U.S. patent application number 17/489391 was filed with the patent office on 2022-04-21 for fibronectin based scaffold proteins having improved stability.
The applicant listed for this patent is BRISTOL-MYERS SQUIBB COMPANY. Invention is credited to Ray CAMPHAUSEN, John O'LOUGHLIN, Bernice YEUNG, Yihong ZHANG.
Application Number | 20220119495 17/489391 |
Document ID | / |
Family ID | |
Filed Date | 2022-04-21 |
![](/patent/app/20220119495/US20220119495A1-20220421-D00001.png)
![](/patent/app/20220119495/US20220119495A1-20220421-D00002.png)
![](/patent/app/20220119495/US20220119495A1-20220421-D00003.png)
![](/patent/app/20220119495/US20220119495A1-20220421-D00004.png)
![](/patent/app/20220119495/US20220119495A1-20220421-D00005.png)
![](/patent/app/20220119495/US20220119495A1-20220421-D00006.png)
![](/patent/app/20220119495/US20220119495A1-20220421-D00007.png)
![](/patent/app/20220119495/US20220119495A1-20220421-D00008.png)
![](/patent/app/20220119495/US20220119495A1-20220421-D00009.png)
![](/patent/app/20220119495/US20220119495A1-20220421-D00010.png)
![](/patent/app/20220119495/US20220119495A1-20220421-D00011.png)
View All Diagrams
United States Patent
Application |
20220119495 |
Kind Code |
A1 |
CAMPHAUSEN; Ray ; et
al. |
April 21, 2022 |
FIBRONECTIN BASED SCAFFOLD PROTEINS HAVING IMPROVED STABILITY
Abstract
The present application provides fibronectin based scaffold
proteins associated with improved stability. The application also
relates to stable formulations of fibronectin based scaffold
proteins and the use thereof in diagnostic, research and
therapeutic applications. The application further relates to cells
comprising such proteins, polynucleotides encoding such proteins or
fragments thereof, and to vectors comprising such
polynucleotides.
Inventors: |
CAMPHAUSEN; Ray; (Wayland,
MA) ; O'LOUGHLIN; John; (Stow, MA) ; YEUNG;
Bernice; (Lexington, MA) ; ZHANG; Yihong;
(Acton, MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
BRISTOL-MYERS SQUIBB COMPANY |
Princeton |
NJ |
US |
|
|
Appl. No.: |
17/489391 |
Filed: |
September 29, 2021 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16298493 |
Mar 11, 2019 |
11161893 |
|
|
17489391 |
|
|
|
|
15385222 |
Dec 20, 2016 |
10273286 |
|
|
16298493 |
|
|
|
|
13699458 |
Mar 28, 2013 |
9562089 |
|
|
PCT/US2011/038013 |
May 26, 2011 |
|
|
|
15385222 |
|
|
|
|
61348663 |
May 26, 2010 |
|
|
|
61348647 |
May 26, 2010 |
|
|
|
International
Class: |
C07K 14/78 20060101
C07K014/78; C07K 16/18 20060101 C07K016/18; C12N 15/63 20060101
C12N015/63 |
Claims
1-46. (canceled)
47. A method of treating a hyperproliferative disease comprising
administering to a subject in need thereof a therapeutically
effective amount of a fibronectin-based protein dimer comprising a
first fibronectin type III tenth (.sup.10Fn3) domain and a second
.sup.10Fn3 domain, wherein each of the first .sup.10Fn3 domain and
the second .sup.10Fn3 domain: (i) comprises an AB loop, a BC loop,
a CD loop, a DE loop, an EF loop, and a FG loop, wherein the first
and second .sup.10Fn3 domains have at least one loop selected from
the BC, DE, and FG loops with an altered amino acid sequence
relative to the sequence of the corresponding loop of the human
.sup.10Fn3 domain having the amino acid sequence of SEQ ID NO: 1;
(ii) comprises an amino acid sequence having at least 60% identity
to SEQ ID NO: 1 and binds to insulin-like growth factor 1 receptor
(IGF-IR), vascular endothelial growth factor receptor 2 (VEGFR2),
or epidermal growth factor receptor (EGFR); and (iii) comprises a
C-terminal tail consisting of an amino acid sequence selected from
the group consisting of SEQ ID NO: 33, SEQ ID NO: 34, and SEQ ID
NO: 35.
48. The method of claim 47, wherein one or both of the first
.sup.10Fn3 domain and the second .sup.10Fn3 domain further
comprised) an N-terminal extension comprising a sequence selected
from the group consisting of: M, MG, G, and any of SEQ ID NOs:
19-21 and 26-31.
49. The method of claim 47, wherein the first .sup.10Fn3 domain and
the second .sup.10Fn3 domain bind to different targets.
50. The method of claim 47, wherein the first .sup.10Fn3 domain and
the second .sup.10Fn3 domain are connected by a polypeptide linker
comprising 1-30 amino acids.
51. The method of claim 50, wherein the linker is selected from the
group consisting of: a glycine-serine based linker, a
glycine-proline based linker, a proline-alanine linker, and an
Fn-based linker.
52. The method of claim 47, wherein the protein dimer has less than
4% fragmentation during storage in solution at pH 4.0 for at least
4 weeks.
53. The method of claim 47, further comprising one or more
pharmacokinetic (PK) moieties selected from: a polyoxyalkylene
moiety, a human serum albumin binding protein, sialic acid, human
serum albumin, transferrin, and an Fc fragment.
54. The method of claim 47, wherein the protein dimer is
administered by an intravenous, intramuscular, subcutaneous, or
oral route.
55. The method of claim 47, further comprising administering one or
more additional therapeutic agents.
56. The method of claim 47, wherein the hyperproliferative disorder
is a cancer selected from the group consisting of: squamous cell
carcinoma, bladder cancer, stomach cancer, liver cancer, kidney
cancer, colorectal cancer, breast cancer, head cancer, neck cancer,
esophageal cancer, gynecological cancer, thyroid cancer, lymphoma,
chronic leukemia, and acute leukemia.
57. A method of inhibiting tumor cell growth in a subject
comprising administering to the subject a therapeutically effective
amount of a fibronectin-based protein dimer comprising a first
fibronectin type III tenth (.sup.10Fn3) domain and a second
.sup.10Fn3 domain, wherein each of the first .sup.10Fn3 domain and
the second .sup.10Fn3 domain: (i) comprises an AB loop, a BC loop,
a CD loop, a DE loop, an EF loop, and a FG loop, wherein the first
and second .sup.10Fn3 domains have at least one loop selected from
the BC, DE, and FG loops with an altered amino acid sequence
relative to the sequence of the corresponding loop of the human
.sup.10Fn3 domain having the amino acid sequence of SEQ ID NO: 1;
(ii) comprises an amino acid sequence having at least 60% identity
to SEQ ID NO: 1 and binds to insulin-like growth factor 1 receptor
(IGF-1R), vascular endothelial growth factor receptor 2 (VEGFR2),
or epidermal growth factor receptor (EGFR); and (iii) comprises a
C-terminal tail consisting of an amino acid sequence selected from
the group consisting of SEQ ID NO: 33, SEQ ID NO: 34, and SEQ ID
NO: 35.
58. The method of claim 57, wherein one or both of the first
.sup.10Fn3 domain and the second .sup.10Fn3 domain further
comprised) an N-terminal extension comprising a sequence selected
from the group consisting of: M, MG, G, and any of SEQ ID NOs:
19-21 and 26-31.
59. The method of claim 57, wherein the first .sup.10Fn3 domain and
the second .sup.10Fn3 domain bind to different targets.
60. The method of claim 57, wherein the first .sup.10Fn3 domain and
the second .sup.10Fn3 domain are connected by a polypeptide linker
comprising 1-30 amino acids.
61. The method of claim 60, wherein the linker is selected from the
group consisting of: a glycine-serine based linker, a
glycine-proline based linker, a proline-alanine linker, and an
Fn-based linker.
62. The method of claim 57, wherein the protein dimer has less than
4% fragmentation during storage in solution at pH 4.0 for at least
4 weeks.
63. The method of claim 57, further comprising one or more
pharmacokinetic (PK) moieties selected from: a polyoxyalkylene
moiety, a human serum albumin binding protein, sialic acid, human
serum albumin, transferrin, and an Fc fragment.
64. The method of claim 57, further comprising administering one or
more additional therapeutic agents.
65. The method of claim 57, wherein the tumor is selected from the
group consisting of: brain tumor, tumor of the urogenital tract,
tumor of the lymphatic system, stomach tumor, laryngeal tumor,
monocytic leukemia, lung tumor, small-cell lung carcinoma,
pancreatic tumor, glioblastoma, and breast tumor.
66. A method of detection comprising (i) contacting a sample with a
fibronectin-based protein dimer under conditions that allow the
fibronectin-based protein dimer to form a complex with a target,
and (ii) detecting the complex, wherein the fibronectin-based
protein dimer comprises a first fibronectin type III tenth
(.sup.10Fn3) domain and a second .sup.10Fn3 domain, wherein each of
the first .sup.10Fn3 domain and the second .sup.10Fn3 domain: (i)
comprises an AB loop, a BC loop, a CD loop, a DE loop, an EF loop,
and a FG loop, wherein the first and second .sup.10Fn3 domains have
at least one loop selected from the BC, DE, and FG loops with an
altered amino acid sequence relative to the sequence of the
corresponding loop of the human .sup.10Fn3 domain having the amino
acid sequence of SEQ ID NO: 1; (ii) comprises an amino acid
sequence having at least 60% identity to SEQ ID NO: 1 and binds to
a target molecule; (iii) comprises a C-terminal tail consisting of
an amino acid sequence selected from the group consisting of SEQ ID
NO: 33, SEQ ID NO: 34, and SEQ ID NO: 35.
Description
RELATED APPLICATIONS
[0001] This application claims the benefit of U.S. Provisional
Application Nos. 61/348,647, filed May 26, 2010, and 61/348,663,
filed May 26, 2010, which applications are hereby incorporated by
reference in their entireties.
INTRODUCTION
[0002] Fibronectin based scaffolds are a family of proteins capable
of evolving to bind any compound of interest. These proteins, which
generally make use of a scaffold derived from a fibronectin type
III (Fn3) or Fn3-like domain, function in a manner characteristic
of natural or engineered antibodies (that is, polyclonal,
monoclonal, or single-chain antibodies) and, in addition, possess
structural advantages. Specifically, the structure of these
antibody mimics has been designed for optimal folding, stability,
and solubility, even under conditions that normally lead to the
loss of structure and function in antibodies. An example of
fibronectin-based scaffold proteins are Adnectins.TM. (Adnexus, a
wholly owned subsidiary of Bristol-Myers Squibb).
[0003] Fibronectin is a large protein which plays essential roles
in the formation of extracellular matrix and cell-cell
interactions; it consists of many repeats of three types (types I,
II, and III) of small domains (Baron et al., 1991). Fn3 itself is
the paradigm of a large subfamily which includes portions of cell
adhesion molecules, cell surface hormone and cytokine receptors,
chaperones, and carbohydrate-binding domains. For reviews see Bork
& Doolittle, Proc Natl Acad Sci USA. 1992 Oct. 1;
89(19):8990-4; Bork et al., J Mol Biol. 1994 Sep. 30;
242(4):309-20; Campbell & Spitzfaden, Structure. 1994 May 15;
2(5):333-7; Harpez & Chothia, J Mol Biol. 1994 May 13;
238(4):528-39).
[0004] Fibronectin type III (Fn3) domains comprise, in order from
N-terminus to C-terminus, a beta or beta-like strand. A; a loop,
AB; a beta or beta-like strand, B; a loop, BC; a beta or beta-like
strand, C; a loop, CD; a beta or beta-like strand, D; a loop, DE; a
beta or beta-like strand, E; a loop, EF; a beta or beta-like
strand, F; a loop, FG; and a beta or beta-like strand, G. Any or
all of loops AB, BC, CD, DE, EF and FG may participate in target
binding. The BC, DE, and FG loops are both structurally and
functionally analogous to the complementarity determining regions
(CDRs) from immunoglobulins. U.S. Pat. No. 7,115,396 describes Fn3
domain proteins wherein alterations to the BC, DE, and FG loops
result in high affinity TNF.alpha. binders. U.S. Publication No.
2007/0148126 describes Fn3 domain proteins wherein alterations to
the BC, DE, and FG loops result in high affinity VEGFR2
binders.
[0005] Protein pharmaceuticals may be associated with physical and
chemical instability during their production, purification, storage
and delivery. These instability issues can adversely impact the
biological properties associated with the protein therapeutic,
thereby reducing the efficacy of that protein therapeutic. Sola,
2009, J. Pharm Sci, 98(4): 1223-1245. Accordingly, it would be
advantageous to obtain improved fibronectin domain scaffold
proteins that are associated with improved stability, e.g. reduced
fragmentation and/or aggregation, that can be used for both
therapeutic and diagnostic purposes.
SUMMARY
[0006] One aspect of the application provides for novel fibronectin
based scaffold proteins that are associated with increased
stability, including reduced fragmentation and/or reduced
aggregation.
[0007] In some embodiments, the fibronectin based scaffold proteins
provided herein comprise a fibronectin type III tenth (.sup.10Fn3)
domain, wherein the .sup.10Fn3 domain comprises an amino acid
sequence having at least 60% identity to SEQ ID NO: 1 and binds to
a target molecule with a K.sub.D of less than 100 nM, and wherein
the .sup.10Fn3 domain further comprises a C-terminal tail that does
not contain a DK sequence. In exemplary embodiments, the C-terminal
tail comprises the amino acid sequence of SEQ ID NO: 4. In some
embodiments, the C-terminal tail further comprises a cysteine
residue. In other embodiments, the C-terminal tail comprises the
sequence of SEQ ID NO: 5.
[0008] In certain embodiments, the fibronectin based scaffold
proteins bind to a target that is not bound by a wild-type
.sup.10Fn3 domain. In certain embodiments, fibronectin based
scaffold proteins do not bind one or more of EGFR, human serum
albumin or PCSK9. In certain embodiments, fibronectin based
scaffold proteins that comprise a single .sup.10Fn3 domain do not
bind one or more of EGFR, human serum albumin or PCSK9. In certain
embodiments, multivalent fibronectin based scaffold proteins do not
bind to one or more of the following combinations of target
molecules: i) EGFR and IGF-IR; ii) EGFR and any other target
protein; or iii) human serum albumin and any other target
protein.
[0009] In some embodiments, the .sup.10Fn3 domains of the
fibronectin based scaffold protein further comprises an N-terminal
extension comprising from 1-10 amino acids. In other embodiments,
the .sup.10Fn3 domain of the fibronectin based scaffold protein
comprises a sequence selected from the group consisting of: M, MG,
G, and any of SEQ ID NOs: 19-21 and 26-31.
[0010] In some embodiments, the fibronectin based scaffold proteins
further comprise a second .sup.10Fn3 domain, wherein the second
.sup.10Fn3 domain comprises an amino acid sequence having at least
60% identity to SEQ ID NO: 1 and binds to a target molecule with a
K.sub.D of less than 100 nM, and wherein the second .sup.10Fn3
domain further comprises a C-terminal tail that does not contain a
DK sequence. In exemplary embodiments, the second .sup.10Fn3 domain
comprises a C-terminal tail comprising the amino acid sequence of
SEQ ID NO: 4. In some embodiments, the first and second .sup.10Fn3
domains bind to different targets. In some embodiments, the second
.sup.10Fn3 domain further comprises an N-terminal extension
comprising from 1-10 amino acids. In some embodiments, the
N-terminal extension comprises a sequence selected from the group
consisting of: M, MG, G, and any of SEQ ID NOs: 19-21 and 25-31. In
some embodiments, the first and second .sup.10Fn3 domains are
connected by a polypeptide linker comprising from 1-30 amino acids.
In some embodiments, the polypeptide linker is selected from the
group consisting of: a glycine-serine based linker, a
glycine-proline based linker, a proline-alanine linker and a
Fn-based linker.
[0011] In certain embodiments, the fibronectin based scaffold
protein comprises one or more .sup.10Fn3 domains comprising a loop,
AB; a loop, BC; a loop, CD; a loop, DE; a loop, EF; and a loop, FG
and each, independently, have at least one loop selected from loop
BC, DE, and FG with an altered amino acid sequence relative to the
sequence of the corresponding loop of the human .sup.10Fn3 domain.
In certain embodiments, the .sup.10Fn3 domains comprise an amino
acid sequence that is at least 50, 60, 70, or 80% identical to the
naturally occurring human .sup.10Fn3 domain represented by SEQ ID
NO: 1. In an exemplary embodiment, the fibronectin based scaffold
protein is a dimer comprising two .sup.10Fn3 domains.
[0012] In another aspect, the application provides for novel
fibronectin based scaffold protein dimers that are associated with
reduced protein fragmentation as compared to the fibronectin based
scaffold protein dimers described in PCT application WO
2009/142773. In some embodiments, the fibronectin based scaffold
protein dimer comprises the amino acid sequence of SEQ ID NO:
48.
[0013] In another aspect, the application provides fibronectin
based scaffold protein dimers having the structure
N1-D1-C1-L-N2-D2-C2. In certain embodiment, N1 and N2 are optional
N-terminal extensions independently comprising from 0-10 amino
acids; D1 and D2 are independently selected from the group
consisting of: (I) a tenth fibronectin type 111 domain (.sup.10Fn3)
domain having at least 95% identity with the amino acid sequence
set forth in SEQ ID NO: 2, wherein said .sup.10Fn3 domain binds to
IGF-IR with a K.sub.D of less than 500 nM, and (ii) a .sup.10Fn3
domain having at least 95% identity with the amino acid sequence
set forth in SEQ ID NO: 3, wherein said .sup.10Fn3 domain binds to
VEGFR2 with a K.sub.D of less than 500 nM; L is a polypeptide
linker comprising from 0-30 amino acid residues; C1 comprises the
amino acid sequence set forth in SEQ ID NO: 4; and C2 comprises the
amino acid sequence set forth in SEQ ID NO: 4, 5 or 6.
[0014] In some embodiments the fibronectin based scaffold protein
dimers have the structure N1-D1-C1-L-N2-D2-C2, wherein D1 comprises
a .sup.10Fn3 domain having at least 95% identity with the amino
acid sequence set forth in SEQ ID NO: 2, and D2 comprises a
.sup.10Fn3 domain having at least 95% identity with the amino acid
sequence set forth in SEQ ID NO: 3. In other embodiments the
fibronectin based scaffold protein dimers have the structure
N1-D1-C1-L-N2-D2-C2, wherein D1 comprises a .sup.10Fn3 domain
having at least 95% identity with the amino acid sequence set forth
in SEQ ID NO: 3, and D2 comprises a .sup.10Fn3 domain having at
least 95% identity with the amino acid sequence set forth in SEQ ID
NO: 2.
[0015] In some embodiments, the fibronectin based scaffold protein
dimers have the structure N1-D1-C1-L-N2-D2-C2, wherein C2 comprises
the amino acid sequence of SEQ ID NO: 6.
[0016] In some embodiments, the fibronectin based scaffold protein
dimers have the structure N1-D1-C1-L-N2-D2-C2, wherein N1 comprises
an amino acid sequence selected from the group consisting of: M,
MG, G, and any one of SEQ ID NOs: 19-21 and 26-31. In exemplary
embodiments, N1 comprises the amino acid sequence of SEQ ID NO: 19.
In some embodiments, the fibronectin based scaffold protein dimers
have the structure N1-D1-CT-L-N2-D2-C2, wherein N2 comprises an
amino acid sequence selected from the group consisting of: M, MG,
G, and any one of SEQ ID NOs: 19-21 and 26-31. In exemplary
embodiments, N2 comprises the amino acid sequence of SEQ ID NO:
20.
[0017] In some embodiments, the fibronectin based scaffold protein
dimers have the structure N1-D1-C1-L-N2-D2-C2, wherein L is a
polypeptide linker selected from the group consisting of: a
glycine-serine based linker, a glycine-proline based linker, a
proline-alanine linker and a Fn-based linker. In other embodiments,
L comprises the amino acid sequence of SEQ ID NO: 7.
[0018] In some embodiments, the fibronectin based scaffold proteins
further comprise one or more pharmacokinetic (PK) moieties selected
from: a polyoxyalkylene moiety, a human serum albumin binding
protein, sialic acid, human serum albumin, transferrin, IgG, an IgG
binding protein, and an Fc fragment. In some embodiments, the PK
moiety is a polyoxyalkylene moiety and said polyoxyalkylene moiety
is polyethylene glycol (PEG). In some embodiments, the PEG moiety
is covalently linked to the fibronectin based scaffold protein via
a Cys or Lys amino acid. In some embodiments, the PEG is between
about 0.5 kDa and about 100 kDa.
[0019] In one aspect, the application provides pharmaceutically
acceptable compositions comprising a fibronectin based scaffold
protein. In some embodiments, the composition is essentially
pyrogen free. In some embodiments, the composition is substantially
free of microbial contamination making it suitable for in vivo
administration. The composition may be formulated, for example, for
IV, IP or subcutaneous administration. In some embodiments, the
composition comprises a physiologically acceptable carrier. In some
embodiments, the pH of the composition is between 4.0-6.5. In some
embodiments, the pH of the composition is between 4.0-5.5. In other
embodiments, the pH of the composition is 5.5. In other
embodiments, the pH of the composition is 4.0. In some embodiments,
the concentration of the fibronectin based scaffold protein is 5
mg/ml in the composition.
[0020] In another aspect, the application provides a pharmaceutical
formulation comprising a fibronectin based scaffold protein,
wherein the formulation comprises at least 5 mg/ml of the
fibronectin based scaffold protein, has a pH of 4.0, and is
suitable for intravenous administration. In some embodiments, the
pharmaceutical formulation is stable for at least 4 weeks at
25.degree. C. In some embodiments, the pharmaceutical formulation
has less than 4% fragmentation. In some embodiments, the
formulation has less than 4% aggregates.
[0021] In another aspect, the application provides a method for
treating a hyperproliferative disorder in a subject comprising
administering to a subject in need thereof a therapeutically
effective amount of any of the compositions as described
herein.
[0022] In another aspect, the application provides a nucleic acid
encoding a fibronectin based scaffold protein as described herein.
Vectors containing polynucleotides for such proteins are included
as well. Suitable vectors include, for example, expression vectors.
A further aspect of the application provides for a cell, comprising
a polynucleotide, vector, or expression vector, encoding a
fibronectin based scaffold protein. Sequences are preferably
optimized to maximize expression in the cell type used. In some
embodiments, expression is in a bacterial cell. In other
embodiments, expression is in a mammalian cell. Preferably,
expression is in E. coli. In one aspect, the cell expresses a
fibronectin based scaffold protein. In one aspect, the
polynucleotides encoding fibronectin based scaffold proteins are
codon optimized for expression in the selected cell type. Also
provided are methods for producing a fibronectin based scaffold
protein as described herein, comprising culturing a host cell
comprising a nucleic, vector, or expression vector, comprising a
nucleic acid encoding the fibronectin based scaffold protein and
recovering the expressed fibronectin based scaffold protein from
the culture.
BRIEF DESCRIPTION OF THE FIGURES
[0023] FIG. 1. Size exclusion-high pressure liquid chromatography
(SE-HPLC) data showing the amount of protein aggregation over time
for two concentrations of pegylated V/I(DK+) (SEQ ID NO: 22). The
pegylated protein was stored at 4.degree. C. for 12 months in 10 mM
succinic acid, 5% sorbitol, pH 5.5 at 3 mg/mL protein
concentration.
[0024] FIG. 2. SE-HPLC data showing the amount of protein
fragmentation over time for two concentrations of pegylated
V/I(DK+) (SEQ ID NO: 22). The pegylated protein was stored at
4.degree. C. for 12 months in 10 mM succinic acid, 5% sorbitol, pH
5.5 at 3 mg/mL protein concentration.
[0025] FIG. 3. SE-HPLC data showing the effect of pH on protein
aggregation over time for pegylated V/I(DK+) (SEQ ID NO: 22). The
pegylated protein was stored at 25.degree. C. for 3 weeks in a
formulation containing 50 mM NaCl, with 20 mM sodium acetate (for
pH 4 and 5) or 20 mM sodium phosphate (for pH 6 and 7).
[0026] FIG. 4. SE-HPLC data showing the effect of pH on protein
fragmentation over time for pegylated V/I(DK+) (SEQ ID NO: 22). The
pegylated protein was stored at 25.degree. C. for 3 weeks in a
formulation containing 50 mM NaCl, with 20 mM sodium acetate (for
pH 4 and 5) or 20 mM sodium phosphate (for pH 6 and 7).
[0027] FIG. 5. Reverse phase-high pressure liquid chromatography
(RP-HPLC) profile showing the sites of cleavage of pegylated
V/I(DK+) molecule (SEQ ID NO: 22) after storage at 25.degree. C.
for 4 weeks in 10 mM acetate, 150 mM NaCl at pH 5.5. As indicated
in the figure, protein cleavage occurs directly following positions
D95, D106, D180 and D200, with cleavage predominantly occurring
directly following sites D95 and D200. The pegylated protein was
stored for 4 week at 25.degree. C. in 10 mM sodium acetate, 150 mM
sodium chloride, pH 5.5 at 5 mg/mL protein concentration.
