embodiments, the identified NgPRK BTS was
found to be useful for targeting a polypeptide linked to it to the
chloroplast of a microalga.
[0072] In an aspect, the invention provides an isolated nucleic
acid comprising the nucleotide sequence of SEQ ID NO:9 or a variant
thereof.
[0073] In embodiments, the variants include nucleotide
substitutions, deletions, and/or insertions of one or more
nucleotides of SEQ ID NO:9 without altering the ability of the
encoded peptide to target a protein linked to it to the
chloroplast. Variant nucleotide sequences may for instance be
codon-optimized sequences to ensure recombinant expression in a
host cell of choice. For instance, nucleotide sequences having at
least about 70%, preferably at least about 80%, more preferably at
least about 85%, 90% or 95%, even more preferably at least about
96%, 97%, 98% or 99% sequence identity to SEQ ID NO:9 and encoding
a chloroplast targeting peptide are envisaged herein. More
particularly, the variant nucleotide sequence encodes a protein
having an amino acid sequence of SEQ ID NO:8 or an amino acid
sequence of at least 95% sequence identity with SEQ ID NO:8.
[0074] Variants (or mutants) of sequences identified herein can be
naturally occurring or they can be man-made e.g. using genetic
engineering techniques. Such techniques are well known in the art
and include, for example but without limitation, site directed
mutagenesis, random chemical mutagenesis, and standard cloning
techniques.
[0075] Provided herein is a bipartite targeting sequence (BTS) from
Nannochloropsis gaditana encoded by SEQ ID NO:9 and variants of the
NgPRK BTS. It is understood that the BTS variants described herein
may have conservative or non-essential amino acid substitutions as
compared to the wild-type BTS, which do not have a substantial
effect on the BTS function. Whether or not a particular
substitution will be tolerated (i.e., will not adversely affect
desired biological properties) can be determined as described in
Bowie et al. (1990) (Science 247:1306 1310). A "conservative amino
acid substitution" is one in which the amino acid residue is
replaced with an amino acid residue having a similar side chain.
Families of amino acid residues having similar side chains have
been defined in the art. These families include amino acids with
basic side chains (e.g., lysine, arginine, histidine), acidic side
chains (e.g., aspartic acid, glutamic acid), uncharged polar side
chains (e.g., glycine, asparagine, glutamine, serine, threonine,
tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine,
leucine, isoleucine, proline, phenylalanine, methionine,
tryptophan), beta-branched side chains (e.g., threonine, valine,
isoleucine), and aromatic side chains (e.g., tyrosine,
phenylalanine, tryptophan, histidine). BRS variants intended herein
may have one or more amino acid substitutions, preferably
conservative amino acid substitutions, of SEQ ID NO:8. The BTS
variants may have an amino acid sequence substantially identical to
SEQ ID NO:8 or they may have an amino acid sequence having at least
about 70%, preferably at least about 80%, more preferably at least
about 85%, 90% or 95%, even more preferably at least about 96%,
97%, 98% or 99% sequence identity to SEQ ID NO:8.
[0076] Other BTS variants include functional or active fragments
comprising at least about 30, 35, 40, 45, 46, 47, 48, 49, 50 or 51
consecutive amino acids, and which retain the same biological
function as NgPRK BTS (e.g. retain chloroplast targeting of a
nuclear-encoded protein linked to it).
[0077] It is to be understood that the BTS variants envisaged
herein are functional or (biologically) active variants that retain
the biological activity of NgPRK BTS, that is, retaining
chloroplast targeting activity (i.e. facilitating translocation of
a protein linked to it to the chloroplast). By "retaining
chloroplast targeting activity" is meant that the variant BTS will
direct the translocation of at least about 50%; preferably at least
about 60% or at least about 70%, more preferably at least about 80%
of the protein linked to it. Methods for measuring chloroplast
targeting activity are well known in the art and include, for
example, but without limitation, operably linking a reporter gene
such as green fluorescent protein (GTP) to the BTS encoding
nucleotide sequence. This construct is placed under the control of
a suitable promoter, ligated into a vector, and transformed into a
microalgal cell. Following an adequate period of time for
expression and localization into the chloroplast, the reporter is
localized by means well known in the art.
[0078] Expression Cassettes
[0079] A chloroplast targeting peptide-encoding nucleotide sequence
as described herein may be provided in a nucleic acid expression
cassette operably linked to a nucleotide sequence encoding a
protein of interest, which expression cassette allows it to be
expressed in a host cell. After expression the BTS will translocate
the polypeptide of interest to the chloroplast.
[0080] A nucleic acid expression cassette envisaged herein thus
comprises a nucleotide sequence encoding a chloroplast targeting
peptide as described herein operably linked to a nucleotide
sequence encoding a protein of interest. In particular, the present
invention provides a nucleic acid expression cassette comprising a
nucleotide sequence encoding NgPRK BTS operably linked to a
nucleotide sequence encoding a protein of interest. More
particularly, the present invention provides a nucleic acid
expression cassette comprising a nucleotide sequence of SEQ ID NO:9
or a variant thereof, operably linked to a nucleotide sequence
encoding a protein of interest.
[0081] The chloroplast targeting peptide-encoding nucleotide
sequence and the nucleotide sequence encoding the protein of
interest may be contiguous and in the same reading frame, or they
may be separated from one another by a nucleotide sequence encoding
one or more "linker" amino acids. The length of this linker may
vary from a small peptide (e.g. 2, 3, 4 or more amino acids) to a
protein of polypeptide such as a reporter protein.
[0082] The protein of interest may be any protein. In particular
embodiments, the protein of interest is not the natural N. gaditana
PRK. In further particular embodiments, the protein of interest is
not a protein from N. gaditana. Indeed, the present inventors have
shown that the BTS sequence of the N. gaditana PRK is able to
translocate a reporter protein to the chloroplast. The protein of
interest may be of animal origin, preferably of mammalian origin,
more preferably of human origin. Alternatively, the protein can be
a synthetic protein.
[0083] The protein of interest may thus be a heterologous protein.
The term "heterologous" is generally used herein with reference to
a protein or nucleic acid sequence means an amino acid or
polynucleotide sequence that does not naturally occur in the host
cell into which it is to be introduced. The term "heterologous"
when referring to one amino acid (or nucleic acid sequence) with
respect to another amino acid sequence protein (or nucleic acid
sequence) can also be used to refer to the fact that the two amino
acid sequences (or nucleic acid sequence) do not naturally occur
together in the same a host cell. For instance, as detailed above,
in the context of the present invention fusion proteins of the N
gaditana BTS sequence with heterologous proteins, i.e. proteins
which do not naturally occur in N. gaditana are envisaged.
[0084] Said protein of interest may for instance be a protein used
for therapeutic purposes, including, without limitation, antibodies
or antibody fragments.
[0085] The protein of interest may be an enzyme, such as an enzyme
involved in a biochemical reaction taking place in the chloroplast
or a chloroplast pathway. A "chloroplast pathway" as used herein
refers to a pathway which naturally takes place in the chloroplast.
In alternative embodiments, the enzyme may be involved in a
biochemical reaction or pathway which does not naturally take place
in the chloroplast of the host cell, and the purpose is to ensure
this biochemical reaction or pathway in the chloroplast. Examples
of pathways which in some micro-organisms take place in the
chloroplast are lipid biosynthesis pathways such as fatty acid
synthesis pathways and TAG synthesis, and chrysolaminarin or starch
accumulation. The protein of interest may also be a modulator such
as an inducer or inhibitor of an enzyme as taught herein. Indeed,
nuclear expression and chloroplast translocation of enzymes or
modulators of enzymes as taught herein is of particular interest in
the context of introducing or modulating biochemical reactions and
pathways taking place in the chloroplast of a host cell. For
example, the proteins of interest may be enzymes or modulators of
enzymes involved in the fatty acid pathway.
[0086] The protein of interest may also be a chloroplast
transporter, such as a carrier protein.
[0087] Further, non-limiting, examples of proteins of interest
include proteins of transcription or translation machinery,
transcription factors/enhancers/silencers, endogenous or engineered
nucleases, chaperones, etc.
[0088] The nucleic acid expression cassettes disclosed herein
further comprises transcription regulatory elements to ensure
expression of the coding sequences in a host cell. In particular
embodiments, the expression cassette comprises regulatory elements
to ensure expression of a coding sequence in a microalga. In
preferred embodiments, the cassette ensures expression in the
nucleus of the host cell.
[0089] Transcription regulatory elements include, without
limitation, promoters, enhancers, and terminators. The nature of
the host cell will determine the nature of the regulatory elements
of the expression cassette. For expression in microalgae, a
promoter functional in microalgae can be operably linked to the
nucleotide sequences encoding the chloroplast targeting peptide and
the protein of interest. Suitable promoters to direct expression in
microalgae include, without limitation, those from Chlamydomonas
reinhardtii, and from Chlorella species including Chlorella
vulgaris, Nannochloropsis sp, Phaeodactylum tricornutum,
Thalassiosira sp, Dunaliella salina and Haematococcus pluvialis.
Non-limiting examples of suitable promoters are the Hsp70A
promoter, the RbcS2 promoter and the beta-2-tubulin (TUB2) promoter
from Chlamydomonas reinhardtii, the fucoxanthin chlorophyll
a/b-binding protein (fcp) promoters, Histone 4 (H4) promoter from
Phaeodactylum tricornutum, the Nitrate reductase (NR) promoter from
Thalassiosira, and ubiquitin extension protein (UEP) from
Nannochloropsis sp. The promoter may be an endogenous (to the host
cell) nuclear promoter or an exogenous promoter. In certain
embodiments, the promoter is endogenous to N. gaditana or an
exogenous promoter, in particular a promoter from another
Nannochloropsis sp. In embodiments, the promoter in the expression
cassettes envisaged herein is the ubiquitin extension protein (UEP)
from Nannochloropsis gaditana.
[0090] In embodiments, the expression cassettes further comprise a
transcription termination sequence or terminator. Any
polyadenylation signal that directs the synthesis of a polyA tail
is useful in the expression cassettes described herein, examples of
those are well known to one of skill in the art. Exemplary
polyadenylation signals include, but are not limited to, the
polyadenylation signal derived from the Simian virus 40 (SV40) late
gene, and the bovine growth hormone (BGH) polyadenylation signal,
or the terminator region of the fucoxanthin chlorophyll a/b-binding
protein (fcp) gene, such as the fcpA terminator. The terminator may
be endogenous to the host cell or exogenous. In certain
embodiments, the terminator is endogenous to N. gaditana or an
exogenous terminator, in particular a terminator from another
Nannochloropsis sp. In embodiments, the fcpA terminator is used in
the expression cassettes envisaged herein.
[0091] Promoter and terminator sequences may be native to the host
cell or exogenous to the host cell. Useful promoter and terminator
sequences include those that are highly identical (i.e. having an
identities score of 90% or more, preferably 95% or more, most
preferably 99% or more) in their functional portions compared to
the functional portions of promoter and terminator sequences,
respectively, that are native to the host cell, particularly when
the insertion of the recombinant nucleic acid is targeted at a
specific site in the host (nuclear) genome. The use of native (to
the host) promoters and terminators, together with their respective
upstream and downstream flanking regions, can permit the targeted
integration of the cassette into specific loci of the host
(nuclear) genome.
[0092] Other sequences may be incorporated in the expression
cassettes according to the invention. More particularly the
inclusion of sequences which further increase the expression of the
coding sequences or stabilize the transcription products (e.g.
enhancers, introns) is envisaged. Enhancers are well known in the
art and include, without limitation, the SV40 enhancer region and
the 35S enhancer element.
[0093] The nucleic acid expression cassette described herein may
further contain one or more nucleic acid coding sequences for a
selectable marker gene as further described herein.
[0094] The nucleic acid expression cassette may further contain
restriction sites e.g. for insertion in a vector.
