U.S. patent application number 17/571794 was filed with the patent office on 2022-05-05 for fab molecules with a rodent hinge region and a non-rodent ch1 region.
The applicant listed for this patent is MorphoSys AG. Invention is credited to Julia NEUGEBAUER, Steffen RUNZ, Stefanie URLINGER.
Application Number | 20220135660 17/571794 |
Document ID | / |
Family ID | 1000006080993 |
Filed Date | 2022-05-05 |
United States Patent
Application |
20220135660 |
Kind Code |
A1 |
NEUGEBAUER; Julia ; et
al. |
May 5, 2022 |
FAB Molecules with a Rodent Hinge Region and a Non-Rodent CH1
Region
Abstract
The disclosure relates to novel Fab molecules comprising a
modified heavy chain constant region. The modified constant region
prevents the recognition of the Fab molecules by anti-Fab
antibodies present in a host's serum. The disclosure further
relates to methods of generating such modified Fab molecules for
biological, diagnostic, pharmaceutical and other uses.
Inventors: |
NEUGEBAUER; Julia; (Munich,
DE) ; RUNZ; Steffen; (Munich, DE) ; URLINGER;
Stefanie; (Munich, DE) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
MorphoSys AG |
Planegg |
|
DE |
|
|
Family ID: |
1000006080993 |
Appl. No.: |
17/571794 |
Filed: |
January 10, 2022 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16348941 |
May 10, 2019 |
11254734 |
|
|
PCT/EP2017/078991 |
Nov 13, 2017 |
|
|
|
17571794 |
|
|
|
|
Current U.S.
Class: |
424/135.1 |
Current CPC
Class: |
C07K 16/18 20130101;
C07K 2317/24 20130101; C07K 2317/53 20130101; C07K 2317/55
20130101; C07K 2317/522 20130101 |
International
Class: |
C07K 16/18 20060101
C07K016/18 |
Foreign Application Data
Date |
Code |
Application Number |
Nov 14, 2016 |
EP |
16198591.6 |
Claims
1. A method of preparing a Fab comprising a modified heavy chain
constant region, wherein the Fab comprises a CH1 domain and a hinge
region in order from N- to C-terminus, comprising the steps of: (a)
providing a Fab comprising a hinge region that is not a rodent IgG
hinge; and (b) replacing the hinge with a rodent hinge.
2. The method according to claim 1, wherein the hinge region in
step (a) is a human IgG hinge.
3. The method according to claim 2, wherein the human IgG1 hinge
comprises the amino acid sequence EPKSC (SEQ ID NO: 94).
4. The method according to claim 1, wherein the rodent hinge is a
wildtype rat IgG2a or rat IgG2b isotype.
5. The method according to claim 1, wherein the rodent hinge
comprises the amino acid sequence of any one of ERRNGGIGHKC (SEQ ID
NO: 32), EERNGGIGHKC (SEQ ID NO: 93), ERRQGGIGHKC (SEQ ID NO: 34),
VPREC (SEQ ID NO: 26).
6. The method according to claim 1, wherein the rodent hinge
contains not more than one cysteine.
7. The method according to claim 1, wherein the CH1 domain is a
wildtype human IgG1 CH1 domain, any allotype of a wildtype human
IgG1 CH1 domain or comprises an amino acid sequence that is at
least 95% identical to the amino acid sequence of a wildtype human
IgG1 CH1 domain.
8. The method according to claim 7, wherein the CH1 domain
comprises the amino acid sequence of an one of: TABLE-US-00005 (SEQ
ID NO: 1) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK V, (SEQ ID NO: 2)
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
VHTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKRV, (SEQ ID NO: 7)
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKK I, (SEQ ID NO: 8)
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
VHTFPAVLQSSGLYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVEKKV, (SEQ ID NO: 9)
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKGV or (SEQ ID NO:
10) ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKE V.
9. The method according to claim 1, wherein the modified heavy
chain constant region inhibits or prevents recognition of the Fab
by anti-Fab antibodies present in a host's serum.
10. The method according to claim 1, wherein replacing the hinge
with a rodent hinge in step b) removes an epitope which is
recognized by anti-Fab antibodies present in a host's serum.
11. The method according to claim 1, where the host's serum is
human serum.
12. The method according to claim 1, wherein the modified heavy
chain constant region consists of an amino acid sequence selected
from the group consisting of SEQ ID NO: 70-76.
13. The method according to claim 1, wherein the modified heavy
chain constant region comprises a CH1 domain and a hinge region in
order from N- to C-terminus, wherein (a) the CH1 domain comprises
the amino acid sequence
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKEV (SEQ ID NO: 10) and b) the
hinge region comprises the amino acid sequence ERRQGGIGHKC (SEQ ID
NO: 34).
14. A Fab obtainable according to the method of claim 1.
15. A method of preventing or inhibiting recognition of a Fab by
anti-Fab antibodies present in a host's serum comprising the steps
of: (a) providing a Fab comprising a hinge region that is not a
rodent IgG hinge; and (b) replacing the hinge with a rodent
hinge.
16. A method for treating or preventing a disease, comprising
administering to a subject a Fab comprising a modified heavy chain
constant region, wherein said modified heavy chain constant region
comprises a CH1 domain and a hinge region, wherein the hinge region
is of a rodent IgG isotype and the CH1 domain is not of a rodent
IgG isotype, so that recognition of said Fab by anti-Fab antibodies
present in a host's serum is inhibited.
17. The method according claim 16, wherein the rodent hinge region
does not serve as an epitope for anti-Fab antibodies present in the
host's serum.
18. The method according to claim 16, wherein the disease is
associated with the undesired presence of a target molecule of
interest specifically bound by said Fab comprising the modified
heavy chain constant region.
19. The method according to claim 16, wherein the disease is an
autoimmune disease, inflammatory disease, cancer, neovascular
disease, infectious disease, thrombosis, myocardial infarction,
and/or diabetes.
Description
[0001] This patent application is a divisional application of U.S.
Ser. No. 16/348,941 filed May 10, 2019 which is the U.S. National
Stage of PCT/EP2017/078991 filed Nov. 13, 2017 which claims the
benefit of priority from EP 16198591.6 filed Nov. 14, 2016, the
contents of each of which is herein incorporated by reference in
its entirety.
FIELD OF THE INVENTION
[0002] The present application relates to Fab molecules comprising
a modified heavy chain constant region. The modified heavy chain
constant region prevents the recognition of the Fab molecules by
pre-existing or newly formed anti-Fab antibodies present in a
host's serum. In particular, it prevents receptor activation
through anti-Fab antibody induced receptor clustering. The present
disclosure further relates to methods of generating such Fab
molecules for biological, diagnostic, pharmaceutical and other
uses.
BACKGROUND OF THE INVENTION
[0003] Fabs can be obtained from any immunoglobulin, especially
from a monoclonal antibody, using any suitable standard enzymatic
cleavage and/or digestion techniques, for example by treatment with
papain. Treatment with papain can be used to cleave an
immunoglobulin into two Fab fragments and an Fc fragment. The
enzymatic cleavage typically results in a Fab comprising an intact
CL and CH1 domain, wherein the CH1 domain is usually extended by
additional amino acids of the IgG hinge region. Alternatively, a
Fab can be prepared by the use of recombinant DNA techniques
involving the manipulation and re-expression of DNA encoding the
Fab variable and constant regions providing flexibility in defining
the length of the included hinge region.
[0004] Fabs which in nature do exist only as a degradation product
of immunoglobulins lack the Fc-part and expose a novel C-terminal
end which forms an epitope that may be recognized by antibodies
present in a host's serum which may elicit an immune response. It
has been observed that the amino acid sequence near the papain
cleavage site which lies within the hinge region of a human IgG, is
reactive with pre-existing anti-Fab antibodies present in human
serum. Amino acid sequences that form the epitopes for such
anti-IgG fragment or anti-Fab antibodies can be referred to as
auto-antigenic sequences (Kormeier et al. (1968) J. Immunol.
100(3); 612-21; Persselin and Stevens (1985) J. Clin. Invest. 76;
723-30). Aside the presence of pre-existing antibodies,
Christopoulos and coworkers (Christopoulos C, et al., Clin. Exp.
Immunol. 1994 October; 98 (1):6-11.1994) also demonstrated that the
C-terminal end of a Fab may also act as a preferred epitope for the
generation of newly formed antibodies which react with the
auto-antigenic Fab sequence. In accordance with these findings, the
inventors of the present disclosure determined that also
recombinant generated human Fab molecules, whose heavy chain
constant region C-terminally ends within the hinge region of an IgG
are recognized by anti-Fab antibodies present in human serum.
[0005] With the development of Fabs as therapeutics, the existence
of anti-Fab antibodies complicates the usage of such therapeutic
molecules. Recognition by anti-Fab antibodies can change the
pharmacokinetics and/or pharmacodynamics of such molecules (e.g.
receptor activation instead of inhibition), formation new complexes
and functions (e.g. adding an antibody Fc-part with all its
effector functions) and changes in the size of the complex which
may also have consequences for tissue distribution. Therefore, this
phenomenon represents a significant safety and efficacy risk which
needs to be avoided.
[0006] In order to minimize such a risk, the formation of an
epitope that is recognized by anti-Fab antibodies can be avoided by
replacing one or more amino acid at the C-terminal end of a Fab
heavy chain with an amino acid sequence which is not recognized by
pre-existing anti-Fab antibodies. More specifically, the exchange
of the hinge region (e.g., a human hinge region) with one more
amino acids of a hinge region from a distinct species (e.g., from a
rodent species) may prevent binding or recognition of anti-Fab
antibodies present in a host's serum (e.g., human serum) and thus
may be suited to avoid the above mentions risks for using Fabs as
therapeutics.
[0007] Modified Fab heavy chain constant regions rendering an
immunogenic compound less immunogenic in a particular host has been
disclosed. In WO94/11028, an auto-antigenic sequence derived from
the human IgG1 constant region was fused to the C-terminal end of a
murine Fab fragment. The thus obtained modified murine Fab fragment
appeared less immunogenic in human when compared to its
corresponding non-modified mouse Fab molecule.
[0008] WO2011073954 describes Fab molecules wherein a
poly-histidine tag or a glycine-serine tag was attached to the
C-terminal end of the Fab heavy chain. The attached tags prevented
binding of pre-existing anti-Fab antibodies to the modified Fab.
However, of the significantly increased size of the Fab molecule,
the addition of an artificial sequence bears a high risk in
provoking an immune response against said newly introduced amino
acid sequence.
[0009] Kim and co-workers (MAbs. 2016 Aug. 9:1-12) suggest the
generic use of human Fab molecules of the IgG2 or IgG4 isotype or
to introduce particular mutations and/or truncations in the hinge
region of a human Fab of the IgG1 isotype, in order to prevent the
binding of anti-Fab antibodies present in human serum.
[0010] Accordingly, a need exists for further improved Fab
molecules lacking of Fab specific epitopes that can be recognized
by pre-existing or newly generated anti-Fab antibodies present in a
host's serum and which efficiently prevent target receptor
activation due to the presence of anti-Fab antibodies.
BRIEF DESCRIPTION OF FIGURES
[0011] FIG. 1: Amino acid sequences of the C-terminal region of
modified heavy chain constant regions according to the present
disclosure. SEQ ID NO: 95 refers to the C-terminal heavy chain
constant region of a human Fab comprising a human IgG1 CH1 domain
and hinge region according SEQ ID NO: 1. The hinge region
C-terminally ends with a cysteine at EU position 220. SEQ ID NO: 96
is similar to SEQ ID NO: 95 with the difference of a natural
occurring K214R mutation in the CH1 domain (allotype). SEQ ID NO:
97 refers to the C-terminal heavy chain constant region of a
modified human constant region according SEQ ID NO: 70. EU position
216-220 of the human Fab hinge region of the IgG1 isotype are
exchanged with 5 amino-acid residues of a corresponding rat IgG2a
hinge region. In addition, the human CH1 domain bears a V2151
mutation in accordance with the presence of an isoleucine at
position 215 in the natural occurring rat IgG2a CH1 domain. SEQ ID
NO: 98 refers to the C-terminal heavy chain constant region of a
modified human constant region according SEQ ID NO: 71. EU position
216-220 of a human Fab hinge region of the IgG1 isotype are
exchanged with 11 amino-acid residues of a corresponding rat IgG2b
hinge region. SEQ ID NO: 99 is similar to SEQ ID NO: 98 but with an
additional D212E mutation in the human CH1 domain in order to
resolve a potential T-cell epitope present in SEQ ID NO: 71. SEQ ID
NO: 100 is similar to SEQ ID NO: 98 but with an additional K214G
mutation in the human CH1 domain to resolve a potential T-cell
epitope present in SEQ ID NO: 71. SEQ ID NO: 101 is similar to SEQ
ID NO: 98 but with an additional K214E mutation in the human CH1
domain to resolve a potential T-cell epitope present in SEQ ID NO:
71. SEQ ID NO: 102 is similar to SEQ ID NO: 98 but with an
additional R217E mutation in the rat IgG2b hinge region to resolve
a potential T-cell epitope present in SEQ ID NO: 71. SEQ ID NO: 103
is similar to SEQ ID NO: 101 but with an additional N219Q mutation
in the hinge region to remove a potential posttranslational
modification site present in SEQ ID NO: 74.
[0012] FIGS. 2A, 2B, and 2C: FACS based functional characterization
of Fab molecules of the present disclosure for their ability to
induce receptor activation through pre-existing anti-Fab antibodies
present in human plasma samples. FIG. 2A: A rat derived Receptor-X
specific IgG (Ref-IgG #2) induces strong expression of a cell
surface activation marker whereas the corresponding rat derived Fab
molecule (Ref-Fab #2) shows no effect on receptor activation in the
presence of human plasma samples. FIG. 2B: A Receptor-X specific
human Fab (Ref-Fab #1) comprising a human CH1 and human hinge
region induces significant expression of the cell surface
activation marker in presence of 8 of 13 tested human plasma
samples. In contrast, a Fab with identical variable domains but
with a rat IgG2b hinge region (SEQ ID NO: 71; Construct #2) reveals
no receptor activation. FIG. 2C: 3 distinct Receptor-X specific
Fabs (Ref-Fab #1, Ref-Fab #3, Ref-Fab #4) comprising a human CH1
domain and a rat IgG2a hinge region (SEQ ID NO: 70; Construct #1)
induce expression of a cell surface activation marker only in the
presence of 1-2 of 12 tested human plasma samples.
[0013] FIG. 3: FACS based functional characterization of various
Fab and IgG molecules of the present disclosure for their ability
to induce receptor activation through pre-existing anti-Fab
antibodies present in different human plasma samples. None of the 3
distinct Receptor-X specific Fabs (Ref-Fab #1, Ref-Fab #3, and
Ref-Fab #4) comprising a modified heavy chain constant region
comprising according SEQ ID NO: 72-75 (Construct #2) induce
expression of the cell surface activation marker in presence of 12
tested human serum samples. The introduced mutations in the human
CH1 domain or in the rat IgG2b hinge region resolves a potential
T-cell epitope present in SEQ ID NO: 71.
[0014] FIG. 4: FACS based functional characterization of various
Fab molecules of the present disclosure for their ability to induce
receptor activation through pre-existing anti-Fab antibodies
present in human serum samples. 3 distinct Receptor-X specific Fabs
(Ref-Fab #5, Ref-Fab #6, Ref-Fab #7) comprising a modified human
constant region according SEQ ID NO: 74 and SEQ ID NO: 76 (removal
of additional posttranslational modification site present in SEQ ID
NO: 74) were compared to their fully human Fab counterpart. For all
3 Fabs, the fully human constructs induced strong receptor
activation in the presence of at least 1 plasma samples. For
Ref-Fab #5 comprising SEQ ID NO: 76 (EQ construct), induction of
the expression of the cell surface marker is observable in presence
of only 1 plasma sample. For Ref-Fab #6, none of the tested
constructs comprising SEQ ID NO: 74 or 76 induced receptor
activation in the presence of human plasma samples.