[0028] FIG. 6. SE-HPLC data showing the effect of pH on protein
aggregation over time for the pegylated E/I(DK+) (SEQ ID NO: 23).
The pegylated protein was stored for 4 week at 25.degree. C. in 10
mM succinic acid, 5% sorbitol, pH 4.0, 4.5 and 5.5.
[0029] FIG. 7. SE-HPLC data showing the effect of pH on the amount
of protein fragmentation over time for the pegylated E/I(DK t) (SEQ
ID NO: 23). The pegylated protein was stored for 4 week at
25.degree. C. in 10 mM succinic acid, 5% sorbitol, pH 4.0, 4.5 and
5.5.
[0030] FIG. 8. RP-HPLC profile showing the sites of cleavage of the
pegylated E/I(DK+) (SEQ ID NO: 23) after storage at 25.degree. C.
for 4 weeks in 10 mM succinic acid, 5% sorbitol, pH 4.0, 5 mg/mL
protein concentration. As indicated in the figure, protein cleavage
occurs directly following positions D95, D199 and D218.
[0031] FIG. 9. SE-HPLC data demonstrating showing the effect of pH
on protein aggregation over time for various fibronectin based
scaffold protein constructs. The level of aggregation for various
fibronectin based scaffold proteins was tested at either pH 5.5 or
pH 4.0 during storage for 4 weeks at 25.degree. C. E/I(DK+) is SEQ
ID NO: 23; E/I(DK-, no C-term) is SEQ ID NO: 24; E/I(2DK-) is SEQ
ID NO: 25; and V/I(DK+) is SEQ ID NO: 22.
[0032] FIG. 10. RP-HPLC data showing the amount of fragmentation of
various fibronectin based scaffold proteins at different pHs during
storage for 4 weeks at 25.degree. C. Fibronectin based scaffold
proteins that contain DK sequences are more susceptible to
fragmentation at pH 4.0 as compared to pH 5.5. Fibronectin based
scaffold proteins that do not contain DK sequences are more
resistant to fragmentation at pH 4.0 as compared to fibronectin
based scaffold proteins that contain DK sequences. E/I(DK+) is SEQ
ID NO: 23; E/I(DK-, no C-term) is SEQ ID NO: 24; E/I(2DK-) is SEQ
ID NO: 25; and V/I(DK+) is SEQ ID NO: 22.
[0033] FIG. 11. LC-MS data demonstrating that the major cleavage
site in the E/I(DK-, no C-term) molecule (SEQ ID NO: 24) is D199,
while the major cleavage site in the E/I(DK+) molecule (SEQ ID NO:
23) is D218.
[0034] FIG. 12. LC-MS data demonstrating that the major cleavage
site in the E/I(2DK-) molecule (SEQ ID NO: 25) is D199.
[0035] FIG. 13. The rates of aggregation observed in VI(DK+) (SEQ
ID NO: 56) and VI(DK-) (SEQ ID NO: 57), under 25.degree. C. storage
for up to two months, as assessed by SE-HPLC analysis.
[0036] FIG. 14. Clip rates observed in VI(DK+) (SEQ ID NO: 56) and
VI(DK-) (SEQ ID NO: 57), under 25.degree. C. storage for up to two
months, as assessed by RP-HPLC analysis.
[0037] FIG. 15. Clip region of a RP-HPLC overlaid chromatogram of
VI(DK+) (SEQ ID NO: 56) and VI(DK-) (SEQ ID NO: 57), after
incubation for 2 months at 25.degree. C. The total % clips for
VI(DK+) is 16%, whereas for VI(DK-) it is 6.9%.
DETAILED DESCRIPTION
Definitions
[0038] By a "polypeptide" is meant any sequence of two or more
amino acids, regardless of length, post-translation modification,
or function. "Polypeptide," "peptide," and "protein" are used
interchangeably herein. Polypeptides can include natural amino
acids and non-natural amino acids such as those described in U.S.
Pat. No. 6,559,126, incorporated herein by reference. Polypeptides
can also be modified in any of a variety of standard chemical ways
(e.g., an amino acid can be modified with a protecting group; the
carboxy-terminal amino acid can be made into a terminal amide
group; the amino-terminal residue can be modified with groups to,
e.g., enhance lipophilicity; or the polypeptide can be chemically
glycosylated or otherwise modified to increase stability or in vivo
half-life). Polypeptide modifications can include the attachment of
another structure such as a cyclic compound or other molecule to
the polypeptide and can also include polypeptides that contain one
or more amino acids in an altered configuration (i.e., R or S; or,
L or D).
[0039] "Percent (%) amino acid sequence identity" herein is defined
as the percentage of amino acid residues in a candidate sequence
that are identical with the amino acid residues in a selected
sequence, after aligning the sequences and introducing gaps, if
necessary, to achieve the maximum percent sequence identity, and
not considering any conservative substitutions as part of the
sequence identity. Alignment for purposes of determining percent
amino acid sequence identity can be achieved in various ways that
are within the skill in the art, for instance, using publicly
available computer software such as BLAST, BLAST-2, ALIGN, ALIGN-2
or Megalign (DNASTAR) software. Those skilled in the art can
determine appropriate parameters for measuring alignment, including
any algorithms needed to achieve maximal alignment over the
full-length of the sequences being compared. For purposes herein,
however, % amino acid sequence identity values are obtained as
described below by using the sequence comparison computer program
ALIGN-2. The ALIGN-2 sequence comparison computer program was
authored by Genentech, Inc. has been filed with user documentation
in the U.S. Copyright Office, Washington D.C., 20559, where it is
registered under U.S. Copyright Registration No. TXU510087, and is
publicly available through Genentech, Inc., South San Francisco,
Calif. The ALIGN-2 program should be compiled for use on a UNIX
operating system, preferably digital UNIX V4.0D. All sequence
comparison parameters are set by the ALIGN-2 program and do not
vary.
[0040] For purposes herein, the % amino acid sequence identity of a
given amino acid sequence A to, with, or against a given amino acid
sequence B (which can alternatively be phrased as a given amino
acid sequence A that has or comprises a certain % amino acid
sequence identity to, with, or against a given amino acid sequence
B) is calculated as follows: 100 times the fraction X/Y where X is
the number of amino acid residues scored as identical matches by
the sequence alignment program ALIGN-2 in that program's alignment
of A and B, and where Y is the total number of amino acid residues
in B. It will be appreciated that where the length of amino acid
sequence A is not equal to the length of amino acid sequence B, the
% amino acid sequence identity of A to B will not equal the % amino
acid sequence identity of B to A.
[0041] The term "therapeutically effective amount" refers to an
amount of a drug effective to treat a disease or disorder in a
mammal. In the case of cancer, the therapeutically effective amount
of the drug may reduce the number of cancer cells; reduce the tumor
size; inhibit (i.e., slow to some extent and preferably stop)
cancer cell infiltration into peripheral organs; inhibit (i.e.,
slow to some extent and preferably stop) tumor metastasis; inhibit,
to some extent, tumor growth; and/or relieve to some extent one or
more of the symptoms associated with the disorder. To the extent
the drug may prevent growth and/or kill existing cancer cells, it
may be cytostatic and/or cytotoxic. For cancer therapy, efficacy in
vivo can, for example, be measured by assessing the time to disease
progression (TTP) and/or determining the response rates (RR).
[0042] The half-life of an amino acid sequence or compound can
generally be defined as the time taken for the serum concentration
of the polypeptide to be reduced by 50%, in vivo, for example due
to degradation of the sequence or compound and/or clearance or
sequestration of the sequence or compound by natural mechanisms.
The half-life can be determined in any manner known per se, such as
by pharmacokinetic analysis. Suitable techniques will be clear to
the person skilled in the art, and may for example generally
involve the steps of suitably administering to the primate a
suitable dose of the amino acid sequence or compound to be treated;
collecting blood samples or other samples from said primate at
regular intervals; determining the level or concentration of the
amino acid sequence or compound of the invention in said blood
sample; and calculating, from (a plot of) the data thus obtained,
the time until the level or concentration of the amino acid
sequence or compound of the invention has been reduced by 50%
compared to the initial level upon dosing. Reference is for example
made to the standard handbooks, such as Kenneth, A et al: Chemical
Stability of Pharmaceuticals: A Handbook for Pharmacists and in
Peters et al, Pharmacokinete analysis: A Practical Approach (1996).
Reference is also made to "Pharmacokinetics", M Gibaldi & D
Perron, published by Marcel Dekker, 2nd Rev. edition (1982).
[0043] Half-life can be expressed using parameters such as the
t1/2-alpha, t1/2-beta and the area under the curve (AUC). In the
present specification, an "increase in half-life" refers to an
increase in any one of these parameters, such as any two of these
parameters, or essentially all three these parameters. An "increase
in half-life" in particular refers to an increase in the t1/2-beta,
either with or without an increase in the t1/2-alpha and/or the AUC
or both.
Overview
[0044] The present application describes improved fibronectin based
scaffold proteins that are associated with increased stability. The
fibronectin based scaffold proteins described herein comprise one
or more human tenth fibronectin type III domains that have been
modified so as to bind to one or more desired targets. The present
application also describes improved VEGFR2/IGF-IR bispecific
fibronectin based scaffold protein dimers that are associated with
increased stability, comprising two human tenth fibronectin type
III domains, one that has been modified so as to bind specifically
to VEGFR2 and one that has been modified so as to bind specifically
to IGF-IR. PCT application WO 2009/142773 describes fibronectin
scaffold multimers that may be linked covalently or non-covalently
and that bind both VEGFR2 and IGF-IR. The present application
relates, in part, to the surprising discovery that bispecific
fibronectin based scaffold proteins that bind to VEGFR2 and IGF-IR
experience a high frequency of fragmentation at certain aspartate
residues. In particular, it has been discovered that aspartate
residues directly followed by a lysine residue are more sensitive
to cleavage in fibronectin based scaffold proteins as compared to
aspartate residues followed by other amino acids. The application
also relates to the surprising discovery that the degree of
fragmentation of VEGFR2/IGF-IR binding fibronectin based scaffold
proteins is considerably higher than the degree of fragmentation
associated with a related fibronectin based scaffold protein, i.e.,
a bispecific EGFR/IGF-IR binding fibronectin based scaffold protein
dimer, despite identical storage conditions and a high percentage
of shared sequence identity between these similar proteins. The
application also demonstrates that fragmentation of a model
fibronectin based scaffold protein can be markedly reduced if the
DK sites are removed or modified to substitute the aspartate
residue for a different amino acid, e.g. glutamic acid. Also
provided herein are improved compositions of fibronectin based
scaffold proteins that have increased stability during storage.
Fibronectin Based Scaffolds
[0045] Fn3 refers to a type III domain from fibronectin. An Fn3
domain is small, monomeric, soluble, and stable. It lacks disulfide
bonds and, therefore, is stable under reducing conditions. The
overall structure of Fn3 resembles the immunoglobulin fold. Fn3
domains comprise, in order from N-terminus to C-terminus, a beta or
beta-like strand, A; a loop, AB; a beta or beta-like strand, B; a
loop, BC; a beta or beta-like strand, C; a loop, CD; a beta or
beta-like strand, D; a loop, DE; a beta or beta-like strand, E; a
loop, EF; a beta or beta-like strand, F; a loop, FG; and a beta or
beta-like strand, G. The seven antiparallel .beta.-strands are
arranged as two beta sheets that form a stable core, while creating
two "faces" composed of the loops that connect the beta or
beta-like strands. Loops AB, CD, and EF are located at one face and
loops BC, DE, and FG are located on the opposing face. Any or all
of loops AB, BC, CD, DE, EF and FG may participate in ligand
binding. There are at least 15 different modules of Fn3, and while
the sequence homology between the modules is low, they all share a
high similarity in tertiary structure.
[0046] Adnectins.TM. (Adnexus, a Bristol-Myers Squibb Company) are
ligand binding scaffold proteins based on the tenth fibronectin
type III domain, i.e., the tenth module of Fn3, (.sup.10Fn3). The
amino acid sequence of the naturally occurring human .sup.10Fn3 is
set forth in SEQ ID NO: 37:
VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATIS
GLKPGVDYTITVYAVTGRGDSPASSKPISINYRT (SEQ ID NO: 37) (the AB, CD and
EF loops are underlined, and the BC, FG, and DE loops are
emphasized in bold).
[0047] In SEQ ID NO: 37, the AB loop corresponds to residues 15-16,
the BC loop corresponds to residues 21-30, the CD loop corresponds
to residues 39-45, the DE loop corresponds to residues 51-56, the
EF loop corresponds to residues 60-66, and the FG loop corresponds
to residues 76-87. See e.g., Xu et al., Chemistry & Biology
2002 9:933-942. The BC, DE and FG loops align along one face of the
molecule and the AB, CD and EF loops align along the opposite face
of the molecule. In SEQ ID NO: 37, beta strand A corresponds to
residues 9-14, beta strand B corresponds to residues 17-20, beta
strand C corresponds to residues 31-38, beta strand D corresponds
to residues 46-50, beta strand E corresponds to residues 57-59,
beta strand F corresponds to residues 67-75, and beta strand G
corresponds to residues 88-94. The strands are connected to each
other through the corresponding loop, e.g., strands A and B are
connected via loop AB in the order: strand A, loop AB, strand B,
etc. The first 8 amino acids of SEQ ID NO: 37 (italicized above)
may be deleted while still retaining binding activity of the
molecule. Residues involved in forming the hydrophobic core (the
"core amino acid residues") in SEQ ID NO: 37 include the amino
acids corresponding to the following amino acids of SEQ ID NO: 37:
L8, V10, A13, L18, I20, W22, Y32, I34, Y36, F48, V50, A57, I59,
L62, Y68, I70, V72, A74, I88, I90 and Y92, wherein the core amino
acid residues are represented by the single letter amino acid code
followed by the position at which they are located within SEQ ID
NO: 37. See e.g., Dickinson et al., J. Mol. Biol. 236: 1079-1092
(1994).
[0048] .sup.10Fn3 domains are structurally and functionally
analogous to antibodies, specifically the variable region of an
antibody. While .sup.10Fn3 domains may be described as "antibody
mimics" or "antibody-like proteins", they do offer a number of
advantages over conventional antibodies. In particular, they
exhibit better folding and thermostability properties as compared
to antibodies, and they lack disulphide bonds, which are known to
impede or prevent proper folding under certain conditions.
[0049] The BC, DE, and FG loops of .sup.10Fn3 domains are analogous
to the complementary determining regions (CDRs) from
immunoglobulins. Alteration of the amino acid sequence in these
loop regions changes the binding specificity of .sup.10Fn3.
.sup.10Fn3 domains with modifications in the AB, CD and EF loops
may also be made in order to produce a molecule that binds to a
desired target. The protein sequences outside of the loops are
analogous to the framework regions from immunoglobulins and play a
role in the structural conformation of the .sup.10Fn3. Alterations
in the framework-like regions of .sup.10Fn3 are permissible to the
extent that the structural conformation is not so altered as to
disrupt ligand binding. Methods for generating .sup.10Fn3 ligand
specific binders have been described in PCT Publication Nos. WO
00/034787, WO 01/64942, and WO 02/032925, disclosing high affinity
TNF.alpha. binders, PCT Publication No. WO 2008/097497, disclosing
high affinity VEGFR2 binders, PCT Publication No. WO 2008/066752,
disclosing high affinity IGF-IR binders, and WO 2009/142773,
disclosing high affinity multivalent VEGFR2/IGF-IR binders.
Additional references discussing .sup.10Fn3 binders and methods of
selecting binders include PCT Publication Nos. WO 98/056915, WO
02/081497, and WO 2008/031098 and U.S. Publication No.
2003/0186385.
[0050] As described above, amino acid residues corresponding to
residues 21-30, 51-56, and 76-87 of SEQ ID NO: 37 define the BC, DE
and FG loops, respectively. However, it should be understood that
not every residue within the loop region needs to be modified in
order to achieve a .sup.10Fn3 binding domain having strong affinity
for a desired target, such as VEGFR2 or IGF-TR. For example, in
some embodiments, only residues corresponding to amino acids 23-29
of the BC loop, 52-55 of the DE loop, and 77-86 of the FG loop were
modified to produce high affinity .sup.10Fn3 binders (see e.g., the
VEGFR2 binding core having SEQ ID NO: 3). Accordingly, in certain
embodiments, the BC loop may be defined by amino acids
corresponding to residues 23-29 of SEQ ID NO: 37, the DE loop may
be defined by amino acids corresponding to residues 52-55 of SEQ ID
NO: 37, and the FG loop may be defined by amino acids corresponding
to residues 77-86 of SEQ ID NO: 37.
[0051] Additionally, insertions and deletions in the loop regions
may also be made while still producing high affinity .sup.10Fn3
binding domains. For example, the FG loop of the VEGFR2 binder
having SEQ ID NO: 3 has the same length FG loop as the wild-type
.sup.10Fn3 domain, i.e., the 10 residues 77-86 of SEQ ID NO: 37
were replaced with the ten residues 69-78 of SEQ ID NO: 3. In
contrast, the FG loop of the IGF-IR binder having SEQ ID NO: 2 is
shorter in length than the corresponding FG loop of the wild-type
.sup.10Fn3 domain, i.e., the 10 residues 77-86 of SEQ ID NO: 37
were replaced with the six residues 69-74 of SEQ ID NO: 2. Finally,
the FG loop of the EGFR binder having SEQ ID NO: 39 is longer in
length than the corresponding FG loop of the wild-type .sup.10Fn3
domain, i.e., the 10 residues 77-86 of SEQ ID NO: 37 were replaced
with the fifteen residues 69-83 of SEQ ID NO: 39.
[0052] Accordingly, in some embodiments, one or more loops selected
from BC, DE, and FG may be extended or shortened in length relative
to the corresponding loop in wild-type human .sup.10Fn3. In some
embodiments, the length of the loop may be extended by from 2-25
amino acids. In some embodiments, the length of the loop may be
decreased by 1-11 amino acids. In particular, the FG loop of
.sup.10Fn3 is 12 residues long, whereas the corresponding loop in
antibody heavy chains ranges from 4-28 residues. To optimize
antigen binding, therefore, the length of the FG loop of .sup.10Fn3
may be altered in length as well as in sequence to cover the CDR3
range of 4-28 residues to obtain the greatest possible flexibility
and affinity in antigen binding. In some embodiments, one or more
residues of the integrin-binding motif "arginine-glycine-aspartic
acid" (RGD) (amino acids 78-80 of SEQ ID NO: 37) may be substituted
so as to disrupt integrin binding. In one embodiment, the RGD
sequence is replaced by a polar amino acid-neutral amino
acid-acidic amino acid sequence (in the N-terminal to C-terminal
direction). In another embodiment, the RGD sequence is replaced
with SGE.
[0053] The non-ligand binding sequences of .sup.10Fn3, i.e., the
".sup.10Fn3 scaffold", may be altered provided that the .sup.10Fn3
domain retains ligand binding function and/or structural stability.
In some embodiments, one or more of Asp 7, Glu 9, and Asp 23 are
replaced by another amino acid, such as, for example, a
non-negatively charged amino acid residue (e.g., Asn, Lys, etc.).
These mutations have been reported to have the effect of promoting
greater stability of the mutant .sup.10Fn3 at neutral pH as
compared to the wild-type form (See, PCT Publication No. WO
02/04523). A variety of additional alterations in the .sup.10Fn3
scaffold that are either beneficial or neutral have been disclosed.
See, for example, Batori et al., Protein Eng. 2002 15(12): 1015-20;
Koide et al., Biochemistry 2001 40(34): 10326-33.
[0054] The .sup.10Fn3 scaffold may be modified by one or more
conservative substitutions. As many as 5%, 10%, 20% or even 30% or
more of the amino acids in the .sup.10Fn3 scaffold may be altered
by a conservative substitution without substantially altering the
affinity of the .sup.10Fn3 for a ligand. In certain embodiments,
the scaffold may comprise anywhere from 0-15, 0-10, 0-8, 0-6, 0-5,
0-4, 0-3, 1-15, 1-10, 1-8, 1-6, 1-5, 1-4, 1-3, 2-15, 2-10, 2-8,
2-6, 2-5, 2-4, 5-15, or 5-10 conservative amino acid substitutions.
In exemplary embodiments, the scaffold modification preferably
reduces the binding affinity of the .sup.10Fn3 binder for a ligand
by less than 100-fold, 50-fold, 25-fold, 10-fold, 5-fold, or
2-fold. It may be that such changes will alter the immunogenicity
of the .sup.10Fn3 in vivo, and where the immunogenicity is
decreased, such changes will be desirable. As used herein,
"conservative substitutions" are residues that are physically or
functionally similar to the corresponding reference residues. That
is, a conservative substitution and its reference residue have
similar size, shape, electric charge, chemical properties including
the ability to form covalent or hydrogen bonds, or the like.
Preferred conservative substitutions are those fulfilling the
criteria defined for an accepted point mutation in Dayhoff et al.,
Atlas of Protein Sequence and Structure 5:345-352 (1978 &
Supp.). Examples of conservative substitutions are substitutions
within the following groups: (a) valine, glycine; (b) glycine,
alanine; (c) valine, isoleucine, leucine; (d) aspartic acid,
glutamic acid; (e) asparagine, glutamine; (f) serine, threonine;
(g) lysine, arginine, methionine; and (h) phenylalanine,
tyrosine.
[0055] In one aspect, the application provides fibronectin based
scaffold proteins, e.g., polypeptides comprising at least one
.sup.10Fn3 domain and having a C-terminal tail that lacks a DK
sequence. In exemplary embodiments, the fibronectin based scaffold
proteins comprise a .sup.10Fn3 domain having a C-terminal tail
comprising the amino acid sequence of SEQ ID NO: 4. Such
fibronectin based scaffold proteins have improved stability
relative to fibronectin based scaffolds containing one or more DK
sequences.
[0056] In some embodiments, a fibronectin based scaffold protein
comprises a .sup.10Fn3 domain having at least 40%, 50%, 55%, 60%,
65%, 70%, 75%, 80%, 85%, or 90% identity to the human .sup.10Fn3
domain having the amino acid sequence of SEQ ID NO: 1. Much of the
variability will generally occur in one or more of the loops. Each
of the beta or beta-like strands of a .sup.10Fn3 domain in a
fibronectin based scaffold protein may comprise, consist
essentially of, or consist of an amino acid sequence that is at
least 80%, 85%, 90%, 95% or 100% identical to the sequence of a
corresponding beta or beta-like strand of SEQ ID NO: 1, provided
that such variation does not disrupt the stability of the
polypeptide in physiological conditions. In exemplary embodiments,
the .sup.10Fn3 domain binds to a desired target with a K.sub.D of
less than 500 nM, 100 nM, 1 nM, 500 pM, 100 pM or less. In
exemplary embodiments, the fibronectin based scaffold protein binds
specifically to a target that is not bound by a wild-type
.sup.10Fn3 domain, particularly the wild-type human .sup.10Fn3
domain.
[0057] In some embodiments, the disclosure provides polypeptides
comprising a .sup.10Fn3 domain, wherein the .sup.10Fn3 domain
comprises a loop, AB; a loop, BC; a loop, CD; a loop, DE; a loop,
EF; and a loop, FG; and has at least one loop selected from loop
BC, DE, and FG with an altered amino acid sequence relative to the
sequence of the corresponding loop of the human .sup.10Fn3 domain.
In some embodiments, the BC and FG loops are altered. In some
embodiments, the BC, DE, and FG loops are altered, i.e., the
.sup.10Fn3 domain comprises non-naturally occurring loops. By
"altered" is meant one or more amino acid sequence alterations
relative to a template sequence (i.e., the corresponding human
fibronectin domain) and includes amino acid additions, deletions,
and substitutions. Altering an amino acid sequence may be
accomplished through intentional, blind, or spontaneous sequence
variation, generally of a nucleic acid coding sequence, and may
occur by any technique, for example, PCR, error-prone PCR, or
chemical DNA synthesis.
[0058] In some embodiments, one or more loops selected from BC, DE,
and FG may be extended or shortened in length relative to the
corresponding human fibronectin loop. In some embodiments, the
length of the loop may be extended by from 2-25 amino acids. In
some embodiments, the length of the loop may be decreased by 1-11
amino acids. In particular, the FG loop of .sup.10Fn3 is 12
residues long, whereas the corresponding loop in antibody heavy
chains ranges from 4-28 residues. To optimize antigen binding,
therefore, the length of the FG loop of a .sup.10Fn3 domain may be
altered in length as well as in sequence to cover the CDR3 range of
4-28 residues to obtain the greatest possible flexibility and
affinity in antigen binding.
[0059] In some embodiments, the fibronectin based scaffold protein
comprises a .sup.10Fn3 domain having an amino acid sequence at
least 80, 85, 90, 95, 98, or 100% identical to the non-loop regions
of SEQ ID NO: 1, wherein at least one loop selected from BC, DE,
and FG is altered. In some embodiments, the altered BC loop has up
to 10 amino acid substitutions, up to 4 amino acid deletions, up to
10 amino acid insertions, or a combination thereof. In some
embodiments, the altered DE loop has up to 6 amino acid
substitutions, up to 4 amino acid deletions, up to 13 amino acid
insertions, or a combination thereof. In some embodiments, the FG
loop has up to 12 amino acid substitutions, up to 11 amino acid
deletions, up to 25 amino acid insertions, or a combination
thereof.