[0095] Vector
[0096] The expression cassettes envisaged herein may be used as
such, or typically, they may be part of (i.e. introduced into) a
nucleic acid vector. Accordingly, a further aspect relates to a
vector comprising a nucleic acid expression cassette envisaged
herein.
[0097] In embodiments, the vectors disclosed herein further
comprise an expression cassette comprising a selectable marker
gene, such as an antibiotic resistance cassette, to allow selection
of host cells that have been transformed. A selectable marker gene
cassette typically includes a promoter and transcription terminator
sequence, operatively linked to a selectable marker gene. Suitable
markers may be selected from markers that confer antibiotic
resistance, herbicide resistance, visual markers, or markers that
complement auxotrophic deficiencies of a host cell, in particular a
microalga. For example, the selection marker may confer resistance
to an antibiotic such as hygromycin B (such as the hph gene),
zeocin/phleomycin (such as the ble gene), kanamycin or G418 (such
as the npII or aphVIII genes), spectinomycin (such as the aadA
gene), neomycin (such as the aphVIII gene), blasticidin (such as
the bsd gene), nourseothricin (such as the natR gene), puromycin
(such as pac gene) and paromomycin (such as the aphVIII gene). In
other examples, the selection marker may confer resistance to a
herbicide such as glyphosate (such as GAT gene), oxyfluorfen (such
as protox/PPO gene) and norflurazon (such as PDS gene). Visual
markers may also be used and include for example beta-glucuronidase
(GUS), luciferase and fluorescent proteins such as Green
Fluorescent Protein (GFP), Yellow Fluorescent protein, etc. Two
prominent examples of auxotrophic deficiencies are the amino acid
leucine deficiency (e.g. LEU2 gene) or uracil deficiency (e.g. URA3
gene). Cells that are orotidine-5'-phosphate decarboxylase negative
(ura3-) cannot grow on media lacking uracil. Thus a functional URA3
gene can be used as a selection marker on a host cell having a
uracil deficiency, and successful transformants can be selected on
a medium lacking uracil. Only cells transformed with the functional
URA3 gene are able to synthesize uracil and grow on such medium. If
the wild-type strain does not have a uracil deficiency, an
auxotrophic mutant having the deficiency must be made in order to
use URA3 as a selection marker for the strain. Methods for
accomplishing this are well known in the art.
[0098] The vectors disclosed herein may further include an origin
of replication that is required for maintenance and/or replication
in a specific cell type. One example is when a vector is required
to be maintained in a host cell as an episomal genetic element
(e.g. plasmid or cosmid molecule). Exemplary origins of replication
include, but are not limited to the f1-ori, colE1 ori, and Gram+
bacteria origins of replication.
[0099] The vectors taught herein may further contain restriction
sites of various types for linearization or fragmentation.
[0100] Numerous vectors are known to practitioners skilled in the
art and any such vector may be used. Selection of an appropriate
vector is a matter of choice. The vector may be a non-viral or
viral vector. Non-viral vectors include but are not limited to
plasmids, cationic lipids, liposomes, nanoparticles, PEG, PEI, etc.
Viral vectors are derived from viruses including but not limited
to: retrovirus, lentivirus, adeno-associated virus, adenovirus,
herpesvirus, hepatitis virus or the like. Preferred vectors are
vectors developed for microalgae such as the vector called
pCT2Ng.
[0101] Construction of the vectors described herein containing or
including the herein described expression cassettes, and optionally
the selectable marker cassettes, and one or more of the above
listed optional components employs standard ligation techniques.
For example, isolated plasmids may be cleaved, tailored, and
re-ligated in the form desired to generate the plasmids
required.
[0102] Recombinant Host Cells
[0103] A further aspect relates to recombinant host cells that have
been transformed with an expression cassette or a vector as
described herein. Accordingly, disclosed herein are recombinant
host cells comprising an exogenous nucleic acid comprising a
nucleotide sequence encoding NgPRK BTS or a variant thereof
operably linked to a nucleotide sequence encoding a protein of
interest. In particular, disclosed herein are recombinant host
cells comprising an exogenous nucleic acid comprising a nucleotide
sequence of SEQ ID NO:9 or a variant thereof operably linked to a
nucleotide sequence encoding a protein of interest.
[0104] Advantageously, the NgPRK BTS was found to ensure uniform
expression levels of the protein linked to it across the cell
population, allowing for reproducible engineering of host
cells.
[0105] Preferred host cells are microalgae.
[0106] Preferred microalgae are microalgae that harbor a
chloroplast (i.e. photosynthesizing microalgae), including species
from the phyla heterokonts, dinoflagellates, cryptophytes,
haptophytes and chlorophytes. In embodiments, the microalgae are
heterokont microalgae, including Eustigmatophytes such as
Nannochloropsis ( ) species, Phaeodactylum, Chaetoceros, Emiliana,
Amphora, Anikstrodesmis, Fistulifera, Cyclotella, Cylindrotheca,
Tribonema, Hematococcus, Isochrysis, Monochrysis, Monoraphidium,
Navicula, Nitzschia, Tetraselmis, Thalassiosira, and Trichodesmium
species, brown algae such as Macrocystis species. In further
embodiments, the microalga is an Eustigmatophyte, preferably a
Nannochloropsis species, more preferably Nannochloropsis
gaditana.
[0107] Also provided herein are methods for obtaining a genetically
engineered or recombinant host cell as described herein, which
method may comprise transforming a host cell with an expression
cassette or a vector as taught herein above. The method may further
comprise the step of selecting the host cells which have taken up
the exogenous nucleic acids.
[0108] Methods used herein for transformation, in particular
nuclear transformation, of the host cells are well known to a
skilled person. For example, electroporation, chemical (such as
calcium chloride- or lithium acetate-based) transformation methods,
microparticles bombardment, glass beads, or viral- or Agrobacterium
tumefaciens-mediated transformation methods as known in the art can
be used for transformation of microalgae.
[0109] The expression cassettes or vectors disclosed herein may
either be integrated into the nuclear genome of the host cell or
they may be maintained in some form (such as a plasmid)
extrachromosomally. A stably transformed host cell is one in which
the exogenous nucleic acid has become integrated into a chromosome
so that it is inherited by daughter cells through chromosome
replication.
[0110] Successful transformants can be selected for in known
manner, e.g. by taking advantage of the attributes contributed by
the marker gene, or by other characteristics resulting from the
introduced coding sequences (such as ability to translocate the
encoded proteins to the chloroplast by conventional methods
including immunocytochemistry and confocal microscopy). Screening
can also be performed by PCR or Southern analysis to confirm that
the desired insertions have taken place, to confirm copy number and
to identify the point of integration of coding sequences into the
host genome.
[0111] Uses and Methods
[0112] A further aspect relates to the use of the herein described
expression cassettes and vectors for the nuclear expression and
subsequent targeting of a protein of interest to the chloroplast in
a host cell, in particular a microalga. The protein of interest
preferably accumulates in the chloroplast (i.e. is stored in the
chloroplast) or is functional in the chloroplast. In particular
embodiments, the protein of interest is an enzyme which can ensure
a biochemical reaction in a chloroplast. The methods may involve
targeting other components involved in said biochemical reaction to
the chloroplast.
[0113] A related aspect is directed to methods for the production
of a protein of interest, which protein of interest preferably
accumulates in the chloroplast and/or is functional in the
chloroplast, using the recombinant host cells described herein. The
protein of interest, which is linked to a BTS as described herein,
is expressed in the nucleus of the host cell and then targeted to
the chloroplast. Advantageously, the NgPRK BTS was found to allow
for robust nuclear expression and accumulation in the
chloroplast.
[0114] Accordingly, disclosed herein is a method for the production
of a protein of interest, said method comprising culturing a host
cell comprising an exogenous nucleic acid comprising a nucleotide
sequence encoding a chloroplast targeting peptide comprising the
NgPRK BTS, in particular the nucleotide sequence of SEQ ID NO:9,
operably linked to a nucleotide sequence encoding the protein of
interest. Preferably, the host cells are cultured under conditions
suitable to ensure nuclear expression of the coding sequences in
the host cell.
[0115] The method may further comprise a former step of
transforming a host cell with the herein described expression
cassettes or vectors as described elsewhere herein.
[0116] In certain embodiments, the protein of interest merely
accumulates in the chloroplast, i.e. the protein of interest is
stored in the chloroplast. Typically, these methods further involve
the steps of harvesting the chloroplasts from the microalga and
purifying the protein of interest from the chloroplasts. These
methods are particularly useful for the production of heterologous
proteins such as, without limitation, therapeutic proteins or
industrial enzymes. The chloroplast advantageously protects the
protein of interest against degradation and adverse effects due to
over-accumulation can be avoided as compared to the cytoplasm.
[0117] The isolation of chloroplasts from the recombinant or
transformed microalgae described herein may include, but is not
limited to, the use of density gradient centrifugation.
[0118] Purification of the protein of interest can be carried out,
for example, but without limitation, by chromatography.
Alternatively, the protein of interest may be fused to an amino- or
carboxy-terminal tag such as a histidine tag composed of six
histidine residues for purification purposes.
[0119] In other embodiments of the method, the protein of interest
is functional in the chloroplast. For example, the protein of
interest may be an enzyme involved in a chloroplast pathway such as
a fatty acid pathway or a pathway for the synthesis of
triacylglycerol. By nuclear expression and chloroplast targeting of
said enzyme, the chloroplast pathway can be modulated (e.g.
stimulated or suppressed) resulting in a changed (e.g. increased or
decreased) production of a biomolecule derived from said pathway,
such as a biomolecule produced by said pathway. For example, to
increase the production of a chloroplast biomolecule (i.e. a
biomolecule derived from or produced by a pathway operative in the
chloroplast), the host cell, in particular the microalga, may be
transformed with an exogenous nucleic acid comprising a nucleotide
sequence encoding a chloroplast targeting peptide comprising the
NgPRK BTS of SEQ ID NO: 8 or a variant thereof, operably linked to
a nucleotide sequence encoding said enzyme, and culturing the
recombinant host cell. Accordingly, also disclosed herein is a
method for modulating the production of a biomolecule of interest,
said biomolecule being derived from, in particular produced in, a
chloroplast pathway, said method comprising culturing a host cell
comprising an exogenous nucleic acid comprising a nucleotide
sequence encoding a chloroplast targeting peptide comprising the
NgPRK BTS of SEQ ID NO: 8 or a variant thereof, operably linked to
a nucleotide sequence encoding an enzyme involved in said
chloroplast pathway.
[0120] In further examples, the protein of interest that is
functional in the chloroplast may be a modulator such as an inducer
or an inhibitor of an enzyme involved in a chloroplast pathway. The
nuclear expression and targeting to the chloroplast of said protein
of interest may result in a modulation of the chloroplast pathway,
and altered production of a biomolecule derived from or produced in
said chloroplast pathway. Accordingly, further disclosed herein is
a method for modulating the production of a biomolecule of
interest, said biomolecule being derived from, in particular
produced in, a chloroplast pathway, said method comprising
culturing a host cell comprising an exogenous nucleic acid
comprising a nucleotide sequence encoding a chloroplast targeting
peptide comprising the NgPRK BTS, operably linked to a nucleotide
sequence encoding a modulator of an enzyme involved in said
chloroplast pathway.