[0015] FIG. 5: SDS-PAGE of mammalian produced Ref-Fab #5 and
Ref-Fab #6 bearing a modified heavy chain constant region
comprising SEQ ID NO: 76, under reducing and non-reducing
conditions. The two detectable protein bands under reducing
conditions reflect the individual Fab heavy and light chains,
whereas the single protein band detectable under non-reducing
conditions reflect the whole Fab molecule. The results clearly
confirmed disulfide-bridge formation between the light chain and
the modified heavy chain for each of the Fabs.
[0016] FIGS. 6 A and B: A: ELISA and B: Cell-ELISA binding of
Ref-Fab #5 and Ref-Fab #6 bearing a modified heavy chain constant
region comprising SEQ ID NO: 76 to Receptor-X. Both binding assays
confirmed that a modified heavy chain constant region according to
the present disclosure did not affected target binding.
[0017] FIG. 7: MSD-based functional characterization of Ref-Fab #5
and Ref-Fab #6 bearing a modified heavy chain constant region
comprising SEQ ID NO: 76 in a Receptor-X/ligand binding inhibition
assay. Both Fabs significantly inhibited binding of the ligand to
the receptor in a dose dependent manner. The assay confirmed that a
modified heavy chain constant region according to the present
disclosure did not affected the antagonistic activity of the
Fab.
SUMMARY OF THE INVENTION
[0018] The present disclosure provides Fab molecules comprising a
modified heavy chain constant region, wherein the modified heavy
chain constant region prevents binding of pre-existing anti-Fab
antibodies present in a host's serum to said Fab.
[0019] Specifically, the modified heavy chain constant region
according to the present disclosure comprises one or more amino
acid residues of a rodent (e.g., rat or mouse) IgG hinge region and
a CH1 constant domain, wherein the CH1 constant domain is of a
non-rodent IgG isotype (e.g., human IgG).
[0020] The Fab of the present disclosure does not induce target
antigen activation through patient specific anti-human Fab
antibodies. More specifically, the Fab of the present disclosure
does not induce receptor activation through patient specific
anti-Fab antibodies. Such a receptor may comprise, but are not
limited to, receptor tyrosine kinases or glycoprotein receptors. In
another aspect of the present disclosure, the Fab molecule of the
present disclosure prevents signaling by anti-human Fab antibody
induced receptor clustering.
[0021] The present disclosure also provides methods for preventing
a Fab to be recognized by anti-Fab antibodies present in a host's
serum consisting in preventing the formation of an epitope which is
recognized by anti-Fab antibodies by replacing the hinge region of
the Fab with a hinge region derived from a distinct species.
[0022] In particular, the inventors of the present disclosure
identified that replacing the hinge region of a human Fab with one
or more amino acid residues of a non-human hinge region (e.g., a
rodent species), prevents the binding of anti-Fab antibodies
present in human serum. In other words, the presence of the
non-human hinge rendered the human Fab molecule less discernible by
pre-existing anti-Fab antibodies present in human serum.
[0023] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the
modified heavy chain constant region comprises a CH1 domain and one
or more amino acids of a hinge region, wherein the hinge region is
of a rodent IgG isotype and the CH1 domain is not of a rodent IgG
isotype, and wherein said modified heavy chain constant region
inhibits recognition of said Fab by anti-Fab antibodies present in
serum.
[0024] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the
rodent hinge region comprises the amino acid sequence of any one of
SEQ ID NO: 16-21, 22-26, 27-34, 93, 35-36, 37-42, 43-47, 48-53,
54-58, 59-60, wherein X, X2, X3 are any amino acid residue except
cysteine with the proviso that X2 and X3 constitute a sequence
motif which is not DG, NG, NS.
[0025] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the
rodent hinge region is of wildtype rat IgG2a (SEQ ID NO: 22) or rat
IgG2b isotype (SEQ ID NO: 27), or comprises an amino acid sequence
that is at least 80% identical to the amino acid sequence of a
wildtype rat IgG2a or rat IgG2b hinge region.
[0026] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the
rodent hinge region is of wildtype rat IgG2b isotype and comprises
the amino acid sequence of any one of SEQ ID NO: 32-34, SEQ ID NO:
93, wherein X2, X3 are any amino acid residues except cysteine with
the proviso that X2 and X3 constitute a sequence motif which is not
DG, NG, NS.
[0027] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the
rodent hinge region comprises the amino acid sequence ERRX2X3GIGHKC
(SEQ ID NO: 33), wherein X2, X3 are any amino acid residues except
cysteine with the proviso that X2 and X3 constitute a sequence
motif which is not DG, NG, NS.
[0028] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the
rodent hinge region comprises the amino acid sequence of any one of
ERRNGGIGHKC (SEQ ID NO: 32), EERNGGIGHKC (SEQ ID NO: 93),
ERRQGGIGHKC (SEQ ID NO: 34) or VPREC (SEQ ID NO: 26).
[0029] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the
hinge region consists of the amino acid sequence of any one of
ERRNGGIGHKC (SEQ ID NO: 32), EERNGGIGHKC (SEQ ID NO: 93),
ERRQGGIGHKC (SEQ ID NO: 34), VPREC (SEQ ID NO: 26).
[0030] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the CH1
domain is a human IgG1 CH1 domain.
[0031] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the CH1
domain is a wildtype human IgG1 CH1 domain, any allotype of a
wildtype human IgG1 CH1 domain or comprises an amino acid sequence
that is at least 95% identical to the amino acid sequence of a
wildtype human IgG1 CH1 domain.
[0032] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the CH1
domain comprises at least the amino acid sequence of any one of
DKKV (SEQ ID NO: 86), DKRV (SEQ ID NO: 87), EKKV (SEQ ID NO: 88),
DKKI (SEQ ID NO: 89), DKGV (SEQ ID NO: 90), DKEV (SEQ ID NO: 91)
from position 212 to 215 (EU numbering).
[0033] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the CH1
domain comprises the amino acid sequence of any oneof
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV (SEQ ID NO: 1),
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRV (SEQ ID NO: 2),
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKI (SEQ ID NO: 7),
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVEKKV (SEQ ID NO: 8),
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKGV (SEQ ID NO: 9),
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKEV (SEQ ID NO: 10) or an amino
acid sequence that differs from SEQ ID NO 1, 2, 7, 8, 9, or 10 in
at most 5 amino acids or is at least 95% identical to SEQ ID NO 1,
2, 7, 8, 9, or 10.
[0034] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the CH1
domain comprises the amino acid substitution D212E, K214G, K214E,
R214G, R214G or V2151.
[0035] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, comprising a CH1
domain and one or more amino acid residues of a hinge region in
order from N- to C-terminus, and wherein (a) the CH1 domain
comprises an amino acid sequence of any one of SEQ ID NO: 1, SEQ ID
NO: 2, SEQ ID NO: 7-10, or an amino acid sequence that differs
therefrom in at most 5 amino acids or which is at least 95%
identical to SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 7-10, and (b) a
hinge region comprising an amino acid sequence of any one of SEQ ID
NO: 16-21, 22-26, 27-34, 93, 35-36, 37-42, 43-47, 48-53, 54-58,
59-60 or a sequence which differs therefrom in at most 5 amino
acids and wherein X, X2, X3 are any amino acid residues except
cysteine, with the proviso that X2 and X3 constitute a sequence
motif which is not DG, NG or NS.
[0036] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, comprising a CH1
domain and one or more amino acid residues of a hinge region in
order from N- to C-terminus, and wherein (a) the CH1 domain
comprises an amino acid sequence of any one of SEQ ID NO: 1, SEQ ID
NO: 2, SEQ ID NO: 7-10, or an amino acid sequence that differs
therefrom in at most 5 amino acids or which is at least 95%
identical to SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 7-10, and (b) a
hinge region comprising an amino acid sequence of any one of SEQ ID
NO: 16-21, 22-26, 27-34, 93, 35-36 or a sequence which differs
therefrom in at most 5 amino acids and wherein X, X2, X3 are any
amino acid residues except cysteine, with the proviso that X2 and
X3 constitute a sequence motif which is not DG, NG or NS.
[0037] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region comprising an
amino acid sequence selected from the group consisting of SEQ ID
NO: 70-76.
[0038] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, comprising a CH1
domain and a hinge region in order from N- to C-terminus, and
wherein (a) the CH1 domain consists of the amino acid sequence
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKEV (SEQ ID NO: 10) and (b) the
hinge region consists the amino acid sequence ERRQGGIGHKC (SEQ ID
NO: 34).
[0039] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, comprising a CH1
domain and a hinge region in order from N- to C-terminus, and
wherein (a) the CH1 domain comprises the amino acid sequence
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKEV (SEQ ID NO: 10) and (b) the
hinge region comprises the amino acid sequence ERRQGGIGHKC (SEQ ID
NO: 34).
[0040] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the Fab
binds specifically to a cell surface receptor.
[0041] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the Fab
binds specifically to a cell surface receptor and prevents receptor
activation through the presence of anti-Fab antibodies present in
human serum.
[0042] In an embodiment, the present disclosure provides a method
of preparing a Fab comprising a modified heavy chain constant
region, wherein the Fab comprises a CH1 domain and a hinge region
in order from N- to C-terminus, comprising the steps of:
(a) providing a Fab comprising a hinge that is not a rodent IgG
hinge; (b) replacing the hinge with one or more amino acid residues
of a rodent hinge, respectively.
[0043] In an embodiment, the present disclosure provides a Fab
obtainable by the methods disclosed herein.
[0044] In an embodiment, the present disclosure provides a method
of preventing recognition of a Fab by anti-Fab antibodies present
in serum comprising the step of:
(a) providing a Fab comprising a hinge region that is not a rodent
IgG hinge; (b) replacing the hinge with a rodent hinge,
respectively.
[0045] In an embodiment, the present disclosure provides a method
of treating a subject, comprising administering the Fab of the
present disclosure.
[0046] In an embodiment, the present disclosure provides the use of
a Fab according to the present disclosure of for the treatment of a
disease.
[0047] In an embodiment, the present disclosure provides a
recombinant nucleic acid molecule encoding the Fab of the present
disclosure
[0048] In an embodiment, the present disclosure provides a vector
comprising the nucleic acid encoding the Fab of the present
disclosure.
[0049] In an embodiment, the present disclosure provides a
recombinant host cell comprising the nucleic acid molecule encoding
the Fab of the present disclosure.
[0050] In an embodiment, the present disclosure provides a
pharmaceutical composition comprising a Fab of the present
disclosure and a pharmaceutically acceptable carrier or
excipient.
[0051] An aspect of the present disclosure relates to the use of
said pharmaceutical composition for the treatment of a disorder or
condition associated with the undesired presence of a target
antigen.
[0052] In an embodiment of the present disclosure, the Fab
comprising a modified heavy chain constant region is a monoclonal
Fab.
[0053] In an embodiment of the present disclosure, the Fab
comprising a modified heavy chain constant region is an isolated
Fab.
[0054] An aspect of the present disclosure pertains to the medical
use of the disclosed Fab comprising a modified heavy chain constant
region.
[0055] An aspect of the disclosure pertains to the use of the Fab
comprising a modified heavy chain constant region for the treatment
of cardiovascular disorder, inflammatory disorder or cancer in
humans.
[0056] In an embodiment the Fab comprising a modified heavy chain
constant region is a recombinant antibody.
[0057] The Fabs of the present disclosure fully retain their in
vitro and ex vivo. Furthermore, the Fab molecules reveal excellent
production properties in mammalian cell culture with no need to
adapt existing purification protocols for human Fab molecules.
[0058] The present disclosure enables the use of Fabs as
therapeutic proteins in which the target biology prevents the use
of bivalent molecules and where it is therefore strictly required
to employ monovalent molecules. Thus, the present disclosure
enables a safe treatment for patients and avoids patient specific
pharmacokinetic and pharmacodynamics variability.
Definitions
[0059] The terms "comprising", "comprises", "comprise" and
"comprised of" as used herein are synonymous with "including",
"includes" or "containing", "contains", and are inclusive or
open-ended and do not exclude additional, non-recited members,
elements or method steps.
By the term "peptide" is meant a short molecule having less than or
equal to 93 amino acids. The term "polypeptide" means a molecule
having more than 93 amino acids.
[0060] The term "antibody" as used herein refers to a protein
comprising at least two heavy (H) chains and two light (L) chains
inter-connected by disulfide bonds which interacts (e.g., by
binding, steric hindrance, stabilizing spatial distribution) with
an antigen. Each heavy chain is comprised of a heavy chain variable
region (abbreviated herein as VH) and a heavy chain constant
region. The heavy chain constant region is comprised of 3 domains,
CH1, CH2 and CH3 and the hinge region which connects the CH1 and
CH2 domain. Each light chain is comprised of a light chain variable
region (abbreviated herein as VL) and a light chain constant
region. The light chain constant region is comprised of one domain,
CL. The VH and VL regions can be further subdivided into regions of
hypervariability, termed complementarity determining regions (CDR),
interspersed with regions that are more conserved, termed framework
regions (FR). Each VH and VL is composed of three CDRs and four
FR's arranged from amino-terminus to carboxy-terminus in the
following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4. The
variable regions of the heavy and light chains contain a binding
domain that interacts with an antigen. The constant regions of the
antibodies may mediate the binding of the immunoglobulin to host
tissues or factors, including various cells of the immune system
(e.g., effector cells) and the first component (Clq) of the
classical complement system. The term "antibody" includes for
example, monoclonal antibodies, human antibodies, humanized
antibodies, camelised antibodies and chimeric antibodies. The
antibodies can be of any isotype.
[0061] As used herein, "isotype" refers to the antibody class
(e.g., IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD, and IgE
antibody) that is encoded by the heavy chain constant domain genes.
The full-length amino acid sequence of each wild type human IgG
constant region (including all domains, i.e., CH1 domain, hinge,
CH2 domain, and CH3 domain) is cataloged in the UniProt database
available on-line, e.g., as P01857 (IgG1), P01859 (IgG2), P01860
(IgG3), and P01861 (IgG4), or different allotypes thereof. As used
herein, a domain of a heavy chain constant region, e.g., the hinge,
is of an "IgG1 isotype," "IgG2 isotype," "IgG3 isotype," or "IgG4
isotype," if the domain comprises the amino acid sequence of the
corresponding domain of the respective isotype, or a variant
thereof (that has a higher homology to the corresponding domain of
the respective isotype than it does to that of the other
isotypes).
[0062] A "wildtype" protein or portion thereof is a version of the
protein as it is found in nature. An amino acid sequence of a
wildtype protein, e.g., a heavy chain constant region, is the amino
acid sequence of the protein as it occurs in nature. Due to
allotypic differences, there can be more than one amino acid
sequence for a wildtype protein. For example, there are several
allotypes of naturally occurring human IGg1 heavy chain constant
regions (see, e.g., Jeffries et al. (2009) mAbs 1:1).
[0063] "Allotype" refers to naturally occurring variants within a
specific isotype group, which variants differ in a few amino acids
(see, e.g., Jefferies et al. (2009) mAbs 1:1). Antibodies described
herein may be of any allotype.
[0064] As used herein, the term "Fab molecule" or "Fab" corresponds
to the light chain (LC) plus parts of the heavy chain (HC) of an
immunoglobulin. More specifically, a Fab comprises a VL, VH, CL,
CH1 domains and additionally parts of the hinge region of an
immunoglobulin.
[0065] Fabs may be produced either by proteolytic cleavage of IgG
molecules or made through expression of recombinant molecules.
Usually parts of the constant domain of the heavy chain (Fc part)
are removed.
[0066] As used herein, a F(ab).sub.2 fragment is a molecule which
comprises two Fab molecules linked by one or more disulfide bridges
between the hinge regions of the two Fabs.
[0067] As used herein, the term "Fab heavy chain constant region"
is meant to refer to an amino acid sequence comprising the CH1
domain and the parts of the hinge region of an IgG molecule.