[0060] In certain embodiments, the fibronectin based scaffold
protein comprises a .sup.10Fn3 domain that is defined generally by
following the sequence:
EVVAATPTSLLISW(X).sub.xRYYRITYGETGGNSPVQEFTVP(X).sub.yTATISGLKP-
GVDYTITVYA VT(X).sub.zPISINYRTEIEK (SEQ ID NO: 38)
In SEQ ID NO: 38, the BC loop is represented by X.sub.x, the DE
loop is represented by X.sub.y, and the FG loop is represented by
X.sub.z. X represents any amino acid and the subscript following
the X represents an integer of the number of amino acids. In
particular, x, y and z may each independently be anywhere from
2-20, 2-15, 2-10, 2-8, 5-20, 5-15, 5-10, 5-8, 6-20, 6-15, 6-10,
6-8, 2-7, 5-7, or 6-7 amino acids. In preferred embodiments, x is 7
amino acids, y is 4 amino acids, and z is 6, 10 or 15 amino acids.
The sequences of the beta strands (underlined) may have anywhere
from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4,
from 0 to 3, from 0 to 2, or from 0 to 1 substitutions, deletions
or additions across all 7 scaffold regions relative to the
corresponding amino acids shown in SEQ ID NO: 38. In an exemplary
embodiment, the sequences of the beta strands may have anywhere
from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4,
from 0 to 3, from 0 to 2, or from 0 to 1 conservative substitutions
across all 7 scaffold regions relative to the corresponding amino
acids shown in SEQ ID NO: 38. In certain embodiments, the core
amino acid residues are fixed and any substitutions, conservative
substitutions, deletions or additions occur at residues other than
the core amino acid residues. The EIEK tail (SEQ ID NO: 4) shown in
bold is fixed. In certain embodiments, the amino acids immediately
flanking the loop regions (e.g., the non-underlined residues) may
each independently be substituted or deleted. When substituting the
residues immediately flanking the loops, each residues may be
substituted with a sequence having the same number of amino acids
or with a larger amino acid sequence (e.g., insertions of 0-10,
0-8, 0-5, 0-3, or 0-2 amino acid residues). The non-underlined
residues are part of the loop region and therefore are amenable to
substitution without significantly affecting the structure of the
.sup.10Fn3 domain.
[0061] The .sup.10Fn3 domains generally begin with amino acid
number 1 of SEQ ID NO: 37. However, domains with amino acid
deletions are also encompassed by the invention. In some
embodiments, the first eight amino acids of SEQ ID NO: 37 are
deleted. Additional sequences may also be added to the N- or
C-terminus of a .sup.10Fn3 domain having amino acids corresponding
to 1-94 of SEQ ID NO: 37 or amino acids 9-94 of SEQ ID NO: 37. For
example, an additional MG sequence may be placed at the N-terminus
of a .sup.10Fn3 domain. The M will usually be cleaved off, leaving
a G at the N-terminus. In some embodiments, the N-terminal
extension consists of an amino acid sequence selected from the
group consisting of: M, MG, G, and any of SEQ ID NOs: 19-21.
[0062] The .sup.10Fn3 domain may optionally comprise an N-terminal
extension of from 1-20, 1-15, 1-10, 1-8, 1-5, 1-4, 1-3, 1-2, or 1
amino acids in length. Exemplary N-terminal extensions include
(represented by the single letter amino acid code) M, MG, G,
MGVSDVPRDL (SEQ ID NO: 19), VSDVPRDL (SEQ ID NO: 20), and GVSDVPRDL
(SEQ ID NO: 21), or N-terminal truncations of any one of SEQ ID
NOs: 19, 20 or 21. Other suitable N-terminal extensions include,
for example, X.sub.nSDVPRDL (SEQ ID NO: 26), X.sub.nDVPRDL (SEQ ID
NO. 27), X.sub.nVPRDL (SEQ ID NO: 28), X.sub.nPRDL (SEQ ID NO: 29),
X.sub.nRDL (SEQ ID NO: 30), X.sub.nDL (SEQ ID NO: 31), or X.sub.nL,
wherein n=0, 1 or 2 amino acids, wherein when n=1, X is Met or Gly,
and when n=2, X is Met-Gly. When a Met-Gly sequence is added to the
N-terminus of a .sup.10Fn3 domain, the M will usually be cleaved
off, leaving a G at the N-terminus.
[0063] The fibronectin based scaffold proteins provided herein
comprise a .sup.10Fn3 domain having a C-terminal tail sequence
comprising the amino acid sequence of SEQ ID NO: 4. Exemplary
C-terminal tails include polypeptides that are from 1-20, 1-15,
1-10, 1-8, 1-5, or 1-4 amino acids in length. Specific examples of
tail sequences include, for example, polypeptides comprising,
consisting essentially of, or consisting of, EIEK (SEQ ID NO: 4),
EGSGC (SEQ ID NO: 5), EIEKPCQ (SEQ ID NO: 6), EIEKPSQ (SEQ ID NO:
32), EIEKP (SEQ ID NO: 33), EIEKPS (SEQ ID NO: 34), or EIEKPC (SEQ
ID NO: 35). Such C-terminal sequences are referred to herein as
tails or extensions and are further described herein. In exemplary
embodiments, the C-terminal tail comprises, consists essentially
of, or consists of the amino acid sequence of SEQ ID NO: 6. In
preferred embodiments, the C-terminal sequences lack DK sequences.
In exemplary embodiments, the C-terminal tail comprises a residue
that facilitates modification by PEG, i.e., a lysine or cysteine
residue. In preferred embodiments, the C-terminal tail lacks a DK
sequence and comprises a cysteine residue.
[0064] In certain embodiments, the fibronectin based scaffold
proteins comprise a .sup.10Fn3 domain having both an N-terminal
extension and a C-terminal tail. In some embodiments, a His6-tag
may be placed at the N-terminus or the C-terminus.
[0065] In an exemplary embodiment, the fibronectin based scaffold
protein comprises a .sup.10Fn3 domain that binds to VEGFR2. In
certain embodiments, the fibronectin based scaffold protein binds
to VEGFR2 with a K.sub.D of less than 500 nM and the BC loop
comprises the amino acid sequence of SEQ ID NO: 43, the DE
comprises the amino acid sequence of SEQ ID NO: 44, the FG loop
comprises the amino acid sequence of SEQ ID NO: 45, and the protein
comprises a C-terminal tail that lacks a DK sequence. In exemplary
embodiments, the C-terminal tail comprises EIEK (SEQ ID NO: 4),
EGSGC (SEQ ID NO: 5), EIEKPCQ (SEQ ID NO: 6), EIEKPSQ (SEQ ID NO:
32), EIEKP (SEQ ID NO: 33), EIEKPS (SEQ ID NO: 34), or EIEKPC (SEQ
ID NO: 35). In preferred embodiments, the C-terminal tail comprises
EIEK (SEQ ID NO: 4) or EIEKPCQ (SEQ ID NO: 6).
[0066] In certain embodiments, the fibronectin based scaffold
protein is a multivalent protein that comprises two or more
.sup.10Fn3 domains. For example, a multivalent fibronectin based
scaffold protein may comprise 2, 3 or more .sup.10Fn3 domains that
are covalently associated. In exemplary embodiments, the
fibronectin based scaffold protein is a bispecific or dimeric
protein comprising two .sup.10Fn3 domains. In certain embodiments,
a multivalent fibronectin based protein scaffold comprises a first
.sup.10Fn3 domain that binds to a first target molecule and a
second .sup.10Fn3 domain that binds to a second target molecule.
The first and second target molecules may be the same or different
target molecules. When the first and second target molecules are
the same, the .sup.10Fn3 domains, i.e., the binding loops, may be
the same or different. Therefore, the first and second .sup.10Fn3
domains may bind to the same target but at different epitopes.
[0067] In exemplary embodiments, each .sup.10Fn3 domain of a
multivalent fibronectin based protein scaffold binds to a desired
target with a K.sub.D of less than 500 nM, 100 nM, 1 nM, 500 pM,
100 pM or less. In exemplary embodiments, each .sup.10Fn3 domain of
a multivalent fibronectin based protein scaffold binds specifically
to a target that is not bound by a wild-type .sup.10Fn3 domain,
particularly the wild-type human .sup.10Fn3 domain.
[0068] The .sup.10Fn3 domains in a multivalent fibronectin based
scaffold protein may be connected by a polypeptide linker.
Exemplary polypeptide linkers include polypeptides having from
1-20, 1-15, 1-10, 1-8, 1-5, 1-4, 1-3, or 1-2 amino acids. Specific
examples of suitable polypeptide linkers are described further
herein. In certain embodiments, the linker may be a C-terminal tail
polypeptide as described herein, an N-terminal extension
polypeptide as described herein, a linker polypeptide as described
below, or any combination thereof.
[0069] In the case of multivalent fibronectin based scaffold
proteins, preferably none of the .sup.10Fn3 domains comprise a
C-terminal tail containing a DK sequence. In exemplary embodiments,
a multivalent fibronectin based scaffold protein comprises two or
more .sup.10Fn3 domains, wherein each domain comprises a C-terminal
tail that does not contain a DK sequence. In certain embodiments, a
multivalent fibronectin based scaffold protein comprises two or
more .sup.10Fn3 domains, wherein each domain comprises a C-terminal
tail that does not contain a DK sequence and does contain a residue
suitable for addition of a PEG moiety, such as a lysine or cysteine
residue. In certain embodiments, a multivalent fibronectin based
scaffold protein comprises two or more .sup.10Fn3 domains, wherein
each domain comprises a C-terminal tail comprising the amino acid
sequence of SEQ ID NO: 4. In certain embodiments, a multivalent
fibronectin based scaffold protein comprises two or more .sup.10Fn3
domains, wherein the N-terminal .sup.10Fn3 domain comprises a
C-terminal tail comprising the amino acid sequence of SEQ ID NO: 4
and the C-terminal .sup.10Fn3 domain comprises a C-terminal tail
comprising the amino acid sequence of EIEK (SEQ ID NO: 4), EGSGC
(SEQ ID NO: 5), EIEKPCQ (SEQ ID NO: 6), EIEKPSQ (SEQ ID NO: 32),
EIEKP (SEQ ID NO: 33), EIEKPS (SEQ ID NO: 34), or EIEKPC (SEQ ID
NO: 35).
[0070] By varying the loop sequences of the 10Fn3 domain, it is
possible to generate a fibronectin based scaffold protein that
binds to any desired target. In exemplary embodiments, the
fibronectin based scaffold proteins provided herein having
increased stability may bind to a therapeutically desirable target,
such as, for example, TNF.alpha., VEGFR2, IGF-IR, or EGFR. In
certain embodiments, a fibronectin based scaffold protein does not
bind to one or more of the following targets: EGFR, IGF-IR, HSA and
PCSK9, or a fragment of any of the foregoing. In certain
embodiments, a fibronectin based scaffold protein comprising a
single .sup.10Fn3 domain docs not bind to one or more of the
following targets: EGFR, IGF-IR, HSA and PCSK9, or a fragment of
any of the foregoing. In certain embodiments, a fibronectin based
scaffold protein comprising a single .sup.10Fn3 domain does not
bind to any of the following targets: EGFR, IGF-IR, HSA and PCSK9,
or a fragment of any of the foregoing. In certain embodiments, a
fibronectin based scaffold protein comprising two .sup.10Fn3
domains does not bind one or more of the following targets: EGFR,
IGF-IR, HSA and PCSK9, or a fragment of any of the foregoing. In
certain embodiments, a fibronectin based scaffold protein
comprising two .sup.10Fn3 domains does not bind one or more of the
following combinations of target molecules: i) EGFR and IGF-IR; ii)
EGFR and any other target protein; or iii) human serum albumin and
any other target protein. In certain embodiments, a fibronectin
based scaffold protein comprising two .sup.10Fn3 domains does not
bind any of the following combinations of target molecules: i) EGFR
and IGF-IR; ii) EGFR and any other target protein; or iii) human
serum albumin and any other target protein.
Fibronectin Based Scaffold Protein Dimers
[0071] In certain embodiments, the fibronectin based scaffold
proteins described herein are dimers comprising two .sup.10Fn3
domains. In one embodiment, the application provides V/I
fibronectin based scaffold protein dimers comprising a first and
second .sup.10Fn3 domain selected from the group consisting of: (i)
a .sup.10Fn3 domain comprising a BC loop having the amino acid
sequence of SEQ ID NO: 40, a DE loop having the amino acid sequence
of SEQ ID NO: 41, an FG loop having the amino acid sequence of SEQ
ID NO: 42, and a C-terminal tail comprising the amino acid sequence
of any one of SEQ ID NOs: 4-6, wherein the .sup.10Fn3 domain binds
IGF-IR; and (ii) a .sup.10Fn3 domain comprising a BC loop having
the amino acid sequence of SEQ ID NO: 43, a DE loop having the
amino acid sequence of SEQ ID NO: 44, an FG loop having the amino
acid sequence of SEQ ID NO: 45, and a C-terminal tail comprising
the amino acid sequence of any one of SEQ ID NOs: 4-6, wherein the
Fn3 domain binds VEGFR2. In exemplary embodiments, each of the
VEGFR2 and IGF-IR binding .sup.10Fn3 domains binds to its target
with a K.sub.D of less than 500 nM, 100 nM, 1 nM, 500 pM, 100 pM or
less.
[0072] In certain embodiments, the V/I fibronectin based scaffold
protein dimer comprises in order from N-terminus to C-terminus an
IGF-IR binding domain and a VEGFR2 binding domain. In exemplary
embodiments, the fibronectin based scaffold protein dimer
comprises: (i) a first .sup.10Fn3 domain comprising a BC loop
having the amino acid sequence of SEQ ID NO: 40, a DE loop having
the amino acid sequence of SEQ ID NO: 41, an FG loop having the
amino acid sequence of SEQ ID NO: 42, and a C-terminal tail
comprising the amino acid sequence of SEQ ID NO: 4, wherein the
.sup.10Fn3 domain binds IGF-IR; and (ii) a second .sup.10Fn3 domain
comprising a BC loop having the amino acid sequence of SEQ ID NO:
43, a DE loop having the amino acid sequence of SEQ ID NO: 44, an
FG loop having the amino acid sequence of SEQ ID NO: 45, and a
C-terminal tail comprising the amino acid sequence of SEQ ID NO: 6,
wherein the .sup.10Fn3 domain binds VEGFR2. In exemplary
embodiments, each of the VEGFR2 and IGF-IR binding .sup.10Fn3
domains binds to its target with a K.sub.D of less than 500 nM, 100
nM, 1 nM, 500 pM, 100 pM or less.
[0073] In certain embodiments, the V/I fibronectin based scaffold
protein dimer comprises in order from N-terminus to C-terminus a
VEGFR2 binding domain and an IGF-IR binding domain. In exemplary
embodiments, the fibronectin based scaffold protein dimer
comprises: (i) a first .sup.10Fn3 domain comprising a BC loop
having the amino acid sequence of SEQ ID NO: 43, a DE loop having
the amino acid sequence of SEQ ID NO: 44, an FG loop having the
amino acid sequence of SEQ ID NO: 45, and a C-terminal tail
comprising the amino acid sequence of SEQ ID NO: 4, wherein the
.sup.10Fn3 domain binds VEGFR2; and (ii) a second .sup.10Fn3 domain
comprising a BC loop having the amino acid sequence of SEQ ID NO:
40, a DE loop having the amino acid sequence of SEQ ID NO: 41, an
FG loop having the amino acid sequence of SEQ ID NO: 42, and a
C-terminal tail comprising the amino acid sequence of SEQ ID NO: 6,
wherein the .sup.10Fn3 domain binds IGF-IR; and In exemplary
embodiments, each of the VEGFR2 and IGF-IR binding .sup.10Fn3
domains binds to its target with a K.sub.D of less than 500 nM, 100
nM, 1 nM, 500 pM, 100 pM or less.
[0074] In certain embodiments, the V/I fibronectin based scaffold
protein dimer comprises a first and second .sup.10Fn3 domain
selected from the group consisting of: (i) a .sup.10Fn3 domain
comprising, consisting essentially of, or consisting of an amino
acid sequence having at least 90%, 95%, 97%, 98%, 99% or 100%
identity with SEQ ID NO: 2, wherein the .sup.10Fn3 domain
comprises, consists essentially of, or consists of a C-terminal
tail having the amino acid sequence of any one of SEQ ID NOs: 4-6,
and wherein the .sup.10Fn3 domain binds IGF-IR; and (ii) a
.sup.10Fn3 domain comprising, consisting essentially of, or
consisting of an amino acid sequence having at least 90%, 95%, 97%,
98%, 99% or 100% identity with SEQ ID NO: 3, wherein the .sup.10Fn3
domain comprises, consists essentially of, or consists of a
C-terminal tail having the amino acid sequence of any one of SEQ ID
NOs: 4-6, and wherein the .sup.10Fn3 domain binds VEGFR2. In
exemplary embodiments, each of the VEGFR2 and IGF-IR binding
.sup.10Fn3 domains binds to its target with a of less than 500 nM,
100 nM, 1 nM, 500 pM, 100 pM or less. In exemplary embodiments the
first and second .sup.10Fn3 domains are connected via a polypeptide
linker. In certain embodiments, the V/I fibronectin based scaffold
protein dimer comprises an N-terminal VEGFR2 binding .sup.10Fn3
domain and a C-terminal IGF-IR binding .sup.10Fn3 domain. In
certain embodiments, the V/I fibronectin based scaffold protein
dimer comprises an N-terminal IGF-IR binding .sup.10Fn3 domain and
a C-terminal VEGFR2 binding .sup.10Fn3 domain. In certain
embodiments, the N-terminal .sup.10Fn3 domain comprises a
C-terminal tail having the amino acid sequence of SEQ ID NO: 4 and
the C-terminal .sup.10Fn3 domain comprises a C-terminal tail having
the amino acid sequence of SEQ ID NO: 6.
[0075] In certain embodiments, a V/I fibronectin based scaffold
protein dimer comprises the amino acid sequence of any one of SEQ
ID NOs: 48-55. In other embodiments, a V/I fibronectin based
scaffold protein dimer comprises the amino acid sequence of SEQ ID
NO: 48. In some embodiments, a V/I fibronectin based scaffold
protein dimer comprises an amino acid sequence having at least 70,
75, 80, 85, 90, 95, 97, 98, 99 or 100% identity with the amino acid
sequence of any one of SEQ ID NOs: 48-55.
[0076] In certain embodiments, a V/T fibronectin based scaffold
protein dimer comprises a polypeptide having the structure
N1-D1-C1-L-N2-D2-C2, wherein N1 and N2 are optional N-terminal
extensions independently comprising from 0-10 amino acids, wherein
D1 and D2 are independently selected from the group consisting of:
(i) a tenth fibronectin type III domain (.sup.10Fn3) domain having
at least 90%, 95%, 97%, 98%, 99% or 100% identity with the amino
acid sequence set forth in SEQ ID NO: 2, wherein said .sup.10Fn3
domain binds to IGF-IR with a K.sub.D of less than 500 nM, 100 nM,
1 nM, 500 pM, 100 pM or less, and (ii) a .sup.10Fn3 domain having
at least 90%, 95%, 97%, 98%, 99% or 100% identity with the amino
acid sequence set forth in SEQ ID NO: 3, wherein said .sup.10Fn3
domain binds to VEGFR2 with a K.sub.D of less than 500 nM, 100 nM,
1 nM, 500 pM, 100 pM; wherein L is a polypeptide linker comprising
from 0-30 amino acid residues; wherein C1 comprises, consists
essentially of, or consists of the amino acid sequence of SEQ ID
NO: 4; and wherein C2 comprises, consists essentially of, or
consists of any one of the amino acid sequences of SEQ ID NOs: 4, 5
or 6. In certain embodiments, D1 binds to VEGFR2 and D2 binds to
IGF-IR. In other embodiments, D1 binds to IGF-IR and D2 binds to
VEGFR2.
[0077] In certain embodiments, the D1 or D2 region is a .sup.10Fn3
domain that binds to VEGFR2 comprising a BC loop having the amino
acid sequence of SEQ ID NO: 43, a DE loop having the amino acid
sequence of SEQ ID NO: 44, and an FG loop having the amino acid
sequence of SEQ ID NO: 45, wherein the .sup.10Fn3 domain binds to
VEGFR2 with a K.sub.D of less than 100 nM.
[0078] In certain embodiments, the D1 or D2 region is a VEGFR2
binder represented by the following amino acid sequence:
TABLE-US-00001 (SEQ ID NO: 3)
EVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEFTVPLQPPTAT
ISGLKPGVDYTITFVYAVTDGRNGRLLSIPISINYRT.
In SEQ ID NO: 3, the sequence of the BC, DE and FG loops have a
fixed sequence as shown in bold (e.g., a BC loop having the amino
acid sequence of SEQ ID NO: 43, a DE loop having the amino acid
sequence of SEQ ID NO: 44, and an FG loop having the amino acid
sequence of SEQ ID NO: 45) and the remaining sequence which is
underlined (e.g., the sequence of the 7 beta strands and the AB, CD
and EF loops) has anywhere from 0 to 20, from 0 to 15, from 0 to
10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to
3, from 0 to 2, or from 0 to 1 substitutions, conservative
substitutions, deletions or additions relative to the corresponding
amino acids shown in SEQ ID NO: 3. In certain embodiments, the core
amino acid residues are fixed and any substitutions, conservative
substitutions, deletions or additions occur at residues other than
the core amino acid residues.
[0079] The .sup.10Fn3 domain that binds to VEGFR2 may optionally be
linked to an N-terminal extension (N1 or N2) of from 1-20, 1-15,
1-10, 1-8, 1-5, 1-4, 1-3, 1-2, or 1 amino acids in length.
Exemplary N-terminal extensions include (represented by the single
letter amino acid code) M, MG, G, MGVSDVPRDL (SEQ ID NO: 19),
VSDVPRDL (SEQ ID NO: 20), and GVSDVPRDL (SEQ ID NO: 21), or
N-terminal truncations of any one of SEQ ID NOs: 19, 20 or 21.
Other suitable N-terminal extensions include, for example,
X.sub.nSDVPRDL (SEQ ID NO: 26), X.sub.nDVPRDL (SEQ ID NO: 27),
X.sub.nVPRDL (SEQ ID NO: 28), X.sub.nPRDL (SEQ ID NO: 29),
X.sub.nRDL (SEQ ID NO: 30), X.sub.nDL (SEQ ID NO: 31), or X.sub.nL,
wherein n=0, 1 or 2 amino acids, wherein when n=1, X is Met or Gly,
and when n=2, X is Met-Gly. In preferred embodiments, N1 comprises,
consists essentially of, or consists of the amino acid sequence of
SEQ ID NO: 19. In preferred embodiments, N2 comprises, consists
essentially of, or consists of the amino acid sequence of SEQ ID
NO: 20.
[0080] The .sup.10Fn3 domain that binds to VEGFR2 may optionally
comprise a C-terminal tail (C1 or C2). The C-terminal tails of the
fibronectin based scaffold protein dimers of the claimed invention
do not contain a DK sequence. Exemplary C-terminal tails include
polypeptides that are from 1-20, 1-15, 1-10, 1-8, 1-5, 1-4, 1-3,
1-2, or 1 amino acids in length. Specific examples of C-terminal
tails include EIEKPSQ (SEQ ID NO: 32), EIEKPCQ (SEQ ID NO: 6), and
EIEK. (SEQ ID NO: 4). In other embodiments, suitable C-terminal
tails may be a C-terminally truncated fragment of SEQ ID NOs: 4, 6
or 32, including, for example, one of the following amino acid
sequences (represented by the single letter amino acid code): EIE,
EIEKP (SEQ ID NO: 33), EIEKPS (SEQ ID NO: 34), or EIEKPC (SEQ ID
NO: 35). Other suitable C-terminal tails include, for example, ES,
EC, EGS, EGC, EGSGS (SEQ ID NO: 36), or EGSGC (SEQ ID NO: 5). In
certain embodiments. C1 comprises, consists essentially of, or
consists of the amino acid sequence of SEQ ID NO: 4. In certain
embodiments, C2 comprises, consists essentially of, or consists of
the amino acid sequence of SEQ ID NO: 4, 5 or 6. In preferred
embodiments, C1 comprises, consists essentially of, or consists of
the amino acid sequence of SEQ ID NO: 4 and C2 comprises, consists
essentially of, or consists of the amino acid sequence of SEQ ID
NO: 6.
[0081] In certain embodiments, the .sup.10Fn3 domain that binds to
VEGFR2 comprises both an N-terminal extension and a C-terminal
tail. In exemplary embodiments, N1 begins with Gly or Met-Gly, C1
does not contain a cysteine residue, N2 does not start with a Met.
and C2 comprises a cysteine residue. Specific examples of
.sup.10Fn3 domains that bind to VEGFR2 are polypeptides comprising:
(i) the amino acid sequence set forth in SEQ ID NO: 3, or (ii) an
amino acid sequence having at least 85%, 90%, 95%, 97%, 98%, or 99%
identity with the amino acid sequence set forth in SEQ ID NO:
3.