[0121] In further examples the protein of interest is not naturally
present in the chloroplast. For example, the protein of interest
may be an enzyme involved in a biochemical reaction or pathway
which is not naturally present in the chloroplast. By nuclear
expression and chloroplast targeting of said enzyme, the
biochemical reaction or pathway can be ensured in the chloroplast,
resulting either in improved properties of the host cell or
production of a biomolecule resulting from said biochemical
reaction or pathway. For example, the host cell, in particular the
microalga, may be transformed with an exogenous nucleic acid
comprising a nucleotide sequence encoding a chloroplast targeting
peptide comprising the NgPRK BTS of SEQ ID NO: 8 or a variant
thereof, operably linked to a nucleotide sequence encoding said
enzyme, and culturing the recombinant host cell. Accordingly, also
disclosed herein is a method for ensuring a biochemical reaction or
pathway in the chloroplast. In particular embodiments, this is a
method for the production of a biomolecule of interest, said method
comprising culturing a host cell comprising an exogenous nucleic
acid comprising a nucleotide sequence encoding a chloroplast
targeting peptide comprising the NgPRK BTS of SEQ ID NO: 8 or a
variant thereof, operably linked to a nucleotide sequence encoding
an enzyme involved in said biochemical reaction or pathway.
[0122] In the methods for modulating or ensuring the production of
a biomolecule of interest as taught herein, the enzymes or the
modulators of the enzymes which ensure the production of said
biomolecule of interest, may be native to the host cell, or
heterologous proteins.
[0123] The methods for modulating the production of a biomolecule
of interest as taught herein may further comprise the step of
recovering the biomolecule of interest from the host cell or the
culture medium. The recovery of the biomolecule of interest from
het host cell may encompass harvesting the chloroplasts from the
microalga and purifying the biomolecule of interest from the
chloroplasts. Methods for harvesting chloroplast are described
elsewhere herein. Suitable purification can be carried out by
methods known to the person skilled in the art such as by using
lysis methods, extraction, ion exchange resins, electrodialysis,
nanofiltration, etc.
[0124] Related aspects are directed to uses of the recombinant host
cells as taught herein for modulating chloroplast pathways or for
modulating the production of a biomolecule derived from or produced
in a chloroplast pathway.
[0125] The culture of the recombinant host cells in the methods
described herein can be carried out by conventional methods of
culture according to the particular host cell that has been
selected for the transformation and the production of the protein
of interest. In the herein described methods, the recombinant host
cells are preferably cultured under "conditions suitable to ensure
nuclear expression of the coding sequences", which means any
condition that allows a host cell to (over)produce a protein of
interest as described herein and to target the protein of interest
to the chloroplast.
[0126] Suitable conditions include, for example, fermentation
conditions. Fermentation conditions can comprise many parameters,
such as temperature ranges, levels of aeration, and media
composition. Each of these conditions, individually and in
combination, allows the host cell to grow. To determine if
conditions are sufficient to allow nuclear (over)expression, a host
cell can be cultured, for example, for about 4, 8, 12, 18, 24, 36,
or 48 hours. During and/or after culturing, samples can be obtained
and analyzed to determine if the conditions allow nuclear
(over)expression. For example, the host cells in the sample or the
culture medium in which the host cells were grown can be tested for
the presence of a desired product (e.g. a protein of interest or a
biomolecule of interest). When testing for the presence of a
desired product, assays, such as, but not limited to, sodium
dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE), TLC,
HPLC, GC/FID, GC/MS, LC/MS, MS, can be used.
[0127] Exemplary culture media include broths or gels. The host
cells may be grown in a culture medium comprising a carbon source
to be used for growth of the host cell. Exemplary carbon sources
include carbohydrates, such as glucose, fructose, cellulose, or the
like, that can be directly metabolized by the host cell. In
addition, enzymes can be added to the culture medium to facilitate
the mobilization (e.g., the depolymerization of starch or cellulose
to fermentable sugars) and subsequent metabolism of the carbon
source. A culture medium may optionally contain further nutrients
as required by the particular strain, including inorganic nitrogen
sources such as ammonia or ammonium salts, and the like, and
minerals and the like. In particular embodiments, wherein
phototrophic microalgae are used as host cells, the method may
comprise providing recombinant microalgae as taught herein, and
culturing said microalgae in photobioreactors or an open pond
system using CO.sub.2 and sunlight as feedstock.
[0128] Other growth conditions, such as temperature, cell density,
and the like are generally selected to provide an economical
process. Temperatures during each of the growth phase and the
production phase may range from above the freezing temperature of
the medium to about 50.degree. C.
[0129] The culturing step of the methods of the invention may be
conducted aerobically, anaerobically, or substantially
anaerobically. Briefly, anaerobic conditions refer to an
environment devoid of oxygen. Substantially anaerobic conditions
include, for example, a culture, batch fermentation or continuous
fermentation such that the dissolved oxygen concentration in the
medium remains between 0 and 10% of saturation. Substantially
anaerobic conditions also includes growing or resting cells in
liquid medium or on solid agar inside a sealed chamber maintained
with an atmosphere of less than 1% oxygen. The percent of oxygen
can be maintained by, for example, sparging the culture with an
N2/CO2 mixture or other suitable non-oxygen gas or gasses.
[0130] Advantageously, the present inventors found that the robust
nuclear expression and accumulation of the protein of interest in
the chloroplast is resistant to nitrogen starvation conditions.
Hence, in certain embodiments of the herein described methods, the
recombinant host cells may be cultured under conditions of nitrogen
depletion (i.e. by growing the recombinant host cells in a culture
medium that lacks a nitrogen source). These culturing conditions
are particularly advantageous for proteins involved in chloroplast
pathways that benefit from nitrogen starvation, such as proteins
involved in TAG biosynthesis and storage, fatty acid biosynthesis,
accumulation of chrysolaminarin or starch, lipid degradation and
recycling, protein degradation, photosystem proteins, and
transporter proteins.
[0131] The present invention will now be further illustrated by
means of the following non-limiting examples.
EXAMPLES
Example 1: Identification of a Bipartite Targeting Sequence (BTS)
within the Phosphoribulokinase (PRK) of Nannochloropsis
gaditana
[0132] The phosphoribulokinase (PRK) of Nannochloropsis gaditana
was selected to identify a chloroplast targeting sequence. This
enzyme catalyzes the conversion of ATP and D-ribulose-5-phosphate
to ADP and D-ribulose-1,5-diphosphate in the Calvin cycle, and is
located in the chloroplast stroma. In N. gaditana, PRK is encoded
by a single exon gene (SEQ ID NO:1; identified as `Naga_100157 g10`
in the Nannochloropsis Genome Portal, CRIBI Genomics,
www.nannochloropsis.org).
[0133] The coding sequence of the NgPRK gene was translated in
silico (SEQ ID NO:2), revealing the typical "AF" junction feature
reported for heterokonts BTS (Gruber et al. 2007. Plant Mol Biol
64:519-30). The in silico protein sequence was further analyzed
with SignalP, which predicts the occurrence of signal peptides. A
strong cleavage prediction was found in correspondence of this "AF"
signature (FIG. 2).
[0134] In heterokonts, properly functioning BTSs require the
presence of a transit peptide-like region adjacent to the
N-terminally located signal peptide of the plastid pre-proteins
(Gruber et al. 2007). In order to identify the mature PRK protein,
sequences from different plant and algae PRKs were retrieved from
Uniprot (FIG. 3 A-E) and a multisequence alignment was performed
(FIG. 3F). The experimentally characterized transit peptides of
these PRKs were removed from the multisequence alignment, allowing
detection of the mature PRK protein sequence. The highly conserved
amino acid sequence (light grey) was noted across organisms, which
follows the highly variable addressing signal at the N-termini (CTP
or BTS).
[0135] Cleavage of the mature N. gaditana PRK protein around the
first 60 amino acids region was also supported by secondary
structure predictions (CFSSP;
http://www.biogem.org/tool/chou-fasman/) showing that a turn occurs
exactly in that region (FIG. 4). This would likely expose the
transit peptide-like region to the activity of a chloroplast
protease, which leads to the mature PRK protein.
[0136] The identified NgPRK BTS sequence (SEQ ID NO:8) is:
TABLE-US-00001 MVKTAAVSLLALAGLASAFVPPTTNFRSANRWTIKAKDTSFTRNLMMKLG
AD
[0137] and the identified nucleic acid sequence (SEQ ID NO:9) of
the N. gaditana PRK BTS is therefore:
TABLE-US-00002 ATGGTCAAGACTGCCGCCGTAAGCCTCCTGGCCCTAGCCGGGCTCGCATC
TGCCTTCGTGCCCCCCACCACGAATTTTCGCAGCGCTAACAGATGGACGA
TTAAGGCCAAAGACACGTCCTTCACCCGCAACCTCATGATGAAGCTGGGC GCGGAC
Example 2: NgPRK BTS Promotes Sustained and Uniform Transgene
Expression
[0138] Material and Methods
[0139] Cell Cultivation
[0140] Nannochloropsis gaditana Lubian Strain CCMP526 (Culture
Collection of Marine Phytoplankton, now known as NCMA: National
Center for Marine Algae and Microbiota) was used in all
experiments. N. gaditana was grown at 20.degree. C. in 250 mL flask
in artificial seawater (ESAVV) medium (Table 1) using ten times
enriched nitrogen and phosphate sources (5.49 10.sup.-3 M
NaNO.sub.3 and 2.24 10.sup.-4 NaH.sub.3PO.sub.4) called
"10.times.ESAW", or nitrogen-depleted medium, where NaNO.sub.3 was
omitted. Cells were grown on a 12:12 light (60 .mu.E m.sup.-2
sec.sup.-1)/dark cycle. For nuclear transformation, cells were
grown under constant light in f/2 medium (Table 1) until they
reached the late exponential phase. All cultures were maintained on
f/2 plates solidified with 1% agar under a 12:12 light/dark regime
in presence (transformed strains) or absence (wild-type strain) of
the selective antibiotic zeocin (7 .mu.g mL.sup.-1). When needed,
cells were counted using a LUNA.TM. Automated Cell Counter
following manufacturer's instructions.
TABLE-US-00003 TABLE 1 Composition of the "10X ESAW" and "f/2"
cultivation media. f/2 Medium 10X ESAW Medium Final Concentration
(mM) Final Concentration (mM) Tris pH8 40 NaCl 363 NaCl 363
Na.sub.2SO.sub.4 25 Na.sub.2SO.sub.4 25 KCl 8.034875922 KCl
8.034875922 NaHCO.sub.3 2.071428571 NaHCO.sub.3 2.071428571 KBr
0.725210084 KBr 0.725210084 H.sub.3BO.sub.3 0.372168285
H.sub.3BO.sub.3 0.372168285 NaF 0.666825435 NaF 0.666825435
MgCl.sub.2 6H.sub.2O 47.17166749 MgCl.sub.2 6H.sub.2O 47.17166749
CaCl.sub.2 2H.sub.2O 9.142235222 CaCl.sub.2 2H.sub.2O 9.142235222
SrCl.sub.2 6H.sub.2O 0.081770443 SrCl.sub.2 6H.sub.2O 0.081770443
NaNO.sub.3 0.88245676 NaNO.sub.3 5.49 NaH.sub.2PO.sub.4 0.041673612
NaH.sub.2PO.sub.4 0.224 Na.sub.2 EDTA 2H.sub.2O 0.011712873
Na.sub.2 EDTA 2H.sub.2O 0.0083 FeCl.sub.3 6H.sub.2O 0.011653718
Fe-EDTA 0.00655 CuSO.sub.4 5H.sub.2O 4.00481E-05 CuSO.sub.4
5H.sub.2O -- Zn SO.sub.4 7H.sub.2O 7.65217E-05 Zn SO.sub.4
7H.sub.2O 0.000254 CoCl.sub.2 6H.sub.2O 4.20345E-05 CoSO.sub.4
7H.sub.2O 0.0000569 MnCl.sub.2 2H.sub.2O 0.001111797 MnSO.sub.4
7H.sub.2O 0.00242 Na.sub.2MoO.sub.4 3.05974E-05 Na.sub.2MoO.sub.4
-- biotin (vit. H) 4.09316E-06 biotin (vit.H) 4.09316E-06 Cobalamin
(Vit. B12) 7.37806E-07 Cobalamin (Vit. B12) 7.37806E-07 thiamine
(vit. B1) 0.000664872 thiamine (vit. B1) 0.000664872
[0141] Constructions
[0142] eYFP (Protein GenBank: CCF77369.1) was selected as the
reporter gene of choice to test the functionality of the identified
BTS sequence in addressing nuclear-encoded protein to the
chloroplast. To ensure correct expression and translation of the
RNA into protein, the DNA sequence was codon-optimized for
Nannochloropsis
(http://www.kazusa.or.jp/codon/cgi-bin/showcodon.cgi?species=52230),
resulting in the sequence below (SEQ ID NO:10). The initial ATG,
when provided by the BTS sequence in the chimeric construct, was
removed.