[0068] A "hinge", "hinge domain" or "hinge region" or "IgG hinge
region" refers to the domain of a heavy chain constant region that
joins the CH1 domain to the CH2 domain. The hinge provides varying
levels of flexibility between the binding and effector regions of
an antibody and also provides sites for intermolecular disulfide
bonding between the two heavy chain constant regions. As used
herein, a full human IgG1, IgG2, and IgG4 hinge starts at E216 (EU
numbering) and ends at G230 (EU numbering). A human IgG3 H1 hinge
region starts at E 216 and ends at R 228 (see IMGT http:// with the
extension imgt.org/IMGTScientificChart/Numbering/Hu_IGHGnber.html
of the world wide web). The sequences of various human, rat and
mouse hinges are depicted in Table 1-3. The term "hinge" includes
wildtype hinges as well as variants thereof (e.g.,
non-naturally-occurring hinges or modified hinges).
[0069] For example, the term "rat IgG2b hinge" includes wildtype
rat IgG2b hinge (SEQ ID: 27 (Table 1), and variants having 1, 2, 3,
4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21,
1-2, 1-3, 1-5, 3-5, 1-10, 3-10, 5-10, 1-21, 5-21, 10-21 and/or at
most 21, 15, 12, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 mutations, e.g.,
substitutions, deletions or additions.
[0070] Exemplary rat IgG2b hinge variants according to the present
disclosure may include hinges in which 3 of the 4 present cysteines
(C11, C14, C17, C20 according Table 1) are changed to another amino
acid and wherein 1 cysteine is maintained to allow disulfide bond
formation between the modified heavy chain constant region and the
light chain constant region of the Fab. Other exemplary rat IgG2b
hinge variants of the present disclosure includes hinges in which
the sequence motif "NG" (position 4-5 according Table 1) is
substituted with any other sequence motif with does not constitutes
a potential posttranslational modification site. Such potential
posttranslational modification sites may include amongst others,
"DG", "NG", "NS", sequence motifs. Preferably, the substitution
sequence consists of a "QG" motif.
[0071] Exemplary rat and mouse hinge sequences used in the modified
heavy chain constant region of the present disclosure are depicted
in Table 1 and Table 2, respectively.
[0072] Preferred hinge sequences present in the modified heavy
chain constant regions of the present disclosure consists of the
sequences selected from the group consisting of SEQ ID NO: 26, SEQ
ID NO: 32-34 or SEQ ID NO: 93.
TABLE-US-00001 TABLE 1 X, X2, X3 indicate any amino acid residue
except cysteine. X2 and X3 may constitute any sequence motif which
is not DG, NG or NS Amino acid sequence Hinge description/ 1 1 1 1
1 1 1 1 1 1 2 2 SEQ Relative Hinge Position 1 2 3 4 5 6 7 8 9 0 1 2
3 4 5 6 7 8 9 0 1 ID NO:: wt rat IgG1 V P R N C G G D C K P C I C T
16 wt rat IgG1 with C5X, V P R N X G G D X K P X I C T 17 C9X, C12X
wt rat IgG1 with C5X, V P R N X G G D X K P C I X T 18 C9X, C14X wt
rat IgG1 with C5X, V P R N X G G D C K P X I X T 19 C12X, C14X wt
rat IgG1 with C9X, V P R N C G G D X K P X I X T 20 C12X, C14X
truncated wt rat IgG1 V P R N C 21 wt rat IgG2a V P R E C N P C G C
T 22 wt rat IgG2a with C8X, V P R E C N P X G X T 23 C10X wt rat
IgG2a with C5X, V P R E X N P C G X T 24 C10X wt rat IgG2a with
C5X, C8X V P R E X N P X G C T 25 truncated wt rat IgG2a V P R E C
26 wt rat IgG2b E R R N G G I G H K C P T C P T C H K C P 27 wt rat
IgG2b with C14X, E R R N G G I G H K C P T X P T X H K X P 28 C17X,
C20X wt rat IgG2b with C11X, E R R N G G I G H K X P T C P T X H K
X P 29 C17X, C20X wt rat IgG2b with C11X, E R R N G G I G H K X P T
X P T C H K X P 30 C14X, C20X wt rat IgG2b with C11X, E R R N G G I
G H K X P T X P T X H K C P 31 C14X, C17X truncated wt rat IgG2b E
R R N G G I G H K C 32 truncated wt rat IgG2b E E R N G G I G H K C
93 with R3E truncated wt rat IgG2b E R R X X G I G H K C 33 with
N4X2 amd G5X3 2 3 truncated wt rat IgG2b E R R Q G G I G H K C 34
with N4Q wt rat IgG2c E P R R P K P R P P T D I C S 35 truncated wt
rat IgG2c E P R R P K P R P P T D I C 36
TABLE-US-00002 TABLE 2 X indicates any amino acid residue except
cysteine Amino acid sequence Hinge description/ 1 1 1 1 1 1 1 1 1 1
2 2 2 SEQ Relative Hinge Position 1 2 3 4 5 6 7 8 9 0 1 2 3 4 5 6 7
8 9 0 1 1 ID NO: wt mouse IgG1 V P R D C G C K P C I C T 37 wt
mouse IgG1 with C5X, V P R D X G X K P X I C T 38 C7X, C10X wt
mouse IgG1 with C7X, V P R D C G X K P X I X T 39 C10X, C12X wt
mouse IgG1 with C5X, V P R D X G C K P X I X T 40 C10X, C14X wt
mouse IgG1 with C5x, V P R D X G X K P C I X T 41 C9X, C14X
truncated wt mouse IgG1 V P R D C 42 wt mouse IgG2a E P R G P T I K
P C P P C K C P 43 wt mouse IgG2a with C13, E P R G P T I K P C P P
X K X P 44 C15 wt mouse IgG2a with C10, E P R G P T I K P X P P C K
X P 45 C15 wt mouse IgG2a with C10, E P R G P T I K P X P P X K C P
46 C13 truncated wt mouse IgG2a E P R G P T I K P C 47 wt mouse
IgG2b E P S G P I S T I N P C P P C K E C H K C P 48 wt mouse IgG2a
with E P S G P I S T I N P C P P X K E X H K X P 49 C15X, C18X,
C21X wt mouse IgG2a with E P S G P I S T I N P X P P C K E X H K X
P 50 C12X, C18X, C21X wt mouse IgG2a with E P S G P I S T I N P X P
P X K E C H K X P 51 C12X, C15X, C21X wt mouse IgG2a with E P S G P
I S T I N P X P P X K E X H K C P 52 C12X, C15X, C18X truncated wt
mouse IgG2b E P S G P I S T I N P C 53 wt mouse IgG2c E P R V P I T
Q N P C P P L K E C P P C A 54 wt mouse IgG2c with E P R V P I T Q
N P C P P L K E X P P X A 55 C17X, C20X wt mouse IgG2c with E P R V
P I T Q N P X P P L K E C P P X A 56 C11X, C20X wt mouse IgG2c with
E P R V P I T Q N P X P P L K E X P P C A 57 C11X, C17X truncated
wt mouse IgG2c E P R V P I T Q N P C 58 wt mouse IgG3 E P R I P K P
S T P P G S S C P 59 truncated wt mouse IgG3 E P R I P K P S T P P
G S S C 60
[0073] The hinge region may also be a chimeric hinge that comprises
sequences from at least two species. For example, a hinge may
comprise one or more amino acid residues from one species (e.g.,
rat) and the remainder of the hinge region comprises one or more
amino acid residues from other species (e.g., mouse).
[0074] The hinge region may also comprise sequences from at least
two IgG isotypes (e.g., IgG1 and IgG2). For example, a hinge
according to the present disclosure may comprise one or more amino
acid residues from a rat IgG2a isotype and one or more amino acid
residues from a rat IgG2b isotype.
[0075] A "non-rodent IgG" hinge refers to a hinge that is not of a
rat or mouse IgG isotype.
[0076] The term "CH1 domain" refers to the heavy chain constant
domain of an antibody linking the variable domain to the hinge in a
heavy chain constant domain. As used herein, a human IgG CH1 domain
starts at EU position A118 and ends at EU position V215. The term
"CH1 domain" also includes wildtype human CH1 domains (such as
having SEQ ID NO: 1 for human IgG1 and one of its natural occurring
allotypes (such as having SEQ ID NO: 2); SEQ ID NO: 3 for IgG2; SEQ
ID NO: 4 for IgG3 or SEQ ID NO: 5 for IgG4), as well as variants
thereof (e.g., non-naturally-occurring CH1 domains or modified CH1
domains).
[0077] For example, the term "CH1 domain" includes wildtype human
CH1 domains and variants thereof having 1, 2, 3, 4, 5, 1-3, 1-5,
3-5 and/or at most 5, 4, 3, 2, or 1 mutations, e.g., substitutions,
deletions or additions.
[0078] Exemplary human CH1 constant domains according to the
present disclosure includes CH1 domains, in which 1, 2, 3, or 4
amino acid residues at the C-terminal end of the CH1 domain (EU
position 212-215 or EU position D212, K213, K214 or R214, V215) are
changed to another naturally occurring amino acid except cysteine.
Preferably, the substitutions includes not more than one amino acid
exchange. Preferably, the substitution consists of D212E, K214G or
K214E, R214G or R214G, or V2151.
[0079] Table 3 provides a listing of the different amino acid
sequences of the human CH1 and hinge regions of various IgG
subclasses and variants thereof.
TABLE-US-00003 TABLE 3 Antibody Seq Class CH1 or hinge region ID Wt
human IgG1 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP 1
CH1 AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV human IgG1
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP 2 (natural
AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRV allotype)CH1 Wt human
IgG1 ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP 6 CH1
with AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVXKXX variant postions
212, 214, 215 Wt human IgG1
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP 7 CH1 with
AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKI V215I Wt human IgG1
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP 8 CH1 with
AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVEKKV D212E Wt human IgG1
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP 9 CH1 with
AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKGV K214G Wt human IgG1
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP CH1 with
AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKEV K214E 10 Wt Human IgG1
EPKSCDKTHTCPPCP 11 hinge Wt Human IgG1 EPKSC 94 hinge truncated Wt
Human IgG2 ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP 3
AVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTV Wt Human IgG2
ERKCCVECPPCP 12 hinge Wt human IgG3
ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP 4
AVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRV human IgG3
ELKTPLGDTTHTCPRCP 13 hinge (H1) Wt human IgG3 EPKSCDTPPPCPRCP 14
hinge (natural variant) Wt human IgG4
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP 5
AVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRV Wt human IgG4
ESKYGPPCPSCP 15 hinge
[0080] The term "modified heavy chain constant region" is defined
herein as a molecule which has the CH1 domain derived from an
antibody of one species (e.g. human IgG) and one more amino acids
of a hinge region of an antibody of a different species (e.g. rat
IgG). The hinge region of the different species removes the epitope
present in the originating hinge region which is recognized by
anti-Fab antibodies present in serum. Preferably, the CH1 domain is
derived from sequences found in humans, e.g. in the human germline
or somatic cells, and the hinge region is derived from sequences
found in a non-human animal, e.g. a mouse or rat.
[0081] As used herein, "engineered Fab" or "modified Fab" refers to
a Fab molecule that has been genetically engineered to contain an
modified heavy chain constant region wherein one or more amino acid
residues of the parental hinge region at the C-terminus of the Fab
heavy chain. The exchange causes that the previously present
epitope recognized by anti-Fab antibodies is removed and thus
prevents recognition and binding of the Fab to anti-Fab
antibodies.
[0082] An antibody can be engineered by modifying one or more
residues within one or both variable regions (i.e., VH and/or VL),
for example within one or more CDR regions and/or within one or
more framework regions. Additionally or alternatively, an antibody
can be engineered by modifying residues within the constant
region(s), for example to alter the effector function(s) of the
antibody. By engineering or modify an antibody improved variants of
the parental clone can be achieved. Meanwhile various technologies
e.g. to improve the affinity, to reduce immunogenicity and to
increase the effector function of an antibody are established in
the art.
[0083] The term "epitope" includes any proteinacious region which
is specifically recognized by an antibody or fragment thereof or a
T-cell receptor or otherwise interacts with a molecule. Generally
epitopes are of chemically active surface groupings of molecules
such as amino acids or carbohydrate or sugar side chains and
generally may have specific three-dimensional structural
characteristics, as well as specific charge characteristics. As
will be appreciated by one of skill in the art, practically
anything to which an antibody can specifically bind could be an
epitope. An epitope can comprise those residues to which the
antibody binds and may be "linear" or "conformational." The term
"linear epitope" refers to an epitope wherein all of the points of
interaction between the protein and the interacting molecule (such
as an antibody) occur linearly along the primary amino acid
sequence of the protein (continuous). The term "conformational
epitope" refers to an epitope in which discontinuous amino acids
that come together in three dimensional conformations. In a
conformational epitope, the points of interaction occur across
amino acid residues on the protein that are separated from one
another. For example, an epitope can be one or more amino acids
within a stretch of amino acids as shown by peptide mapping or HDX,
or one or more individual amino acids as shown by X-ray
crystallography.
[0084] The term "isolated" refers to a compound which can be e.g.
an antibody or antibody fragment that is substantially free of
other antibodies or antibody fragments having different antigenic
specificities. Moreover, an isolated antibody or antibody fragment
may be substantially free of other cellular material and/or
chemicals. Thus, in some aspects, antibodies provided are isolated
antibodies which have been separated from antibodies with a
different specificity. An isolated antibody may be a monoclonal
antibody. An isolated antibody may be a recombinant monoclonal
antibody. An isolated antibody that specifically binds to an
epitope, isoform or variant of a target may, however, have
cross-reactivity to other related antigens, e.g., from other
species (e.g., species homologs).
[0085] The term "monoclonal antibody" as used herein refers to a
preparation of antibody molecules of single molecular composition.
A monoclonal antibody composition displays a unique binding site
having a unique binding specificity and affinity for particular
epitopes.
[0086] As used herein, an antibody "binds specifically to",
"specifically binds to", is "specific to/for" or "specifically
recognizes" an antigen if such antibody is able to discriminate
between such antigen and one or more reference antigen(s), since
binding specificity is not an absolute, but a relative property.
The reference antigen(s) may be one or more closely related
antigen(s), which are used as reference points. In its most general
form (and when no defined reference is mentioned), "specific
binding" is referring to the ability of the antibody to
discriminate between the antigen of interest and an unrelated
antigen, as determined, for example, in accordance with one of the
following methods. Such methods comprise, but are not limited to
Western blots, ELISA-, RIA-, ECL-, IRMA-tests and peptide scans.
For example, a standard ELISA assay can be carried out. The scoring
may be carried out by standard color development (e.g. secondary
antibody with horseradish peroxide and tetramethyl benzidine with
hydrogen peroxide). The reaction in certain wells is scored by the
optical density, for example, at 450 nm. Typical background
(=negative reaction) may be 0.1 OD; typical positive reaction may
be 1 OD. This means the difference positive/negative can be more
than 10-fold. Typically, determination of binding specificity is
performed by using not a single reference antigen, but a set of
about three to five unrelated antigens, such as milk powder, BSA,
transferrin or the like. Additionally, "specific binding" may
relate to the ability of an antibody to discriminate between
different parts of its target antigen, e.g. different domains or
regions or between one or more key amino acid residues or stretches
of amino acid residues.
[0087] As used herein, the term "affinity" refers to the strength
of interaction between the polypeptide and its target at a single
site. Within each site, the binding region of the polypeptide
interacts through weak non-covalent forces with its target at
numerous sites; the more interactions, the stronger the
affinity.
[0088] As used herein, the term "pre-immunity" antibodies or
"pre-existing" antibodies is meant to refer to antibodies that are
normally present in an individual or organism.
[0089] As used herein, the term "antigenic" refers to the ability
of a compound to react with the immune system, i.e. antibodies.
[0090] As used herein, the terms "auto-antigenic sequence",
"auto-antigenic peptide" are used interchangeably and are meant to
refer to an amino acid sequence that is an epitope recognized by
pre-immunity antibodies.
[0091] The term "recombinant host cell" (or simply "host cell")
refers to a cell into which a recombinant expression vector has
been introduced. It should be understood that such terms are
intended to refer not only to the particular subject cell but to
the progeny of such a cell. Because certain modifications may occur
in succeeding generations due to either mutation or environmental
influences, such progeny may not, in fact, be identical to the
parent cell, but are still included within the scope of the term
"host cell" as used herein. Typical host cells are prokaryotic
(such as bacterial, including but not limited to E. coli) or
eukaryotic (which includes yeast, mammalian cells, and more).