[0082] In certain embodiments, the D1 or D2 region is a .sup.10Fn3
domain that binds to IGF-IR comprising a BC loop having the amino
acid sequence of SEQ ID NO: 40, a DE loop having the amino acid
sequence of SEQ ID NO: 41, and an FG loop having the amino acid
sequence of SEQ ID NO: 42, wherein the .sup.10Fn3 domain binds to
IGF-IR with a K.sub.D of less than 100 nM.
[0083] In certain embodiments, the D1 or D2 region is an IGF-IR
binder represented by the following amino acid sequence:
TABLE-US-00002 (SEQ ID NO: 2)
EVVAATPTSLLISWSARLKVARYYRITYGETGGNSPVQEFTVPKNVYTAT
ISGLKPGVDYTITVYAVTRFRQYQPISINYRT.
[0084] In SEQ ID NO: 2, the sequence of the BC, DE and FG loops
have a fixed sequence as shown in bold (e.g., a BC loop having the
amino acid sequence of SEQ ID NO: 40, a DE loop having the amino
acid sequence of SEQ ID NO: 41, and an FG loop having the amino
acid sequence of SEQ ID NO: 42) and the remaining sequence which is
underlined (e.g., the sequence of the 7 beta strands and the AB, CD
and EF loops) has anywhere from 0 to 20, from 0 to 15, from 0 to
10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to
3, from 0 to 2, or from 0 to 1 substitutions, conservative
substitutions, deletions or additions relative to the corresponding
amino acids shown in SEQ ID NO: 2. In certain embodiments, the core
amino acid residues are fixed and any substitutions, conservative
substitutions, deletions or additions occur at residues other than
the core amino acid residues.
[0085] The .sup.10Fn3 domain that binds to IGF-IR may optionally be
linked to an N-terminal extension (N1 or N2) of from 1-20, 1-15,
1-10, 1-8, 1-5, 1-4, 1-3, 1-2, or 1 amino acids in length.
Exemplary N-terminal extensions include (represented by the single
letter amino acid code) M, MG, G, MGVSDVPRDL (SEQ ID NO: 19),
VSDVPRDL (SEQ ID NO: 20), and GVSDVPRDL (SEQ ID NO: 21), or
N-terminal truncations of any one of SEQ ID NOs: 19, 20 or 21.
Other suitable N-terminal extensions include, for example,
X.sub.nSDVPRDL (SEQ ID NO: 26), X.sub.nDVPRDL (SEQ ID NO: 27),
X.sub.nVPRDL (SEQ ID NO: 28), X.sub.nPRDL (SEQ ID NO: 29),
X.sub.nRDL (SEQ ID NO: 30), X.sub.nDL (SEQ ID NO: 31), or X.sub.nL,
wherein n=0, 1 or 2 amino acids, wherein when n=1, X is Met or Gly,
and when n=2, X is Met-Gly. In preferred embodiments, N1 comprises,
consists essentially of, or consists of the amino acid sequence of
SEQ ID NO: 19. In preferred embodiments, N2 comprises, consists
essentially of, or consists of the amino acid sequence of SEQ ID
NO: 20.
[0086] The .sup.10Fn3 domain that binds to IGF-IR may optionally
comprise a C-terminal tail (C1 or C2). The C-terminal tails of the
fibronectin based scaffold protein dimers of the claimed invention
do not contain a DK sequence. Exemplary C-terminal tails include
polypeptides that are from 1-20, 1-15, 1-10, 1-8, 1-5, 1-4, 1-3,
1-2, or 1 amino acids in length. Specific examples of C-terminal
tails include EIEKPSQ (SEQ ID NO: 32), EIEKPCQ (SEQ ID NO: 6), and
EIEK (SEQ ID NO: 4). In other embodiments, suitable C-terminal
tails may be a C-terminally truncated fragment of SEQ ID NOs: 4, 6
or 32, including, for example, one of the following amino acid
sequences (represented by the single letter amino acid code): EIE,
EIEKP (SEQ ID NO: 33), EIEKPS (SEQ ID NO: 34), or EIEKPC (SEQ ID
NO: 35). Other suitable C-terminal tails include, for example, ES,
EC, EGS, EGC, EGSGS (SEQ ID NO: 36), or EGSGC (SEQ ID NO: 5). In
certain embodiments, C1 comprises, consists essentially of, or
consists of the amino acid sequence of SEQ ID NO: 4. In certain
embodiments, C2 comprises, consists essentially of, or consists of
the amino acid sequence of SEQ ID NO: 4, 5 or 6. In preferred
embodiments. C1 comprises, consists essentially of, or consists of
the amino acid sequence of SEQ ID NO: 4 and C2 comprises, consists
essentially of, or consists of the amino acid sequence of SEQ ID
NO: 6.
[0087] In certain embodiments, the .sup.10Fn3 domain that binds to
IGF-IR comprises both an N-terminal extension and a C-terminal
tail. In exemplary embodiments, N1 begins with Gly or Met-Gly, C1
does not contain a cysteine residue, N2 does not start with a Met,
and C2 comprises a cysteine residue. Specific examples of
.sup.10Fn3 domains that bind to IGF-IR are polypeptides comprising:
(i) the amino acid sequence set forth in SEQ ID NO: 2, or (ii) an
amino acid sequence having at least 85%, 90%, 95%, 97%, 98%, or 99%
identity with the amino acid sequence set forth in SEQ ID NO:
2.
[0088] The L region is a polypeptide linker. Exemplary polypeptide
linkers include polypeptides having from 1-20, 1-15, 1-10, 1-8,
1-5, 1-4, 1-3, or 1-2 amino acids. Specific examples of suitable
polypeptide linkers are described further herein. In certain
embodiments, the linker may be a C-terminal tail polypeptide as
described herein, an N-terminal extension polypeptide as described
herein, or a combination thereof.
[0089] In certain embodiments, one or more of N1, N2, L, C1 or C2
may comprise an amino acid residue suitable for pegylation, such as
a cysteine or lysine residue. In exemplary embodiments, C2
comprises at least one amino acid suitable for pegylation, such as
a cysteine or lysine residue. Specific examples of suitable
polypeptide linkers are described further below. Specific examples
of fibronectin based scaffold protein dimers having the structure
N1-D1-C1-L-N2-D2-C2 are polypeptides comprising: (i) the amino acid
sequence set forth in any one of SEQ ID NOs: 48-55, or (ii) an
amino acid sequence having at least 85%, 90%, 95%, 97%, 98%, or 99%
identity with any one of SEQ ID NOs: 48-55.
[0090] In certain embodiments, fibronectin based scaffold protein
dimers will have the structure N1-D1-L-N2-D2, wherein D1 and D2
each comprise an amino acid sequence having the following
sequence:
TABLE-US-00003 (SEQ ID NO: 38)
EVVAATPTSLLISW(X).sub.xRYYRITYGETGGNSPVQEFTVP(X).sub.yTATISG
LKPGVDYTITVYAVT(X).sub.zPISINYRTEIEK
In SEQ ID NO: 38, the BC loop is represented by X.sub.x, the DE
loop is represented by X.sub.y, and the FG loop is represented by
X.sub.z. The sequences of the beta strands (underlined) may have
anywhere from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from
0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 substitutions,
deletions or additions across all 7 scaffold regions relative to
the corresponding amino acids shown in SEQ ID NO: 38. In an
exemplary embodiment, the sequences of the beta strands may have
anywhere from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from
0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 conservative
substitutions across all 7 scaffold regions relative to the
corresponding amino acids shown in SEQ ID NO: 38. In certain
embodiments, the core amino acid residues are fixed and any
substitutions, conservative substitutions, deletions or additions
occur at residues other than the core amino acid residues. The EIEK
tail (SEQ ID NO: 4) shown in bold is fixed. In certain embodiments,
the amino acids immediately flanking the loop regions (e.g., the
non-underlined residues) may each independently be substituted or
deleted. When substituting the residues immediately flanking the
loops, each residues may be substituted with a sequence having the
same number of amino acids or with a larger amino acid sequence
(e.g., insertions of 0-10, 0-8, 0-5, 0-3, or 0-2 amino acid
residues). The non-underlined residues are part of the loop region
and therefore are amenable to substitution without significantly
affecting the structure of the .sup.10Fn3 domain.
[0091] In certain embodiments, a fibronectin based scaffold protein
dimer has the structure N1-D1-L-N2-D2, wherein D1 and D2 are
selected from the group consisting of: (i) a .sup.10Fn3 domain
comprising SEQ ID NO: 38, wherein X.sub.x comprises, consists
essentially of, or consists of the amino acid sequence of SEQ ID
NO: 40, X.sub.y comprises, consists essentially of, or consists of
the amino acid sequence of SEQ ID NO: 41, and X.sub.z comprises,
consists essentially of, or consists of the amino acid sequence of
SEQ ID NO: 42; and (ii) a .sup.10Fn3 domain comprising SEQ ID NO:
38, wherein X.sub.x comprises, consists essentially of, or consists
of the amino acid sequence of SEQ ID NO: 43, X.sub.y comprises,
consists essentially of, or consists of the amino acid sequence of
SEQ ID NO: 44, and X.sub.z comprises, consists essentially of, or
consists of the amino acid sequence of SEQ ID NO: 45.
[0092] In an exemplary embodiment, a fibronectin based scaffold
protein dimer has the structure N1-D1-L-N2-D2, wherein D1 comprises
the amino acid sequence of SEQ ID NO: 38, wherein X.sub.x
comprises, consists essentially of, or consists of the amino acid
sequence of SEQ ID NO: 40, X.sub.y comprises, consists essentially
of, or consists of the amino acid sequence of SEQ ID NO: 41, and
X.sub.z comprises, consists essentially of, or consists of the
amino acid sequence of SEQ ID NO: 42, and wherein D2 comprises the
amino acid sequence of SEQ ID NO: 38, wherein X.sub.x comprises,
consists essentially of, or consists of the amino acid sequence of
SEQ ID NO: 43, X.sub.y comprises, consists essentially of, or
consists of the amino acid sequence of SEQ ID NO: 44, and X.sub.z
comprises, consists essentially of, or consists of the amino acid
sequence of SEQ ID NO: 45.
[0093] In another exemplary embodiment, a fibronectin based
scaffold protein dimer has the structure N1-D1-L-N2-D2, wherein D1
comprises the amino acid sequence of SEQ ID NO: 38, wherein X.sub.x
comprises, consists essentially of, or consists of the amino acid
sequence of SEQ ID NO: 43, X.sub.y comprises, consists essentially
of, or consists of the amino acid sequence of SEQ ID NO: 44, and
X.sub.z comprises, consists essentially of, or consists of the
amino acid sequence of SEQ ID NO: 45; and wherein D2 comprises the
amino acid sequence of SEQ ID NO: 38, wherein X.sub.x comprises,
consists essentially of, or consists of the amino acid sequence of
SEQ ID NO: 40, X.sub.y comprises, consists essentially of, or
consists of the amino acid sequence of SEQ ID NO: 41, and X.sub.z
comprises, consists essentially of, or consists of the amino acid
sequence of SEQ ID NO: 42.
[0094] In certain embodiments, a fibronectin based scaffold protein
dimer having the structure N1-D1-L-N2-D2 further comprises a
C-terminal tail. In exemplary embodiments, the C-terminal tail
comprises a residue suitable for addition of a PEG moiety, e.g., a
lysine or cysteine residue. In a preferred embodiment, the
C-terminal tail comprises the sequence PCQ.
[0095] In various embodiments, the L domain of a fibronectin based
scaffold protein dimer having the structure N1-D1-L-N2-D2 is a
polypeptide linker. Exemplary polypeptide linkers include
polypeptides having from 1-20, 1-15, 1-10, 1-8, 1-5, 1-4, 1-3, or
1-2 amino acids. Specific examples of suitable polypeptide linkers
are described further herein. In addition, N1 and N2 are N-terminal
extensions as described herein above.
[0096] In preferred embodiments, the fibronectin based scaffold
protein dimers described herein have increased stability either in
vitro, in vivo or both. In certain embodiments, the fibronectin
based scaffold protein dimers described herein have reduced
fragmentation and/or decreased aggregation during storage in
solution. In certain embodiments, the fibronectin based scaffold
protein dimers described herein have increased serum half-life.
[0097] In exemplary embodiments, the fibronectin based scaffold
protein dimers described herein have reduced fragmentation relative
to a fibronectin based scaffold protein dimer comprising a DK
sequence. In particular, the fibronectin based scaffold protein
dimers described herein have increased stability relative to a
fibronectin based scaffold protein dimer having one or more DK
sequences in any one of: a C-terminal tail, an N-terminal extension
or a linker between two .sup.10Fn3 domains. For example, the
fibronectin based scaffold protein dimers are generally more stable
than fibronectin based scaffold protein dimers having a DK sequence
in one or both C-terminal tail regions, e.g., comprising a tail
having SEQ ID NO: 46 after the first and/or second .sup.10Fn3
subunit. In exemplary embodiments, the fibronectin based scaffold
protein dimers described herein have reduced fragmentation relative
to a fibronectin based scaffold protein dimer having the formula
N1-D1-C1-L-N2-D2-C2, wherein C1 and/or C2 comprise SEQ ID NO: 46.
Fragmentation may be assessed, for example, using RP-HPLC analysis,
as described in Example 3.
[0098] In exemplary embodiments, the fibronectin based scaffold
protein dimers described herein exhibit less than 7%, 6%, 5%, 4%,
3.5%, 3%, 2% or less fragmentation upon storage in solution for
four weeks at pH 4.0. In certain embodiments, the fibronectin based
scaffold protein dimers described herein exhibit a level of
fragmentation that is reduced by at least 25%, 30%, 40%, 50%, 60%,
70%, 75%, 80% or more relative to an equivalent version of the
fibronectin based scaffold protein dimer that contains one or more
DK sequences.
[0099] In exemplary embodiments, the fibronectin based scaffold
protein dimers described herein exhibit a serum half-life that is
increased by at least 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%
or more relative to the serum half-life of a an equivalent version
of the fibronectin based scaffold protein dimer that contains one
or more DK sequences. In other embodiments, the fibronectin based
scaffold protein dimers described herein exhibit a serum half-life
that is increased by at least 2-fold, 3-fold, 5-fold, 10-fold, or
more relative to the serum half-life of a an equivalent version of
the fibronectin based scaffold protein dimer that contains one or
more DK sequences.
[0100] In certain embodiments, the application provides an E/I
fibronectin based scaffold protein dimer, comprising one .sup.10Fn3
domain that binds to EGFR and one .sup.10Fn3 domain that binds to
IGF-IR. In certain embodiments, an E/I fibronectin based scaffold
protein dimer comprises the amino acid sequence of any one of SEQ
ID NOs: 22-25. In other embodiments, an E/I fibronectin based
scaffold protein dimer comprises the amino acid sequence of SEQ ID
NO: 25. In some embodiments, an E/I fibronectin based scaffold
protein dimer comprises an amino acid sequence having at least 70,
75, 80, 85, 90, 95, 97, 98, 99 or 100% identity with the amino acid
sequence of any one of SEQ ID NOs: 22-25.
Polypeptide Linkers
[0101] The application provides multivalent fibronectin based
scaffold proteins comprising at least two .sup.10Fn3 domains linked
via a polypeptide linker. In one embodiment, the application
provides fibronectin based scaffold dimers comprising two
.sup.10Fn3 domains linked via a polypeptide linker (L). The
polypeptides comprise an N-terminal domain comprising a first
.sup.10Fn3 domain and a C-terminal domain comprising a second
.sup.10Fn3 domain. The first and second .sup.10Fn3 domains may be
directly or indirectly linked via a polypeptide linker (L).
Additional linkers or spacers, e.g., SEQ ID NOS: 4, 6 or 32, may be
introduced at the C-terminus of the first .sup.10Fn3 domain between
the .sup.10Fn3 domain and the polypeptide linker. Additional
linkers or spacers may be introduced at the N-terminus of the
second .sup.10Fn3 domain between the .sup.10Fn3 domain and the
polypeptide linker.
[0102] Suitable linkers for joining the .sup.10Fn3 domains are
those which allow the separate domains to fold independently of
each other forming a three dimensional structure that permits high
affinity binding to a target molecule. The application provides
that suitable linkers that meet these requirements comprise
glycine-serine based linkers, glycine-proline based linkers,
proline-alanine based linkers as well as the linker SEQ ID NO: 7.
The Examples described in WO 2009/142773 demonstrate that Fn3
domains joined via these linkers retain their target binding
function. In some embodiments, the linker is a glycine-serine based
linker. These linkers comprise glycine and serine residues and may
be between 8 and 50, 10 and 30, and 10 and 20 amino acids in
length. Examples of such linkers include SEQ ID NOs: 8-12. In some
embodiments the polypeptide linker is selected from SEQ ID NOs: 8
and 9. In some embodiments, the linker is a glycine-proline based
linker. These linkers comprise glycine and proline residues and may
be between 3 and 30, 10 and 30, and 3 and 20 amino acids in length.
Examples of such linkers include SEQ ID NOs: 13, 14 and IS. In some
embodiments, the linker is a proline-alanine based linker. These
linkers comprise proline and alanine residues and may be between 3
and 30, 10 and 30, 3 and 20 and 6 and 18 amino acids in length.
Examples of such linkers include SEQ ID NOs: 16, 17 and 18. It is
contemplated, that the optimal linker length and amino acid
composition may be determined by routine experimentation by methods
well known in the art. In some embodiments, the polypeptide linker
is SEQ ID NO: 7. In exemplary embodiments, the linker does not
contain any DK sequences.
Pharmacokinetic Moieties
[0103] In one aspect, the application provides for fibronectin
based scaffold proteins further comprising a pharmacokinetic (PK)
moiety. Pharmokinetics encompasses properties of a compound
including, by way of example, absorption, distribution, metabolism,
and elimination by a subject. Improved pharmacokinetics may be
assessed according to the perceived therapeutic need. Often it is
desirable to increase bioavailability and/or increase the time
between doses, possibly by increasing the time that a protein
remains available in the serum after dosing. In some instances, it
is desirable to improve the continuity of the serum concentration
of the protein over time (e.g., decrease the difference in serum
concentration of the protein shortly after administration and
shortly before the next administration). The fibronectin based
scaffold proteins may be attached to a moiety that reduces the
clearance rate of the polypeptide in a mammal (e.g., mouse, rat, or
human) by greater than three-fold relative to the unmodified
polypeptide. Other measures of improved pharmacokinetics may
include serum half-life, which is often divided into an alpha phase
and a beta phase. Either or both phases may be improved
significantly by addition of an appropriate moiety. A PK moiety
refers to any protein, peptide, or moiety that affects the
pharmacokinetic properties of a biologically active molecule when
fused to the biologically active molecule.
[0104] PK moieties that tend to slow clearance of a protein from
the blood include polyoxyalkylene moieties, e.g., polyethylene
glycol, sugars (e.g., sialic acid), and well-tolerated protein
moieties (e.g., Fc, Fc fragments, transferrin, or serum albumin).
The fibronectin based scaffold proteins may be fused to albumin or
a fragment (portion) or variant of albumin as described in U.S.
Publication No. 20070048282. In some embodiments, the PK moiety is
a serum albumin binding protein such as those described in U.S.
Publication Nos. 2007/0178082 and 2007/0269422. In some
embodiments, the PK moiety is a serum immunoglobulin binding
protein such as those described in U.S. Publication No.
2007/0178082.
[0105] In some embodiments, the fibronectin based scaffold proteins
may be attached to a PK moiety comprising a nonproteinaceous
polymer. In some embodiments, the polymer is polyethylene glycol
("PEG"), polypropylene glycol, or polyoxyalkylenes, as described in
U.S. Pat. Nos. 4,640,835; 4,496,689; 4,301,144; 4,670,417;
4,791,192 or 4,179,337. In exemplary embodiments, the polymer is a
PEG moiety.
[0106] PEG is a well-known, water soluble polymer that is
commercially available or can be prepared by ring-opening
polymerization of ethylene glycol according to methods well known
in the art (Sandler and Karo, Polymer Synthesis, Academic Press,
New York, Vol. 3, pages 138-161). The term "PEG" is used broadly to
encompass any polyethylene glycol molecule, without regard to size
or to modification at an end of the PEG, and can be represented by
the formula; X--O(CH.sub.2CH.sub.2O).sub.n-1CH.sub.2CH.sub.2OH (1),
where n is 20 to 2300 and X is H or a terminal modification, e.g.,
a CM alkyl. In one embodiment, the PEG of the invention terminates
on one end with hydroxy or methoxy, i.e., X is H or CH.sub.3
("methoxy PEG"). A PEG can contain further chemical groups which
are necessary for binding reactions; which results from the
chemical synthesis of the molecule; or which is a spacer for
optimal distance of parts of the molecule. In addition, such a PEG
can consist of one or more PEG side-chains which are linked
together. PEGs with more than one PEG chain are called multiarmed
or branched PEGs. Branched PEGs can be prepared, for example, by
the addition of polyethylene oxide to various polyols, including
glycerol, pentaerythriol, and sorbitol. For example, a four-armed
branched PEG can be prepared from pentaerythriol and ethylene
oxide. Branched PEG are described in, for example, European
Published Application No. 473084A and U.S. Pat. No. 5,932,462. One
form of PEGs includes two PEG side-chains (PEG2) linked via the
primary amino groups of a lysine (Monfardini, C., et al.,
Bioconjugate Chem. 6 (1995) 62-69).
[0107] PEG conjugation to peptides or proteins generally involves
the activation of PEG and coupling of the activated
PEG-intermediates directly to target proteins/peptides or to a
linker, which is subsequently activated and coupled to target
proteins/peptides (see Abuchowski, A. et al, J. Biol. Chem., 252,
3571 (1977) and J. Biol. Chem., 252, 3582 (1977), Zalipsky, et al.,
and Harris et. al., in: Poly(ethylene glycol) Chemistry:
Biotechnical and Biomedical Applications; (J. M. Harris ed.) Plenum
Press: New York, 1992; Chap. 21 and 22). It is noted that a
fibronectin based scaffold protein containing a PEG molecule is
also known as a conjugated protein, whereas the protein lacking an
attached PEG molecule can be referred to as unconjugated.
[0108] The size of PEG utilized will depend on several factors
including the intended use of the fibronectin based scaffold
protein. Larger PEGs are preferred to increase half life in the
body, blood, non-blood extracellular fluids or tissues. For in vivo
cellular activity, PEGs of the range of about 10 to 60 kDa are
preferred, as well as PEGs less than about 100 kDa and more
preferably less than about 60 kDa, though sizes greater than about
100 kDa can be used as well. For in vivo imaging applications,
smaller PEGs, generally less than about 20 kDa, may be used that do
not increase half life as much as larger PEGs so as to permit
quicker distribution and less half life. A variety of molecular
mass forms of PEG can be selected, e.g., from about 1,000 Daltons
(Da) to 100,000 Da (n is 20 to 2300), for conjugating to
fibronectin based scaffold proteins. The number of repeating units
"n" in the PEG is approximated for the molecular mass described in
Daltons. It is preferred that the combined molecular mass of PEG on
an activated linker is suitable for pharmaceutical use. Thus, in
one embodiment, the molecular mass of the PEG molecules does not
exceed 100,000 Da. For example, if three PEG molecules are attached
to a linker, where each PEG molecule has the same molecular mass of
12,000 Da (each n is about 270), then the total molecular mass of
PEG on the linker is about 36,000 Da (total n is about 820). The
molecular masses of the PEG attached to the linker can also be
different, e.g., of three molecules on a linker two PEG molecules
can be 5,000 Da each (each n is about 110) and one PEG molecule can
be 12,000 Da (n is about 270). In some embodiments, one PEG moiety
is conjugated to the fibronectin based scaffold protein. In some
embodiments, the PEG moiety is about 20, 30, 40, 50, 60, 70, 80, or
90 KDa. In some embodiments, the PEG moiety is about 40 KDa.
[0109] In some embodiments, PEGylated fibronectin based scaffold
proteins contain one, two or more PEG moieties. In one embodiment,
the PEG moiety(ies) are bound to an amino acid residue which is on
the surface of the protein and/or away from the surface that
contacts the target ligand. In one embodiment, the combined or
total molecular mass of PEG in a pegylated fibronectin based
scaffold protein is from about 3,000 Da to 60,000 Da, or from about
10,000 Da to 36,000 Da. In a one embodiment, the PEG in a pegylated
fibronectin based scaffold protein is a substantially linear,
straight-chain PEG.
[0110] One skilled in the art can select a suitable molecular mass
for PEG, e.g., based on how the pegylated fibronectin based
scaffold protein will be used therapeutically, the desired dosage,
circulation time, resistance to proteolysis, immunogenicity, and
other considerations. For a discussion of PEG and its use to
enhance the properties of proteins, see N. V. Katre, Advanced Drug
Delivery Reviews 10: 91-114 (1993).
[0111] In some embodiments, a fibronectin based scaffold protein is
covalently linked to one poly(ethylene glycol) group of the
formula: --CO--(CH.sub.2).sub.x--(OCH.sub.2CH.sub.2).sub.m--OR,
with the --CO (i.e. carbonyl) of the poly(ethylene glycol) group
forming an amide bond with one of the amino groups of the binding
polypeptide; R being lower alkyl; x being 2 or 3; m being from
about 450 to about 950; and n and m being chosen so that the
molecular weight of the conjugate minus the binding polypeptide is
from about 10 to 40 kDa. In one embodiment, a fibronectin based
scaffold protein's .epsilon.-amino group of a lysine is the
available (free) amino group.