[0143] SEQ ID NO:10: eYFP encoding nucleotide sequence
codon-optimized for expression in Nannochloropsis.
TABLE-US-00004 ATGGTCTCCAAGGGCGAGGAGCTCTTCACCGGCGTCGTCCCCATCCTCGT
CGAGCTCGACGGCGACGTCAACGGCCACAAGTTCTCCGTCTCCGGCGAGG
GCGAGGGCGACGCTACCTACGGCAAGCTCACCCTCAAGTTCATCTGCACC
ACCGGCAAGCTCCCCGTCCCCTGGCCCACCCTCGTCACCACCTTCGGCTA
CGGCCTCCAGTGCTTCGCTCGCTACCCCGACCACATGAAGCAGCACGACT
TCTTCAAGTCCGCTATGCCCGAGGGCTACGTCCAGGAGCGCACCATCTTC
TTCAAGGACGACGGCAACTACAAGACCCGCGCTGAGGTCAAGTTCGAGGG
CGACACCCTCGTCAACCGCATCGAGCTCAAGGGCATCGACTTCAAGGAGG
ACGGCAACATCCTCGGCCACAAGCTCGAGTACAACTACAACTCCCACAAC
GTCTACATCATGGCTGACAAGCAGAAGAACGGCATCAAGGTCAACTTCAA
GATCCGCCACAACATCGAGGACGGCTCCGTCCAGCTCGCTGACCACTACC
AGCAGAACACCCCCATCGGCGACGGCCCCGTCCTCCTCCCCGACAACCAC
TACCTCTCCTACCAGTCCGCTCTCTCCAAGGACCCCAACGAGAAGCGCGA
CCACATGGTCCTCCTCGAGTTCGTCACCGCTGCTGGCATCACCCTCGGCA
TGGACGAGCTCTACAAGTAA
[0144] Three different cassettes were synthesized by Thermo
Scientific and subcloned via EcoRl/Ndel into the recipient
Nannochloropsis overexpression plasmid pCT2Ng, thus generating:
[0145] pCT55 (PtAtpC_BTS::eYFP), where the Phaeodactylum BTS from
they subunit of plastid ATP synthetase (AtpC) was fused to eYFP
(Apt et al. 2002).
[0146] pCT56 (NgPRK_BTS::eYFP), where the NgPRK BTS identified in
Example 1 was fused to eYFP pCT59 (eYFP), lacking any BTS sequence
and used as a positive control for cytosolic eYFP expression. This
construct was obtained from amplification of the .DELTA.ATG eYFP
coding sequence with primers `eYFP Fw2`
(CCGCCGGAATTCATGGTCTCCAAGGGCGAGG, SEQ ID NO:11) and `eYFP Rev2`
(GAAAGTC {square root over (CATATG)}TTACTTGTAGAGCTCGTCCATG, SEQ ID
NO:12), introducing the missing ATG and EcoRl/Ndel cloning
sites.
[0147] All three pCT2Ng derivatives carry the shBle gene conferring
resistance to the antibiotic Zeocin. In these plasmids,
transcription is driven by the ubiquitin extension protein (UEP)
promoter and terminated by the Phaeodactylum fucoxanthin
chlorophyll binding protein (fcpA) terminator.
[0148] DNA sequences of the recipient pCT2Ng and of the three
EcoRl/Ndel synthesized cassettes, and the corresponding vector maps
are shown in FIG. 5.
[0149] Nuclear Transformation of N. gaditana
[0150] Plasmids pCT55, pCT56 and pCT59 were linearized by digestion
with Scal and column-purified by the NucleoSpin.RTM. Gel and PCR
Clean-up kit (Macherey-Nagel) following manufacturer's
instructions. One microgram linearized plasmid was electroporated
into Nannochloropsis gaditana following the protocol published by
Radakovits et al. (2012 Nat Commun doi: 10.1038/ncomms1688).
Transformed lines were selected on f/2 plates containing 7 .mu.g
mL.sup.-1 zeocin and correct integration of the cassettes was
assessed by colony PCR with primers Cass02Ng Fw
(CTTGGAATGTGGTCCTGGTT, SEQ ID NO:17) and eYFP Rev
(GAACTTGAGGGTGAGCTTGC, SEQ ID NO:18), which bind to the UEP
promoter and eYFP coding sequence, respectively.
[0151] Fluorescence Activated Cell Sorting (FACS)
[0152] A Becton Dickinson FACSCalibur and CellQuest Pro software
(BD Biosciences, San Jose, Calif.) were used to measure the
fluorescent intensity of single cells. Excitation was performed at
488 nm by an argon laser and a 530/30 fluorescence filter was used
in FL1 to collect eYFP fluorescence.
[0153] Results
[0154] To validate NgPRK BTS functionality, transgenic
Nannochloropsis lines overexpressing either the previously
described Phaeodactylum AtpC BTS (pCT55) (Apt et al. 2002 J Cell
Sci 115:4061-9) or the NgPRK BTS identified in Example 1 (pCT56)
fused to a codon-optimised eYFP were generated. As an internal
control, strains that accumulate eYFP in their cytosol (pCT59) were
also included.
[0155] We first checked whether the BTS sequences had an impact on
the expression levels of the transgenes. Eleven pCT55 and eleven
pCT56 clones were assessed for eYFP fluorescence on a single cell
level by Fluorescence Assisted Cell Sorting (FACS), allowing a
qualitatively and quantitatively estimate of protein expression
across the cell line population. The untransformed wild-type strain
(WT) was used as a negative control for eYFP accumulation in the
analysis. Fluorescence collected in the YFP window for this strain
was labelled as M1 (negative signal).
TABLE-US-00005 TABLE 2 FACS analysis on eleven randomly selected
pCT55 clones. eYFP-expressing cells were gated in the M2 part of
the graph (FIG. 6) , whereas cells gated to the M1 were considered
negative (see WT as a reference). By choosing an M2-gated cutoff at
10%, clones pCT55-2, 6, 7, 8 and 9 were selected as positives.
Marker All M1 M2 Sample % % % ID Gated Mean Median Gated Mean
Median Gated Mean Median WT 100.00 4.43 3.79 95.85 4.05 3.79 2.53
21.02 19.46 55.1 100.00 5.31 4.37 93.37 4.51 4.26 5.52 19.91 15.96
55.2 100.00 7.54 6.32 82.25 5.76 5.57 17.72 16.01 13.22 55.3 100.00
3.83 3.08 92.98 3.42 3.08 3.28 18.60 14.59 55.4 100.00 5.64 4.78
94.61 4.92 4.66 5.10 19.48 15.19 55.5 100.00 5.52 3.52 89.13 3.68
3.40 8.72 25.46 21.29 55.6 100.00 14.10 5.52 80.61 5.07 4.83 19.29
51.96 29.96 55.7 100.00 12.29 5.00 77.88 4.60 4.29 21.78 40.00
26.18 55.8 100.00 8.35 5.00 85.60 4.83 4.61 14.05 30.00 23.71 55.9
100.00 25.83 21.29 41.75 4.62 4.37 58.04 41.18 35.55 55.10 100.00
4.67 3.68 94.12 3.91 3.62 4.55 21.58 19.11 55.11 100.00 5.45 3.19
89.12 3.43 3.11 7.61 31.11 22.88
TABLE-US-00006 TABLE 3 FACS analysis on eleven randomly selected
pCT56 clones. eYFP-expressing cells were gated in the M2 part of
the graph (FIG. 7), whereas cells gated to the M1 were considered
negative (see WT as a reference). By choosing an M2-gated cutoff at
10%, clones pCT56-2, 3, 4, 6, 7, 10 and 11 were considered
positives. Marker All M1 M2 Sample % % % ID Gated Mean Median Gated
Mean Median Gated Mean Median WT 100.00 4.61 3.96 96.26 4.18 3.92
2.66 21.70 20.17 56.1 100.00 3.81 3.05 93.40 3.38 3.05 3.00 20.52
15.61 56.2 100.00 19.78 17.78 9.88 8.75 9.14 90.47 20.96 18.77 56.3
100.00 12.67 5.47 71.55 4.76 4.41 28.19 32.90 24.36 56.4 100.00
18.51 17.31 8.73 9.03 9.39 91.71 19.38 17.94 56.5 100.00 5.83 4.29
93.11 4.43 4.18 6.34 26.96 24.36 56.6 100.00 10.86 5.47 83.31 5.15
4.96 16.64 39.53 27.38 56.7 100.00 17.75 15.96 12.21 8.96 9.31
88.27 18.93 17.00 56.8 100.00 5.07 4.53 97.42 4.68 4.49 2.29 22.03
20.35 56.9 100.00 6.84 4.49 90.28 4.53 4.26 9.31 29.58 22.77 56.10
100.00 43.86 40.68 4.94 5.77 5.62 95.05 45.85 41.79 56.11 100.00
7.40 5.19 89.10 5.08 4.87 10.72 26.84 21.87
[0156] The results obtained for pCT55 (PtAtpC BTS::eYFP; FIG. 6,
Table 2) and pCT56 (NgPRK BTS::eYFP; FIG. 7, Table 3) show that 45%
of the pCT55 and 63% of the pCT56 clones expressed eYFP to a level
higher than the defined cut-off of 10% in the M2.
[0157] Although the observed different percentage of the
eYFP-positive clones between pCT55 and pCT56 could have arisen from
random transgene integration and position effects, a closer look at
the FACS analysis indicates that transgene (eYFP) expression across
cell populations is on average very uniform in pCT56 positive lines
when compared to their pCT55 counterparts, as highlighted by the
higher percentage of M2-gated cells.
[0158] A similar yet not as uniform expression pattern was observed
for six pCT59 positive clones which express eYFP in the cytosol
(FIG. 8, Table 4).
TABLE-US-00007 TABLE 4 FACS analysis six positive pCT59 clones that
express eYFP in the cytosol. eYFP-expressing cells were gated in
the M2 part of the graph (FIG. 8), whereas cells gated to the M1
were considered negative (see WT as a reference). M2-gated cutoff
was chosen at 10%. Marker All M1 M2 Sample % % % ID Gated Mean
Median Gated Mean Median Gated Mean Median WT 100.00 4.37 4.00
95.18 4.35 4.03 1.56 13.21 11.97 59-10 100.00 51.26 40.68 8.16 7.13
7.43 91.89 55.16 43.71 59-11 100.00 18.27 8.28 62.32 6.09 6.04
37.81 38.41 24.36 59-12 100.00 8.70 7.77 75.91 6.70 6.73 24.60
14.95 12.98 59-13 100.00 9.91 6.98 79.53 6.17 6.15 20.65 24.44
15.26 59-14 100.00 27.28 17.47 25.78 7.36 7.64 74.57 34.10 23.71
59-15 100.00 32.59 18.11 19.83 7.93 8.28 80.55 38.55 21.67
[0159] In conclusion, the NgPRK BTS promotes sustained and uniform
transgene expression.
Example 3: Targeting of Nuclear-Encoded Recombinant Proteins into
the Chloroplast Via Fusion to the BTS of NgPRK
[0160] Materials and Methods
[0161] See Example 2 for the generation of the constructs, nuclear
transformation of N. gaditana and cell culture.