Bacterial cells are preferred prokaryotic host cells and typically
are a strain of Escherichia coli (E. coli) such as, for example,
the E. coli strain DH5 available from Bethesda Research
Laboratories, Inc., Bethesda, Md. Preferred eukaryotic host cells
include yeast and mammalian cells including murine and rodents,
preferably vertebrate cells such as those from a mouse, rat, monkey
or human cell line, for example HKB11 cells, PERC.6 cells, or CHO
cells.
[0092] As used herein, amino acid residues will be indicated either
by their full name or according to the standard three-letter or
one-letter amino acid code. "Natural occurring amino acids" means
the following amino acids:
TABLE-US-00004 TABLE 4 Amino acids Amino acid Three letter code One
letter code Alanine Ala A Arginine Arg R Asparagine Asn N Aspartic
acid Asp D Cysteine Cys C Glutamic acid Glu E glutamine Gln Q
Glycine Gly G Histidine His H Isoleucine Ile I Leucine Leu L Lysine
Lys K Methionine Met M Phenylalanine Phe F Proline Pro P Serine Ser
S Threonine Thr T Tryptophan Trp W Tyrosine Tyr Y Valine Val V
[0093] Amino acid numbering is according EU numbering (Edelman, G.
M. et al., Proc. Natl. Acad. USA, 63, 78-85 (1969). PMID: 5257969
and as depicted under http:// with the extension
imgt.org/IMGTScientificChart/Numbering/Hu_IGHGnber.html of the
world wide web.
DETAILED DESCRIPTION OF THE INVENTION
[0094] The invention is based on the findings that the substitution
of the hinge region of Fab with a hinge region derived from a
different species (e.g. rodent IgG hinge) removes an epitope which
is recognized by pre-existing anti-Fab antibodies present in a
host's serum. Accordingly, the presence of the hinge region from a
different species prevents the binding of pre-existing anti-Fab
antibodies to said Fab. It may also prevent formation of
anti-Fab/Fab complexes which may restore an undesired bivalent
binding of full IgGs to their target antigen.
[0095] Accordingly, the present disclosure provides a Fab
comprising a modified heavy chain constant region. More
specifically, the present disclosure provides a Fab which comprise
a light chain and a heavy chain, wherein one or more amino acid
residues at the C-terminal end of the heavy chain are exchanged.
More specifically, the modified heavy chain constant region
encompasses a human CH1 domain and one or more amino acids of a
hinge region derived from a different species. More specifically,
the Fab of the present disclosure comprises a human CH1 domain and
one or more amino acids of a rodent IgG hinge region (e.g., rat or
mouse IgG).
[0096] The hinge region of a Fab comprising an unmodified heavy
chain constant domain (e.g. human CH1+human hinge) is thought to
comprise an auto-antigenic sequence which is a sequence capable of
forming an epitope which is recognized by pre-existing anti-Fab
antibodies present in a host. In contrast, the hinge region of a
distinct species may constitute a non-auto-antigenic sequence when
introduced into the Fab and thus is not recognized by pre-existing
anti-Fab antibodies. Accordingly, the substitution of the hinge
region of a Fab which comprises an auto-antigenic sequence with a
hinge region from a different species causes that the previously
present epitope which is recognized by anti-Fab antibodies present
in a host's serum, is removed.
[0097] A modified heavy chain constant region according to the
present disclosure may comprise a wildtype CH1 and a wildtype hinge
region, or a variant thereof, e.g., a CH1 and hinge region having
one or more amino acid substitutions, deletions or additions
relative to the corresponding wildtype domain/region, and/or having
an amino acid sequence that is at least 90% identical, or more, to
the corresponding wildtype sequence.
[0098] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein said
modified heavy chain constant region comprises a CH1 domain and one
or more amino acids of a hinge region, wherein the hinge region is
of rodent IgG isotype and the CH1 domain is not of a non-rodent IgG
isotype.
[0099] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein said
modified heavy chain constant region comprises a CH1 domain and one
or more amino acids of a hinge region, wherein the hinge region is
of a rodent IgG isotype and the CH1 domain is not of a non-rodent
IgG isotype, and wherein said modified heavy chain constant region
inhibits recognition of said Fab by anti-Fab antibodies present in
serum.
[0100] Exemplary modified heavy chain constant regions include one
or more amino acid residues of a rodent (e.g., rat or mouse) hinge
region and a CH1 domain, wherein the CH1 domain is not of the
rodent IgG isotype and may be, e.g., of a human IgG1, IgG2, IgG3 or
IgG4 isotype.
[0101] In certain embodiments, the modified heavy chain constant
region comprises one or more amino acids of a rat IgG2a or rat
IgG2b hinge region and a CH1 domain.
[0102] In certain embodiments, the modified heavy chain constant
region comprises one or more amino acids of a rat IgG2a hinge
region and a CH1 constant domain.
[0103] In certain embodiments, the modified heavy chain constant
region comprises one or more amino acids of a rat IgG2b hinge
region and a CH1 domain.
[0104] In certain embodiments, the modified heavy chain constant
region comprises a human IgG1 CH1 constant domain.
[0105] In certain embodiments, the modified heavy chain constant
region comprises a human IgG1 CH1 constant domain or variant
thereof.
[0106] In certain embodiments, the modified heavy chain constant
region comprises one or more amino acids of a rat IgG2a or rat
IgG2b hinge region and a CH1 domain, wherein the CH1 domain is not
a wild-type rat IgG2a or rat IgG2b constant region or variant
thereof.
[0107] In certain embodiments, the modified heavy chain constant
region comprises one or more amino acids of a rat IgG2a or rat
IgG2b hinge region and a CH1 domain, wherein the CH1 domain is a
human IgG constant region or variant thereof.
[0108] In certain embodiments, the modified heavy chain constant
region comprises one or more amino acids of a rat IgG2a or rat
IgG2b hinge region and a CH1 domain, wherein the CH1 domain
consists of a human IgG1 constant domain or variant thereof.
[0109] In certain embodiments, the modified heavy chain constant
region comprises one or more amino acids of a rat IgG2b hinge
region and a CH1 domain, wherein the CH1 domain is a human IgG1
constant region or variant thereof.
[0110] The modified heavy chain constant region of the present
disclosure can include the corresponding wildtype amino acid
sequence, or a variant thereof, e.g., one or more (e.g., between
1-10, or more) amino acid substitutions or deletions within the
hinge and/or the CH1 domain relative to the wildtype amino acid
sequence. Accordingly, the amino acid sequence of the hinge and/or
the CH1 domain is at least about 80%, 85%, 90%, 95%, or more (i.e.,
96%, 97%, 98%, 99%, or 100%) identical to the corresponding
wildtype amino acid sequence.
[0111] Generally, variants of the CH1 or hinge region may comprise
1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more mutations, and/or at most 10,
9, 8, 7, 6, 5, 4, 3, 2 or 1 mutation, or 1-10 or 1-5 mutations, or
comprise an amino acid sequence that is at least about 75%, 80%,
85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to that of the
corresponding wildtype domain (CH1, or hinge, respectively),
provided that the heavy chain constant region comprising the
specific variant retains the necessary biological activity.
[0112] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein said
modified heavy chain constant region inhibits recognition of said
Fab by anti-Fab antibodies present in human serum.
CH1 Constant Domain
[0113] The modified heavy chain constant domain of the present
disclosure may comprise a human IgG1 CH1 domain that is wildtype or
variant; a human IgG2 CH1 domain that is wildtype or variant, a
human IgG3 CH1 domain that is wildtype or variant or a human IgG4
CH1 domain that is wildtype or variant.
[0114] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the CH1
domain is a human IgG1 CH1 domain.
[0115] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the CH1
domain is a wildtype human IgG1 CH1 domain or an amino acid
sequence that is at least 95% identical to the amino acid sequence
of a wildtype human IgG1 CH1 domain (SEQ ID NO: 1).
[0116] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the CH1
domain is a wildtype human IgG1 CH1 domain (SEQ ID NO: 1), any
allotype of a wildtype human IgG1 CH1 domain or comprises an amino
acid sequence that is at least 95% identical to the amino acid
sequence of a wildtype human IgG1 CH1 domain (SEQ ID NO: 1).
[0117] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the CH1
domain comprises at least the amino acid sequence XKXX (SEQ ID NO:
92) from position 212 to 215 (EU numbering), wherein X is any amino
acid residues except cysteine.
[0118] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the CH1
domain comprises at least the amino acid sequence of any one of
DKKV (SEQ ID NO: 86), DKRV (SEQ ID NO: 87), EKKV (SEQ ID NO: 88),
DKKI (SEQ ID NO: 89), DKGV (SEQ ID NO: 90), DKEV (SEQ ID NO: 91)
from position 212 to 215 (EU numbering).
[0119] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the
human CH1 domain comprises the amino acid substitution D212E,
K214G, K214E, R214G, R214G or V2151.
[0120] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the CH1
domain comprises the amino acid sequence
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVXKXX (SEQ ID NO: 6), wherein X is
any amino acid residues except cysteine.
[0121] In certain embodiments, the CH1 domain is an allotype of the
wildtype IgG1 CH1 domain having the amino acid sequence:
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKRV (SEQ ID NO: 2) In certain
embodiments, the CH1 domain is a variant of SEQ ID NO: 2 and
comprises 1-10, 1-5, 1-2 or 1 amino acid substitutions or deletions
relative to SEQ ID NO: 2.
[0122] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the CH1
domain comprises the amino acid sequence of any one of
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKV (SEQ ID NO: 1),
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKRV (SEQ ID NO: 2),
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKI (SEQ ID NO: 7),
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVEKKV (SEQ ID NO: 8),
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKGV (SEQ ID NO: 9),
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKEV (SEQ ID NO: 10)
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG (SEQ
ID NO: 104), or an amino acid sequence that differs from SEQ ID NO
1, 2, 7, 8, 9, or 10 in at most 5 amino acids or is at least 95%
identical to SEQ ID NO 1, 2, 7, 8, 9, or 10.
[0123] In certain embodiments, the present disclosure provides a
Fab comprising a modified heavy chain constant region, wherein the
heavy chain constant region comprises a CH1 domain comprising the
sequence
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKRV (SEQ ID NO: 2) or an amino
acid sequence that differs from SEQ ID NO: 2 in at most 10 amino
acids or is at least 90% identical to SEQ ID NO: 2, wherein at
least one of D212, R214, V215 is substituted with any amino acid
residue except cysteine.
Hinge Region
[0124] In an embodiment, the modified heavy chain constant region
may comprise an amino acid sequence comprising one or more amino
acid residues of a wildtype rat IgG1 hinge (SEQ ID NO: 16), rat
IgG2a hinge (SEQ ID NO: 22), rat IgG2b hinge (SEQ ID NO: 27), rat
IgG2c hinge (SEQ ID NO: 35) or mouse IgG1 hinge (SEQ ID NO: 37),
mouse IgG2a hinge (SEQ ID NO: 43), mouse IgG2b hinge (SEQ ID NO:
48), mouse IgG2c hinge (SEQ ID NO: 54), mouse IgG3 hinge (SEQ ID
NO: 50), or an amino acid sequence that is at least 80%, 85%, 90%,
95% identical to the corresponding amino acid sequence of a
wildtype rat or mouse IgG hinge region.
[0125] Also provided are Fabs comprising a modified heavy chain
constant region, wherein the modified heavy chain constant region
comprises a wildtype rat or mouse hinge region, wherein the hinge
comprises up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
16, 17, 18, 19, 20, 21, 1-2, 1-3, 1-5, 3-5, 1-10, 3-10, 5-10, 1-21,
5-21, 10-21 and/or at most 21, 15, 12, 10, 9, 8, 7, 6, 5, 4, 3, 2,
or 1 substitutions, deletions or additions.
[0126] In an embodiment, the modified heavy chain constant region
comprises an amino acid sequence comprising one or more amino acid
residues of a wildtype rat IgG1, IgG2a, IgG2b, IgG2c hinge region,
or an amino acid sequence that is at least 80%, 85%, 90% or 95%
identical to the corresponding amino acid sequence of a wildtype
rat IgG hinge region.
[0127] In an embodiment, the rat IgG hinge region comprises a
wildtype rat IgG2b hinge (SEQ ID NO: 27) and variants having 1, 2,
3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20,
21, 1-2, 1-3, 1-5, 3-5, 1-10, 3-10, 5-10, 1-21, 5-21, 10-21 and/or
at most 21, 15, 12, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 substitutions,
deletions or additions.
[0128] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the
rodent hinge region is of wildtype rat IgG2a (SEQ ID NO: 22) or rat
IgG2b isotype (SEQ ID NO: 27), or comprises an amino acid sequence
that is at least 80%, 85%, 90% or 95% identical to the amino acid
sequence of a wildtype rat IgG2a or rat IgG2b hinge region.
[0129] In an embodiment, the modified heavy chain constant region
comprises an amino acid sequence comprising one or more amino acid
residues of a wildtype rat IgG1 hinge region (SEQ ID NO: 16), or an
amino acid sequence that is at least 80%, 85%, 90% or 95% identical
to the corresponding amino acid sequence of a wildtype rat IgG1
hinge region.
[0130] In an embodiment, the modified heavy chain constant region
comprises an amino acid sequence comprising one or more amino acid
residues of a wildtype rat IgG2a hinge region (SEQ ID NO: 22), or
an amino acid sequence that is at least 80%, 85%, 90% or 95%
identical to the amino acid sequence of the corresponding wildtype
rat IgG2a hinge region.
[0131] In an embodiment, the modified heavy chain constant region
comprises an amino acid sequence comprising one or more amino acid
residues of a wildtype rat IgG2b hinge region SEQ ID NO: 27), or an
amino acid sequence that is at least 80%, 85%, 90% or 95% identical
to the amino acid sequence of the corresponding wildtype rat IgG2b
hinge region.
[0132] In an embodiment, the modified heavy chain constant region
comprises an amino acid sequence comprising one or more amino acid
residues of a wildtype rat IgG2c hinge region (SEQ ID NO: 35), or
an amino acid sequence that is at least 80%, 85%, 90% or 95%
identical to the corresponding amino acid sequence of a wildtype
rat IgG2c hinge region.
[0133] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the
hinge region comprises the amino acid sequence of any one of SEQ ID
NO: 16-21, 22-26, 27-34, 93, 35-36, 37-42, 43-47, 48-53, 54-58,
59-60, wherein X, X2, X3 are any amino acid residue except cysteine
with the proviso that X2 and X3 constitute a sequence motif which
is not DG, NG or NS.
[0134] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the one
more amino acid residues of the rodent hinge region are of rat
IgG2b isotype and comprises the amino acid sequence of any one of
SEQ ID NO: 32-34, 93, wherein X2, X3 are any amino acid residues
except cysteine with the proviso that X2 and X3 constitute a
sequence motif which is not DG, NG or NS.
[0135] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the
hinge region comprises the amino acid sequence ERRX2X3GIGHKC (SEQ
ID NO: 33), wherein X2, X3 are any amino acid residue except
cysteine with the proviso that X2 and X3 constitute a sequence
motif which is not DG, NG, NS.
[0136] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, wherein the
hinge region comprises the amino acid sequence of any one of
ERRNGGIGHKC (SEQ ID NO: 32), EERNGGIGHKC (SEQ ID NO: 93),
ERRQGGIGHKC (SEQ ID NO: 34), VPREC (SEQ ID NO: 26).
[0137] If the rat or mouse hinge region comprises more than one
cysteine residue, the hinge region can further contain additional
modifications, for example, to reduce disulfide bond formation in
order to prevent formation of (Fab).sub.2 molecules.