[0112] In one specific embodiment, carbonate esters of PEG are used
to form the PEG-fibronectin based scaffold protein conjugates.
N,N'-disuccinimidylcarbonate (DSC) may be used in the reaction with
PEG to form active mixed PEG-succinimidyl carbonate that may be
subsequently reacted with a nucleophilic group of a linker or an
amino group of a fibronectin based scaffold protein (see U.S. Pat.
Nos. 5,281,698 and 5,932,462). In a similar type of reaction,
1,1'-(dibenzotriazolyl)carbonate and di-(2-pyridyl)carbonate may be
reacted with PEG to form PEG-benzotriazolyl and PEG-pyridyl mixed
carbonate (U.S. Pat. No. 5,382,657), respectively.
[0113] Pegylation of a fibronectin based scaffold protein can be
performed according to the methods of the state of the art, for
example by reaction of the fibronectin based scaffold protein with
electrophilically active PEGs (supplier: Shearwater Corp., USA,
world wide web at shearwatercorp.com). Preferred PEG reagents of
the present invention are, e.g., N-hydroxysuccinimidyl propionates
(PEG-SPA), butanoates (PEG-SBA), PEG-succinimidyl propionate or
branched N-hydroxysuccinimides such as mPEG2-NHS (Monfardini, C.,
et al., Bioconjugate Chem. 6 (1995) 62-69). Such methods may used
to pegylate at an .epsilon.-amino group of a lysine of a
fibronectin based scaffold protein or at the N-terminal amino group
of the fibronectin based scaffold protein.
[0114] In another embodiment, PEG molecules may be coupled to
sulfhydryl groups on a fibronectin based scaffold protein (Sartore,
L., et al., Appl. Biochem. Biotechnol., 27, 45 (1991); Morpurgo et
al., Biocon. Chem., 7, 363-368 (1996); Goodson et al.,
Bio/Technology (1990) 8, 343; U.S. Pat. No. 5,766,897). U.S. Pat.
Nos. 6,610,281 and 5,766,897 describes exemplary reactive PEG
species that may be coupled to sulfhydryl groups.
[0115] In some embodiments, the pegylated fibronectin based
scaffold protein is produced by site-directed pegylation,
particularly by conjugation of PEG to a cysteine moiety. In certain
embodiments, the Cys residue may be positioned at the N-terminus,
between the N-terminus and the most N-terminal beta or beta-like
strand, at the C-terminus, or between the C-terminus and the most
C-terminal beta or beta-like strand of the fibronectin based
scaffold protein. In certain embodiments, the fibronectin based
scaffold protein is a dimer and the Cys residue may be positioned
at the N-terminus, between the N-terminus and the most N-terminal
beta or beta-like strand, at the C-terminus, or between the
C-terminus and the most C-terminal beta or beta-like strand of
either binding domain of the fibronectin based scaffold protein
dimer. In certain embodiments, the Cys residue may be positioned at
the N-terminus of the fibronectin based scaffold protein dimer,
between the N-terminus and the most N-terminal beta or beta-like
strand of the fibronectin based scaffold protein dimer (i.e., of
the N-terminal binding domain of the fibronectin based scaffold
protein dimer), or at the C-terminus of the fibronectin based
scaffold protein dimer, or between the C-terminus and the most
C-terminal beta or beta-like strand of the fibronectin based
scaffold protein dimer (i.e., of the C-terminal binding domain of
the fibronectin based scaffold protein dimer). A Cys residue may be
situated at other positions as well, particularly any of the loops
that do not participate in target binding or between two binding
domains of a multivalent fibronectin based scaffold protein. A PEG
moiety may also be attached by other chemistry, including by
conjugation to amines.
[0116] In some embodiments where PEG molecules are conjugated to
cysteine residues on a fibronectin based scaffold protein, the
cysteine residues are native to the fibronectin based scaffold
protein, whereas in other embodiments, one or more cysteine
residues are engineered into the fibronectin based scaffold
protein. Mutations may be introduced into a fibronectin based
scaffold protein coding sequence to generate cysteine residues.
This might be achieved, for example, by mutating one or more amino
acid residues to cysteine. Preferred amino acids for mutating to a
cysteine residue include serine, threonine, alanine and other
hydrophilic residues. Preferably, the residue to be mutated to
cysteine is a surface-exposed residue. Algorithms are well-known in
the art for predicting surface accessibility of residues based on
primary sequence or a protein. Alternatively, surface residues may
be predicted by comparing the amino acid sequences of fibronectin
based scaffold proteins, given that the crystal structure of the
tenth fn3 domain framework based on which fibronectin based
scaffold proteins are designed has been solved (see Dickinson, et
al., J. Mol. Biol. 236(4): 1079-92 (1994)) and thus the
surface-exposed residues identified. In one embodiment, cysteine
residues are introduced into fibronectin based scaffold protein at
or near the N- and/or C-terminus, or within loop regions.
Pegylation of cysteine residues may be carried out using, for
example, PEG-maleimide, PEG-vinylsulfone, PEG-iodoacetamide, or
PEG-orthopyridyl disulfide.
[0117] In some embodiments, the pegylated fibronectin based
scaffold protein comprises a PEG molecule covalently attached to
the alpha amino group of the N-terminal amino acid. Site specific
N-terminal reductive animation is described in Pepinsky et al.,
(2001) JPET, 297,1059, and U.S. Pat. No. 5,824,784. The use of a
PEG-aldehyde for the reductive animation of a protein utilizing
other available nucleophilic amino groups is described in U.S. Pat.
No. 4,002,531, in Wieder et al., (1979) J. Biol. Chem. 254,12579,
and in Chamow et al., (1994) Bioconjugate Chem. 5, 133.
[0118] In another embodiment, pegylated fibronectin based scaffold
proteins comprise one or more PEG molecules covalently attached to
a linker, which in turn is attached to the alpha amino group of the
amino acid residue at the N-terminus of the fibronectin based
scaffold protein. Such an approach is disclosed in U.S. Publication
No. 2002/0044921 and PCT Publication No.
[0119] In one embodiment, a fibronectin based scaffold protein is
pegylated at the C-terminus. In a specific embodiment, a protein is
pegylated at the C-terminus by the introduction of C-terminal
azido-methionine and the subsequent conjugation of a
methyl-PEG-triarylphosphine compound via the Staudinger reaction.
This C-terminal conjugation method is described in Cazalis et al.,
C-Terminal Site-Specific PEGylation of a Truncated Thrombomodulin
Mutant with Retention of Full Bioactivity, Bioconjug Chem. 2004;
15(5): 1005-1009.
[0120] In exemplary embodiments, a fibronectin based scaffold
protein is pegylated in a C-terminal tail region as described
further herein. Exemplary C-terminal tails include, for example, a
polypeptide having any one of SEQ ID NOs: 5, 6 or 35.
[0121] Conventional separation and purification techniques known in
the art can be used to purify PEGylated fibronectin based scaffold
proteins, such as size exclusion (e.g., gel filtration) and ion
exchange chromatography. Products may also be separated using
SDS-PAGE. Products that may be separated include mono-, di-, tri-
poly- and un-pegylated fibronectin based scaffold proteins, as well
as free PEG. The percentage of mono-PEG conjugates can be
controlled by pooling broader fractions around the elution peak to
increase the percentage of mono-PEG in the composition. About
ninety percent mono-PEG conjugates represents a good balance of
yield and activity. Compositions in which, for example, at least
ninety-two percent or at least ninety-six percent of the conjugates
are mono-PEG species may be desired. In an embodiment of this
invention the percentage of mono-PEG conjugates is from ninety
percent to ninety-six percent.
[0122] In one embodiment of the invention, the PEG in a pegylated
fibronectin based scaffold protein is not hydrolyzed from the
pegylated amino acid residue using a hydroxylamine assay, e.g., 450
mM hydroxylamine (pH 6.5) over 8 to 16 hours at room temperature,
and is thus stable. In one embodiment, greater than 80% of the
composition is stable mono-PEG-fibronectin based scaffold protein,
more preferably at least 90%, and most preferably at least 95%.
[0123] In another embodiment, the pegylated fibronectin based
scaffold proteins will preferably retain at least about 25%, 50%,
60%, 70%, 80%, 85%, 90%, 95% or 100% of the biological activity
associated with the unmodified protein. In one embodiment,
biological activity refers to its ability to bind to one or more
target molecules, as assessed by K.sub.D, k.sub.on or k.sub.off. In
one specific embodiment, the pegylated fibronectin based scaffold
protein shows an increase in binding to one or more target
molecules relative to unpegylated fibronectin based scaffold
protein.
[0124] The serum clearance rate of PEG-modified fibronectin based
scaffold proteins may be decreased by about 10%, 20%, 30%, 40%,
50%, 60%, 70%, 80%, or even 90%, relative to the clearance rate of
the unmodified fibronectin based scaffold protein. The PEG-modified
fibronectin based scaffold protein may have a half-life (t.sub.1/2)
which is enhanced relative to the half-life of the unmodified
fibronectin based scaffold protein. The half-life of PEG-modified
fibronectin based scaffold protein may be enhanced by at least 10%,
20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 175%,
200%, 250%, 300%, 400% or 500%, or even by 1000% relative to the
half-life of the unmodified fibronectin based scaffold protein. In
some embodiments, the protein half-life is determined in vitro,
such as in a buffered saline solution or in serum. In other
embodiments, the protein half-life is an in vivo half life, such as
the half-life of the fibronectin based scaffold protein in the
serum or other bodily fluid of an animal.
Nucleic Acid-Protein Fusion Technology
[0125] In one aspect, the application provides fibronectin based
scaffold proteins comprising a fibronectin type III domain that
bind a human target, such as, for example, TNF-alpha, EGFR, VEGFR2,
IGF-IR, or other proteins. One way to rapidly make and test Fn3
domains with specific binding properties is the nucleic
acid-protein fusion technology of Adnexus, a Bristol-Myers Squibb
Company. Such in vitro expression and tagging technology, termed
PROfusion.TM., that exploits nucleic acid-protein fusions (RNA- and
DNA-protein fusions) may be used to identify novel polypeptides and
amino acid motifs that are important for binding to proteins.
Nucleic acid-protein fusion technology is a technology that
covalently couples a protein to its encoding genetic information.
For a detailed description of the RNA-protein fusion technology and
fibronectin-based scaffold protein library screening methods see
Szostak et al., U.S. Pat. Nos. 6,258,558; 6,261,804; 6,214,553;
6,281,344; 6,207,446; 6,518,018; PCT Publication Nos. WO00/34784;
WO01/64942; WO02/032925; and Roberts and Szostak, Proc Natl. Acad.
Sci. 94:12297-12302, 1997, herein incorporated by reference.
Vectors & Polynucleotides
[0126] Nucleic acids encoding any of the various fibronectin based
scaffold proteins disclosed herein may be synthesized chemically,
enzymatically or recombinantly. Codon usage may be selected so as
to improve expression in a cell. Such codon usage will depend on
the cell type selected. Specialized codon usage patterns have been
developed for E. coli and other bacteria, as well as mammalian
cells, plant cells, yeast cells and insect cells. See for example:
Mayfield et al., Proc Natl Acad Sci USA. 2003 Jan. 21;
100(2):438-42; Sinclair et al. Protein Expr Purif. 2002 October;
26(1):96-105; Connell N D. Curr Opin Biotechnol. 2001 October;
12(5):446-9; Makrides et al. Microbiol Rev. 1996 September;
60(3):512-38; and Sharp et al. Yeast. 1991 October;
7(7):657-78.
[0127] General techniques for nucleic acid manipulation are
described for example in Sambrook et al., Molecular Cloning: A
Laboratory Manual, Vols. 1-3, Cold Spring Harbor Laboratory Press,
2 ed., 1989, or F. Ausubel et al., Current Protocols in Molecular
Biology (Green Publishing and Wiley-Interscience: New York, 1987)
and periodic updates, herein incorporated by reference. The DNA
encoding the polypeptide is operably linked to suitable
transcriptional or translational regulatory elements derived from
mammalian, viral, or insect genes. Such regulatory elements include
a transcriptional promoter, an optional operator sequence to
control transcription, a sequence encoding suitable mRNA ribosomal
binding sites, and sequences that control the termination of
transcription and translation. The ability to replicate in a host,
usually conferred by an origin of replication, and a selection gene
to facilitate recognition of transformants are additionally
incorporated.
[0128] The fibronectin based scaffold proteins described herein may
be produced recombinantly not only directly, but also as a fusion
polypeptide with a heterologous polypeptide, which is preferably a
signal sequence or other polypeptide having a specific cleavage
site at the N-terminus of the mature protein or polypeptide. The
heterologous signal sequence selected preferably is one that is
recognized and processed (i.e., cleaved by a signal peptidase) by
the host cell. For prokaryotic host cells that do not recognize and
process a native signal sequence, the signal sequence is
substituted by a prokaryotic signal sequence selected, for example,
from the group of the alkaline phosphatase, penicillinase, lpp, or
heat-stable enterotoxin II leaders. For yeast secretion the native
signal sequence may be substituted by, e.g., the yeast invertase
leader, a factor leader (including Saccharomyces and Kluyveromyces
alpha-factor leaders), or acid phosphatase leader, the C. albicans
glucoamylase leader, or the signal described in PCT Publication No.
WO90/13646. In mammalian cell expression, mammalian signal
sequences as well as viral secretory leaders, for example, the
herpes simplex gD signal, are available. The DNA for such precursor
regions may be ligated in reading frame to DNA encoding the
protein.
[0129] Both expression and cloning vectors contain a nucleic acid
sequence that enables the vector to replicate in one or more
selected host cells. Generally, in cloning vectors this sequence is
one that enables the vector to replicate independently of the host
chromosomal DNA, and includes origins of replication or
autonomously replicating sequences. Such sequences are well known
for a variety of bacteria, yeast, and viruses. The origin of
replication from the plasmid pBR322 is suitable for most
Gram-negative bacteria, the 2 micron plasmid origin is suitable for
yeast, and various viral origins (SV40, polyoma, adenovirus, VSV or
BPV) are useful for cloning vectors in mammalian cells. Generally,
the origin of replication component is not needed for mammalian
expression vectors (the SV40 origin may typically be used only
because it contains the early promoter).
[0130] Expression and cloning vectors may contain a selection gene,
also termed a selectable marker. Typical selection genes encode
proteins that (a) confer resistance to antibiotics or other toxins,
e.g., ampicillin, neomycin, methotrexate, or tetracycline, (b)
complement auxotrophic deficiencies, or (c) supply critical
nutrients not available from complex media, e.g., the gene encoding
D-alanine racemase for Bacilli.
[0131] A suitable selection gene for use in yeast is the trp 1 gene
present in the yeast plasmid YRp7 (Stinchcomb et al., Nature,
282:39 (1979)). The trp1 gene provides a selection marker for a
mutant strain of yeast lacking the ability to grow in tryptophan,
for example, ATCC No. 44076 or PEP4-1. Jones, Genetics, 85:12
(1977). The presence of the trp1 lesion in the yeast host cell
genome then provides an effective environment for detecting
transformation by growth in the absence of tryptophan. Similarly,
Leu2-deficient yeast strains (ATCC 20,622 or 38,626) are
complemented by known plasmids bearing the Leu2 gene.
[0132] Expression and cloning vectors usually contain a promoter
that is recognized by the host organism and is operably linked to
the nucleic acid encoding the fibronectin-based scaffold protein.
Promoters suitable for use with prokaryotic hosts include the phoA
promoter, beta-lactamase and lactose promoter systems, alkaline
phosphatase, a tryptophan (trp) promoter system, and hybrid
promoters such as the tac promoter. However, other known bacterial
promoters are suitable. Promoters for use in bacterial systems also
will contain a Shine-Dalgarno (S.D.) sequence operably linked to
the DNA encoding the fibronectin based scaffold protein.
[0133] Promoter sequences are known for eukaryotes. Virtually all
eukaryotic genes have an AT-rich region located approximately 25 to
30 bases upstream from the site where transcription is initiated.
Another sequence found 70 to 80 bases upstream from the start of
transcription of many genes is a CNCAAT region where N may be any
nucleotide. At the 3' end of most eukaryotic genes is an AATAAA
sequence that may be the signal for addition of the poly A tail to
the 3' end of the coding sequence. All of these sequences are
suitably inserted into eukaryotic expression vectors.
[0134] Examples of suitable promoting sequences for use with yeast
hosts include the promoters for 3-phosphoglycerate kinase or other
glycolytic enzymes, such as enolase, glyceraldehyde-3-phosphate
dehydrogenase, hexokinase, pyruvate decarboxylase,
phosphofructokinase, glucose-6-phosphate isomerase,
3-phosphoglycerate mutase, pyruvate kinase, triosephosphate
isomerase, phosphoglucose isomerase, and glucokinase.
[0135] Other yeast promoters, which are inducible promoters having
the additional advantage of transcription controlled by growth
conditions, are the promoter regions for alcohol dehydrogenase 2,
isocytochrome C, acid phosphatase, degradative enzymes associated
with nitrogen metabolism, metallothionein,
glyceraldehyde-3-phosphate dehydrogenase, and enzymes responsible
for maltose and galactose utilization. Suitable vectors and
promoters for use in yeast expression are further described in EP
Patent Publication No. 73,657. Yeast enhancers also are
advantageously used with yeast promoters.
[0136] Transcription from vectors in mammalian host cells can be
controlled, for example, by promoters obtained from the genomes of
viruses such as polyoma virus, fowlpox virus, adenovirus (such as
Adenovirus 2), bovine papilloma virus, avian sarcoma virus,
cytomegalovirus, a retrovirus, hepatitis-B virus and most
preferably Simian Virus 40 (SV40), from heterologous mammalian
promoters, e.g., the actin promoter or an immunoglobulin promoter,
from heat-shock promoters, provided such promoters are compatible
with the host cell systems.
[0137] The early and late promoters of the SV40 virus are
conveniently obtained as an SV40 restriction fragment that also
contains the SV40 viral origin of replication. The immediate early
promoter of the human cytomegalovirus is conveniently obtained as a
HindIII E restriction fragment. A system for expressing DNA in
mammalian hosts using the bovine papilloma virus as a vector is
disclosed in U.S. Pat. No. 4,419,446. A modification of this system
is described in U.S. Pat. No. 4,601,978. See also Reyes et al.,
Nature 297:598-601 (1982) on expression of human .beta.-interferon
cDNA in mouse cells under the control of a thymidine kinase
promoter from herpes simplex virus. Alternatively, the rous sarcoma
virus long terminal repeat can be used as the promoter.
[0138] Transcription of a DNA encoding fibronectin based scaffold
proteins by higher eukaryotes is often increased by inserting an
enhancer sequence into the vector. Many enhancer sequences are now
known from mammalian genes (globin, elastase, albumin,
.alpha.-fetoprotein, and insulin). Typically, however, one will use
an enhancer from a eukaryotic cell virus. Examples include the SV40
enhancer on the late side of the replication origin (bp 100-270),
the cytomegalovirus early promoter enhancer, the polyoma enhancer
on the late side of the replication origin, and adenovirus
enhancers. See also Yaniv, Nature 297:17-18 (1982) on enhancing
elements for activation of eukaryotic promoters. The enhancer may
be spliced into the vector at a position 5' or 3' to the
polypeptide-encoding sequence, but is preferably located at a site
5' from the promoter.
[0139] Expression vectors used in eukaryotic host cells (e.g.,
yeast, fungi, insect, plant, animal, human, or nucleated cells from
other multicellular organisms) will also contain sequences
necessary for the termination of transcription and for stabilizing
the mRNA. Such sequences are commonly available from the 5' and,
occasionally 3', untranslated regions of eukaryotic or viral DNAs
or cDNAs. These regions contain nucleotide segments transcribed as
polyadenylated fragments in the untranslated portion of the mRNA
encoding the polypeptide. One useful transcription termination
component is the bovine growth hormone polyadenylation region. See
WO94/11026 and the expression vector disclosed therein.
[0140] The recombinant DNA can also include any type of protein tag
sequence that may be useful for purifying the fibronectin based
scaffold protein. Examples of protein tags include but are not
limited to a histidine tag, a FLAG tag, a myc tag, an HA tag, or a
GST tag. Appropriate cloning and expression vectors for use with
bacterial, fungal, yeast, and mammalian cellular hosts can be found
in Cloning Vectors: A Laboratory Manual, (Elsevier, New York,
1985), the relevant disclosure of which is hereby incorporated by
reference.
[0141] The expression construct is introduced into the host cell
using a method appropriate to the host cell, as will be apparent to
one of skill in the art. A variety of methods for introducing
nucleic acids into host cells are known in the art, including, but
not limited to, electroporation; transfection employing calcium
chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or
other substances; microprojectile bombardment; lipofection; and
infection (where the vector is an infectious agent).
[0142] Suitable host cells include prokaryotes, yeast, mammalian
cells, or bacterial cells. Suitable bacteria include gram negative
or gram positive organisms, for example, E. coli or Bacillus spp.
Yeast, preferably from the Saccharomyces species, such as S.
cerevisiae, may also be used for production of polypeptides.
Various mammalian or insect cell culture systems can also be
employed to express recombinant proteins. Baculovirus systems for
production of heterologous proteins in insect cells are reviewed by
Luckow and Summers, (Bio/Technology, 6:47, 1988). Examples of
suitable mammalian host cell lines include endothelial cells, COS-7
monkey kidney cells, CV-1, L cells, C127, 3T3, Chinese hamster
ovary (CHO), human embryonic kidney cells, HeLa, 293, 293T, and BHK
cell lines. Purified fibronectin based scaffold proteins are
prepared by culturing suitable host/vector systems to express the
recombinant proteins. For many applications, the small size of the
fibronectin based scaffold proteins would make expression in E.
coli the preferred method for expression. The fibronectin based
scaffold protein is then purified from culture media or cell
extracts.
Protein Production
[0143] Host cells are transformed with the herein-described
expression or cloning vectors for protein production and cultured
in conventional nutrient media modified as appropriate for inducing
promoters, selecting transformants, or amplifying the genes
encoding the desired sequences.
[0144] The host cells used to produce the fibronectin based
scaffold proteins may be cultured in a variety of media.
Commercially available media such as Ham's F10 (Sigma), Minimal
Essential Medium ((MEM), (Sigma)), RPMI-1640 (Sigma), and
Dulbecco's Modified Eagle's Medium ((DMEM), (Sigma)) are suitable
for culturing the host cells. In addition, any of the media
described in Ham et al., Meth. Enz. 58:44 (1979), Barnes et al.,
Anal. Biochem. 102:255 (1980), U.S. Pat. Nos. 4,767,704; 4,657,866;
4,927,762; 4,560,655; or 5,122,469; WO90/03430; WO87/00195; or U.S.
Pat. No. Re. 30,985 may be used as culture media for the host
cells. Any of these media may be supplemented as necessary with
hormones and/or other growth factors (such as insulin, transferrin,
or epidermal growth factor), salts (such as sodium chloride,
calcium, magnesium, and phosphate), buffers (such as HEPES),
nucleotides (such as adenosine and thymidine), antibiotics (such as
GENTAMYCIN.TM. drug), trace elements (defined as inorganic
compounds usually present at final concentrations in the micromolar
range), and glucose or an equivalent energy source. Any other
necessary supplements may also be included at appropriate
concentrations that would be known to those skilled in the art. The
culture conditions, such as temperature, pH, and the like, are
those previously used with the host cell selected for expression,
and will be apparent to the ordinarily skilled artisan.
[0145] Fibronectin based scaffold proteins disclosed herein can
also be produced using cell-free translation systems. For such
purposes the nucleic acids encoding the fibronectin based scaffold
protein must be modified to allow in vitro transcription to produce
mRNA and to allow cell-free translation of the mRNA in the
particular cell-free system being utilized (eukaryotic such as a
mammalian or yeast cell-free translation system or prokaryotic such
as a bacterial cell-free translation system).
[0146] Fibronectin based scaffold proteins can also be produced by
chemical synthesis (e.g., by the methods described in Solid Phase
Peptide Synthesis, 2nd ed., 1984, The Pierce Chemical Co.,
Rockford, Ill.). Modifications to the fibronectin based scaffold
protein can also be produced by chemical synthesis.
[0147] The fibronectin based scaffold proteins disclosed herein can
be purified by isolation/purification methods for proteins
generally known in the field of protein chemistry. Non-limiting
examples include extraction, recrystallization, salting out (e.g.,
with ammonium sulfate or sodium sulfate), centrifugation, dialysis,
ultrafiltration, adsorption chromatography, ion exchange
chromatography, hydrophobic chromatography, normal phase
chromatography, reversed-phase chromatography, gel filtration, gel
permeation chromatography, affinity chromatography,
electrophoresis, countercurrent distribution or any combinations of
these. After purification, fibronectin based scaffold proteins may
be exchanged into different buffers and/or concentrated by any of a
variety of methods known to the art, including, but not limited to,
filtration and dialysis.