[0162] Confocal Microscopy
[0163] Functionality of the different BTS was assessed by imaging
the subcellular chlorophyll and YFP fluorescence by confocal laser
scanning microscopy with a Leica TCS-SP2 operating system (Leica,
Heidelberg, Germany). Chlorophyll was excited at 633 nm and the
emitted fluorescence was detected between 650 and 750 nm. YFP was
excited at 488 nm and emitted fluorescence was detected between 510
and 545 nm.
[0164] Western Blotting
[0165] Nannochloropsis total protein extracts were obtained from
frozen cell pellets resulting from 50 mL of cell cultures in the
exponential phase. Whole proteins were extracted with a micotube
pestel after addition of 200 .mu.L of extraction buffer (30 mM
pyrophosphate tetrasodium, 100 mM Tris-HCl pH 6.8, 1% SDS). The
cell extract was centrifuged for 5 minutes at 13200 rpm and the
supernatant quantified using the Bio-Rad protein assay reagent
(Bio-Rad, Hercules, Calif.). Proteins (15 to 40 .mu.g) were loaded
on 12% acrylamide gels (TGX Stain-Free.TM. FastCast.TM., BioRad
Cat. 161-0185) for SDS-PAGE analyses. For Western blot analyses,
proteins were transferred to a nitrocellulose membrane (BA85,
Schleicher & Schuell). eYFP fusions were detected using a
commercially available aGFP mouse monoclonal antibody (GFP-2A5,
Euromedex, 67458 Mundolsheim, France) at a 1/3300 dilution.
Processing of Western Blots images was performed with the Image Lab
5.1 Software (Bio-Rad, Hercules, Calif.).
[0166] Results
[0167] Based on the FACS results, one clone showing the highest
eYFP expression for each strain was selected and subcellular
localization of the fluorescent marker was assessed by means of
confocal microscopy. pCT55-9 was selected for the PtAtpC BTS::eYFP
strain, pCT56-10 was selected for the NgPRK BTS::eYFP strain, and
pCT59-10 was selected for the strain with cytosolic eYFP
expression.
[0168] As shown in FIG. 9, eYFP fusions with either the BTS from
Phaeodactylum AtpC (pCT55-9) or the BTS from Nannochloropsis PRK
(pCT56-10) resulted in a perfect overlay between eYFP and
chlorophyll fluorescence, indicative of chloroplast localization.
The strain where the eYFP sequence was not preceded by any BTS
(pCT59-10) showed, as expected, a complete separation between eYFP
and chlorophyll fluorescence, indicative of cytosolic eYFP
expression.
[0169] Correct processing of the NgPRK BTS and higher expression of
the eYFP marker in pCT56 strains when compared to their cytosolic
pCT59 counterparts was also assessed by Western blots as an
independent confirmation of FACS analyses on three independently
generated clones per strain (FIG. 10).
Example 4: NgPRK BTS Promotes Sustained Transgene Expression Under
Nitrogen Starvation Conditions
[0170] Materials and Methods
[0171] See Example 2 for the generation of the constructs, nuclear
transformation of N. gaditana and cell culture, and Example 3 for
Western blotting.
[0172] Results
[0173] In order to evaluate the efficiency of the identified NgPRK
BTS identified in Example 1 in promoting robust accumulation of
recombinant proteins in the Nannochloropsis chloroplast under
conditions of nitrogen starvation, eYFP accumulation was checked in
the pCT56-10 and pCT59-10 clones under both nitrogen replete and
deplete conditions (FIG. 11). Nitrogen and phosphorous starvation
is known to trigger triacylglycerol (TAG) accumulation in algae
(Abida et al. 2015. Plant Physiology. 167(1): 118-136), but results
in global down-regulation of protein expression, with some specific
exceptions (Dong et al. 2013 Plant Physiol. 162(2):1110-1126). The
results show that the NgPRK_BTS::eYFP chimeric protein had almost
half of the reduction in protein expression when compared to the
clone expressing cytosolic eYFP (pCT59-10).
Sequence CWU 1
1
1912638DNANannochloropsis gaditana 1gttgcgtaac acttcttctg
atgaggtgca ttggatggtg tcgtacgtgt tttcgcctcc 60tcgtccacac catccgactg
tttgtaccca tgatgacgcg atcacaccgt cttcacgggt 120tgggacactg
tcgtcttgct gtttgtcaac gtgccacgct acctcgcctt cgacaaagat
180ctccatgcca tccgcggccg ggaatacctg gattttggca tagctcccac
atcatgggga 240aattcggcat gccacaccgc tcatttaact cctgagcgct
gcaacatgtg caagccaagc 300gccaagacgc ccgagccact tgttcagttc
tcaagagggg ccgggaggat cgtcgcgggc 360ttcgatgaaa gcgtctccgc
ttcagtttaa gccccagcgt cattcatagt cacgttgttt 420ttctcacaaa
atctcatttt tccttgcaga agtatggtca agactgccgc cgtaagcctc
480ctggccctag ccgggctcgc atctgccttc gtgcccccca ccacgaattt
tcgcagcgct 540aacagatgga cgattaaggc caaagacacg tccttcaccc
gcaacctcat gatgaagctg 600ggcgcggacg acaaggtcat tttgatcggc
gtggccgcgg attccggctg tggaaagtcg 660acgttcatgc ggcggctgac
caacatcttt ggtgggagca acgtgggccc cctggggggc 720ggtttcgaca
acgggggatg ggagacgaac accctggtct cggacacgac caccgtcatc
780tgcttggacg actaccatgc caacgaccgc tctgggcgga aagtgacggg
ccgcaccgcc 840ttggaagctg ccgagcagaa ttttgacctc atgtacgagc
agctcaaggc cctgaaggag 900ggcaaaactg tggccaagcc catctacaac
cacgtgaacg ggaccttgga ccggcccgag 960gaggtggtgc ccacccccat
tgtgatcgtg gagggcttgc acccctggta cgacgcccgc 1020gtcaaggacc
tgctcgacta cactatctac ctggacatat cggacgagat caagcgcgca
1080tggaagatcc agcgggacat ggccgagcgc ggatggacct tggagcaggt
ggaggcagag 1140attgaaaagc gtaagccgga cttcaataaa ttcgtggggc
cccagaagga ggtagccgac 1200tcggtgatcc aagtcttgcc cacagagctg
accaacgacc ccgaggggaa gatcctccgc 1260gtccggctca tccagaagga
gacgggggac tacgaacccg tctacctgtt cgaccagggc 1320tctacggtct
cctggattcc ctgcggcacg aagctgacat gctcctaccc cggcatcaag
1380ctgggctcgg gaccggaccg ctggttcaac aacgcggtga acgtggtgga
gatggacggc 1440cagtttgaca agctggaaga gcttgcctac gtggagaagc
acctggggaa cacggccagc 1500aagtacgacg gggagatcac ggcccagatg
ctcaagaacg agggcccccg ggaccctgaa 1560cggctcaggc ctcttccaga
ccatcgtctc gctcaagatc cgcgaggtct acgagaagct 1620gagcgggaag
aaggtagacg cctccgtcaa ggcccccgtg gccgcgtaag ccggcggcaa
1680aggagcgagg gctggttggc tgctgaaaac agggtaggct ttgaggtgtg
gagatcgtaa 1740cggctcccac cggacctcag cagcatccct tgaacaaacg
gcgagcctca cacgccgact 1800gctgcatgtt ttgtgtgttc tgtgcttttc
gtgtccggag ccatcgcgtc gtctgcgccg 1860ggtgccgggc ccagagagcg
gggggagggc cagggaggca ttctgttgtt ttgggtggtg 1920tttgggggat
aggagactga cctgtcggcc cctttttgac gtatcgcgaa tttcgatgaa
1980ataatcggct ccattctcca ttaaattgaa gcatgcatgg atgatgatcg
aggtgggagg 2040ggcgcctata acaccgccac ctgtgtccct gggcgagctc
ttcgggttcc tttacttttc 2100gactccgaaa acgcttttct gaaacaaagt
cgccaaggtt actcgctgtt gcccataccc 2160cttccattcg cgagtctaga
actccttgca gatccctgga taagagattc aaaaacgttg 2220cggccgagga
gtcgatggaa tgcctccctc cttgaacccg cccggcctgc gcgtgctcat
2280ggctcgtgac agacacccat gtcgacctcg cctgcgggag agaaacagag
cgtccgaaaa 2340cagcgcaaag ggagtccgag aactgcgcaa agaaagtccg
agagcagcgc gcagcaaaag 2400cgagggtcct tgtggcctga tttcatcgtg
gaagatgtta cgaatcacga cttatgcgca 2460ccacttcact tcatcgaagc
gcgatcctgt ttatactttc tactgcacaa aattgtgtgt 2520cgatcccctc
cttctccccc tctcctcctc tccctcgcct cactcatcta aatggcgtgc
2580cagcacatga taggtggcgt catagcaggg taaaattaca ctggccacgg gcacggcc
26382428PRTArtificial SequenceIn silico protein sequence of
Nannochloropsis gaditana phosphoribulokinase 2Met Val Lys Thr Ala
Ala Val Ser Leu Leu Ala Leu Ala Gly Leu Ala1 5 10 15Ser Ala Phe Val
Pro Pro Thr Thr Asn Phe Arg Ser Ala Asn Arg Trp 20 25 30Thr Ile Lys
Ala Lys Asp Thr Ser Phe Thr Arg Asn Leu Met Met Lys 35 40 45Leu Gly
Ala Asp Asp Lys Val Ile Leu Ile Gly Val Ala Ala Asp Ser 50 55 60Gly
Cys Gly Lys Ser Thr Phe Met Arg Arg Leu Thr Asn Ile Phe Gly65 70 75
80Gly Ser Asn Val Gly Pro Leu Gly Gly Gly Phe Asp Asn Gly Gly Trp