[0138] Exemplary rat IgG2b hinge variants according to the present
disclosure include hinges in which 3 of the 4 present cysteines
(C11, C14, C17, C20 in SEQ ID NO: 28-31 as shown in Table 1) are
changed to another amino acid and wherein only 1 cysteine is
maintained to allow disulfide bond formation between the modified
heavy chain constant region and the light chain constant region of
the Fab. Other such variants for rat or mouse hinges may comprise
the amino acid sequence of any one of SEQ ID NO: 17-20, 23-25,
28-31, 38-41, 44-46, 49-52, 55-57. Preferably, a cysteine may be
replaced by a serine.
[0139] Other exemplary rat IgG2b hinge variants of the present
disclosure includes hinges in which the sequence motif "NG" present
at rat IgG2b hinge position 4-5 according Table 1 is substituted
with any other sequence motif with does not constitutes a potential
posttranslational modification sites. Such motifs may include
amongst others, "DG", "NG", "NS" motifs.
[0140] Preferably, the substitution consists of a "QG" motif at
said position.
[0141] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region comprising a
hinge region comprising the sequence ERRQGGIGHKC (SEQ ID NO: 34) or
an amino acid sequence that differs from SEQ ID NO: 34 in at most 5
amino acids.
[0142] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region comprising a
hinge region comprising the sequence ERRQGGIGHKC (SEQ ID NO:
34).
CH1+Hinge
[0143] A Fab comprising a modified heavy chain constant region may
comprise a human IgG1 CH1 domain or variant thereof and one or more
amino acid residues of a rodent IgG hinge or any variant thereof.
More specifically, a Fab comprising a modified heavy chain constant
region may comprise a human IgG1 CH1 domain or variant thereof and
one or more amino acid residues of a rat IgG2a or rat IgG2b hinge
or variants thereof.
[0144] The hinge and CH1 domain may be any combination of any rat
IgG2a or rat IgG2b hinge region and CH1 domain described
herein.
[0145] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, comprising a CH1
domain and one or more amino acid residues of a hinge region in
order from N- to C-terminus, and wherein (a) the CH1 domain
comprises an amino acid sequence of any one of SEQ ID NO: 1, SEQ ID
NO: 2, SEQ ID NO: 7-10, or an amino acid sequence that differs
therefrom in at most 5 amino acids or which is at least 95%
identical to SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 7-10, and (b) a
hinge region comprising any amino acid sequence of any one of SEQ
ID NO: 17-21, 23-26, 28-36, 93, 38-42, 44-47, 49-53, 55-58, 59-60
or a sequence which differs therefrom in at most 5 amino acids,
wherein X, X2, X3 are any amino acid residues except cysteine with
the proviso that X2 and X3 constitute a sequence motif which is not
DG, NG or NS.
[0146] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region, comprising a CH1
domain and a hinge region in order from N- to C-terminus, and
wherein (a) the CH1 domain consists of the amino acid sequence
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKEV (SEQ ID NO: 10) and (b) the
hinge region consists of the amino acid sequence ERRQGGIGHKC (SEQ
ID NO: 34).
[0147] In an embodiment, the present disclosure provides a Fab
comprising a modified heavy chain constant region comprising an
amino acid sequence selected from the group consisting of SEQ ID
NO: 70-76.
[0148] In certain embodiments, a Fab according to the present
disclosure comprises a modified heavy chain constant region,
wherein the heavy chain constant region comprises the sequence of
any one of:
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKIVPREC (SEQ ID NO: 70) or an
amino acid sequence that differs from SEQ ID NO: 70 in at most 10
amino acids or is at least 90% identical to SEQ ID NO: 70;
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVERRNGGIGHKC (SEQ ID NO: 71) or
an amino acid sequence that differs from SEQ ID NO: 71 in at most
10 amino acids or is at least 90% identical to SEQ ID NO: 71;
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVEKKVERRNGGIGHKC (SEQ ID NO: 72) or
an amino acid sequence that differs from SEQ ID NO: 72 in at most
10 amino acids or is at least 90% identical to SEQ ID NO: 72;
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKGVERRNGGIGHKC (SEQ ID NO: 73), or
an amino acid sequence that differs from SEQ ID NO: 73 in at most
10 amino acids or is at least 90% identical to SEQ ID NO: 73;
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKEVERRNGGIGHKC (SEQ ID NO: 74), or
an amino acid sequence that differs from SEQ ID NO: 74 in at most
10 amino acids or is at least 90% identical to SEQ ID NO: 74;
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKKVEERNGGIGHKC (SEQ ID NO: 75), or
an amino acid sequence that differs from SEQ ID NO: 75 in at most
10 amino acids or is at least 90% identical to SEQ ID NO: 75;
ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSWTVPSSSLGTQTYICNVNHKPSNTKVDKEVERRQGGIGHKC (SEQ ID NO: 76), or
an amino acid sequence that differs from SEQ ID NO: 76 in at most
10 amino acids or is at least 90% identical to SEQ ID NO: 76.
Methods for Preparing Fab Molecules Bearing a Modified Heavy Chain
Constant Domain
[0149] Methods for preparing a Fab comprising a modified heavy
chain constant region are provided.
[0150] In an aspect of the present disclosure, an amino acid
sequence comprising one or more amino acid residues at the
C-terminal end of the heavy chain of a Fab are substituted by a
different amino acid sequence. In principle, any substitution may
be appropriate which preserves the specific binding of the Fab to
its target antigen but which prevents the recognition of the Fab
from binding of pre-existing anti-Fab antibodies present in a
host's serum.
[0151] Accordingly, the Fab comprising an unmodified heavy chain
constant region (e.g., being fully human) includes a sequence which
forms an epitope that is recognized by pre-existing anti-Fab
antibodies. The amino acid sequence of the epitope that is involved
in the binding of pre-existing anti-Fab antibodies is referred to
as the "auto-antigenic sequence".
[0152] In order to determine whether an amino acid sequence acts as
an auto-antigenic sequence, peptide constructs comprising the
specific sequence to be tested can be exposed to human sera to
determine whether antibodies are present in the sera which
recognize and specifically bind to the peptide constructs. More
specifically, in order to identify whether a particular amino acid
sequence of an immunoglobulin is an auto-antigenic sequence, IgG
molecules can, for example, be cleaved with a panel of proteases to
provide IgG fragments that contain different hinge region sequences
at the C-terminal end. Alternatively, peptides and polypeptides can
be produced by peptide synthesis or recombinant DNA technology
which are modelled upon the sequence of the hinge region. In either
case, human sera can be screened to determine whether pre-existing
antibodies are present which bind to a particular exposed
C-terminal sequence or synthetic peptide, respectively.
[0153] A human IgG1 hinge region derived human pre-immunity
sequence having the sequence CDKTH (SEQ ID NO: 77) was identified
from observations made concerning the nature of pre-existing human
immunity and induced immune responses to a murine Fab and its
chimeric (rat/human) Fab counterpart (see WO94/11028). Other
potential auto-antigenic sequences present in the human IgG1 hinge
region may include PKSCD (SEQ ID NO: 61), EPKSC (SEQ ID NO: 94),
KSCDK (SEQ ID NO: 62), SCDKT (SEQ ID NO: 63), DKTHT (SEQ ID NO:
64), KTHTC (SEQ ID NO: 65), THTCP (SEQ ID NO: 66), HTCPP (SEQ ID
NO: 67), TCPPC (SEQ ID NO: 68) and CPPCP (SEQ ID NO: 69). These
peptides cover the entire human IgG1 hinge region.
[0154] Accordingly, removing the entire human hinge region of a
fully human Fab or any parts thereof may prevent the binding of
pre-existing anti-Fab antibodies present in human serum.
[0155] The inventors of the present disclosure determined that the
substitution of a rat for a human hinge region in a Fab comprising
a human CH1 domain prevented the binding of anti-Fab antibodies
present in human plasma samples and also prevented unwanted target
receptor activation caused by anti-Fab antibodies present in said
plasma samples.
[0156] In a preferred embodiment, the non-auto-antigenic sequence
is derived from a rodent IgG heavy chain constant region. More
specifically, the non-auto-antigenic sequence is derived from the
rodent hinge region. More specifically, the non-auto-antigenic
sequence is derived from a rat hinge region. More specifically, the
non-auto-antigenic sequence comprises one or more amino acid
residues of the rat hinge region is of the rat IgG2a or IgG2b
isotype.
[0157] In an embodiment, the present disclosure provides a method
of preparing a Fab comprising a modified heavy chain constant
region, wherein the Fab comprises a CH1 domain and a hinge region
in order from N- to C-terminus, comprising the steps of:
[0158] (a) providing a Fab comprising a hinge that is not a rodent
IgG hinge region;
[0159] (b) replacing the non-rodent hinge with one or more amino
acid residues of a rodent hinge region, respectively.
[0160] The Fab of the present disclosure may be derived from any
animal, such as from human, mouse, rat, rabbit, goat or camel. In
an aspect of the present disclosure, the Fab is a human or
humanized Fab. In an embodiment, the non-rodent IgG hinge region is
of human IgG1, IgG2, IgG3 or IgG4 isotype and comprises an amino
acid sequence as set forth in SEQ ID NO: 11-15. In an embodiment,
the non-rodent IgG hinge region comprises a human IgG1 hinge region
comprising the sequence EPKSC (SEQ ID NO: 94).
[0161] In an embodiment, the non-rodent hinge region is of human
IgG1 isotype and may comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10
substitution or deletions of the amino acid sequence
EPKSCDKTHTCPPCP (SEQ ID NO: 11).
[0162] In an embodiment, the non-rodent hinge region comprises the
amino acid sequence selected from the group consisting of EPKSCDKT
SEQ ID NO 78, EPKSCDKTHT SEQ ID NO: 79, EPKSCDKTH SEQ ID NO: 80,
EPKSCDK SEQ ID NO: 81, EPKSCD SEQ ID NO: 82, EPKSC (SEQ ID NO: 94),
EPKS SEQ ID NO: 83, EPK SEQ ID NO: 84, EP SEQ ID NO: 85, PKSCD (SEQ
ID NO: 61), KSCDK (SEQ ID NO: 62), SCDKT (SEQ ID NO: 63), DKTHT
(SEQ ID NO: 64), KTHTC (SEQ ID NO: 65), THTCP (SEQ ID NO: 66),
HTCPP (SEQ ID NO: 67), TCPPC (SEQ ID NO: 68) and CPPCP (SEQ ID NO:
69).
[0163] The isotype of the rodent hinge may be of the same isotype
(e.g. human IgG1 vs. mouse IgG1) or different isotype (e.g. human
IgG1 vs. mouse IgG2a) as the non-rodent hinge region.
[0164] In an embodiment of the disclosure, the method comprises the
step of replacing one or more amino acid residues of the non-rodent
hinge comprising the amino acid sequence EPKSC (SEQ ID NO: 94) with
a rodent hinge region comprising any one of SEQ ID NO: 17-21,
23-26, 28-34, 93, 35-36, 38-42, 44-47, 49-53, 55-58, or 59-60 or a
sequence which differs therefrom in at most 5 amino acids, wherein
X, X2, X3 are any amino acid residue except cysteine with the
proviso that X2 and X3 constitute a sequence motif which is not DG,
NG or NS.
[0165] In an aspect of the present disclosure, the rodent hinge
region comprises only one cysteine which allows the formation of a
disulfide bond between the heavy chain and the light chain of the
Fab and thus stabilizes the molecule. Said cysteine may be located
at the C-terminus of the hinge region. In a particular embodiment,
said cysteine is the last amino-acid residue of the modified heavy
chain constant region of the Fab of the present disclosure. In
further aspects of the present disclosure, the cysteine does not
allow the formation of disulfide bonds between the heavy chain
constant region of a first Fab molecule and the heavy chain
constant region of a second Fab molecule. In a further aspect of
the present disclosure, the rodent hinge region prevents the
formation of (Fab).sub.2 molecules. In a further aspect of the
present disclosure, the rodent hinge region of the Fab molecule of
the present disclosure contains not more than one cysteine.
[0166] In an embodiment of the disclosure, the method comprises the
step of replacing the non-rodent hinge amino acid sequence EPKSC
(SEQ ID NO: 94) with the truncated rat IgG2a hinge region sequence
VPREC (SEQ ID NO: 26) In an embodiment of the disclosure, the
method comprises the step of replacing the non-rodent hinge amino
acid sequence EPKSC (SEQ ID NO: 94) with the truncated rat IgG2a
hinge region sequence VPREC (SEQ ID NO: 26) or a sequence which
differs therefrom in at most 1, 2, 3, 4, or 5 amino acid(s).
[0167] In an embodiment of the disclosure, the method comprises the
step of replacing the non-rodent hinge amino acid sequence EPKSC
(SEQ ID NO: 94) with the truncated rat IgG2b hinge region sequence
ERRQGGIGHKC (SEQ ID NO: 34).
[0168] In an embodiment of the disclosure, the method comprises the
step of replacing the non-rodent hinge amino acid sequence EPKSC
(SEQ ID NO: 94) with a truncated rat IgG2b hinge region sequence
ERRQGGIGHKC (SEQ ID NO: 34), ERRNGGIGHKC (SEQ ID NO: 32) or
EERNGGIGHKC (SEQ ID NO: 93).
[0169] In an embodiment of the disclosure, the method comprises the
step of replacing the non-rodent hinge amino acid sequence EPKSC
(SEQ ID NO: 94) with the truncated rat IgG2b hinge region sequence
ERRQGGIGHKC (SEQ ID NO: 34) or a sequence which differs therefrom
in at most 1, 2, 4, or 5 amino acid(s).
[0170] It is within the scope of the disclosure, that the rodent
hinge sequences may comprise additional amino-acid substitution,
for instance in order to remove potential post-translational
modification sites or potential T-cell epitopes present in a
produced Fab of the present disclosure.
[0171] The rodent hinge region sequences comprising a
non-auto-antigenic sequence disclosed herein can be incorporated
into a heavy chain constant region of a Fab by a variety of means
that can be readily practiced by those having ordinary skill in the
art. According to the invention, such a molecule can be produced by
standard recombinant DNA techniques used to produce antibodies. For
example, a nucleotide sequence encoding the non-auto-antigenic
hinge region sequence can be inserted at the 3' end of a gene
encoding the CH1 domain of the Fab molecule. The nucleotide
sequence is inserted in the proper reading frame such that the
residues encoded by it will occur at the very end of the resulting
protein. Regardless of the method of fusing the rodent hinge
sequence to the Fab CH1 domain, the Fab is converted to a Fab
comprising a modified heavy chain constant region, wherein the
inserted hinge sequence does not serve as an epitope for
pre-existing antibodies present in human serum. Techniques for
engineering antibodies are well known and described in Winter and
Millstein (1991) Nature 349:293, and Larrich and Fry (1991) Hum.
Antibod. and Hybridomas 2:17, both of which are incorporated herein
by reference.
[0172] In certain embodiments, the present disclosure provides a
nucleic acid encoding the Fab comprising a modified heavy chain
constant region of the present disclosure.
[0173] In certain embodiments, the present disclosure provides a
vector comprising the nucleic acid molecules encoding the Fab
comprising a modified heavy chain constant region of the present
disclosure. In certain embodiments, the vector is an expression
vector.
[0174] In certain embodiments, the present disclosure provides a
recombinant host cell comprising the nucleic acid molecule or the
vector encoding the Fab comprising a modified heavy chain constant
region of the present disclosure.
[0175] In certain aspects of the present disclosure, additional
amino acid residues at the C-terminal end of the modified heavy
chain constant region are added for example to aid in the
expression or purification or to increase the stability of the Fab
of the present disclosure.
[0176] The coding sequences for the heavy and light chain of the
Fab of the present disclosure can be recombinant DNA molecules,
which are introduced into expression vectors by operatively linking
the DNA to the necessary expression control regions (e.g.
regulatory regions) required for gene expression The skilled man
will realize that the polynucleotides encoding the heavy or light
chain can be cloned into different vectors or in the same vector.
In a preferred embodiment, said polynucleotides are cloned in the
same vector. The vectors can be introduced into the appropriate
host cells such as prokaryotic (e.g., bacterial) or eukaryotic
(e.g., yeast or mammalian) cells by methods well known in the art
(see e.g., "Current Protocol in Molecular Biology", Ausubel et al.