[0148] The purified fibronectin based scaffold protein is
preferably at least 85% pure, more preferably at least 95% pure,
and most preferably at least 98% pure. Regardless of the exact
numerical value of the purity, the fibronectin based scaffold
protein is sufficiently pure for use as a pharmaceutical
product.
Exemplary Uses
[0149] In one aspect, the application provides fibronectin based
scaffold proteins labeled with a detectable moiety. The fibronectin
based scaffold proteins may be used for a variety of diagnostic
applications. The detectable moiety can be any one which is capable
of producing, either directly or indirectly, a detectable signal.
For example, the detectable moiety may be a radioisotope, such as
H3, C14, C13, P32, S35, or I131; a fluorescent or chemiluminescent
compound, such as fluorescein isothiocyanate, rhodamine, or
luciferin; or an enzyme, such as alkaline phosphatase,
beta-galactosidase or horseradish peroxidase.
[0150] Any method known in the art for conjugating a protein to the
detectable moiety may be employed, including those methods
described by Hunter, et al., Nature 144:945 (1962); David, et al.,
Biochemistry 13:1014 (1974); Pain, et al., J. Immunol. Meth. 40:219
(1981); and Nygren, J. Histochem. and Cytochem. 30:407 (1982). In
vitro methods, include conjugation chemistry well know in the art
including chemistry compatible with proteins, such as chemistry for
specific amino acids, such as Cys and Lys. In order to link a
detectable moiety to a fibronectin based scaffold protein, a
linking group or reactive group is used. Suitable linking groups
are well known in the art and include disulfide groups, thioether
groups, acid labile groups, photolabile groups, peptidase labile
groups and esterase labile groups. Preferred linking groups are
disulfide groups and thioether groups depending on the application.
For polypeptides without a Cys amino acid, a Cys can be engineered
in a location to allow for activity of the protein to exist while
creating a location for conjugation.
[0151] Fibronectin based scaffold proteins linked with a detectable
moiety also are useful for in vivo imaging. The polypeptide may be
linked to a radio-opaque agent or radioisotope, administered to a
subject, preferably into the bloodstream, and the presence and
location of the labeled protein in the subject is assayed. This
imaging technique is useful, for example, in the staging and
treatment of malignancies when the fibronectin based scaffold
protein binds to a target associated with cancer. The fibronectin
based scaffold protein may be labeled with any moiety that is
detectable in a subject, whether by nuclear magnetic resonance,
radiology, or other detection means known in the art.
[0152] Fibronectin based scaffold proteins also are useful as
affinity purification agents. In this process, the fibronectin
based scaffold proteins are immobilized on a suitable support, such
a Sephadex resin or filter paper, using methods well known in the
art.
[0153] Fibronectin based scaffold proteins can be employed in any
known assay method, such as competitive binding assays, direct and
indirect sandwich assays, and immunoprecipitation assays (Zola,
Monoclonal Antibodies: A Manual of Techniques, pp. 147-158 (CRC
Press, Inc., 1987)).
[0154] In certain aspects, the disclosure provides methods for
detecting a target molecule in a sample, such as VEGFR2, IGF-IR or
EGFR. A method may comprise contacting the sample with a
fibronectin based scaffold protein described herein, wherein said
contacting is carried out under conditions that allow fibronectin
based scaffold protein-target complex formation; and detecting said
complex, thereby detecting said target in said sample. Detection
may be carried out using any technique known in the art, such as,
for example, radiography, immunological assay, fluorescence
detection, mass spectroscopy, or surface plasmon resonance. The
sample will often be a biological sample, such as a biopsy, and
particularly a biopsy of a tumor, a suspected tumor. The sample may
be from a human or other mammal. The fibronectin based scaffold
protein may be labeled with a labeling moiety, such as a
radioactive moiety, a fluorescent moiety, a chromogenic moiety, a
chemiluminescent moiety, or a hapten moiety. The fibronectin based
scaffold protein may be immobilized on a solid support.
[0155] In one aspect, the application provides fibronectin based
scaffold proteins useful in the treatment of disorders. The
diseases or disorders that may be treated will be dictated by the
binding specificity of the fibronectin based scaffold protein. The
application also provides methods for administering fibronectin
based scaffold proteins to a subject. In some embodiments, the
subject is a human. In some embodiments, the fibronectin based
scaffold proteins are pharmaceutically acceptable to a mammal, in
particular a human. A "pharmaceutically acceptable" polypeptide
refers to a polypeptide that is administered to an animal without
significant adverse medical consequences. Examples of
pharmaceutically acceptable fibronectin based scaffold proteins
include .sup.10Fn3 domains that lack the integrin-binding domain
(RGD) and .sup.10Fn3 domains that are essentially endotoxin or
pyrogen free or have very low endotoxin or pyrogen levels.
[0156] In certain embodiments, fibronectin based scaffold proteins,
in particular fibronectin based scaffold proteins that bind to
IGF-IR, VEGFR2 and/or EGFR, are useful in treating disorders such
as cancer. In certain embodiments, the fibronectin based scaffold
proteins are useful in treating cancers associated with IGF-IR,
VEGFR2 and/or EGFR mutations or expression levels. In some
embodiments, administration of a fibronectin based scaffold protein
treats an antiproliferative disorder in a subject. In some
embodiments, administration of a fibronectin based scaffold protein
inhibits tumor cell growth in vivo. The tumor cell may be derived
from any cell type including, without limitation, epidermal,
epithelial, endothelial, leukemia, sarcoma, multiple myeloma, or
mesodermal cells. Examples of common tumor cell lines for use in
xenograft tumor studies include A549 (non-small cell lung
carcinoma) cells, DU-145 (prostate) cells, MCF-7 (breast) cells,
Colo 205 (colon) cells, 3T3/IGF-IR (mouse fibroblast) cells, NCI
H441 cells, HEP G2 (hepatoma) cells, MDA MB 231 (breast) cells,
HT-29 (colon) cells, MDA-MB-435s (breast) cells, U266 cells,
SH-SY5Y cells, Sk-Mel-2 cells, NCI-H929, RPM18226, and A431 cells.
In some embodiments, the fibronectin based scaffold protein
inhibits tumor cell growth relative to the growth of the tumor in
an untreated animal. In some embodiments, the fibronectin based
scaffold protein inhibits tumor cell growth by 50, 60, 70, 80% or
more relative to the growth of the tumor in an untreated animal. In
some embodiments, the inhibition of tumor cell growth is measured
at least 7 days or at least 14 days after the animals have started
treatment with the fibronectin based scaffold protein. In some
embodiments, another antineoplastic agent is administered to the
animal with the fibronectin based scaffold protein.
[0157] In certain aspects, the disclosure provides methods for
administering fibronectin based scaffold protein for the treatment
and/or prophylaxis of tumors and/or tumor metastases, where the
tumor is selected from the group consisting of brain tumor, tumor
of the urogenital tract, tumor of the lymphatic system, stomach
tumor, laryngeal tumor, monocytic leukemia, lung adenocarcinoma,
small-cell lung carcinoma, pancreatic cancer, glioblastoma and
breast carcinoma, without being restricted thereto.
[0158] In certain aspects, the disclosure provides methods for
administering fibronectin based scaffold proteins for the treatment
of cancerous diseases selected from the group consisting of
squamous cell carcinoma, bladder cancer, stomach cancer, liver
cancer, kidney cancer, colorectal cancer, breast cancer, head
cancer, neck cancer, oesophageal cancer, gynecological cancer,
thyroid cancer, lymphoma, chronic leukemia and acute leukemia.
[0159] In other embodiments, a fibronectin based scaffold protein
binds to a target involved in inflammatory response and/or
autoimmune disorders, such as, for example, tumor necrosis factor
(TNF) alpha. Such fibronectin based scaffold proteins may be useful
for treating autoimmune disorders such as rheumatoid arthritis,
ankylosing spondylitis, Crohn's disease, psoriasis and refractory
asthma.
Formulation and Administration
[0160] The application further provides pharmaceutically acceptable
compositions comprising the fibronectin based scaffold proteins
described herein, wherein the composition is essentially endotoxin
or pyrogen free.
[0161] Therapeutic formulations comprising fibronectin based
scaffold proteins are prepared for storage by mixing the described
proteins having the desired degree of purity with optional
physiologically acceptable carriers, excipients or stabilizers
(Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed.
(1980)), in the form of aqueous solutions, lyophilized or other
dried formulations. Acceptable carriers, excipients, or stabilizers
are nontoxic to recipients at the dosages and concentrations
employed, and include buffers such as phosphate, citrate, and other
organic acids; antioxidants including ascorbic acid and methionine;
preservatives (such as octadecyidimethylbenzyl ammonium chloride;
hexamethonium chloride; benzalkonium chloride, benzethonium
chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as
methyl or propyl paraben; catechol; resorcinol; cyclohexanol;
3-pentanol; and m-cresol); low molecular weight (less than about 10
residues) polypeptides; proteins, such as serum albumin, gelatin,
or immunoglobulins; hydrophilic polymers such as
polyvinylpyrrolidone; amino acids such as glycine, glutamine,
asparagine, histidine, arginine, or lysine; monosaccharides,
disaccharides, and other carbohydrates including glucose, mannose,
or dextrans; chelating agents such as EDTA; sugars such as sucrose,
mannitol, trehalose or sorbitol; salt-forming counter-ions such as
sodium; metal complexes (e.g., Zn-protein complexes); and/or
non-ionic surfactants such as TWEEN.TM., PLURONICS.TM. or
polyethylene glycol (PEG).
[0162] The formulations herein may also contain more than one
active compound as necessary for the particular indication being
treated, preferably those with complementary activities that do not
adversely affect each other. Such molecules are suitably present in
combination in amounts that are effective for the purpose
intended.
[0163] The fibronectin based scaffold proteins may also be
entrapped in microcapsule prepared, for example, by coacervation
techniques or by interfacial polymerization, for example,
hydroxymethylcellulose or gelatin-microcapsule and
poly-(methylmethacylate) microcapsule, respectively, in colloidal
drug delivery systems (for example, liposomes, albumin
microspheres, microemulsions, nano-particles and nanocapsules) or
in macroemulsions. Such techniques are disclosed in Remington's
Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980).
[0164] In certain embodiments, the application provides stable
compositions of fibronectin based scaffold proteins having a pH of
4.0-6.5. In other embodiments, the application provides stable
compositions of fibronectin based scaffold proteins having a pH of
4.0-5.5. In other embodiments, the application provides stable
compositions of fibronectin based scaffold proteins having a pH of
5.5. In other embodiments, the application provides stable
compositions of fibronectin based scaffold proteins having a pH of
4.0. In particular, the application provides stable compositions of
fibronectin based scaffold proteins that have reduced fragmentation
and/or low levels of aggregation during storage in solution. As
demonstrated in the exemplification section, the fibronectin based
scaffold proteins described herein having increased stability at pH
4.0 while at the same time exhibition decreased levels of
aggregation at pH 4.0 as compared to a pH of 5.5. Such stable,
soluble formulations having a pH of 4.0 are particularly suitable
for intravenous administration. In some embodiments, the protein
concentration in such stable formulations is at least 3 mg/mL. In
exemplary embodiments, the protein concentration in such stable
formulations is at least 5 mg/mL. In certain embodiments, the
protein concentration in such stable formulations ranges from 3-10
mg/mL, 3-8 mg/mL, 3-6 mg/mL, 3-5 mg/mL, 4-10 mg/mL, 4-8 mg/mL, 4-6
mg/mL, 5-10 mg/mL, 5-8 mg/mL, or 5-6 mg/mL. In exemplary
embodiments, the stable formulations of fibronectin based scaffold
proteins have reduced aggregation relative to an equivalent
formulation of a fibronectin based scaffold protein at a higher pH.
For example, the stable formulations may exhibit at least 10%, 20%,
30%, 40%, 50%, 60%, 70%, 75%, 80%, or less aggregation during
storage in solution for 4 weeks at pH 4.0 relative to the level of
aggregation seen during storage of the fibronectin based scaffold
protein during storage for 4 weeks at pH 5.5 or higher. In certain
embodiments, the stable formulations of fibronectin based scaffold
proteins have less than 10%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or
less aggregates after storage at 25.degree. C. for at least 4
weeks. In certain embodiments, the stable formulations of
fibronectin based scaffold proteins have less than 7%, 6%, 5%, 4%,
3.5%, 3%, 2% or less fragmentation upon storage in solution for
four weeks at pH 4.0 and 25.degree. C. In certain embodiments, the
stable formulations of fibronectin based scaffold proteins have
less than 5% fragmentation and less than 5% aggregation during
storage in solution at 25.degree. C. for at least 4 weeks. In
exemplary embodiments, the stable formulations of fibronectin based
scaffold proteins have less than 4% fragmentation and less than 4%
aggregation during storage in solution at 25.degree. C. for at
least 4 weeks.
[0165] The formulations to be used for in vivo administration must
be sterile. This is readily accomplished by filtration through
sterile filtration membranes.
[0166] Sustained-release preparations may be prepared. Suitable
examples of sustained-release preparations include semipermeable
matrices of solid hydrophobic polymers containing the fibronectin
based scaffold proteins described herein, which matrices are in the
form of shaped articles, e.g., films, or microcapsule. Examples of
sustained-release matrices include polyesters, hydrogels (for
example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)),
polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic
acid and y ethyl-L-glutamate, non-degradable ethylene-vinyl
acetate, degradable lactic acid-glycolic acid copolymers such as
the LUPRON DEPOT.TM. (injectable microspheres composed of lactic
acid-glycolic acid copolymer and leuprolide acetate), and
poly-D-(-)-3-hydroxybutyric acid. While polymers such as
ethylene-vinyl acetate and lactic acid-glycolic acid enable release
of molecules for over 100 days, certain hydrogels release proteins
for shorter time periods. When encapsulated proteins remain in the
body for a long time, they may denature or aggregate as a result of
exposure to moisture at 37.degree. C., resulting in a loss of
biological activity and possible changes in immunogenicity.
Rational strategies can be devised for stabilization depending on
the mechanism involved. For example, if the aggregation mechanism
is discovered to be intermolecular S--S bond formation through
thio-disulfide interchange, stabilization may be achieved by
modifying sulfhydryl residues, lyophilizing from acidic solutions,
controlling moisture content, using appropriate additives, and
developing specific polymer matrix compositions.
[0167] While the skilled artisan will understand that the dosage of
each fibronectin based scaffold protein will be dependent on the
identity of the protein, the preferred dosages can range from about
10 mg/square meter to about 2000 mg/square meter, more preferably
from about 50 mg/square meter to about 1000 mg/square meter.
[0168] For therapeutic applications, the fibronectin based scaffold
proteins are administered to a subject, in a pharmaceutically
acceptable dosage form. They can be administered intravenously as a
bolus or by continuous infusion over a period of time, by
intramuscular, subcutaneous, intra-articular, intrasynovial,
intrathecal, oral, topical, or inhalation routes. The protein may
also be administered by intratumoral, peritumoral, intralesional,
or perilesional routes, to exert local as well as systemic
therapeutic effects. Suitable pharmaceutically acceptable carriers,
diluents, and excipients are well known and can be determined by
those of skill in the art as the clinical situation warrants.
Examples of suitable carriers, diluents and/or excipients include:
(1) Dulbecco's phosphate buffered saline, pH about 7.4, containing
about 1 mg/ml to 25 mg/ml human serum albumin, (2) 0.9% saline
(0.9% w/v NaCl), and (3) 5% (w/v) dextrose. The methods of the
present invention can be practiced in vitro, in vivo, or ex
vivo.
[0169] Administration of fibronectin based scaffold proteins, and
one or more additional therapeutic agents, whether co-administered
or administered sequentially, may occur as described above for
therapeutic applications. Suitable pharmaceutically acceptable
carriers, diluents, and excipients for co-administration will be
understood by the skilled artisan to depend on the identity of the
particular therapeutic agent being co-administered.
[0170] When present in an aqueous dosage form, rather than being
lyophilized, the fibronectin based scaffold protein typically will
be formulated at a concentration of about 0.1 mg/ml to 100 mg/ml,
although wide variation outside of these ranges is permitted. For
the treatment of disease, the appropriate dosage of fibronectin
based scaffold proteins will depend on the type of disease to be
treated, as defined above, the severity and course of the disease,
whether the fibronectin based scaffold proteins are administered
for preventive or therapeutic purposes, the course of previous
therapy, the patient's clinical history and response to the
fibronectin based scaffold protein, and the discretion of the
attending physician. The fibronectin based scaffold protein is
suitably administered to the patient at one time or over a series
of treatments.
TABLE-US-00004 SEQUENCE LISTING WT Core Sequence (SEQ ID NO: 1)
EVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTAT
ISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT I core (SEQ ID NO: 2)
EVVAATPTSLLISWSARLKVARYYRITYGETGGNSPVQEFTVPKNVYTAT
ISGLKPGVDYTITVYAVTRFRDYQPISINYRT V core (SEQ ID NO: 3)
EVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEFTVPLQPPTAT
ISGLKPGVDYTITVYAVTDGRNGRLLSIPISINYRT Short Tail (SEQ ID NO: 4) EIEK
Modified Cys Tail (SEQ ID NO: 5) EGSGC Cys Tail (SEQ ID NO: 6)
EIEKPCQ Fn based linker (SEQ ID NO: 7) PSTSTST GS.sub.5 linker (SEQ
ID NO: 8) GSGSGSGSGS GS.sub.10 linker (SEQ ID NO: 9)
GSGSGSGSGSGSGSGSGSGS (GGGGS).sub.3 (SEQ ID NO: 10) GGGGS GGGGS
GGGGS (GGGGS).sub.5 (SEQ ID NO: 11) GGGGS GGGGS GGGGS GGGGS GGGGS
G.sub.4SG.sub.4SG.sub.3SG (SEQ ID NO: 12) GGGGSGGGGSGGGSG (SEQ ID
NO: 13) GPG (SEQ ID NO: 14) GPGPGPG (SEQ ID NO: 15) GPGPGPGPGPG PA3
linker (SEQ ID NO: 16) PAPAPA PA6 linker (SEQ ID NO: 17)
PAPAPAPAPAPA PA9 linker (SEQ ID NO: 18) PAPAPAPAPAPAPAPAPA (SEQ ID
NO: 19) MGVSDVPRDL (SEQ ID NO: 20) VSDVPRDL (SEQ ID NO: 21)
GVSDVPRDL DK+ VEGFR2/IGF-IR Binder (SEQ ID NO: 22)
MGVSDVPRDLEVVAATPTSLLISWSARLKVARYYRITYGETGGNSPVQEF
TVPKNVYTATISGLKPGVDYTITVYAVTRFRPYQPISINYRTEIDKPSTS
TSTVSPVPRDLEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQE
FTVPLQPPTATISGLKPGVDYTITVYAVTDGRNGRLLSIPISINYRTEID KPCQ DK+
EGFR/IGF-IR Binder (SEQ ID NO: 23)
MGVSDVPRDLEVVAATPTSLLISWSARLKVARYYRITYGETGGNSPVQEF
TVPKNVYTATISGLKPGVDYTITVYAVTRFRDYQPISINYRTEIDKGSGS
GSGSGSGSGSGSGSGSVSDVPRDLEVVAATPTSLLISWWAPVDRYQYYRI
TYGETGGNSPVQEFTVPRDVYTATISGLKPGVDYTITVYAVTDYKPHADG
PHTYHESPISINYRTEIDKPCQ DK- EGFR/IGF-IR Binder with GSGC Tail (SEQ
ID NO: 24) MGVSDVPRDLEVVAATPTSLLISWSARLKVARYYRITYGETGGNSPVQEF
TVPKNVYTATISGLKPGVDYTITVYAVTRFRDYQPISINYRTEIEKGSGS
GSGSGSGSGSGSGSGSVSDVPRDLEVVAATPTSLLISWWAPVDRYQYYRI
TYGETGGNSPVQEFTVPRDVYTATISGLKPGVDYTITVYAVTDYKPHADG
PHTYHESPISINYRTEGSGC DK- EGFR/IGF-IR Binder with EIEKPCQ Tail (SEQ
ID NO: 25) MGVSDVPRDLEVVAATPTSLLISVVSARLKVARYYRITYGETGGNSPVQE
FTVPKNVYTATISGLKPGVDYTITVYAVTRFRDYQPISINYRTEIEKGSG
SGSGSGSGSGSGSGSGSVSDVPRDLEVVAATPTSLLISWWAPVPRYQYYR
ITYGETGGNSPVQEFTVPRDVYTATISGLKPGVDYTITVYAVTDYKPHAD
GPHTYHESPISINYRTEIEKPCQ (SEQ ID NO: 26) X.sub.nSDVPRDL, wherein n =
0, 1 or 2 amino acids, wherein when n = 1, X is Met or Gly, and
when n = 2, X is Met-Gly (SEQ ID NO: 27) X.sub.nDVPRDL, wherein n =
0, 1 or 2 amino acids, wherein when n = 1, X is Met or Gly, and
when n = 2, X is Met-Gly (SEQ ID NO: 28) X.sub.nVPRDL, wherein n =
0, 1 or 2 amino acids, wherein when n = 1, X is Met or Gly, and
when n = 2, X is Met-Gly (SEQ ID NO: 29) X.sub.nPRDL, wherein n =
0, 1 or 2 amino acids, wherein when n = 1, X is Met or Gly, and
when n = 2, X is Met-Gly (SEQ ID NO: 30) X.sub.nRDL, wherein n = 0,
1 or 2 amino acids, wherein when n = 1, X is Met or Gly, and when n
= 2, X is Met-Gly (SEQ ID NO: 31) X.sub.nDL, wherein n = 0, 1 or 2
amino acids, wherein when n = 1, X is Met or Gly, and when n = 2, X
is Met-Gly (SEQ ID NO: 32) EIEKPSQ (SEQ ID NO: 33) EIEKP (SEQ ID
NO: 34) EIEKPS (SEQ ID NO: 35) EIEKPC (SEQ ID NO: 36) EGSGS WT
Fibronectin Sequence (SEQ ID NO: 37)
VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTV
PGSKSTATISGLKPGVDYTITVYAVTGRGPSPASSKPISINYRT .sup.10Fn3 Core with
EIEK Tail (SEQ ID NO: 38)
EVVAATPTSLLISW(X).sub.xRYYRITYGETGGNSPVQEFTVP(X).sub.yTATISG
LKPGVDYTITVYAVT(X).sub.zPISINYRTEIEK E Core (SEQ ID NO: 39)
EVVAATPTSLLISWWAPVDRYQYYRITYGFTGGNSPVQEFTVPRDVYTAT
ISGLKPGVDYTITVYAVTDYKPHADGPHTYHESPISINYRT IGF-IR BC Loop (SEQ ID
NO: 40) SARLKVA IGF-IR DE Loop (SEQ ID NO: 41) KNVY IGF-IR FG Loop
(SEQ ID NO: 42) RFRDYQ VEGFR2 BC Loop (SEQ ID NO: 43) RHPHFPT
VEGFR2 DE Loop (SEQ ID NO: 44) LQPP VEGFR2 FG Loop (SEQ ID NO: 45)
DGRNGRLLSI (SEQ ID NO: 46) EIDK (SEQ ID NO: 47) EIDKPCQ
I-Fn-V(2DK-) with Cys tail (SEQ ID NO: 48)
MGVSDVPRDLEVVAATPTSLLISWSARLKVARYYRITYGETGGNSPVQEF
TVPKNVYTATISGLKPGVDYTITVYAVTRFRDYQPISINYRTEIEKPSTS
TSTVSDVPRDLEWAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEF
TVPLQPPTATISGLKPGVDYTITVYAVTDGRNGRLLSIPISINYRTEIEK PCQ I-Fn-V(2DK-)
with ser tail (SEQ ID NO: 49)
MGVSPVPRPLEVVAATPTSLLISWSARLKVARYYRITYGETGGNSPVQEF
TVPKNVYTATISGLKPGVDYTITVYAVTRFRDYQPISINYRTEIEKPSTS
TSTVSDVPRDLEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQE
FTVPLQPPTATISGLKPGVDYTITVYAVTDGRNGRLLSIPISINYRTEIE KPSQ
I-GS5-V(2DK-) with ser or cys tail (SEQ ID NO: 50)
MGVSDYPRDLEVVAATPTSLLISWSARLKVARYYRITYGETGGNSPVQEF
TVPKNVYTATISGLKPGVDYTITVYAVTRFRDYQPISINYRTEIEKGSGS
GSGSGSVSDVPRDLEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSP
VQEFTVPLQPPTATISGLKPGVDYTITVYAVTPGRNGRLLSTPISINYRT EIEKPXQ, wherein
X = serine or cysteine I-GS10-V(2DK-) with ser or cys tail (SEQ ID
NO: 51) MGVSDVPRDLEVVAATPTSLLISWSARLKVARYYRITYGETGGNSPVQEF
TVPKNVYTATISGLKPGVPYTITVYAVTRFRPYQPISINYRTEIEKGSGS
GSGSGSCSGSGSGSGSVSDVPRPLEVVAATPTSLLISWRHPHFPTRYYRI
TYGETGGNSPVQEFTVPLQPPTATISGLKPGVDYTITVYAVTDGRNGRLL
SIPISINYRTEIEKPXQ, wherein X = serine or cysteine V-Fn-I(2DK-) with
ser tail (SEQ ID NO: 52)
MGVSDVPRDLEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEF
TVPLQPPTATISGLKPGVDYTITVYAVTDGRNGRLLSIPISINYRTEIEK
PSTSTSTVSPVPRDLEVVAATPTSLLISWSARLKVARYYRITYGETGGNS
PVQEFTVPKNVYTATISGLKPGVDYTITVYAVTRFRDYQPISINYRTEIE KPSQ
V-Fn-I(2DK-) with cys tail (SEQ ID NO: 53)
MGVSDVPRDLEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEF
TVPLQPPTATISGLKPGVDYTITVYAVTDGRNGRLLSIPISINYRTEIEK
PSTSTSTVSDVPRDLEVVAATPTSLLISWSARLKVARYYRTTYGETGGNS
PVQEFTVPKNVYTATISGLKPGVDYTITVYAVTRFRDYQPISINYRTEIE KPCQ
V-GS5-I(2DK-) with ser or cys tail (SEQ ID NO: 54)
MGVSDVPRDLEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEF
TVPLQPPTATISGIKPGVDYTITVYAVTDGRNGRLLSIPISINYRTEIEK
GSGSCSGSGSVSDVPRDLEVVAATPTSLLISWSARLKVARYYRITYGETG
GNSPVQEFTVPKNVYTATISGLKPGVDYTITVYAVTRFRDYQPISINYRT EIEKPXQ. wherein
X = serine or cysteine V-GS10-I(2DK-) with ser or cys tail (SEQ ID
NO: 55) MGVSDVPRDLEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEF
TVPLQPPTATISGLKPGVDYTITVYAVTDGRNGRLLSTPISINYRTEIEK
GSGSGSGSGSGSGSGSGSGSVSPVPRDLEVVAATPTSLLISWSARLKVAR
YYRITYGETGGNSPVQEFTVPKNVYTATISGLKPGVDYTITVYAVTRFRD
YQPISINYRTEIEKPXQ. wherein X = serine or cysteine VI(DK+) (SEQ ID
NO: 56) GVSDVPRDLEVVAATPTSLLISWSARLKVARYYRITYGETGGNSPVQEFT
VPKNVYTATISGLKPGVPYTITVYAVTRFRDYQPISINYRFEIDKPSTST
STVSDVPRDLEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEF
TVPLQPPTATISGLKPGVDYTITVYAVTDGRNGRLLSIPISINYRTEIDK PCQ VI(DK-) (SEQ
ID NO: 57) GVSDVPRDLEVVAATPTSLLISWSARLKVARYYRITYGETGGNSPVQEFT
VPKNVYTATISGLKPGVDYTITVYAVTRFRDYQPISINYRTEIEKPSTST
STVSDVPRDLEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEF
TVPLQPPTATISGEKPGVDYTITVYAVTDGRNGRLLSIPISINYRTEIEK PCQ
EXAMPLES
[0171] The invention is now described by reference to the following
examples, which are illustrative only, and are not intended to
limit the present invention. While the invention has been described
in detail and with reference to specific embodiments thereof, it
will be apparent to one of skill in the art that various changes
and modifications can be made thereto without departing from the
spirit and scope thereof.