85 90 95Glu Thr Asn Thr Leu Val Ser Asp Thr Thr Thr Val Ile Cys Leu
Asp 100 105 110Asp Tyr His Ala Asn Asp Arg Ser Gly Arg Lys Val Thr
Gly Arg Thr 115 120 125Ala Leu Glu Ala Ala Glu Gln Asn Phe Asp Leu
Met Tyr Glu Gln Leu 130 135 140Lys Ala Leu Lys Glu Gly Lys Thr Val
Ala Lys Pro Ile Tyr Asn His145 150 155 160Val Asn Gly Thr Leu Asp
Arg Pro Glu Glu Val Val Pro Thr Pro Ile 165 170 175Val Ile Val Glu
Gly Leu His Pro Trp Tyr Asp Ala Arg Val Lys Asp 180 185 190Leu Leu
Asp Tyr Thr Ile Tyr Leu Asp Ile Ser Asp Glu Ile Lys Arg 195 200
205Ala Trp Lys Ile Gln Arg Asp Met Ala Glu Arg Gly Trp Thr Leu Glu
210 215 220Gln Val Glu Ala Glu Ile Glu Lys Arg Lys Pro Asp Phe Asn
Lys Phe225 230 235 240Val Gly Pro Gln Lys Glu Val Ala Asp Ser Val
Ile Gln Val Leu Pro 245 250 255Thr Glu Leu Thr Asn Asp Pro Glu Gly
Lys Ile Leu Arg Val Arg Leu 260 265 270Ile Gln Lys Glu Thr Gly Asp
Tyr Glu Pro Val Tyr Leu Phe Asp Gln 275 280 285Gly Ser Thr Val Ser
Trp Ile Pro Cys Gly Thr Lys Leu Thr Cys Ser 290 295 300Tyr Pro Gly
Ile Lys Leu Gly Ser Gly Pro Asp Arg Trp Phe Asn Asn305 310 315
320Ala Val Asn Val Val Glu Met Asp Gly Gln Phe Asp Lys Leu Glu Glu
325 330 335Leu Ala Tyr Val Glu Lys His Leu Gly Asn Thr Ala Ser Lys
Tyr Asp 340 345 350Gly Glu Ile Thr Ala Gln Met Leu Lys Asn Glu Gly
Pro Arg Asp Pro 355 360 365Glu Arg Leu Arg Pro Leu Pro Asp His Arg
Leu Ala Gln Asp Pro Arg 370 375 380Gly Leu Arg Glu Ala Glu Arg Glu
Glu Gly Arg Arg Leu Arg Gln Gly385 390 395 400Pro Arg Gly Arg Val
Ser Arg Arg Gln Arg Ser Glu Gly Trp Leu Ala 405 410 415Ala Glu Asn
Arg Val Gly Phe Glu Val Trp Arg Ser 420 4253395PRTArabidopsis
thaliana 3Met Ala Val Ser Thr Ile Tyr Ser Thr Gln Ala Leu Asn Ser
Thr His1 5 10 15Phe Leu Thr Ser Ser Ser Ser Ser Lys Gln Val Phe Leu
Tyr Arg Arg 20 25 30Gln Pro Gln Thr Asn Arg Arg Phe Asn Thr Leu Ile
Thr Cys Ala Gln 35 40 45Glu Thr Ile Val Ile Gly Leu Ala Ala Asp Ser
Gly Cys Gly Lys Ser 50 55 60Thr Phe Met Arg Arg Leu Thr Ser Val Phe
Gly Gly Ala Ala Lys Pro65 70 75 80Pro Lys Gly Gly Asn Pro Asp Ser
Asn Thr Leu Ile Ser Asp Thr Thr 85 90 95Thr Val Ile Cys Leu Asp Asp
Tyr His Ser Leu Asp Arg Tyr Gly Arg 100 105 110Lys Glu Gln Lys Val
Thr Ala Leu Asp Pro Arg Ala Asn Asp Phe Asp 115 120 125Leu Met Tyr
Glu Gln Val Lys Ala Leu Lys Asn Gly Ile Ala Val Glu 130 135 140Lys
Pro Ile Tyr Asn His Val Thr Gly Leu Leu Asp Pro Pro Glu Leu145 150
155 160Ile Gln Pro Pro Lys Ile Leu Val Ile Glu Gly Leu His Pro Met
Phe 165 170 175Asp Glu Arg Val Arg Asp Leu Leu Asp Phe Ser Ile Tyr
Leu Asp Ile 180 185 190Ser Asn Glu Val Lys Phe Ala Trp Lys Ile Gln
Arg Asp Met Ala Glu 195 200 205Arg Gly His Ser Leu Glu Ser Ile Lys
Ala Ser Ile Glu Ala Arg Lys 210 215 220Pro Asp Phe Asp Ala Phe Ile
Asp Pro Gln Lys Gln Tyr Ala Asp Ala225 230 235 240Val Ile Glu Val
Leu Pro Thr Thr Leu Ile Pro Asp Asp Asn Glu Gly 245 250 255Lys Val
Leu Arg Val Arg Leu Ile Met Lys Glu Gly Val Lys Tyr Phe 260 265
270Ser Pro Val Tyr Leu Phe Asp Glu Gly Ser Thr Ile Ser Trp Ile Pro
275 280 285Cys Gly Arg Lys Leu Thr Cys Ser Tyr Pro Gly Ile Lys Phe
Asn Tyr 290 295 300Glu Pro Asp Ser Tyr Phe Asp His Glu Val Ser Val
Leu Glu Met Asp305 310 315 320Gly Gln Phe Asp Arg Leu Asp Glu Leu
Ile Tyr Val Glu Ser His Leu 325 330 335Ser Asn Leu Ser Thr Lys Phe
Tyr Gly Glu Val Thr Gln Gln Met Leu 340 345 350Lys His Ala Asp Phe
Pro Gly Ser Asn Asn Gly Thr Gly Leu Phe Gln 355 360 365Thr Ile Val
Gly Leu Lys Ile Arg Asp Leu Tyr Glu Gln Leu Ile Ala 370 375 380Asn
Lys Ala Thr Ala Arg Ala Glu Ala Lys Ala385 390 3954402PRTSpinacia
oleracea 4Met Ala Val Cys Thr Val Tyr Thr Ile Pro Thr Thr Thr His
Leu Gly1 5 10 15Ser Ser Phe Asn Gln Asn Asn Lys Gln Val Phe Phe Asn
Tyr Lys Arg 20 25 30Ser Ser Ser Ser Asn Asn Thr Leu Phe Thr Thr Arg
Pro Ser Tyr Val 35 40 45Ile Thr Cys Ser Gln Gln Gln Thr Ile Val Ile
Gly Leu Ala Ala Asp 50 55 60Ser Gly Cys Gly Lys Ser Thr Phe Met Arg
Arg Leu Thr Ser Val Phe65 70 75 80Gly Gly Ala Ala Glu Pro Pro Lys
Gly Gly Asn Pro Asp Ser Asn Thr 85 90 95Leu Ile Ser Asp Thr Thr Thr
Val Ile Cys Leu Asp Asp Phe His Ser 100 105 110Leu Asp Arg Asn Gly
Arg Lys Val Glu Lys Val Thr Ala Leu Asp Pro 115 120 125Lys Ala Asn
Asp Phe Asp Leu Met Tyr Glu Gln Val Lys Ala Leu Lys 130 135 140Glu
Gly Lys Ala Val Asp Lys Pro Ile Tyr Asn His Val Ser Gly Leu145 150
155 160Leu Asp Pro Pro Glu Leu Ile Gln Pro Pro Lys Ile Leu Val Ile
Glu 165 170 175Gly Leu His Pro Met Tyr Asp Ala Arg Val Arg Glu Leu
Leu Asp Phe 180 185 190Ser Ile Tyr Leu Asp Ile Ser Asn Glu Val Lys
Phe Ala Trp Lys Ile 195 200 205Gln Arg Asp Met Lys Glu Arg Gly His
Ser Leu Glu Ser Ile Lys Ala 210 215 220Ser Ile Glu Ser Arg Lys Pro
Asp Phe Asp Ala Tyr Ile Asp Pro Gln225 230 235 240Lys Gln His Ala
Asp Val Val Ile Glu Val Leu Pro Thr Glu Leu Ile 245 250 255Pro Asp
Asp Asp Glu Gly Lys Val Leu Arg Val Arg Met Ile Gln Lys 260 265
270Glu Gly Val Lys Phe Phe Asn Pro Val Tyr Leu Phe Asp Glu Gly Ser
275 280 285Thr Ile Ser Trp Ile Pro Cys Gly Arg Lys Leu Thr Cys Ser
Tyr Pro 290 295 300Gly Ile Lys Phe Ser Tyr Gly Pro Asp Thr Phe Tyr
Gly Asn Glu Val305 310 315 320Thr Val Val Glu Met Asp Gly Met Phe
Asp Arg Leu Asp Glu Leu Ile 325 330 335Tyr Val Glu Ser His Leu Ser
Asn Leu Ser Thr Lys Phe Tyr Gly Glu 340 345 350Val Thr Gln Gln Met
Leu Lys His Gln Asn Phe Pro Gly Ser Asn Asn 355 360 365Gly Thr Gly
Phe Phe Gln Thr Ile Ile Gly Leu Lys Ile Arg Asp Leu 370 375 380Phe
Glu Gln Leu Val Ala Ser Arg Ser Thr Ala Thr Ala Thr Ala Ala385 390
395 400Lys Ala5396PRTPhaeodactylum tricornutum 5Met Lys Phe Ala Val
Phe Ala Ser Leu Thr Ala Thr Ala Ala Ala Phe1 5 10 15Ala Pro Thr Ala
Phe Val Pro Ser Asn Leu Arg Gly Val Ala Pro Ser 20 25 30Ala Ser Ser
Leu Asn Met Ala Leu Lys Glu Gly Gln Thr Pro Ile Ile 35 40 45Ile Gly
Val Ala Ala Asp Ser Gly Cys Gly Lys Ser Thr Phe Met Arg 50 55 60Arg
Leu Thr Asn Ile Phe Gly Gly Asp Val Val Gly Pro Leu Gly Gly65 70 75
80Gly Phe Asp Lys Gly Ser Trp Glu Thr Asn Thr Leu Val Ser Asp Leu
85 90 95Thr Thr Val Ile Cys Leu Asp Asp Tyr His Leu Asn Asp Arg Ala
Gly 100 105 110Arg Lys Val Thr Met Arg Thr Ala Leu Asp Pro Glu Glu
Asn Asn Phe 115 120 125Asp Leu Met Tyr Glu Gln Val Lys Ala Leu Lys
Asp Gly Lys Thr Val 130 135 140Glu Lys Pro Ile Tyr Asn His Val Asn
Gly Thr Leu Asp Thr Pro Glu145 150 155 160Thr Ile Glu Pro Thr Pro
Ile Ile Ile Phe Glu Gly Leu His Pro Met 165 170 175His Asp Lys Arg
Val Leu Asp Leu Leu Asp Phe Ser Leu Tyr Leu Asp 180 185 190Ile Ser
Asp Asp Val Lys Leu Asn Trp Lys Val Gln Arg Asp Met Glu 195 200
205Glu Arg Gly His Ser Met Glu Ser Ile Leu Ala Ser Ile Glu Ala Arg
210 215 220Lys Pro Asp Phe Asp Ala Tyr Ile Asp Pro Gln Lys Gln Leu
Ala Asp225 230 235 240Leu Ile Ile Glu Val Leu Pro Thr Arg Leu Asp
Gln Asp Asp Lys Lys 245 250 255Thr Leu Arg Val Arg Cys Ile Gln Lys
Glu Gly Val Glu Asn Phe Asp 260 265 270Pro Cys Phe Leu Phe Asp Glu
Gly Ser Ser Ile Glu Trp Thr Pro Ala 275 280 285Pro Thr Lys Leu Ser
Ser Pro Ala Pro Gly Ile Lys Leu Ala Tyr Tyr 290 295 300Pro Glu Glu
Phe Phe Gly Lys Asp Ala Gln Val Leu Glu Met Asp Gly305 310 315
320Asn Phe Asp Asn Ile Gln Glu Leu Val Tyr Val Glu Ser Ala Leu Ser
325 330 335Asn Thr Lys Thr Lys Phe Tyr Gly Glu Met Thr Gln Ala Met
Leu Ala 340 345 350Leu Ala Thr Ala Pro Gly Ser Asn Asn Gly Thr Gly
Leu Met Gln Thr 355 360 365Leu Ala Ala Phe Ala Ile Arg Asp Ile Tyr
Glu Lys Lys Thr Ala Ala 370 375 380Ala Lys Ala Lys Ala Gly Val Ser
Ala Ala Ala Ala385 390 3956375PRTChlamydomonas reinhardtii 6Met Ala
Phe Thr Met Arg Ala Pro Ala Pro Arg Ala Thr Ala Gln Ser1 5 10 15Arg
Val Thr Ala Asn Arg Ala Arg Arg Ser Leu Val Val Arg Ala Asp 20 25
30Lys Asp Lys Thr Val Val Ile Gly Leu Ala Ala Asp Ser Gly Cys Gly