(eds.), Greene Publishing Assoc. and John Wiley Interscience, New
York, 1989 and 1992). Numerous cloning vectors are known to those
of skill in the art, and the selection of an appropriate cloning
vector is a matter of choice. The gene can be placed under the
control of a promoter, ribosome binding site (for bacterial
expression) and, optionally, an operator (collectively referred to
herein as "control" elements), so that the DNA sequence encoding
the desired protein is transcribed into RNA in the host cell
transformed by a vector containing this expression construction.
The coding sequence may or may not contain a signal peptide or
leader sequence.
[0177] Upon expression in host cells, the Fabs of the present
disclosure is obtained. These steps can be achieved in different
ways, as will be known by the person skilled in the art. In
general, such steps typically include transforming or transfecting
a suitable host cell with a nucleic acid or vector or an infectious
particle which encodes the Fab molecule. Further, such steps
typically include culturing said host cells under conditions
suitable for the proliferation (multiplication, growth) of said
host cells and a culturing step under conditions suitable for the
production (expression, synthesis) of the encoded Fabs. The
culturing of host cells under conditions suitable for proliferation
or expression is typically accomplished in the presence of media
comprising components suitable for cell growth or induction of
expression. In particular embodiments, the methods for the
production of Fab molecules of the present disclosure further
comprise the step of isolating the produced Fab from the host cells
or medium.
[0178] Depending on the expression system and host selected, the
Fabs of the present disclosure are produced by growing host cells
transformed by an expression vector described above under
conditions whereby the protein of interest is expressed. The
protein is then isolated from the host cells and purified. If the
expression system secretes the protein into growth media, the
protein can be purified directly from the media. If the protein is
not secreted, it is isolated from cell lysates or recovered from
the cell membrane fraction. The selection of the appropriate growth
conditions and recovery methods are within the skill of the
art.
[0179] The Fabs of the present disclosure can then be purified by a
number of techniques as known to the person skilled in the art. It
should be noted that Fabs of the disclosure are not naturally
occurring proteins. Typically, the Fabs of the present disclosure
are recombinant, synthetic or semi-synthetic amino acid sequences,
polypeptides or proteins.
Functionality
[0180] In general, the Fabs of the present disclosure can be used
to prevent or to inhibit the interaction between one or more target
molecules of interest and their corresponding receptors or natural
binding partners, thereby preventing, inhibiting or reducing the
signaling pathways that are mediated by those target molecules of
interest and/or modulating the biological pathways and mechanisms
in which those target molecules of interest are involved.
[0181] Methods for assaying for functional activity may utilize
binding assays, such as the enzyme-linked immunosorbent assay
(ELISA), radioimmunoassay (RIA), fluorescence activated cell
sorting (FACS) and other methods that are well known in the art
(see Hampton, R. et al. (1990; Serological Methods a Laboratory
Manual, APS Press, St Paul, Minn.) and Maddox, D. E. et al. (1983;
J. Exp. Med. 158:1211-1216). Alternatively, assays may test the
ability of the Fab of the present disclosure in eliciting a
biological response as a result of binding to a biological target,
either in vivo or in vitro. Such assays include B cell and T cell
proliferation assays, and inhibition of proliferation assays (see
Paul et al., (1991). Other suitable assays will be known to those
of skill in the art.
[0182] The Fabs according to the present disclosure (i.e., Fabs
having a modified heavy chain constant region) may exhibit one or
more enhanced or altered features, compared to the same Fab without
a modified heavy chain constant region. These features may include
prevention of recognition of the Fab by pre-existing anti-Fab
antibodies present in serum, in particular human serum, reduced
formation of large cross-linked complexes, reduced receptor
mediated signaling caused by the presence of pre-existing anti-Fab
antibodies or an antagonist activity.
[0183] The prevention of binding of anti-Fab antibodies present in
serum can be assessed by a serum ELISA or by any in vitro assays
suited to assess target activation.
[0184] Herein, the "prevention of recognition by" or "prevention of
recognition binding of" anti-Fab antibodies" means that after
replacing the non-rodent hinge of a Fab with one or more amino acid
residues of a rodent IgG hinge region, the anti-Fab antibodies
display less than 95%, less than 90%, less than 80%, less than 50%,
less than 10%, less than 5%, less than 1% binding to the Fab
comprising a modified heavy chain constant region. The binding
activity can be determined by methods known to those skilled in the
art, for example by ELISA or by using Biacore.
[0185] Alternatively, the "prevention of recognition by" or
"prevention of recognition binding of" anti-Fab antibodies" means
that the Fab molecules of the present disclosure do not from
aggregates due to the presence of anti-Fab antibodies present in
serum. Aggregate formation can be determined by methods known to
those skilled in the art, for example by using size exclusion
chromatography or dynamic light scattering.
[0186] Alternatively, the "prevention of recognition by" or
"prevention of binding of" means that the Fab molecules of the
present disclosure do not cross-link and activate their target
antigen due to the presence of anti-Fab antibodies present in
serum. If the target antigen is for instance a cell surface
receptor, such cross-linking may mimic the activity of natural
ligands of the receptor resulting in receptor activation. In other
words, a Fab may act as agonist instead of acting as antagonists.
An antagonist which neutralizes the antigen's function or an
agonistic molecule that activates the function of an antigen can be
assessed by assaying an in vivo marker that reflects the function
of the antigen.
[0187] In certain embodiments, a Fab comprising a modified heavy
chain constant region according to the present disclosure has the
ability to reduce formation of larger Fab/antigen cross-linked
complexes, relative to a same Fab that does not comprise a modified
heavy chain constant region, wherein the antibody comprises a
modified heavy chain constant region selected from the group
consisting of SEQ ID NOs: 70-76. Fab/antigen complexes formed with
a Fab that comprises a modified heavy chain constant region may be
at least 2 fold, 3 fold, 5 fold or 10 folder smaller than complexes
formed with the same Fab that does not comprise a modified heavy
chain constant region.
[0188] In certain embodiments, a Fab comprising a modified heavy
chain constant region has a more potent antagonist or blocking
activity, relative to the same Fab that does not comprise a
modified heavy chain constant region, wherein the antibody
comprises a modified heavy chain constant region selected from the
group consisting of SEQ ID NOs: 70-76. The enhanced antagonist
activity of an antagonist which neutralizes the antigen's function
can be assessed by assaying an in vivo marker that reflects the
function of the antigen. The antagonist activity may be enhanced by
at least 10%, 30%, 50%, 75%, 2 fold, 3 fold, 5 fold or more.
[0189] In certain embodiments, a Fab comprising a modified heavy
chain constant region transduces a different type of signaling or
signal transduction, relative to the same antibody that does not
comprise a modified heavy chain constant region, wherein the
antibody comprises a modified heavy chain constant region selected
from the group consisting of SEQ ID NOs: 70-76. Signal transduction
can be monitored by determining the level of activation of one or
more proteins in signal transduction pathways. Signal transduction
triggered by a Fab that comprises a modified heavy chain constant
region may be higher or lower by at least 2 fold, 5 fold or more
than signal transduction with the same antibody that does not
comprise a modified heavy chain constant region.
[0190] Certain methods provided herein include methods of
preventing recognition of a Fab by anti-Fab antibodies present in a
host's serum, reduced formation of large cross-linked complexes,
reduced receptor mediated signaling caused by presence of
pre-existing antibodies or antagonist activity as compared to the
same Fab comprising a hinge of a non-rat or mouse IgG isotype.
[0191] Such methods comprise the steps of providing a Fab having a
hinge that is not an rodent IgG hinge region, and replacing the
hinge region with one or more amino acid residues of a rodent IgG
hinge (such as a hinge or any parts thereof that is a wildtype rat
IgG2a or IgG2b hinge, a hinge having an amino acid sequence that is
at least 80%, 85%, 90%, 95% identical to the amino acid sequence of
a wildtype rat IgG2a or rat IgG2b hinge region).
[0192] Accordingly, the present disclosure provides a method of
preventing the recognition of a Fab by anti-Fab antibodies present
in serum, comprising: [0193] (a) providing a Fab comprising a hinge
region that is not a rodent IgG hinge region; [0194] (b) replacing
the hinge region with one or more amino acid residues of a rodent
IgG hinge region, respectively.
[0195] Accordingly, the present disclosure provides a method of
preventing of receptor activation by anti-Fab antibodies present in
serum when an anti-receptor Fab is used, comprising: [0196] (a)
providing a Fab comprising a hinge region that is not a rodent IgG
hinge region; [0197] (b) replacing the hinge with one or more amino
acid residues of a rodent IgG hinge region, respectively.
[0198] A rodent IgG hinge may be a wildtype rat IgG2a or rat IgG2b
hinge, or comprises an amino acid sequence that is at least 80%,
95% 90%, 95% identical to the amino acid sequence of a wildtype rat
IgG2a or rat IgG2b hinge and may comprise, e.g., any sequence set
forth in Table 1.
[0199] In an embodiment of the disclosure, the method comprises the
step of replacing one or more amino acid residues of the non-rodent
hinge comprising the amino acid sequence EPKSC (SEQ ID NO: 94) with
a rodent hinge region comprising any one of SEQ ID NOs: SEQ ID NO:
17-21, 23-26, 28-34, 93, 35-36, 38-42, 44-47, 49-53, 55-58, or
59-60 or a sequence which differs therefrom in at most 5 amino
acids, wherein X, X2, X3 are any amino acid residues except
cysteine with the proviso that X2 and X3 constitute a sequence
motif which is not DG, NG or NS.
[0200] In another aspect of the present disclosure, the Fab of the
present disclosure prevents cross-linking of a target antigen due
to the presence of anti-Fab antibodies present in serum, wherein
the Fab comprises a modified heavy chain constant region selected
from the group of SEQ ID NOs: 70-76.
[0201] In another aspect of the present disclosure, the presence of
the modified heavy chain constant region prevents cross-linking of
one or more Fab molecules of the present disclosure due to the
presence of anti-Fab antibodies present in serum, wherein the
modified heavy chain constant region is selected from the group
consisting of SEQ ID NOs: 70-76.
[0202] In a further aspect of the present disclosure, the Fab of
the present disclosure does not from aggregates due to the presence
of anti-Fab antibodies present in serum, wherein the Fab comprises
a modified heavy chain constant region selected from the group of
SEQ ID NO: 70-76.
[0203] In certain embodiments, a Fab comprising a modified heavy
chain constant region binds specifically to a cell surface molecule
and triggers intracellular signaling, wherein the Fab comprises a
modified heavy chain constant region selected from the group of SEQ
ID NO: 70-76. In certain aspect of the disclosure, intracellular
signaling mediates antagonist activity. In certain embodiments, the
Fab inhibits more potent intracellular signaling relative to a Fab
having the same variable regions and light chain, but comprising a
wild-type human IgG1 heavy chain constant region.
[0204] In certain embodiments, a Fab comprising a modified heavy
chain constant region binds specifically to a cell surface molecule
and prevents formation of high molecular weight antibody-cell
surface molecule complexes, wherein the Fab comprises a modified
heavy chain constant region selected from the group of SEQ ID NO:
70-76. In certain embodiments, the antibody prevents formation of
higher molecular weight complexes relative to a Fab having the same
variable regions and light chain, but comprising a wildtype human
IgG1 heavy chain constant region.
[0205] In certain embodiments, a Fab comprising a modified heavy
chain constant region binds specifically to a cell surface molecule
and prevents clustering or oligomerization of the cell surface
molecule, wherein the Fab comprises a modified heavy chain constant
region selected from the group of SEQ ID NO: 70-77. In certain
embodiments, the Fab prevents or reduces clustering or
oligomerization of the cell surface molecule relative to an Fab
having the same variable regions and light chain, but comprising an
wildtype human IgG1 heavy chain constant region.
Pharmaceutical Compositions
[0206] The Fab of the present disclosure comprising a modified
heavy chain constant region may be used for the prevention and
treatment of diseases and disorders which are mediated by
biological pathway(s) in which the target molecule of interest,
against which the Fab of the present disclosure is directed to, is
involved.
[0207] In certain embodiments, the present disclosure provides
pharmaceutical compositions comprising one or more Fab molecules of
the present disclosure obtainable by the methods of the present
disclosure and optionally at least one pharmaceutically acceptable
carrier together referred to herein as pharmaceutical compositions.
The pharmaceutical compositions may further comprise at least one
other pharmaceutically active compound. The pharmaceutical
compositions of the present disclosure can be used in the
diagnosis, prevention and/or treatment of diseases and disorders
associated with a target molecule of interest.
[0208] In particular, the present disclosure provides
pharmaceutical compositions comprising a Fab comprising a modified
heavy chain constant region that are suitable for prophylactic,
therapeutic and/or diagnostic use in a warm-blooded animal, and in
particular in a mammal, and more in particular in a human being.
Generally, the Fab of the present disclosure may be formulated as a
pharmaceutical preparation or compositions comprising at least one
Fab according to the present disclosure and at least one
pharmaceutically acceptable carrier, diluent or excipient and/or
adjuvant, and optionally one or more further pharmaceutically
active polypeptides and/or compounds. Such a formulation may be
suitable for oral, parenteral, topical administration or for
administration by inhalation.
[0209] In particular, the Fab comprising a modified heavy chain
constant region according to the present disclosure may be used in
combination with other pharmaceutically active compounds that are
or can be used for the prevention and/or treatment of the diseases
and disorders in which a target molecule of interest is involved,
as a result of which a synergistic effect may or may not be
obtained. Examples of such compounds, as well as routes, methods
and pharmaceutical formulations or compositions for administering
them will be clear to the clinician.
[0210] In an embodiment, the present disclosure provides a
pharmaceutical composition comprising one or more Fabs of the
present disclosure for use in the prevention and/or treatment of a
disorder or condition associated with the undesired presence of a
target molecule of interest specifically bound by the one or more
Fab molecules.
[0211] In an embodiment, the present disclosure provides a
pharmaceutical composition comprising one or more modified Fabs of
the present disclosure for use in the prevention of undesired side
effect caused by the presence of pre-existing or newly formed
anti-Fab antibodies.
[0212] In an embodiment, the present disclosure provides a
pharmaceutical composition comprising one or more modified Fabs of
the present disclosure for the use as a medicament.
[0213] In an embodiment, the disclosure provides a pharmaceutical
composition comprising one or more Fabs of the present disclosure
for use in the prevention and/or treatment of autoimmune diseases,
inflammatory diseases, cancer, neovascular diseases, infectious
diseases, thrombosis, myocardial infarction, and/or diabetes.
[0214] In a further embodiment, the disclosure provides a method
for the treatment of autoimmune diseases, inflammatory diseases,
cancer, neovascular diseases, infectious diseases, thrombosis,
myocardial infarction, and/or diabetes in a subject in need thereof
using a pharmaceutical composition comprising one or more Fabs
comprising a modified heavy chain constant region according to the
present disclosure.
[0215] In an embodiment, the disclosure provides a pharmaceutical
composition comprising one or more Fabs comprising a modified heavy
chain constant region for use in the treatment of certain clinical
indications, as for example thrombotic and vascular diseases, acute
coronary syndrome, percutaneous coronary intervention, ischemic
stroke, carotid artery stenosis or peripheral arterial occlusive
disease. Furthermore it could be used for the prevention of
restenosis and atherosclerosis.
WORKING EXAMPLES
Example 1: Design of the Modified Heavy Chain Constant Region
[0216] As a starting point, a fully human Fab molecule (Ref-Fab #1)
against Receptor-X was selected. The Fab molecule is based on the
human IgG1 isotype and its heavy chain C-terminally ends at
position 220 (EU numbering). The Fab is based on a natural IgG1
allotype which bears a K214R mutation in the CH1 domain (SEQ ID NO:
2).
[0217] Receptor-X is a cell surface receptor which becomes
activated after ligand interaction and subsequent Receptor-X
clustering. Experimental studies demonstrated that bivalent
therapeutics, like IgGs, are able to mimic ligand function and
strongly activate the receptor. Like the above referenced IgGs,
Ref-Fab #1 induces receptor activation in the presence of human
plasma samples obtained from healthy donors (see FIG. 2B). This
finding strongly indicates that the fully human Fab is bound by
pre-existing anti-Fab antibodies present in the tested plasma
samples. Binding of anti-Fab antibodies is suggested to cross-link
Fab molecules leading to receptor clustering and subsequent
receptor-activation.