Example 1. Fibronectin Based Scaffold Proteins
[0172] Various fibronectin based scaffold proteins were generated,
including VEGFR2/IGF-IR binders ("V/I binders") and EGFR/IGF-IR
binders ("E/I binders"). The following table depicts constructs
described herein and their corresponding SEQ ID NOs.
TABLE-US-00005 TABLE 1 Overview of various V/I and E/I binders.
Construct Description SEQ ID NO: Abbreviation DK+ IGF-IR/ A
bivalent V/I construct 22 V/I(DK+) VEGFR2 Binder with a C1 tail
consisting with EIDKPCQ of SEQ ID NO: 46 and a Tail C2 tail
consisting of SEQ ID NO: 47 DK+ EGFR/ A bivalent E/I construct 23
E/I(DK+) IGF-IR Binder with a C1 tail consisting with EIDKPCQ of
SEQ ID NO: 46 and a Tail C2 tail consisting of SEQ ID NO: 47 DK-
EGFR/ A bivalent E/I construct 24 E/I(DK-, IGF-IR Binder with a C1
tail consisting no C-term) with EGSGC of SEQ ID NO: 4 and a Tail C2
tail consisting of SEQ ID NO: 5 DK- EGFR/ A bivalent E/I construct
25 E/I(2DK-) IGF-IR Binder with a C1 tail consisting with EIEKPCQ
of SEQ ID NO: 4 and a Tail C2 tail consisting of SEQ ID NO: 6
[0173] SEQ ID NO: 22 is the amino acid sequence of the V/I(DK+)
bivalent construct that was first described in WO 2009/142773.
V/I(DK+) comprises fibronectin domains that bind to IGF-IR and
VEGFR2. The IGF-IR binding fibronectin core has the sequence set
forth in SEQ ID NO: 2 and the VEGFR2 binding fibronectin core has
the sequence set forth in SEQ ID NO: 3. The two domains are
connected by a polypeptide linker derived from the amino acid
sequence that connects the first and second Fn3 domains in human
fibronectin (SEQ ID NO: 7). The I binding subunit of V/I(DK+)
contains a C-terminal extension (C1) having the amino acid sequence
SEQ ID NO: 46, i.e., containing a DK site. The V binding subunit of
V/I(DK+) contains a C-terminal extension (C2) having the amino acid
sequence of SEQ ID NO: 47, i.e., containing a DK site.
[0174] SEQ ID NO: 23 is the amino acid sequence of the E/I(DK+)
bivalent construct. E/I(DK+) comprises fibronectin domains that
bind to IGF-IR and EGFR. The IGF-IR binding fibronectin core has
the sequence set forth in SEQ ID NO: 2 and the EGFR2 binding
fibronectin core has the sequence set forth in SEQ ID NO: 39. The
two domains are linked by a glycine-serine polypeptide linker
having SEQ ID NO: 9. The I binding subunit of E/I(DK+) contains a
C-terminal extension (C1) having the amino acid sequence SEQ ID NO:
46, i.e., containing a DK site. The E binding subunit of E/I(DK+)
contains a C-terminal extension (C2) having the amino acid sequence
of SEQ ID NO: 47, i.e., containing a DK site.
[0175] SEQ ID NO: 24 is the amino acid sequence of the E/I(DK-, no
C-term) bivalent construct. The E/I(DK-, no C-term) comprises the
IGF-IR core (SEQ ID NO: 2) and EGFR core (SEQ ID NO: 39) linked by
a glycine-serine linker (SEQ ID NO: 9). The IGF-IR binding subunit
contains a C-terminal extension (C1) having the amino acid sequence
SEQ ID NO: 4, i.e., containing an EK site rather than a DK site.
The EGFR binding subunit contains a C-terminal extension (C2)
having the amino acid sequence of SEQ ID NO: 5, i.e., lacking a DK
site.
[0176] SEQ ID NO: 25 is the amino acid sequence of the E/I(2DK-)
bivalent construct. The E/I(2DK-) comprises the IGF-IR core (SEQ ID
NO: 2) and EGFR core (SEQ ID NO: 39) linked by a glycine-serine
linker (SEQ ID NO: 9). The IGF-IR binding subunit contains a
C-terminal extension (C1) having the amino acid sequence SEQ ID NO:
4, i.e., containing an EK site rather than a DK site. The EGFR
binding subunit contains a C-terminal extension (C2) having the
amino acid sequence of SEQ ID NO: 6, i.e., containing an EK site
rather than a DK site.
Example 2: Expression and Purification of Fibronectin Based
Scaffold Proteins
Expression of E/I Molecules
[0177] E/I bivalent constructs are expressed in E. coli cells in
soluble form. The inclusion bodies are recovered by cell disruption
and centrifugation. The E/I proteins are filtered and captured
using column chromatography. The purified protein is then
covalently linked to a PEG via maleimide chemistry at a single
cysteine residue. The PEGylated product is then polished using
column chromatography and formulated using tangential flow
filtration.
Expression of V/I Molecules
[0178] For expression of V/I bivalent constructs, a nucleotide
sequence encoding the construct is cloned into an inducible
expression vector and is expressed into intracellular inclusion
bodies in E. coli cells. Cell bank vials generated from a culture
of a single plated colony are used to inoculate a shake flask
culture as an inoculum for a large-scale fermentor. Alternatively,
a seed fermentor is used for an inoculum culture, depending on the
final fermentation volume. The large-scale fermentation contains a
growth phase to accumulate biomass and a production phase to
generate the fibronectin based scaffold proteins. For primary
recovery, intracellular inclusion bodies are released from
harvested cells using a microfluidizer and recovered by
centrifugation, followed by washes with buffer and water.
[0179] The purification process for the bivalent constructs uses a
Guanidine-HCl based resolubolization of inclusion bodies, followed
by refolding the protein. The refolded protein is filtered and
loaded onto a cation exchange chromatography column. The product is
then purified using a hydrophobic interaction column and the
resulting elution pool is PEGylated by the addition of the PEG
reagent to produce PEGylated protein.
[0180] The PEGylated protein is then purified over a second cation
exchange chromatography column. The elution is concentrated to a
target protein concentration and then exchanged into the
formulation buffer using ultrafiltration/diafiltration (UF/DF). The
UF/DF product is filtered using a final 0.22 .mu.m filter. The
filtered product is then filled into vials to produce the final
drug product.
Example 3: Effects of Protein Concentration on V/I Protein
Stability
[0181] The effects of protein concentration on physical
(aggregation) and chemical (fragmentation) stability of purified
V/I(DK+) (SEQ ID NO: 22) were examined. V/I(DK+) protein was
formulated in 10 mM succinic acid, 5% sorbitol at pH 5.5. V/I
protein concentration was either at 3 mg/mL or at 5 mg/ml. Samples
were stored at 4.degree. C. for a period of 12 months, with samples
being collected and analyzed at 1 month, 6 weeks, 2 months, 3
months, 6 months, 9 months and 12 months.
[0182] The amount of aggregation is measured by assessing the
percentage of total protein that has formed aggregates (measured as
High Molecular Weight ("HMW") species) over time. Aggregation was
determined using Size Exclusion-High Performance Liquid
Chromatography (SE-HPLC) analysis to assess the levels of HMW over
time. SE-HPLC analysis was conducted using a Superdex 200 10/300 GL
column, with a mobile phase of 0.2M potassium phosphate, 0.15 M
sodium chloride, 0.02% sodium azide, pH 6.8. Flow rate was 0.5
mL/min with detection at 280 nm. The effects of protein
concentration on aggregation of V/l protein over time (0-12 months)
is depicted in FIG. 1. V/I(DK+) aggregates at a rate of 0.3%/month
at a concentration of 3 mg/mL. Higher protein concentration (5
mg/ml) leads to a faster aggregation rate.
[0183] Fragmentation is measured by assessing percentage of total
protein that has been fragmented, or "clipped", over time. Levels
of clipped protein were determined by utilizing Reversed Phase-High
Performance Liquid Chromatography (RP-HPLC). RP-HPLC was performed
using a Varian PLRP-S column (4.6*250 mm, 300 .ANG. pore size, 5
.mu.m particle size). Separation of the various species is achieved
via a gradient comprised of water/acetonitrile/trifluoroacetic
acid. Flow rate was 1.0 mL/min. Dual detection was conducted at 280
nm (for protein-related species) and with evaporative light
scattering (ELS, for PEG-related species). FIG. 2 demonstrates that
fragmentation of V/I(DK+) was found to be less dependent on protein
concentration than was aggregation. The fragmentation rate for
V/I(DK+) was .about.0.1%/month at 4.degree. C.
[0184] Based on these aggregation and fragmentation data, a
formulation of V/I(DK+) having a protein concentration of 3 mg/mL
would be preferred over a concentration of 5 mg/mL in order to
minimize aggregation and to ensure sufficient stability for one
year.
Example 4: Effects of pH on V/l Protein Stability
[0185] The effects of pH on physical and chemical stability of
purified V/I(DK+) (SEQ ID NO: 22) were examined. V/I(DK+) protein
was formulated in 50 mM sodium chloride, with the buffer component
being 20 mM sodium acetate (for pH 4 and 5) or 20 mM sodium
phosphate (for pH 6 and 7), and was stored at 25.degree. C.
[0186] Samples were collected once per week for a period of four
weeks and evaluation of aggregation was carried out using SE-HPLC
analysis as described in Example 3. The effects of pH on
aggregation of V/I(DK+) protein over time (0-4 wks) are depicted in
FIG. 3. The lowest aggregation rate was observed in the samples
having the lowest pH tested (pH 4.0). The highest aggregation rate
was observed in the samples having the highest pH tested (pH
7.0).
[0187] Samples were collected once per week for a period of four
weeks and evaluation of fragmentation was carried out using SE-HPLC
analysis as described in Example 3. The effects of pH on
fragmentation of V/I(DK+) protein is depicted in FIG. 4. While a
low pH (pH 4.0) was found to prevent aggregation over time of the
V/I(DK+) protein (FIG. 3), low pH was found to lead to an increase
in protein fragmentation of the V/I(DK+) protein (FIG. 4).
[0188] To identify clip sites in the fragmented V/I(DK+) protein,
liquid chromatography-Mass Spectrometry (LC-MS) was performed.
V/I(DK+) protein was formulated in 10 mM sodium acetate, 150 mM
sodium chloride, pH 5.5, at 5 mg/mL protein concentration. LC-MS
was performed according to the RP-HPLC method described in Example
3 followed by coupling to a Thermo LTQ ion trap mass spectrometer
(MS). The HPLC eluent was split 1:5 with 0.2 mL/min flow diverted
into the MS. On-line detection at 280 nm was maintained. FIG. 5
depicts the LC-MS data from this experiment and demonstrates that
several aspartate (D) residues are involved in fragmentation, with
D95 and D200 being the predominant sites at which fragmentation
occurs. It should be noted that while there are several D residues
throughout the V/I(DK+) protein (e.g. D5, D9, D110), only the D95
and D200 residues are immediately followed by a lysine residue. "VI
des Met" indicates a cleavage event occurring at the maleimide bond
of the PEG conjugation as a result of heat stress.
[0189] Based on these experiments, aggregation and fragmentation
are best balanced by fixing the formulation pH at 5.5, however,
neither degradation pathway (aggregation and fragmentation) could
be eliminated by relying on this pH level alone.
Example 5: Evaluation of Aggregation and Fragmentation on E/I
Proteins
[0190] To confirm that the aggregation and fragmentation
instability issues observed in V/I(DK+) (SEQ ID NO: 22) were issues
common to other structurally related bivalent constructs, the
aggregation and fragmentation properties of E/I(DK+) (SEQ ID NO:
23) were also assessed at several pH levels.
[0191] E/I(DK+) was formulated in 10 mM succinic acid, 5% sorbitol
and at pH 4.0, 4.5 or 5.5. E/I(DK+) was formulated into the desired
formulation via tangential flow filtration (TFF) using a 30 kD MWCO
membrane. At least six dia-volumes of buffer were exchanged to
achieve the final formulation. Concentration of the resulting
protein was verified by A280 and adjusted to 5 mg/mL with
additional formulation buffer. Formulated E/I(DK+) was sterile
filtered in a laminar flow hood, and filled into sterilized glass
vials for stability monitoring. The vials were capped and crimped,
followed by placement into temperature-controlled incubators at 4,
25 and 37.degree. C.
[0192] Aggregation rate of E/I(DK+) was assessed by performing
SE-HPLC analysis. SE-HPLC was performed using a Shodex KW404-4F
HPLC column (4.6*250 mm, 300 .ANG. pore size, 5 .mu.m particle
size) and a mobile phase comprised of 10 mM succinic acid/3%
sorbitol/0.4M arginine at pH 5.5. Flow rate was 0.35 mL/min and
detection was conducted at 280 nm. FIG. 6 shows that, similar to
V/I(DK+), the aggregation rate of E/I(DK+) was higher for samples
stored at higher pH levels at 25.degree. C. than for samples stored
at lower pH levels at 25.degree. C. The same data trends were also
observed for samples stressed at 37.degree. C.
[0193] The effect of protein concentration on aggregation rate of
E/I(DK+) was also assessed. Similar to V/I(DK+), Table 2
illustrates that higher concentrations (7 mg/ml) of E/I(DK+) were
associated with a higher percentage of aggregate formation (lower
percentage of monomers) after 4 weeks. Table 2 also demonstrates
that by reducing pH along with protein concentration, the percent
of aggregation can be further decreased.
TABLE-US-00006 TABLE 2 Protein Conc. Formulation pH % Monomer 7.5
mg/mL 5.5 94.30% 5.0 mg/mL 5.5 97.70% 5.0 mg/mL 4.0 99.20%
[0194] Fragmentation of the E/I(DK+) was assessed by performing
RP-HPLC analysis as described in Example 3. FIG. 7 shows that,
similar to V/I(DK+), the fragmentation rate of E/I(DK+) was highest
for samples stored at lower pH levels at 25.degree. C. then for
samples stored at higher pH levels at 25.degree. C. The same data
trends were also observed for samples stressed at 37.degree. C.
[0195] To identify clip sites in the fragmented E/I(DK+) protein,
LC-MS was performed as described in Example 4. E/I(DK+) was
formulated in 10 mM succinic acid, 5% sorbitol, pH 4.0, at 5 mg/mL
protein concentration and was maintained at 25.degree. C. to induce
protein stress. FIG. 8 depicts the LC-MS data from this experiment
and demonstrates that several aspartate (D) residues are involved
in fragmentation, including D95 and D218 (the homologous position
to D200 in V/I(DK+)). Fragmentation was also observed at D199. The
D199 site is specific to these E/I molecules and is not found in
V/I molecules, as it is located within the FG binding loop of the
EGFR-binding region.
Example 6: Evaluation of Aggregation and Fragmentation in DK Minus
E/I Variants
[0196] Various E/I binders (SEQ ID NOs: 23-25) were formulated and
their physical (aggregation) and chemical (fragmentation) stability
was compared to each other under identical conditions (see Table
1). Based upon the characterization of the D95 and D218 clipped
sites observed in E/I(DK+) (Example 5), and based on the fact that
these DK clip sites are located in the structurally nonessential
C-terminal tails, two different E/I constructs were generated in
which the C-terminal tail DK sites were removed or substituted.
[0197] The E/I(DK-t) molecule (SEQ ID NO: 23) is the control E/I
binder that contains a C-terminal tail comprising DK sites (D95 and
D218) after each of the two binding domains. The physical and
chemical stability of this molecule was characterized in Example 5.
The E/I(DK-, no C-term) molecule (SEQ ID NO: 24) does not contain
any DK sites. In this molecule, the aspartate at position 95 was
mutated to a glutamic acid, and the EIDKPCQ tail (SEQ ID NO: 47)
was replaced with an EGSGC tail (SEQ ID NO: 5). The E/I(2DK-)
molecule (SEQ ID NO: 25) also does not contain any DK sites. In
this molecule the aspartates at positions 95 and 218 have been
replaced with glutamic acids. V/I(DK+) was included in this study
as a control.
[0198] The E/I proteins (SEQ ID NOs: 23-25) were formulated in 10
mM succinic acid, 5% sorbitol at pH 4.0. In addition, E/I(DK+) (SEQ
ID NO: 23) and V/I(DK+) (SEQ ID NO: 22) were formulated in 10 mM
succinic acid, 5% sorbitol at pH 5.5. Surfactant was not found to
be necessary based on a preliminary surfactant screen. E/I(DK+) was
formulated into the desired formulation via tangential flow
filtration (TFF) using a 30 kD MWCO membrane. At least six
dia-volumes of buffer were exchanged to achieve the final
formulation. Concentration of the resulting protein was verified by
A280 and adjusted to 5 mg/mL with additional formulation buffer.
Each formulated bivalent construct was sterile filtered in a
laminar flow hood, and filled into sterilized glass vials for
stability monitoring. The vials were capped and crimped, followed
by placement into temperature-controlled incubators at 4, 25 and
37.degree. C.
[0199] Aggregation rate for the different E/I molecules was
determined by performing SE-HPLC as described according to Example
5 and the results from this experiment are illustrated in FIG. 9.
As expected, the rate of aggregation is significantly higher at pH
5.5 than at pH 4.0 for E/I(DK+) at 25.degree. C. Based on the
slopes seen in FIG. 9, the rate of aggregation for E/I(DK+) is
approximately 7-fold higher at pH 5.5 than at pH 4.0 at 25.degree.
C. For the two E/I molecules lacking DK sites, the aggregation rate
was unaffected at pH 4.0. E/I(DK+) and V/I(DK+) displayed similar
aggregation rates at pH 5.5.
[0200] Fragmentation rate for the different E/I molecules was
determined by performing RP-HPLC according to Example 3 and the
results from this experiment are illustrated in FIG. 10. In terms
of clipping. FIG. 10 shows lower clip rates at pH 5.5 than at pH
4.0 for E/I(DK+) at 25.degree. C. Among the molecules represented
in FIG. 10, the highest clip rate was seen in E/I(DK+) at pH 4.0,
which was significantly minimized when the formulation pH was
increased to pH 5.5. However, as described above, aggregation rate
was highest at pH 5.5 for this molecule. For the other two E/I
molecules lacking DK sites, the clip rates at pH 4.0 decreased by
approximately 3-fold as compared to E/I(DK+) at the same pH.
V/I(DK+) displayed a higher degree of fragmentation as compared to
E/I(DK+) at the same pH (pH 5.5) indicating that although the
V/I(DK+) and E/I(DK+) molecules are similar, the V/I(DK+) molecule
is more susceptible to fragmentation.
[0201] Characterization of clipped sites for E/I(DK-, no C-term),
as compared to the clipped sites for E/I(DK+), was performed using
LC-MS as described in Example 4. The two different E/I Binders were
each formulated in 10 mM succinic acid, 5% sorbitol, pH 4.0, at 5
mg/mL protein concentration and were maintained at 25.degree. C. to
induce protein stress. FIG. 11 depicts the LC-MS data from this
experiment and demonstrates that the fragmentation profiles differ
between the two different E/I binders. The predominant aspartate
(D) residues involved in fragmentation in E/I(DK+) were D95, D218
and D199. By contrast, the predominant aspartate residues involved
in fragmentation in E/I(DK-, no C-term) were D199, D82 and D193.
However, as illustrated in Table 3 below, the percentage of total
clips was nearly halved in E/I(DK-, no C-term) after 4 weeks as
compared to E/I(DK+) after this same period (3.8% compared to
7.5%). These results indicate that E/I(DK-, no C-term) is
associated with reduced fragmentation as compared to E/I(DK+).
[0202] Characterization of clipped sites in E/I(2DK-) was performed
using LC-MS as described in Example 4. E/I(2DK-) was formulated in
10 mM succinic acid, 5% sorbitol, pH 4.0, at 5 mg/mL protein
concentration and was maintained at 25.degree. C. to induce protein
stress. FIG. 12 depicts the LC-MS data from this experiment and
demonstrates that similar to E/I (DK-, no C-term), the predominant
aspartate residues involved in fragmentation in E/I(2DK-) were
D199, D82 and D193. Also, as illustrated in Table 3 below, the
percentage of total clips was more than halved in E/I(2DK-) after 4
weeks, as compared to E/I (DK+) after this same period (3.5%
compared to 7.5%). These results indicate that E/I(2DK-) is
associated with reduced fragmentation as compared to E/I(DK+).
TABLE-US-00007 TABLE 3 Amount and location of fragmentation for
various E/I binders after four weeks of storage at 25.degree. C.
SEQ ID Clip Sites Identified % Total Clips at 4 wks Construct NO
(in order of intensity) (value at T = 0) E/I(DK+) 23 D218K 7.5%
D199G (0.5%) D95K E/I(DK-, 24 D199G 3.8% no C-term) D193Y (1.4%)
D82Y E/I(2DK-) 25 D199G 3.5% D193Y (0.9%) D82Y
[0203] As discussed above, the D199 site is located within the FG
binding loop of the EGFR-binding region. As such, D199 likely is
necessary for binding function and will be difficult to remove from
the E/I(2DK-) or E/I(DK-, no C-term) molecules.
[0204] The exact mechanism of clipping at the aspartic acid sites
observed in V/I(DK+) and E/I(DK+) is not clear. Based on apparent
pKa values of three aspartic acids in glucagon as measured by NMR
methods, Joshi et al. (Journal of Pharmaceutical Sciences, 94 (9),
2005) proposed several mechanisms for the cleavage reaction at
aspartic acid sites. Without wishing to be bound by theory, it is
possible that some of the proposed mechanisms involve cyclization
of the aspartic acid side chain to form a five-member ring,
followed by nucleophilic attack on the peptide carbonyl which then
leads to peptide bond cleavage. By substituting aspartic acid with
glutamic acid, it is possible that the ring formation does not
occur as readily due to steric hindrance, thus preventing peptide
bond cleavage at that location.
Example 7: Evaluation of Aggregation and Fragmentation in DK Minus
V/I Variants
[0205] The stability of two VEGFR-IGFR (VI) fibronectin based
scaffold proteins has been compared. The first construct is VI(DK+)
(SEQ ID NO: 56), and the second construct VI(DK-) (SEQ ID NO: 57)
contains substitution of aspartic acid with glutamic acid at
positions 94 and 199 of SEQ ID NO: 56.