35 40 45Lys Ser Thr Phe Met Arg Arg Met Thr Ser Ile Phe Gly Gly Val
Pro 50 55 60Lys Pro Pro Ala Gly Gly Asn Pro Asp Ser Asn Thr Leu Ile
Ser Asp65 70 75 80Met Thr Thr Val Ile Cys Leu Asp Asp Tyr His Cys
Leu Asp Arg Asn 85 90 95Gly Arg Lys Val Lys Gly Val Thr Ala Leu Ala
Pro Glu Ala Gln Asn 100 105 110Phe Asp Leu Met Tyr Asn Gln Val Lys
Ala Leu Lys Glu Gly Lys Ser 115 120 125Val Asp Lys Pro Ile Tyr Asn
His Val Ser Gly Leu Ile Asp Ala Pro 130 135 140Glu Lys Ile Glu Ser
Pro Pro Ile Leu Val Ile Glu Gly Leu His Pro145 150 155 160Phe Tyr
Asp Lys Arg Val Ala Glu Leu Leu Asp Phe Lys Ile Tyr Leu 165 170
175Asp Ile Ser Asp Asp Ile Lys Phe Ala Trp Lys Ile Gln Arg Asp Met
180 185 190Ala Glu Arg Gly His Ser Leu Glu Ser Ile Lys Ser Ser Ile
Ala Ala 195 200 205Arg Lys Pro Asp Phe Asp Ala Tyr Ile Asp Pro Gln
Lys Lys Asp Ala 210 215 220Asp Met Ile Ile Gln Val Leu Pro Thr Gln
Leu Val Pro Asp Asp Lys225 230 235 240Gly Gln Tyr Leu Arg Val Arg
Leu Ile Met Lys Glu Gly Ser Lys Met 245 250 255Phe Asp Pro Val Tyr
Leu Phe Asp Glu Gly Ser Thr Ile Ser Trp Ile 260 265 270Pro Cys Gly
Arg Lys Leu Thr Cys Ser Phe Pro Gly Ile Lys Met Phe 275 280 285Tyr
Gly Pro Asp Thr Trp Tyr Gly Gln Glu Val Ser Val Leu Glu Met 290 295
300Asp Gly Gln Phe Asp Lys Leu Glu Glu Leu Ile Tyr Val Glu Ser
His305 310 315 320Leu Ser Asn Thr Ser Ala Lys Phe Tyr Gly Glu Ile
Thr Gln Gln Met 325 330 335Leu Lys Asn Ser Gly Phe Pro Gly Ser Asn
Asn Gly Thr Gly Leu Phe 340 345 350Gln Thr Ile Val Gly Leu Lys Val
Arg Glu Val Tyr Glu Arg Ile Val 355 360 365Lys Lys Asp Val Val Pro
Val 370 3757403PRTOryza sativa 7Met Ala Ile Ser Ser Leu His Ala Thr
Thr Ser Leu
His Ser Pro Cys1 5 10 15Thr Thr Asn Thr Ser Phe Arg Gln Asn Gln Val
Ile Phe Phe Thr Thr 20 25 30Arg Ser Asn Arg Arg Gly Ser Thr Arg Tyr
Gly Gly Ala Arg Thr Phe 35 40 45Gln Val Ser Cys Ser Val Asp Lys Pro
Val Val Ile Gly Leu Ala Ala 50 55 60Asp Ser Gly Cys Gly Lys Ser Thr
Phe Met Arg Arg Leu Thr Ser Val65 70 75 80Phe Gly Gly Ala Ala Glu
Pro Pro Lys Gly Gly Asn Pro Asp Ser Asn 85 90 95Thr Leu Ile Ser Asp
Thr Thr Thr Val Ile Cys Leu Asp Asp Tyr His 100 105 110Ser Leu Asp
Arg Thr Gly Arg Lys Glu Lys Gly Val Thr Ala Leu Asp 115 120 125Pro
Arg Ala Asn Asp Phe Asp Leu Met Tyr Glu Gln Val Lys Ala Ile 130 135
140Lys Glu Gly Lys Ala Ile Glu Lys Pro Ile Tyr Asn His Val Thr
Gly145 150 155 160Leu Leu Asp Pro Pro Glu Leu Ile Gln Pro Pro Lys
Ile Phe Val Ile 165 170 175Glu Gly Leu His Pro Met Phe Asp Glu Arg
Val Arg Asp Leu Leu Asp 180 185 190Phe Ser Ile Tyr Leu Asp Ile Ser
Asp Glu Val Lys Phe Ala Trp Lys 195 200 205Ile Gln Arg Asp Met Ala
Glu Arg Gly His Ser Leu Glu Ser Ile Lys 210 215 220Ala Ser Ile Glu
Ala Arg Lys Pro Asp Phe Asp Ala Phe Ile Asp Pro225 230 235 240Gln
Lys Gln Tyr Ala Asp Ala Val Ile Glu Val Leu Pro Thr Gln Leu 245 250
255Ile Pro Asp Asp Asn Glu Gly Lys Val Leu Arg Val Lys Leu Ile Met
260 265 270Lys Glu Gly Val Lys Asn Phe Asn Pro Val Tyr Leu Phe Asp
Glu Gly 275 280 285Ser Ser Ile Thr Trp Val Pro Cys Gly Arg Lys Leu
Thr Cys Ser Tyr 290 295 300Pro Gly Ile Lys Phe Ala Tyr Gly Pro Asp
Thr Tyr Phe Gly His Glu305 310 315 320Val Ser Val Leu Glu Met Asp
Gly Gln Phe Asp Arg Leu Asp Glu Leu 325 330 335Ile Tyr Val Glu Ser
His Leu Ser Asn Leu Ser Thr Lys Phe Tyr Gly 340 345 350Glu Val Thr
Gln Gln Met Leu Lys His Ala Asp Phe Pro Gly Ser Asn 355 360 365Asn
Gly Thr Gly Leu Phe Gln Thr Ile Val Gly Leu Lys Ile Arg Asp 370 375
380Leu Tyr Glu Gln Ile Ile Ala Glu Arg Ala Gly Ala Pro Thr Glu
Ala385 390 395 400Ala Lys Val852PRTArtificial Sequencebipartite
targeting sequence of the phoshoribulokinase of Nannochloropsis
gaditana (NgPRK BTS) 8Met Val Lys Thr Ala Ala Val Ser Leu Leu Ala
Leu Ala Gly Leu Ala1 5 10 15Ser Ala Phe Val Pro Pro Thr Thr Asn Phe
Arg Ser Ala Asn Arg Trp 20 25 30Thr Ile Lys Ala Lys Asp Thr Ser Phe
Thr Arg Asn Leu Met Met Lys 35 40 45Leu Gly Ala Asp
509156DNANannochloropsis gaditana 9atggtcaaga ctgccgccgt aagcctcctg
gccctagccg ggctcgcatc tgccttcgtg 60ccccccacca cgaattttcg cagcgctaac
agatggacga ttaaggccaa agacacgtcc 120ttcacccgca acctcatgat
gaagctgggc gcggac 15610720DNAArtificial Sequencecodon-optimized
(for expression in Nannochloropsis) eYFP 10atggtctcca agggcgagga
gctcttcacc ggcgtcgtcc ccatcctcgt cgagctcgac 60ggcgacgtca acggccacaa
gttctccgtc tccggcgagg gcgagggcga cgctacctac 120ggcaagctca
ccctcaagtt catctgcacc accggcaagc tccccgtccc ctggcccacc
180ctcgtcacca ccttcggcta cggcctccag tgcttcgctc gctaccccga
ccacatgaag 240cagcacgact tcttcaagtc cgctatgccc gagggctacg
tccaggagcg caccatcttc 300ttcaaggacg acggcaacta caagacccgc
gctgaggtca agttcgaggg cgacaccctc 360gtcaaccgca tcgagctcaa
gggcatcgac ttcaaggagg acggcaacat cctcggccac 420aagctcgagt
acaactacaa ctcccacaac gtctacatca tggctgacaa gcagaagaac
480ggcatcaagg tcaacttcaa gatccgccac aacatcgagg acggctccgt
ccagctcgct 540gaccactacc agcagaacac ccccatcggc gacggccccg
tcctcctccc cgacaaccac 600tacctctcct accagtccgc tctctccaag
gaccccaacg agaagcgcga ccacatggtc 660ctcctcgagt tcgtcaccgc
tgctggcatc accctcggca tggacgagct ctacaagtaa 7201131DNAArtificial
SequencePrimer eYFP Fw2 11ccgccggaat tcatggtctc caagggcgag g
311235DNAArtificial SequencePrimer eYFP Rev2 12gaaagtccat
atgttacttg tagagctcgt ccatg 35135198DNAArtificial SequencepCT2Ng
vector 13gtggcacttt tcggggaaat gtgcgcggaa cccctatttg tttatttttc
taaatacatt 60caaatatgta tccgctcatg agacaataac cctgataaat gcttcaataa
tattgaaaaa 120ggaagagtat gagtattcaa catttccgtg tcgcccttat
tccctttttt gcggcatttt 180gccttcctgt ttttgctcac ccagaaacgc
tggtgaaagt aaaagatgct gaagatcagt 240tgggtgcacg agtgggttac
atcgaactgg atctcaacag cggtaagatc cttgagagtt 300ttcgccccga
agaacgtttt ccaatgatga gcacttttaa agttctgcta tgtggcgcgg
360tattatcccg tattgacgcc gggcaagagc aactcggtcg ccgcatacac
tattctcaga 420atgacttggt tgagtactca ccagtcacag aaaagcatct
tacggatggc atgacagtaa 480gagaattatg cagtgctgcc ataaccatga
gtgataacac tgcggccaac ttacttctga 540caacgatcgg aggaccgaag
gagctaaccg cttttttgca caacatgggg gatcatgtaa 600ctcgccttga
tcgttgggaa ccggagctga atgaagccat accaaacgac gagcgtgaca
660ccacgatgcc tgtagcaatg gcaacaacgt tgcgcaaact attaactggc
gaactactta 720ctctagcttc ccggcaacaa ttaatagact ggatggaggc
ggataaagtt gcaggaccac 780ttctgcgctc ggcccttccg gctggctggt
ttattgctga taaatctgga gccggtgagc 840gtgggtctcg cggtatcatt
gcagcactgg ggccagatgg taagccctcc cgtatcgtag 900ttatctacac
gacggggagt caggcaacta tggatgaacg aaatagacag atcgctgaga
960taggtgcctc actgattaag cattggtaac tgtcagacca agtttactca
tatatacttt 1020agattgattt aaaacttcat ttttaattta aaaggatcta
ggtgaagatc ctttttgata 1080atctcatgac caaaatccct taacgtgagt
tttcgttcca ctgagcgtca gaccccgtag 1140aaaagatcaa aggatcttct
tgagatcctt tttttctgcg cgtaatctgc tgcttgcaaa 1200caaaaaaacc
accgctacca gcggtggttt gtttgccgga tcaagagcta ccaactcttt
1260ttccgaaggt aactggcttc agcagagcgc agataccaaa tactgtcctt
ctagtgtagc 1320cgtagttagg ccaccacttc aagaactctg tagcaccgcc
tacatacctc gctctgctaa 1380tcctgttacc agtggctgct gccagtggcg
ataagtcgtg tcttaccggg ttggactcaa 1440gacgatagtt accggataag
gcgcagcggt cgggctgaac ggggggttcg tgcacacagc 1500ccagcttgga
gcgaacgacc tacaccgaac tgagatacct acagcgtgag ctatgagaaa
1560gcgccacgct tcccgaaggg agaaaggcgg acaggtatcc ggtaagcggc
agggtcggaa 1620caggagagcg cacgagggag cttccagggg gaaacgcctg
gtatctttat agtcctgtcg 1680ggtttcgcca cctctgactt gagcgtcgat
ttttgtgatg ctcgtcaggg gggcggagcc 1740tatggaaaaa cgccagcaac
gcggcctttt tacggttcct ggccttttgc tggccttttg 1800ctcacatgtt
ctttcctgcg ttatcccctg attctgtgga taaccgtatt accgcctttg
1860agtgagctga taccgctcgc cgcagccgaa cgaccgagcg cagcgagtca
gtgagcgagg 1920aagcggaaga gcgcccaata cgcaaaccgc ctctccccgc