[0218] Accordingly, the design of the modified non-auto-antigenic
Fab heavy chain constant region of the present disclosure was
supported by the findings described in WO94/11028. WO94/11028
teaches that the whole hinge region of a human IgG1 or any
fragments thereof may act as auto-antigenic sequences which are
recognized by anti-Fab antibodies present in human serum. The
findings of WO94/11028 were confirmed by the inventors of the
present disclosure by using a rat derived IgG2a molecule (Ref-IgG
#2) directed to Receptor-X. Because of its bivalent structure, the
IgG induces strong receptor activation, whereas a corresponding rat
Fab fragment (Ref-Fab #2) prepared by papain digest, shows no signs
of receptor activation in presence of human serum samples (see FIG.
2B). These finding indicate that the enzymatically generated rat
hinge sequence present at the C-terminal end of the Fab heavy chain
does not form an epitope which is recognized by pre-existing
anti-human Fab antibodies.
[0219] In order to select the optimal sequence for the generation
of a modified human heavy chain constant region which is not
recognized by human anti-Fab antibodies, the inventors decided to
exchange the entire hinge region sequence of the human Fab
comprising SEQ ID NO: 94. The stretch was replaced with a rat IgG2a
hinge sequence consisting of SEQ ID NO: 26 resulting in Fab
Construct #1 or with the rat IgG2b hinge sequence consisting of SEQ
ID NO: 32 resulting in Fab Construct #2. The C-terminally present
cysteine residue in both constructs allowed disulfide formation
between the modified heavy chain and unmodified light chain of the
Fab. Additional cysteines were avoided to prevent disulfide bond
formation between the heavy chains of two Fab molecules which would
result in (Fab).sub.2 formation.
[0220] The thus obtained Fab molecules comprising a modified heavy
chain constant region were produced in a mammalian line and tested
in a FACS based receptor activation assays. In contrast to the
corresponding fully human Fab molecule, both, Fab Construct #1 and
Fab Construct #2 prevented receptor activation caused by the
presence of anti-Fab antibodies in human plasma samples. However,
Construct #2 revealed superior properties (see FIGS. 2A and 2B) and
was subjected to further studies.
[0221] In order to minimize the risk for increased immunogenicity
in human patients, an in silico T cell epitope screening for
Construct #2 (Lonza, The Epibase.TM. In Silico tool) was performed
which indeed revealed a potential T-cell epitope in the amino acid
sequence of Construct #2. In order to remove said epitope, an
Epibase.TM. mutation analysis was performed, wherein each
amino-acid-position was virtually substituted with each of the
natural occurring amino acid residue except cysteine. Suggested
amino acid exchanges were further analyzed in silico regarding
their potential structural influence. 4 variants affecting 2
positions in the human CH1 domain and 1 position in the rat hinge
region (EU position 212, 214 and 217, see SEQ ID NO: 99-102, FIG.
1) were produced and characterized in vitro including ELISA
binding, ligand binding inhibition and FACS based receptor
activation.
[0222] Amongst the 4 variants, the K214E mutant revealed the most
promising in vitro properties and was further engineered to remove
the potential post-translational modification motif `NG" at EU
position 219-220 by introducing a N219Q mutation.
[0223] Accordingly, the finally preferred Fab construct (referred
to as the `EQ Construct`) is comprised of a modified heavy chain
constant region including a human wild-type IgG1 CH1 domain with a
K214E mutation and a hinge region spanning position 216-226
consisting of the first 11 amino acids of the wildtype rat IgG2b
hinge region including a N219Q mutation (see SEQ ID NO: 103 in FIG.
1).
[0224] The `EQ construct` was incorporated into 3 Receptor-X
targeting human Fab molecules for in vitro characterization. The
Fab EQ constructs retained their binding to their target antigen
(see FIG. 6 and Example 3-4), their antagonistic activity (see FIG.
7 and Example 5) and did not mediated receptor activation in the
presence of a large panel of human serum samples (see FIG. 4 and
Example 6).
Example 2: Generation and Production of Fab Molecules
[0225] For generation of fully human anti-Receptor X Fab molecules,
the MorphoSys Ylanthia.RTM. library was used for pannings against
to the recombinant receptor. The MorphoSys Ylanthia.RTM. library
(Tiller et al. mAbs 5:3, 1-26; May/June (2013) and U.S. Pat. No.
8,728,981) is a commercially available phagemid library and employs
the CysDisplay.RTM. technology for displaying the Fab on the phage
surface (Lohning et al., WO2001/05950).
[0226] Functional human Fab fragments were converted from the
bacterial to the mammalian Fab format by sub-cloning procedure.
Antibody encoding vectors were enzymatically digested and the
resulting vector backbones were ligated with the Ylanthia.RTM.
mammalian expression cassette and further sub-cloned into the
respective mammalian Fab vector.
[0227] For generation of the modified heavy chain constant regions
according to the present disclosure, the DNA encoding the entire
designed heavy chain constant region was synthesized as
double-stranded DNA fragments by an external provider (IDT). The
resulting synthetic linear DNA fragments comprising the modified
heavy chain constant region with homologous overlapping sequences
were subsequently seamlessly cloned into the corresponding
mammalian Fab vector by replacing the parental heavy chain constant
region.
[0228] Variants for the removal of a potential T cell epitope (aa
exchanges within the human CH1 domain or in the rat hinge region
(see SEQ ID NO: 99-102, FIG. 1) were generated by a PCR based
mutagenesis strategy. Briefly, linear DNA fragments were produced
by PCR with suitable oligonucleotides harboring the favored
mutations and homologous overlapping sequences and subsequently
cloned into the corresponding mammalian Fab vector.
[0229] Introduction of the N219Q mutation was achieved using the by
a Site-Directed Mutagenesis approach. A specific primer pair was
designed and PCR-based mutagenesis applied according to
manufacturer's instructions.
[0230] For expression and purification eukaryotic HKB11 cells were
transfected with pYMex10 eukaryotic expression vector DNA encoding
both heavy and light chains of Fabs. Cell culture supernatant was
harvested on day 3 post transfection and subjected to Capture
select IgG-CH1 affinity chromatography (MabSelect SURE, GE
Healthcare) for antibody purification. All samples were sterile
filtered (0.2 .mu.m pore size). Purity of Fab was analyzed under
denaturing, reducing and non-reducing conditions using a Labchip
System (Caliper GXII, Perkin Elmer) or on SDS-PAGE. Protein
concentrations were determined by UV-spectrophotometry and HP-SEC
was performed to analyze IgG preparations in native state.
[0231] All Fabs were produced in exploratory-scale in HKB11 cells.
All Fabs showed good expression yields (>5 mg/L) and passed
quality control. Individual antibodies were produced in good
quantities and successfully passed quality control in SEC (>90%
monomer content). SDS-Page analysis under reducing and non-reducing
conditions confirmed disulfide-bridge formation between the heavy
and light chain of the Fab. Produced Fabs were tested for binding
and functionality.
Example 3: Characterization of Purified Receptor-X Specific Fab EQ
Constructs for ELISA Binding
[0232] Target-specific binding of Receptor-X specific Fabs (RefFab
#5 and RefFab #6) as EQ constructs was confirmed by ELISA.
Methods:
[0233] 0.05 .mu.g/ml of recombinant Receptor-X-Fc-fusion protein
was coated on Nunc MaxiSorp.TM. plates. Bound Fabs were detected
using an alkaline phosphatase-conjugated detection antibody
(Jackson Immuno Research) directed against human F(ab').sub.2
fragment.
Results:
[0234] As indicated in FIG. 6A, both Fabs displayed specific
binding to the recombinant Receptor-X protein. EC.sub.50 values
were in the sub-nanomolar range.
[0235] The results confirmed that the modified heavy chain constant
region of the Fab molecules did not affect binding to the target
antigen.
Example 4: Characterization of Purified Receptor-X Specific Fab EQ
Constructs for Cell ELISA Binding
[0236] Binding of Receptor-X specific Fabs (RefFab #5 and RefFab
#6) as EQ constructs to Receptor-X expressed on CHO cells was
analyzed in a cell-ELISA.
Methods:
[0237] CHO cells stably transfected with Receptor-X were seeded at
a density of 5.times.10.sup.3 cells/well in growth medium to a 96
well High Bind Plate (Meso Scale Discovery) and cultivated over
night at 37.degree. C. and 5% CO.sub.2. Cells were blocked with PBS
supplied with 5% BSA and then incubated with varying concentrations
of Fabs diluted in PBS supplied with 0.5% BSA. After washing, bound
Fabs were detected using ECL-conjugated detection antibody directed
against human F(ab').sub.2 fragment (Jackson Immuno Research). MSD
read buffer (Meso Scale Discovery) was added to cells prior to
readout via Sector Imager6000 (Meso Scale Discovery).
Results:
[0238] As depicted in FIG. 6B, the purified Fab_EQ constructs
revealed specific cell binding to Receptor-X expressed on CHO cells
with EC.sub.50 values in the single digit nanomolar range.
[0239] Again, this result confirmed that the modified heavy chain
constant region of the Fab molecules did not affect binding to the
native target antigen.
Example 5: Characterization of Purified Receptor-X Specific Fab EQ
Constructs in a Receptor-Ligand Binding Inhibition Assay
[0240] The antagonistic activity of Receptor-X specific Fabs
(RefFab #5 and RefFab #6) as EQ constructs was analyzed in a
MSD-based receptor-X/ligand binding inhibition assay
Methods:
[0241] 1 .mu.g/ml of recombinant Receptor-X-ligand was coated on a
MSD-plate and blocked with PBS supplied with 0.05% Tween-20 and 5%
skim milk powder. Purified recombinant Fc-conjugated Receptor-X and
varying concentrations of Fab were incubated in a polypropylene
plate for 30 min at RT. Fab/Receptor-X mixture was added to coated
ligand for 1 h at RT. Bound Receptor-X was detected using an
ECL-conjugated detection antibody directed against human Fc
(Jackson Immuno Research). MSD read buffer (Meso Scale Discovery)
was added prior to readout via Sector Imager6000 (Meso Scale
Discovery). Inhibition of the specific Receptor-X/ligand
interaction by the Fab resulted in decreasing signals.
Results:
[0242] As depicted in FIG. 7, both tested Fabs displayed
significant Receptor-X ligand interaction inhibition with IC50
values in the single digit nM range.
[0243] This result confirmed that the modified heavy chain constant
region of the Fab molecules did not affect the antagonistic
activity of the Fab molecules.
Example 6: Characterization of Purified Receptor-X Specific Fab EQ
Constructs for Receptor Activation Through Anti-Fab Antibodies
[0244] The activating potential of the EQ construct, the Construct
#2 with the K214E mutation and the fully human CH1 and hinge region
was tested on 20 different blood samples for three different
Receptor-X specific Fabs (RefFab #5-#7).
Methods:
[0245] Receptor activation and subsequent downstream signaling was
evaluated by assessing the cell surface expression of a
corresponding activation marker protein by fluorocytometry. Cells
of interest were isolated from human blood samples. Cells in
autologous human plasma were incubated with varying concentrations
of Fab and incubated for 30 min at RT. Subsequently,
phycoerythrin-conjugated antibody directed against the surface
activation marker (BD Pharmingen) was added followed by incubation
for 20 min at RT protected from light. Cells were fixated with 1%
formaldehyde solution for 30 min at 4.degree. C. and analyzed using
BD FACSCANTO.TM. II (BD Biosciences). Basal activation marker
expression was determined by incubation with PBS instead of Fab.
Fab-induced Receptor-X activation is represented as level of
activation marker expression in the presence of Fab normalized to
basal expression level in the presence of PBS.
Results:
[0246] As shown in FIG. 4, the fully human Fab induced a
significant increase in the expression of the surface activation
marker on cells expressing Receptor-X in the presence of human
plasma (defined as >5 fold over background in 23 samples
(corresponds to 42%)). In sharp contrast, the two Fabs with the
modified heavy chain constant region were much less active in this
test with Construct #2_EQ showing activity only on 1 serum sample
and Construct #2_K214E being not active at all.
[0247] This differential activation pattern may indicate that the
activating potential of the tested Fab in this assay is not
determined by the variable region of the Fabs but appears to reside
in the C-terminal region of the heavy because the activity is
significantly reduced by the C-terminal rat hinge region. These
results clearly suggest that the fully human Fabs were recognized
by anti-Fab IgG pre-existing in donors' blood, which induced
receptor activation.
Sequence CWU 1
1
104198PRTHomo sapiens 1Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu
Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly
Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp
Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val
Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val
Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile Cys Asn Val
Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Lys
Val298PRTHomo sapiens 2Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu
Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly
Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp
Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val
Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val
Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile Cys Asn Val
Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Arg
Val398PRTHomo sapiens 3Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu
Ala Pro Cys Ser Arg1 5 10 15Ser Thr Ser Glu Ser Thr Ala Ala Leu Gly
Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp
Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val
Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val
Pro Ser Ser Asn Phe Gly Thr Gln Thr65 70 75 80Tyr Thr Cys Asn Val
Asp His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Thr
Val498PRTHomo sapiens 4Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu
Ala Pro Cys Ser Arg1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly
Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp
Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val
Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val
Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Thr Cys Asn Val
Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Arg
Val598PRTHomo sapiens 5Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu
Ala Pro Cys Ser Arg1 5 10 15Ser Thr Ser Glu Ser Thr Ala Ala Leu Gly
Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp
Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val
Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val
Pro Ser Ser Ser Leu Gly Thr Lys Thr65 70 75 80Tyr Thr Cys Asn Val
Asp His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Arg
Val698PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic polypeptide"MOD_RES(95)..(95)Any amino acid
except CysMOD_RES(97)..(98)Any amino acid except Cys 6Ala Ser Thr
Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr
Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe
Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40
45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser
50 55 60Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln
Thr65 70 75 80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys
Val Xaa Lys 85 90 95Xaa Xaa798PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
polypeptide" 7Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro
Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu
Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser
Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln
Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser
Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile Cys Asn Val Asn His
Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Lys Ile898PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
polypeptide" 8Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro
Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu
Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser
Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln
Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser
Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile Cys Asn Val Asn His
Lys Pro Ser Asn Thr Lys Val Glu Lys 85 90 95Lys Val998PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
polypeptide" 9Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro
Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu
Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser
Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln
Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser
Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile Cys Asn Val Asn His
Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Gly
Val1098PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic polypeptide" 10Ala Ser Thr Lys Gly Pro Ser Val
Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala
Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr
Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe
Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val
Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile
Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Glu
Val1115PRTHomo sapiens 11Glu Pro Lys Ser Cys Asp Lys Thr His Thr
Cys Pro Pro Cys Pro1 5 10 151212PRTHomo sapiens 12Glu Arg Lys Cys
Cys Val Glu Cys Pro Pro Cys Pro1 5 101317PRTHomo sapiens 13Glu Leu
Lys Thr Pro Leu Gly Asp Thr Thr His Thr Cys Pro Arg Cys1 5 10
15Pro1415PRTHomo sapiens 14Glu Pro Lys Ser Cys Asp Thr Pro Pro Pro
Cys Pro Arg Cys Pro1 5 10 151512PRTHomo sapiens 15Glu Ser Lys Tyr
Gly Pro Pro Cys Pro Ser Cys Pro1 5 101615PRTRattus sp. 16Val Pro
Arg Asn Cys Gly Gly Asp Cys Lys Pro Cys Ile Cys Thr1 5 10
151715PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide"MOD_RES(5)..(5)Any amino acid except
CysMOD_RES(9)..(9)Any amino acid except CysMOD_RES(12)..(12)Any
amino acid except Cys 17Val Pro Arg Asn Xaa Gly Gly Asp Xaa Lys Pro
Xaa Ile Cys Thr1 5 10 151815PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide"MOD_RES(5)..(5)Any amino acid except CysMOD_RES(9)..(9)Any
amino acid except CysMOD_RES(14)..(14)Any amino acid except Cys
18Val Pro Arg Asn Xaa Gly Gly Asp Xaa Lys Pro Cys Ile Xaa Thr1 5 10
151915PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide"MOD_RES(5)..(5)Any amino acid except
CysMOD_RES(12)..(12)Any amino acid except CysMOD_RES(14)..(14)Any
amino acid except Cys 19Val Pro Arg Asn Xaa Gly Gly Asp Cys Lys Pro
Xaa Ile Xaa Thr1 5 10 152015PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide"MOD_RES(9)..(9)Any amino acid except
CysMOD_RES(12)..(12)Any amino acid except CysMOD_RES(14)..(14)Any
amino acid except Cys 20Val Pro Arg Asn Cys Gly Gly Asp Xaa Lys Pro
Xaa Ile Xaa Thr1 5 10 15215PRTRattus sp. 21Val Pro Arg Asn Cys1
52211PRTRattus sp. 22Val Pro Arg Glu Cys Asn Pro Cys Gly Cys Thr1 5
102311PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide"MOD_RES(8)..(8)Any amino acid except
CysMOD_RES(10)..(10)Any amino acid except Cys 23Val Pro Arg Glu Cys
Asn Pro Xaa Gly Xaa Thr1 5 102411PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide"MOD_RES(5)..(5)Any amino acid except
CysMOD_RES(10)..(10)Any amino acid except Cys 24Val Pro Arg Glu Xaa
Asn Pro Cys Gly Xaa Thr1 5 102511PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide"MOD_RES(5)..(5)Any amino acid except CysMOD_RES(8)..(8)Any
amino acid except Cys 25Val Pro Arg Glu Xaa Asn Pro Xaa Gly Cys
Thr1 5 10265PRTRattus sp. 26Val Pro Arg Glu Cys1 52721PRTRattus sp.