gcgttggccg attcattaat 1980gcagctggca cgacaggttt cccgactgga
aagcgggcag tgagcgcaac gcaattaatg 2040tgagttagct cactcattag
gcaccccagg ctttacactt tatgcttccg gctcgtatgt 2100tgtgtggaat
tgtgagcgga taacaatttc acacaggaaa cagctatgac catgattacg
2160ccaagcgcgc aattaaccct cactaaaggg aacaaaagct ggagctcagc
tgctgccccg 2220accgtatctc caagtcagac atgaaatctt cagttgcgtt
aaaaactcta cgatgctacc 2280agcgttaaat aaccttgccc acgcctttaa
acgtacccga tcattaacat atcgactggc 2340tgccttggct ttgcaccagc
catcatcaga cttaacgatg ggtatgttgc ttgcctttcc 2400tgcttgaagg
gggtccgact ctctgctttc tcgatcgcgg gtgtgacctc tgaattggaa
2460tgtaaaaatg taagaagcga cgtgtccggt aaagaaatgc ccaagctcca
tcaaatctgc 2520gttgtcggcg accaaaccat gctggctcgt cgacctgccc
cggatgcagg agcatggcac 2580tcggcggcat ggcacttgag cctcgcggga
ggaatgtgtg tggttgggcg caggctgtgg 2640acggcccccc tccagcgaag
cggtcgcctc cctttccgac gctttgtgca cgttgtctgg 2700tgtcctctgt
ctcacgcacc tcttcaccga cgtggtgtcc ctcttgttgc tggtgaggga
2760cttggaatgt ggtcctggtt ctatcctggg cgcgtgtgtt cctttttttc
tctaccgtta 2820ttctctccat ttctgatgtc tcaccaccat ctccctcacc
ctccaaccgc gtcgttgtgc 2880caaaatcata cagcaggatc gatggccaag
ttgaccagtg ccgttccggt gctcaccgcg 2940cgcgacgtcg ccggagcggt
cgagttctgg accgaccggc tcgggttctc ccgggacttc 3000gtggaggacg
acttcgccgg tgtggtccgg gacgacgtga ccctgttcat cagcgcggtc
3060caggaccagg tggtgccgga caacaccctg gcctgggtgt gggtgcgcgg
cctggacgag 3120ctgtacgccg agtggtcgga ggtcgtgtcc acgaacttcc
gggacgcctc cgggccggcc 3180atgaccgaga tcggcgagca gccgtggggg
cgggagttcg ccctgcgcga cccggccggc 3240aactgcgtgc acttcgtggc
cgaggagcag gactaaatcg atcttcctta aaaatttaat 3300tttcattagt
tgcagtcact ccgctttggt ttcacagtca ggaataacac tagctcgtct
3360tcaccatgga tgccaatctc gcctattcat ggtgtataaa agttcaacat
ccaaagctag 3420aacttttgga aagagaaaga atatccgaat agggcacggc
gtgccgtatt gttggagtgg 3480actagcagaa agtgaggaag gcacaggatg
agttttctcg agagctgctg ccccgaccgt 3540atctccaagt cagacatgaa
atcttcagtt gcgttaaaaa ctctacgatg ctaccagcgt 3600taaataacct
tgcccacgcc tttaaacgta cccgatcatt aacatatcga ctggctgcct
3660tggctttgca ccagccatca tcagacttaa cgatgggtat gttgcttgcc
tttcctgctt 3720gaagggggtc cgactctctg ctttctcgat cgcgggtgtg
acctctgaat tggaatgtaa 3780aaatgtaaga agcgacgtgt ccggtaaaga
aatgcccaag ctccatcaaa tctgcgttgt 3840cggcgaccaa accatgctgg
ctcgtcgacc tgccccggat gcaggagcat ggcactcggc 3900ggcatggcac
ttgagcctcg cgggaggaat gtgtgtggtt gggcgcaggc tgtggacggc
3960ccccctccag cgaagcggtc gcctcccttt ccgacgcttt gtgcacgttg
tctggtgtcc 4020tctgtctcac gcacctcttc accgacgtgg tgtccctctt
gttgctggtg agggacttgg 4080aatgtggtcc tggttctatc ctgggcgcgt
gtgttccttt ttttctctac cgttattctc 4140tccatttctg atgtctcacc
accatctccc tcaccctcca accgcgtcgt tgtgccaaaa 4200tcatacagca
ggaggcctgt cgacggcgcg ccggatccag atctgaattc gatatcacgc
4260gtccatggca tatggctagc gcggccgcct cgagtctaga cttccttaaa
aatttaattt 4320tcattagttg cagtcactcc gctttggttt cacagtcagg
aataacacta gctcgtcttc 4380accatggatg ccaatctcgc ctattcatgg
tgtataaaag ttcaacatcc aaagctagaa 4440cttttggaaa gagaaagaat
atccgaatag ggcacggcgt gccgtattgt tggagtggac 4500tagcagaaag
tgaggaaggc acaggatgag ttttctcgag ggtacccaat tcgccctata
4560gtgagtcgta ttacgcgcgc tcactggccg tcgttttaca acgtcgtgac
tgggaaaacc 4620ctggcgttac ccaacttaat cgccttgcag cacatccccc
tttcgccagc tggcgtaata 4680gcgaagaggc ccgcaccgat cgcccttccc
aacagttgcg cagcctgaat ggcgaatggg 4740acgcgccctg tagcggcgca
ttaagcgcgg cgggtgtggt ggttacgcgc agcgtgaccg 4800ctacacttgc
cagcgcccta gcgcccgctc ctttcgcttt cttcccttcc tttctcgcca
4860cgttcgccgg ctttccccgt caagctctaa atcgggggct ccctttaggg
ttccgattta 4920gtgctttacg gcacctcgac cccaaaaaac ttgattaggg
tgatggttca cgtagtgggc 4980catcgccctg atagacggtt tttcgccctt
tgacgttgga gtccacgttc tttaatagtg 5040gactcttgtt ccaaactgga
acaacactca accctatctc ggtctattct tttgatttat 5100aagggatttt
gccgatttcg gcctattggt taaaaaatga gctgatttaa caaaaattta
5160acgcgaattt taacaaaata ttaacgctta caatttag
519814891DNAArtificial SequencepCT55 cassette 14gaattcatga
gatccttttg catcgcagcc cttttggctg tggcatctgc cttcaccaca 60cagccaactt
ccttcactgt gaagactgcg aatgtgggcg aacgggcgag tggggttttc
120cctgagcaga gctctgctca tcgcacgcgt aaagcaacga ttgtcatggt
ctccaagggc 180gaggagctct tcaccggcgt cgtccccatc ctcgtcgagc
tcgacggcga cgtcaacggc 240cacaagttct ccgtctccgg cgagggcgag
ggcgacgcta cctacggcaa gctcaccctc 300aagttcatct gcaccaccgg
caagctcccc gtcccctggc ccaccctcgt caccaccttc 360ggctacggcc
tccagtgctt cgctcgctac cccgaccaca tgaagcagca cgacttcttc
420aagtccgcta tgcccgaggg ctacgtccag gagcgcacca tcttcttcaa
ggacgacggc 480aactacaaga cccgcgctga ggtcaagttc gagggcgaca
ccctcgtcaa ccgcatcgag 540ctcaagggca tcgacttcaa ggaggacggc
aacatcctcg gccacaagct cgagtacaac 600tacaactccc acaacgtcta
catcatggct gacaagcaga agaacggcat caaggtcaac 660ttcaagatcc
gccacaacat cgaggacggc tccgtccagc tcgctgacca ctaccagcag
720aacaccccca tcggcgacgg ccccgtcctc ctccccgaca accactacct
ctcctaccag 780tccgctctct ccaaggaccc caacgagaag cgcgaccaca
tggtcctcct cgagttcgtc 840accgctgctg gcatcaccct cggcatggac
gagctctaca agtaacatat g 89115885DNAArtificial SequencepCT56
cassette 15gaattcatgg tcaagactgc cgccgtaagc ctcctggccc tagccgggct
cgcatctgcc 60ttcgtgcccc ccaccacgaa ttttcgcagc gctaacagat ggacgattaa
ggccaaagac 120acgtccttca cccgcaacct catgatgaag ctgggcgcgg
acgtctccaa gggcgaggag 180ctcttcaccg gcgtcgtccc catcctcgtc
gagctcgacg gcgacgtcaa cggccacaag 240ttctccgtct ccggcgaggg
cgagggcgac gctacctacg gcaagctcac cctcaagttc 300atctgcacca
ccggcaagct ccccgtcccc tggcccaccc tcgtcaccac cttcggctac
360ggcctccagt gcttcgctcg ctaccccgac cacatgaagc agcacgactt
cttcaagtcc 420gctatgcccg agggctacgt ccaggagcgc accatcttct
tcaaggacga cggcaactac 480aagacccgcg ctgaggtcaa gttcgagggc
gacaccctcg tcaaccgcat cgagctcaag 540ggcatcgact tcaaggagga
cggcaacatc ctcggccaca agctcgagta caactacaac 600tcccacaacg
tctacatcat ggctgacaag cagaagaacg gcatcaaggt caacttcaag
660atccgccaca acatcgagga cggctccgtc cagctcgctg accactacca
gcagaacacc 720cccatcggcg acggccccgt cctcctcccc gacaaccact
acctctccta ccagtccgct 780ctctccaagg accccaacga gaagcgcgac
cacatggtcc tcctcgagtt cgtcaccgct 840gctggcatca ccctcggcat
ggacgagctc tacaagtaac atatg 88516732DNAArtificial SequencepCT59
cassette 16gaattcatgg tctccaaggg cgaggagctc ttcaccggcg tcgtccccat
cctcgtcgag 60ctcgacggcg acgtcaacgg ccacaagttc tccgtctccg gcgagggcga
gggcgacgct 120acctacggca agctcaccct caagttcatc tgcaccaccg
gcaagctccc cgtcccctgg 180cccaccctcg tcaccacctt cggctacggc
ctccagtgct tcgctcgcta ccccgaccac 240atgaagcagc acgacttctt
caagtccgct atgcccgagg gctacgtcca ggagcgcacc 300atcttcttca
aggacgacgg caactacaag acccgcgctg aggtcaagtt cgagggcgac
360accctcgtca accgcatcga gctcaagggc atcgacttca aggaggacgg
caacatcctc 420ggccacaagc tcgagtacaa ctacaactcc cacaacgtct
acatcatggc tgacaagcag 480aagaacggca tcaaggtcaa cttcaagatc
cgccacaaca tcgaggacgg ctccgtccag 540ctcgctgacc actaccagca
gaacaccccc atcggcgacg gccccgtcct cctccccgac 600aaccactacc
tctcctacca gtccgctctc tccaaggacc ccaacgagaa gcgcgaccac
660atggtcctcc tcgagttcgt caccgctgct ggcatcaccc tcggcatgga
cgagctctac 720aagtaacata tg 7321720DNAArtificial SequencePrimer
Cass02Ng Fw 17cttggaatgt ggtcctggtt 201820DNAArtificial
SequencePrimer eYFP Rev 18gaacttgagg gtgagcttgc 201970PRTArtificial
SequenceIn silico protein sequence of first 70 amino acids of
Nannochloropsis gaditana phosphoribulokinase 19Met Val Lys Thr Ala
Ala Val Ser Leu Leu Ala Leu Ala Gly Leu Ala1 5 10 15Ser Ala Phe Val
Pro Pro Thr Thr Asn Phe Arg Ser Ala Asn Arg Trp 20 25 30Thr Ile Lys
Ala Lys Asp Thr Ser Phe Thr Arg Asn Leu Met Met Lys 35 40 45Leu Gly
Ala Asp Asp Lys Val Ile Leu Ile Gly Val Ala Ala Asp Ser 50 55 60Gly
Cys Gly Lys Ser Thr65 70
* * * * *
References