27Glu Arg Arg Asn Gly Gly Ile Gly His Lys Cys Pro Thr Cys Pro Thr1
5 10 15Cys His Lys Cys Pro 202821PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide"MOD_RES(14)..(14)Any amino acid except
CysMOD_RES(17)..(17)Any amino acid except CysMOD_RES(20)..(20)Any
amino acid except Cys 28Glu Arg Arg Asn Gly Gly Ile Gly His Lys Cys
Pro Thr Xaa Pro Thr1 5 10 15Xaa His Lys Xaa Pro 202921PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide"MOD_RES(11)..(11)Any amino acid except
CysMOD_RES(17)..(17)Any amino acid except CysMOD_RES(20)..(20)Any
amino acid except Cys 29Glu Arg Arg Asn Gly Gly Ile Gly His Lys Xaa
Pro Thr Cys Pro Thr1 5 10 15Xaa His Lys Xaa Pro 203021PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide"MOD_RES(11)..(11)Any amino acid except
CysMOD_RES(14)..(14)Any amino acid except CysMOD_RES(20)..(20)Any
amino acid except Cys 30Glu Arg Arg Asn Gly Gly Ile Gly His Lys Xaa
Pro Thr Xaa Pro Thr1 5 10 15Cys His Lys Xaa Pro 203121PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide"MOD_RES(11)..(11)Any amino acid except
CysMOD_RES(14)..(14)Any amino acid except CysMOD_RES(17)..(17)Any
amino acid except Cys 31Glu Arg Arg Asn Gly Gly Ile Gly His Lys Xaa
Pro Thr Xaa Pro Thr1 5 10 15Xaa His Lys Cys Pro 203211PRTRattus sp.
32Glu Arg Arg Asn Gly Gly Ile Gly His Lys Cys1 5
103311PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide"MOD_RES(4)..(5)Any amino acid except
Cyssource/note="See specification as filed for detailed description
of substitutions and preferred embodiments" 33Glu Arg Arg Xaa Xaa
Gly Ile Gly His Lys Cys1 5 103411PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide" 34Glu Arg Arg Gln Gly Gly Ile Gly His Lys Cys1 5
103515PRTRattus sp. 35Glu Pro Arg Arg Pro Lys Pro Arg Pro Pro Thr
Asp Ile Cys Ser1 5 10 153614PRTRattus sp. 36Glu Pro Arg Arg Pro Lys
Pro Arg Pro Pro Thr Asp Ile Cys1 5 103713PRTMus sp. 37Val Pro Arg
Asp Cys Gly Cys Lys Pro Cys Ile Cys Thr1 5 103813PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide"MOD_RES(5)..(5)Any amino acid except CysMOD_RES(7)..(7)Any
amino acid except CysMOD_RES(10)..(10)Any amino acid except Cys
38Val Pro Arg Asp Xaa Gly Xaa Lys Pro Xaa Ile Cys Thr1 5
103913PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide"MOD_RES(7)..(7)Any amino acid except
CysMOD_RES(10)..(10)Any amino acid except CysMOD_RES(12)..(12)Any
amino acid except Cys 39Val Pro Arg Asp Cys Gly Xaa Lys Pro Xaa Ile
Xaa Thr1 5 104013PRTArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic peptide"MOD_RES(5)..(5)Any amino acid
except CysMOD_RES(10)..(10)Any amino acid except
CysMOD_RES(12)..(12)Any amino acid except Cys 40Val Pro Arg Asp Xaa
Gly Cys Lys Pro Xaa Ile Xaa Thr1 5 104113PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide"MOD_RES(5)..(5)Any amino acid except CysMOD_RES(7)..(7)Any
amino acid except CysMOD_RES(12)..(12)Any amino acid except Cys
41Val Pro Arg Asp Xaa Gly Xaa Lys Pro Cys Ile Xaa Thr1 5
10425PRTMus sp. 42Val Pro Arg Asp Cys1 54316PRTMus sp. 43Glu Pro
Arg Gly Pro Thr Ile Lys Pro Cys Pro Pro Cys Lys Cys Pro1 5 10
154416PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide"MOD_RES(13)..(13)Any amino acid except
CysMOD_RES(15)..(15)Any amino acid except Cys 44Glu Pro Arg Gly Pro
Thr Ile Lys Pro Cys Pro Pro Xaa Lys Xaa Pro1 5 10
154516PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide"MOD_RES(10)..(10)Any amino acid except
CysMOD_RES(15)..(15)Any amino acid except Cys 45Glu Pro Arg Gly Pro
Thr Ile Lys Pro Xaa Pro Pro Cys Lys Xaa Pro1 5 10
154616PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide"MOD_RES(10)..(10)Any amino acid except
CysMOD_RES(13)..(13)Any amino acid except Cys 46Glu Pro Arg Gly Pro
Thr Ile Lys Pro Xaa Pro Pro Xaa Lys Cys Pro1 5 10 154710PRTMus sp.
47Glu Pro Arg Gly Pro Thr Ile Lys Pro Cys1 5 104822PRTMus sp. 48Glu
Pro Ser Gly Pro Ile Ser Thr Ile Asn Pro Cys Pro Pro Cys Lys1 5 10
15Glu Cys His Lys Cys Pro 204922PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide"MOD_RES(15)..(15)Any amino acid except
CysMOD_RES(18)..(18)Any amino acid except CysMOD_RES(21)..(21)Any
amino acid except Cys 49Glu Pro Ser Gly Pro Ile Ser Thr Ile Asn Pro
Cys Pro Pro Xaa Lys1 5 10 15Glu Xaa His Lys Xaa Pro
205022PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide"MOD_RES(12)..(12)Any amino acid except
CysMOD_RES(18)..(18)Any amino acid except CysMOD_RES(21)..(21)Any
amino acid except Cys 50Glu Pro Ser Gly Pro Ile Ser Thr Ile Asn Pro
Xaa Pro Pro Cys Lys1 5 10 15Glu Xaa His Lys Xaa Pro
205122PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide"MOD_RES(12)..(12)Any amino acid except
CysMOD_RES(15)..(15)Any amino acid except CysMOD_RES(21)..(21)Any
amino acid except Cys 51Glu Pro Ser Gly Pro Ile Ser Thr Ile Asn Pro
Xaa Pro Pro Xaa Lys1 5 10 15Glu Cys His Lys Xaa Pro
205222PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide"MOD_RES(12)..(12)Any amino acid except
CysMOD_RES(15)..(15)Any amino acid except CysMOD_RES(18)..(18)Any
amino acid except Cys 52Glu Pro Ser Gly Pro Ile Ser Thr Ile Asn Pro
Xaa Pro Pro Xaa Lys1 5 10 15Glu Xaa
His Lys Cys Pro 205312PRTMus sp. 53Glu Pro Ser Gly Pro Ile Ser Thr
Ile Asn Pro Cys1 5 105421PRTMus sp. 54Glu Pro Arg Val Pro Ile Thr
Gln Asn Pro Cys Pro Pro Leu Lys Glu1 5 10 15Cys Pro Pro Cys Ala
205521PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide"MOD_RES(17)..(17)Any amino acid except
CysMOD_RES(20)..(20)Any amino acid except Cys 55Glu Pro Arg Val Pro
Ile Thr Gln Asn Pro Cys Pro Pro Leu Lys Glu1 5 10 15Xaa Pro Pro Xaa
Ala 205621PRTArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic peptide"MOD_RES(11)..(11)Any amino
acid except CysMOD_RES(20)..(20)Any amino acid except Cys 56Glu Pro
Arg Val Pro Ile Thr Gln Asn Pro Xaa Pro Pro Leu Lys Glu1 5 10 15Cys
Pro Pro Xaa Ala 205721PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide"MOD_RES(11)..(11)Any amino acid except
CysMOD_RES(17)..(17)Any amino acid except Cys 57Glu Pro Arg Val Pro
Ile Thr Gln Asn Pro Xaa Pro Pro Leu Lys Glu1 5 10 15Xaa Pro Pro Cys
Ala 205811PRTMus sp. 58Glu Pro Arg Val Pro Ile Thr Gln Asn Pro Cys1
5 105916PRTMus sp. 59Glu Pro Arg Ile Pro Lys Pro Ser Thr Pro Pro
Gly Ser Ser Cys Pro1 5 10 156015PRTMus sp. 60Glu Pro Arg Ile Pro
Lys Pro Ser Thr Pro Pro Gly Ser Ser Cys1 5 10 15615PRTHomo sapiens
61Pro Lys Ser Cys Asp1 5625PRTHomo sapiens 62Lys Ser Cys Asp Lys1
5635PRTHomo sapiens 63Ser Cys Asp Lys Thr1 5645PRTHomo sapiens
64Asp Lys Thr His Thr1 5655PRTHomo sapiens 65Lys Thr His Thr Cys1
5665PRTHomo sapiens 66Thr His Thr Cys Pro1 5675PRTHomo sapiens
67His Thr Cys Pro Pro1 5685PRTHomo sapiens 68Thr Cys Pro Pro Cys1
5695PRTHomo sapiens 69Cys Pro Pro Cys Pro1 570103PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
polypeptide" 70Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro
Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu
Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser
Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln
Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val Val Thr Val Pro Ser
Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile Cys Asn Val Asn His
Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Lys Ile Val Pro Arg Glu
Cys 10071109PRTArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic polypeptide" 71Ala Ser Thr Lys Gly
Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly
Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu
Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val
His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu
Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75
80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys
85 90 95Lys Val Glu Arg Arg Asn Gly Gly Ile Gly His Lys Cys 100
10572109PRTArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic polypeptide" 72Ala Ser Thr Lys Gly
Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly
Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu
Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val
His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu
Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75
80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Glu Lys
85 90 95Lys Val Glu Arg Arg Asn Gly Gly Ile Gly His Lys Cys 100
10573109PRTArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic polypeptide" 73Ala Ser Thr Lys Gly
Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly
Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu
Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val
His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu
Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75
80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys
85 90 95Gly Val Glu Arg Arg Asn Gly Gly Ile Gly His Lys Cys 100
10574109PRTArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic polypeptide" 74Ala Ser Thr Lys Gly
Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly
Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu
Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val
His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu
Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75
80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys
85 90 95Glu Val Glu Arg Arg Asn Gly Gly Ile Gly His Lys Cys 100
10575109PRTArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic polypeptide" 75Ala Ser Thr Lys Gly
Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly
Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu
Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val
His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu
Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75
80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys
85 90 95Lys Val Glu Glu Arg Asn Gly Gly Ile Gly His Lys Cys 100
10576109PRTArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic polypeptide" 76Ala Ser Thr Lys Gly
Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly
Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu
Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val
His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu
Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75
80Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys
85 90 95Glu Val Glu Arg Arg Gln Gly Gly Ile Gly His Lys Cys 100
105775PRTHomo sapiens 77Cys Asp Lys Thr His1
5788PRTUnknownsource/note="Description of Unknown non-rodent hinge
region peptide" 78Glu Pro Lys Ser Cys Asp Lys Thr1
57910PRTUnknownsource/note="Description of Unknown non-rodent hinge
region peptide" 79Glu Pro Lys Ser Cys Asp Lys Thr His Thr1 5
10809PRTUnknownsource/note="Description of Unknown non-rodent hinge
region peptide" 80Glu Pro Lys Ser Cys Asp Lys Thr His1
5817PRTUnknownsource/note="Description of Unknown non-rodent hinge
region peptide" 81Glu Pro Lys Ser Cys Asp Lys1
5826PRTUnknownsource/note="Description of Unknown non-rodent hinge
region peptide" 82Glu Pro Lys Ser Cys Asp1
5834PRTUnknownsource/note="Description of Unknown non-rodent hinge
region peptide" 83Glu Pro Lys
Ser1843PRTUnknownsource/note="Description of Unknown non-rodent
hinge region peptide" 84Glu Pro
Lys1852PRTUnknownsource/note="Description of Unknown non-rodent
hinge region peptide" 85Glu Pro1864PRTHomo sapiens 86Asp Lys Lys
Val1874PRTHomo sapiens 87Asp Lys Arg Val1884PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide" 88Glu Lys Lys Val1894PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide" 89Asp Lys Lys Ile1904PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide" 90Asp Lys Gly Val1914PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide" 91Asp Lys Glu Val1924PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide"MOD_RES(1)..(1)Any amino acid except CysMOD_RES(3)..(4)Any
amino acid except Cys 92Xaa Lys Xaa Xaa19311PRTArtificial
Sequencesource/note="Description of Artificial Sequence Synthetic
peptide" 93Glu Glu Arg Asn Gly Gly Ile Gly His Lys Cys1 5
10945PRTHomo sapiens 94Glu Pro Lys Ser Cys1 59511PRTHomo sapiens
95Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys1 5 109611PRTHomo
sapiens 96Lys Val Asp Lys Arg Val Glu Pro Lys Ser Cys1 5
109711PRTArtificial Sequencesource/note="Description of Artificial
Sequence Synthetic peptide" 97Lys Val Asp Lys Lys Ile Val Pro Arg
Glu Cys1 5 109817PRTArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic peptide" 98Lys Val Asp Lys Lys Val
Glu Arg Arg Asn Gly Gly Ile Gly His Lys1 5 10
15Cys9917PRTArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic peptide" 99Lys Val Glu Lys Lys Val
Glu Arg Arg Asn Gly Gly Ile Gly His Lys1 5 10
15Cys10017PRTArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic peptide" 100Lys Val Asp Lys Gly Val
Glu Arg Arg Asn Gly Gly Ile Gly His Lys1 5 10
15Cys10117PRTArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic peptide" 101Lys Val Asp Lys Glu Val
Glu Arg Arg Asn Gly Gly Ile Gly His Lys1 5 10
15Cys10217PRTArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic peptide" 102Lys Val Asp Lys Lys Val
Glu Glu Arg Asn Gly Gly Ile Gly His Lys1 5 10
15Cys10317PRTArtificial Sequencesource/note="Description of
Artificial Sequence Synthetic peptide" 103Lys Val Asp Lys Glu Val
Glu Arg Arg Gln Gly Gly Ile Gly His Lys1 5 10 15Cys10461PRTHomo
sapiens 104Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser
Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val
Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly
Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe Pro Ala Val Leu Gln Ser
Ser Gly 50 55 60
* * * * *
References