[0206] Both molecules were formulated at 3 mg/mL protein
concentration, in 10 mM succinic acid, 5% sorbitol, at pH 4.0, 4.5
and 5.5. Limited stability of these formulations was performed at 4
and 25.degree. C. for up to two months, with periodic time points
pulled for analysis by SE-HPLC and RP-HPLC. In addition, LC-MS
characterization was performed on the 2-month 25.degree. C. samples
in order to determine the exact clipped sites in both proteins.
Effects of pH on Aggregation Rate in VI Fibronectin Based Scaffold
Proteins
[0207] Based on experience with past fibronectin based scaffold
proteins, low pH formulations have been recognized to provide the
best biophysical stability for these molecules (i.e., lower
aggregation). In the current study, the two VI constructs
demonstrate the same trend as that seen before, as illustrated in
FIG. 13. Although the starting levels of aggregates are slightly
different between the two molecules, the rates observed over the
stability period are very similar at each given pH, with the
aggregation rates for both molecules showing the same order, pH
5.5>>pH 4.5>pH 4.0.
Effects of pH on Clip Rate in VI Fibronectin Based Scaffold
Proteins
[0208] Based on experience with past fibronectin based scaffold
proteins, low pH formulations have been recognized to provide the
least chemical stability for these proteins, if sites susceptible
to clipping exist in the protein sequence. In past stability
studies conducted for VI(DK+) (SEQ ID NO: 56), numerous clip sites
have been identified, with clipping at D94 and D199 being the most
severe. In the current study, the two VI constructs demonstrate the
same trend as seen before, as illustrated in FIG. 14, with the pH
effects on clip rate being worse for VI(DK+) than for VI(DK-).
While the clip rate follows the general trend of pH 4.0>pH
4.5>pH 5.5 for both molecules, VI(DK-) exhibits much less
difference in its clip rate across all three pH values.
[0209] From the stability data trends shown in FIGS. 13 and 14, the
clip rate per week for VI(DK+) increases by 3.3-fold when the
formulation pH is decreased from 5.5 to 4.0, whereas for the
VI(DK-) molecule, this rate increases by 1.6-fold, due to the
elimination of the major clip sites at two positions. Therefore,
with these amino acid substitutions, the clip rate in the VI
fibronectin based scaffold protein has decreased by about 50% over
the same stability period when the pH 4 formulation is used. On the
other hand, the aggregation rates per week for VI(DK+) and VI(DK-)
decrease by 86- and 216-fold, respectively, when the formulation pH
is decreased from 5.5 to 4.0. The pH effect on aggregation rate,
therefore, is more drastic than on the clip rate in VI fibronectin
based scaffold proteins.
Identification of Clipped Sites by LC-MS
[0210] Structural characterization of the observed clipped sites in
VI(DK+) and VT(DK-) has been performed by LC-MS. The overlaid
RP-HPLC chromatogram of the clip region from the 25.degree.
C./2-month time point can be seen in FIG. 15 and peak
identification is summarized in Table 4.
TABLE-US-00008 TABLE 4 Summary of peak identification by mass
spectrometry. Residues highlighted in red indicate the aspartic
acids that exist in the original VI sequence which have been
replaced by glutamic acids in the VI(DK-) construct. Peak Area Peak
Area Structure % Among Structure % Among of Clips All Clips of
Clips All Clips Peak # in VI(DK+) in VI(DK+) in VI(DK-) in VI(DK-)
1 G1-D105 11.6 G1-D105 37.8 2 G1-D81 3.1 G1-D81 7.9 3 G1-D94 24.7
G1-R80 36.3 4 G1-D199 43.0 G1-D179 14.1 5 G1-K200 3.7 T15-D81 3.9 6
(G1-D199)-18 5.1 n/a n/a 7 (G1-D199)-35 3.2 n/a n/a 8 D109-Q203 1.9
n/a n/a
[0211] While some clips remain identical between the two molecules,
the major clip sites at D94 and D199 have been eliminated in
VI(DK-), bringing the level of total clips to 6.9% after 2 months
of stress at 25.degree. C. On the other hand, the total clips in
VI(DK+) remained high at 16.0% over the same stability period.
Other clips at low level have also been identified in VI(DK-),
which are not found in VI(DK+).
TABLE-US-00009 TABLE 5 Comparison of Clip Rates in VI(DK+) and
VI(DK-). Rate for VI(DK+) Rate for VI(DK-) Formulation pH (% per
week) (% per week) 4.0 1.6650 0.6350 4.5 1.0375 0.4330 5.5 0.4975
0.3925
[0212] The clip rate of VI(DK+) at pH 4.0 was 1.6 fold and 3.3 fold
faster than the clip rate of VI(DK+) at pH 4.5 and 5.5,
respectively. The clip rate of VI(DK-) at pH 4.0 was 1.5 fold and
1.6 fold faster than the clip rate of VI(DK-) at pH 4.5 and 5.5,
respectively.
TABLE-US-00010 TABLE 6 Comparison of Aggregation Rates in VI(DK+)
and VI(DK-). Rate for VI(DK+) Rate for VI(DK-) Formulation pH (%
per week) (% per week) 4.0 0.0225 -0.0075 4.5 0.4450 0.4050 1.9400
1.9400 1.6200
[0213] The agreggation rates of VI(DK+) at pH 4.5 and 5.0 were 4.4
fold and 86 fold faster, respectively, than the agreggation rate of
VI(DK+) at pH 4.0. The agreggation rates of VI(DK-) at pH 4.5 and
5.0 were 4.0 fold and 216 fold faster, respectively, than the
agreggation rate of VI(DK-) at pH 4.0.
[0214] The stability results obtained on two versions of the VI
fibronectin based scaffold proteins demonstrate the effectiveness
and benefits of selective substitutions of problematic aspartic
acids to glutamic acids, for the purpose of eliminating specific
chemical degradation in the fibronectin based scaffold protein.
With the major chemical degradation eliminated through this
approach, better biophysical stability in fibronectin based
scaffold proteins may now be achieved through formulation at the
lower pH. The results from the current study with VI, as well as
those previously obtained from EI bi-functional fibronectin based
scaffold proteins, demonstrate the necessity in eliminating certain
aspartic acid residues known to be prone to clipping, which in turn
allows for formulations at acidic pH to be used in order to
maximize the biophysical stability in the fibronectin based
scaffold proteins.
Materials and Methods
[0215] Formulation: Each molecule was formulated into the desired
formulations via tangential flow filtration (TFF) using a 30 kD
MWCO membrane. At least six dia-volumes of buffer were exchanged to
achieve the final formulation. Concentration of the resulting
protein was verified by A280 and adjusted to 3 mg/mL with
additional formulation buffer.
[0216] Vial Fill and Stability: Each formulated protein was sterile
filtered in a laminar flow hood, and filled into sterilized glass
vials for stability monitoring. The vials were capped and crimped,
followed by placement into temperature-controlled incubators at 4
and 25.degree. C.
Analytical Methods:
[0217] Size Exclusion HPLC (SE-HPLC): The analysis was conducted
using a Shodex KW404-4F HPLC column (4.6*250 mm, 300 .ANG. pore
size, 5 .mu.m particle size) and a mobile phase comprised of 10 mM
succinic acid/3% sorbitol/0.4M arginine at pH 5.5. Flow rate was
0.35 mL/min and detection was conducted at 280 nm.
[0218] Reversed Phase HPLC (RP-HPLC): The analysis was performed
using a Varian PLRP-S column (4.6*250 mm, 300 .ANG. pore size, 5
.mu.m particle size). Separation of the various species is achieved
via a gradient comprised of water/acetonitrile/trifluoroacetic
acid. Flow rate was 1.0 mL/min. Dual detection was conducted at 280
nm (for protein-related species) and with evaporative light
scattering (ELS, for PEG-related species).
[0219] LC-MS: Characterization of clipped sites was performed using
a Jupiter C18 column (4.6*250 mm, 300 .ANG. pore size, 5 .mu.m
particle size) coupled to a Thermo LTQ ion trap mass spectrometer
(MS). The HPLC eluent was split 1:5 with 0.2 mL/min flow diverted
into the MS. On-line detection at 280 nm was maintained.
INCORPORATION BY REFERENCE
[0220] All documents and references, including patent documents and
websites, described herein are individually incorporated by
reference to into this document to the same extent as if there were
written in this document in full or in part.
Sequence CWU 1
1
59186PRTHomo sapiens 1Glu Val Val Ala Ala Thr Pro Thr Ser Leu Leu
Ile Ser Trp Asp Ala1 5 10 15Pro Ala Val Thr Val Arg Tyr Tyr Arg Ile
Thr Tyr Gly Glu Thr Gly 20 25 30Gly Asn Ser Pro Val Gln Glu Phe Thr
Val Pro Gly Ser Lys Ser Thr 35 40 45Ala Thr Ile Ser Gly Leu Lys Pro
Gly Val Asp Tyr Thr Ile Thr Val 50 55 60Tyr Ala Val Thr Gly Arg Gly
Asp Ser Pro Ala Ser Ser Lys Pro Ile65 70 75 80Ser Ile Asn Tyr Arg
Thr 85282PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 2Glu Val Val Ala Ala Thr Pro Thr Ser Leu Leu
Ile Ser Trp Ser Ala1 5 10 15Arg Leu Lys Val Ala Arg Tyr Tyr Arg Ile
Thr Tyr Gly Glu Thr Gly 20 25 30Gly Asn Ser Pro Val Gln Glu Phe Thr
Val Pro Lys Asn Val Tyr Thr 35 40 45Ala Thr Ile Ser Gly Leu Lys Pro
Gly Val Asp Tyr Thr Ile Thr Val 50 55 60Tyr Ala Val Thr Arg Phe Arg
Asp Tyr Gln Pro Ile Ser Ile Asn Tyr65 70 75 80Arg
Thr386PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 3Glu Val Val Ala Ala Thr Pro Thr Ser Leu Leu
Ile Ser Trp Arg His1 5 10 15Pro His Phe Pro Thr Arg Tyr Tyr Arg Ile
Thr Tyr Gly Glu Thr Gly 20 25 30Gly Asn Ser Pro Val Gln Glu Phe Thr
Val Pro Leu Gln Pro Pro Thr 35 40 45Ala Thr Ile Ser Gly Leu Lys Pro
Gly Val Asp Tyr Thr Ile Thr Val 50 55 60Tyr Ala Val Thr Asp Gly Arg
Asn Gly Arg Leu Leu Ser Ile Pro Ile65 70 75 80Ser Ile Asn Tyr Arg
Thr 8544PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 4Glu Ile Glu Lys155PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 5Glu
Gly Ser Gly Cys1 567PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 6Glu Ile Glu Lys Pro Cys Gln1
577PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 7Pro Ser Thr Ser Thr Ser Thr1 5810PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 8Gly
Ser Gly Ser Gly Ser Gly Ser Gly Ser1 5 10920PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 9Gly
Ser Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser1 5 10
15Gly Ser Gly Ser 201015PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 10Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser1 5 10 151125PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 11Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly1 5 10
15Gly Gly Gly Ser Gly Gly Gly Gly Ser 20 251215PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 12Gly
Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Ser Gly1 5 10
15133PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 13Gly Pro Gly1147PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 14Gly
Pro Gly Pro Gly Pro Gly1 51511PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 15Gly Pro Gly Pro Gly Pro Gly
Pro Gly Pro Gly1 5 10166PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 16Pro Ala Pro Ala Pro Ala1
51712PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 17Pro Ala Pro Ala Pro Ala Pro Ala Pro Ala Pro
Ala1 5 101818PRTArtificial SequenceDescription of Artificial
Sequence Synthetic peptide 18Pro Ala Pro Ala Pro Ala Pro Ala Pro
Ala Pro Ala Pro Ala Pro Ala1 5 10 15Pro Ala1910PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 19Met
Gly Val Ser Asp Val Pro Arg Asp Leu1 5 10208PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 20Val
Ser Asp Val Pro Arg Asp Leu1 5219PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 21Gly Val Ser Asp Val Pro
Arg Asp Leu1 522204PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 22Met Gly Val Ser Asp Val Pro Arg
Asp Leu Glu Val Val Ala Ala Thr1 5 10 15Pro Thr Ser Leu Leu Ile Ser
Trp Ser Ala Arg Leu Lys Val Ala Arg 20 25 30Tyr Tyr Arg Ile Thr Tyr
Gly Glu Thr Gly Gly Asn Ser Pro Val Gln 35 40 45Glu Phe Thr Val Pro
Lys Asn Val Tyr Thr Ala Thr Ile Ser Gly Leu 50 55 60Lys Pro Gly Val
Asp Tyr Thr Ile Thr Val Tyr Ala Val Thr Arg Phe65 70 75 80Arg Asp
Tyr Gln Pro Ile Ser Ile Asn Tyr Arg Thr Glu Ile Asp Lys 85 90 95Pro
Ser Thr Ser Thr Ser Thr Val Ser Asp Val Pro Arg Asp Leu Glu 100 105
110Val Val Ala Ala Thr Pro Thr Ser Leu Leu Ile Ser Trp Arg His Pro
115 120 125His Phe Pro Thr Arg Tyr Tyr Arg Ile Thr Tyr Gly Glu Thr
Gly Gly 130 135 140Asn Ser Pro Val Gln Glu Phe Thr Val Pro Leu Gln
Pro Pro Thr Ala145 150 155 160Thr Ile Ser Gly Leu Lys Pro Gly Val
Asp Tyr Thr Ile Thr Val Tyr 165 170 175Ala Val Thr Asp Gly Arg Asn
Gly Arg Leu Leu Ser Ile Pro Ile Ser 180 185 190Ile Asn Tyr Arg Thr
Glu Ile Asp Lys Pro Cys Gln 195 20023222PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
23Met Gly Val Ser Asp Val Pro Arg Asp Leu Glu Val Val Ala Ala Thr1
5 10 15Pro Thr Ser Leu Leu Ile Ser Trp Ser Ala Arg Leu Lys Val Ala
Arg 20 25 30Tyr Tyr Arg Ile Thr Tyr Gly Glu Thr Gly Gly Asn Ser Pro
Val Gln 35 40 45Glu Phe Thr Val Pro Lys Asn Val Tyr Thr Ala Thr Ile
Ser Gly Leu 50 55 60Lys Pro Gly Val Asp Tyr Thr Ile Thr Val Tyr Ala
Val Thr Arg Phe65 70 75 80Arg Asp Tyr Gln Pro Ile Ser Ile Asn Tyr
Arg Thr Glu Ile Asp Lys 85 90 95Gly Ser Gly Ser Gly Ser Gly Ser Gly
Ser Gly Ser Gly Ser Gly Ser 100 105 110Gly Ser Gly Ser Val Ser Asp
Val Pro Arg Asp Leu Glu Val Val Ala 115 120 125Ala Thr Pro Thr Ser
Leu Leu Ile Ser Trp Trp Ala Pro Val Asp Arg 130 135 140Tyr Gln Tyr
Tyr Arg Ile Thr Tyr Gly Glu Thr Gly Gly Asn Ser Pro145 150 155
160Val Gln Glu Phe Thr Val Pro Arg Asp Val Tyr Thr Ala Thr Ile Ser
165 170 175Gly Leu Lys Pro Gly Val Asp Tyr Thr Ile Thr Val Tyr Ala
Val Thr 180 185 190Asp Tyr Lys Pro His Ala Asp Gly Pro His Thr Tyr
His Glu Ser Pro 195 200 205Ile Ser Ile Asn Tyr Arg Thr Glu Ile Asp
Lys Pro Cys Gln 210 215 22024220PRTArtificial SequenceDescription
of Artificial Sequence Synthetic polypeptide 24Met Gly Val Ser Asp
Val Pro Arg Asp Leu Glu Val Val Ala Ala Thr1 5 10 15Pro Thr Ser Leu
Leu Ile Ser Trp Ser Ala Arg Leu Lys Val Ala Arg 20 25 30Tyr Tyr Arg
Ile Thr Tyr Gly Glu Thr Gly Gly Asn Ser Pro Val Gln 35 40 45Glu Phe
Thr Val Pro Lys Asn Val Tyr Thr Ala Thr Ile Ser Gly Leu 50 55 60Lys
Pro Gly Val Asp Tyr Thr Ile Thr Val Tyr Ala Val Thr Arg Phe65 70 75
80Arg Asp Tyr Gln Pro Ile Ser Ile Asn Tyr Arg Thr Glu Ile Glu Lys
85 90 95Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser Gly
Ser 100 105 110Gly Ser Gly Ser Val Ser Asp Val Pro Arg Asp Leu Glu
Val Val Ala 115 120 125Ala Thr Pro Thr Ser Leu Leu Ile Ser Trp Trp
Ala Pro Val Asp Arg 130 135 140Tyr Gln Tyr Tyr Arg Ile Thr Tyr Gly
Glu Thr Gly Gly Asn Ser Pro145 150 155 160Val Gln Glu Phe Thr Val
Pro Arg Asp Val Tyr Thr Ala Thr Ile Ser 165 170 175Gly Leu Lys Pro
Gly Val Asp Tyr Thr Ile Thr Val Tyr Ala Val Thr 180 185 190Asp Tyr
Lys Pro His Ala Asp Gly Pro His Thr Tyr His Glu Ser Pro 195 200
205Ile Ser Ile Asn Tyr Arg Thr Glu Gly Ser Gly Cys 210 215
22025222PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 25Met Gly Val Ser Asp Val Pro Arg Asp Leu Glu
Val Val Ala Ala Thr1 5 10 15Pro Thr Ser Leu Leu Ile Ser Trp Ser Ala
Arg Leu Lys Val Ala Arg 20 25 30Tyr Tyr Arg Ile Thr Tyr Gly Glu Thr
Gly Gly Asn Ser Pro Val Gln 35 40 45Glu Phe Thr Val Pro Lys Asn Val
Tyr Thr Ala Thr Ile Ser Gly Leu 50 55 60Lys Pro Gly Val Asp Tyr Thr
Ile Thr Val Tyr Ala Val Thr Arg Phe65 70 75 80Arg Asp Tyr Gln Pro
Ile Ser Ile Asn Tyr Arg Thr Glu Ile Glu Lys 85 90 95Gly Ser Gly Ser
Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser 100 105 110Gly Ser
Gly Ser Val Ser Asp Val Pro Arg Asp Leu Glu Val Val Ala 115 120
125Ala Thr Pro Thr Ser Leu Leu Ile Ser Trp Trp Ala Pro Val Asp Arg
130 135 140Tyr Gln Tyr Tyr Arg Ile Thr Tyr Gly Glu Thr Gly Gly Asn
Ser Pro145 150 155 160Val Gln Glu Phe Thr Val Pro Arg Asp Val Tyr
Thr Ala Thr Ile Ser 165 170 175Gly Leu Lys Pro Gly Val Asp Tyr Thr
Ile Thr Val Tyr Ala Val Thr 180 185 190Asp Tyr Lys Pro His Ala Asp
Gly Pro His Thr Tyr His Glu Ser Pro 195 200 205Ile Ser Ile Asn Tyr
Arg Thr Glu Ile Glu Lys Pro Cys Gln 210 215 220269PRTArtificial
SequenceDescription of Artificial Sequence Synthetic
peptideMOD_RES(1)..(2)May or may not be presentSee specification as
filed for detailed description of substitutions and preferred
embodiments 26Met Gly Ser Asp Val Pro Arg Asp Leu1
5278PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptideMOD_RES(1)..(2)May or may not be presentSee
specification as filed for detailed description of substitutions
and preferred embodiments 27Met Gly Asp Val Pro Arg Asp Leu1
5287PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptideMOD_RES(1)..(2)May or may not be presentSee
specification as filed for detailed description of substitutions
and preferred embodiments 28Met Gly Val Pro Arg Asp Leu1
5296PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptideMOD_RES(1)..(2)May or may not be presentSee
specification as filed for detailed description of substitutions
and preferred embodiments 29Met Gly Pro Arg Asp Leu1
5305PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptideMOD_RES(1)..(2)May or may not be presentSee
specification as filed for detailed description of substitutions
and preferred embodiments 30Met Gly Arg Asp Leu1 5314PRTArtificial
SequenceDescription of Artificial Sequence Synthetic
peptideMOD_RES(1)..(2)May or may not be presentSee specification as
filed for detailed description of substitutions and preferred
embodiments 31Met Gly Asp Leu1327PRTArtificial SequenceDescription
of Artificial Sequence Synthetic peptide 32Glu Ile Glu Lys Pro Ser
Gln1 5335PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 33Glu Ile Glu Lys Pro1 5346PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 34Glu
Ile Glu Lys Pro Ser1 5356PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 35Glu Ile Glu Lys Pro Cys1
5365PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 36Glu Gly Ser Gly Ser1 53794PRTHomo sapiens 37Val
Ser Asp Val Pro Arg Asp Leu Glu Val Val Ala Ala Thr Pro Thr1 5 10
15Ser Leu Leu Ile Ser Trp Asp Ala Pro Ala Val Thr Val Arg Tyr Tyr
20 25 30Arg Ile Thr Tyr Gly Glu Thr Gly Gly Asn Ser Pro Val Gln Glu
Phe 35 40 45Thr Val Pro Gly Ser Lys Ser Thr Ala Thr Ile Ser Gly Leu
Lys Pro 50 55 60Gly Val Asp Tyr Thr Ile Thr Val Tyr Ala Val Thr Gly
Arg Gly Asp65 70 75 80Ser Pro Ala Ser Ser Lys Pro Ile Ser Ile Asn
Tyr Arg Thr 85 9038129PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptideMOD_RES(15)..(34)Any amino
acid and this region may encompass 2-20, 2-15, 2-10, 2-8, 5-20,
5-15, 5-10, 5-8, 6-20, 6-15, 6-10, 6-8, 2-7, 5-7, or 6-7
residuesMOD_RES(57)..(76)Any amino acid and this region may
encompass 2-20, 2-15, 2-10, 2-8, 5-20, 5-15, 5-10, 5-8, 6-20, 6-15,
6-10, 6-8, 2-7, 5-7, or 6-7 residuesMOD_RES(98)..(117)Any amino
acid and this region may encompass 2-20, 2-15, 2-10, 2-8, 5-20,
5-15, 5-10, 5-8, 6-20, 6-15, 6-10, 6-8, 2-7, 5-7, or 6-7
residuesSee specification as filed for detailed description of
substitutions and preferred embodiments 38Glu Val Val Ala Ala Thr
Pro Thr Ser Leu Leu Ile Ser Trp Xaa Xaa1 5 10 15Xaa Xaa Xaa Xaa Xaa
Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa 20 25 30Xaa Xaa Arg Tyr
Tyr Arg Ile Thr Tyr Gly Glu Thr Gly Gly Asn Ser 35 40 45Pro Val Gln
Glu Phe Thr Val Pro Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa 50 55 60Xaa Xaa
Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Thr Ala Thr Ile65 70 75
80Ser Gly Leu Lys Pro Gly Val Asp Tyr Thr Ile Thr Val Tyr Ala Val
85 90 95Thr Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa
Xaa 100 105 110Xaa Xaa Xaa Xaa Xaa Pro Ile Ser Ile Asn Tyr Arg Thr
Glu Ile Glu 115 120 125Lys3991PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 39Glu Val Val Ala Ala Thr
Pro Thr Ser Leu Leu Ile Ser Trp Trp Ala1 5 10 15Pro Val Asp Arg Tyr
Gln Tyr Tyr Arg Ile Thr Tyr Gly Glu Thr Gly 20 25 30Gly Asn Ser Pro
Val Gln Glu Phe Thr Val Pro Arg Asp Val Tyr Thr 35 40 45Ala Thr Ile
Ser Gly Leu Lys Pro Gly Val Asp Tyr Thr Ile Thr Val 50 55 60Tyr Ala
Val Thr Asp Tyr Lys Pro His Ala Asp Gly Pro His Thr Tyr65 70 75
80His Glu Ser Pro Ile Ser Ile Asn Tyr Arg Thr 85 90407PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 40Ser
Ala Arg Leu Lys Val Ala1 5414PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 41Lys Asn Val
Tyr1426PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 42Arg Phe Arg Asp Tyr Gln1 5437PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 43Arg
His Pro His Phe Pro Thr1 5444PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 44Leu Gln Pro
Pro14510PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 45Asp Gly Arg Asn Gly Arg Leu Leu Ser Ile1 5
10464PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 46Glu Ile Asp Lys1477PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 47Glu
Ile Asp Lys Pro Cys Gln1 548204PRTArtificial SequenceDescription of
Artificial
Sequence Synthetic polypeptide 48Met Gly Val Ser Asp Val Pro Arg
Asp Leu Glu Val Val Ala Ala Thr1 5 10 15Pro Thr Ser Leu Leu Ile Ser
Trp Ser Ala Arg Leu Lys Val Ala Arg 20 25 30Tyr Tyr Arg Ile Thr Tyr
Gly Glu Thr Gly Gly Asn Ser Pro Val Gln 35 40 45Glu Phe Thr Val Pro
Lys Asn Val Tyr Thr Ala Thr Ile Ser Gly Leu 50 55 60Lys Pro Gly Val
Asp Tyr Thr Ile Thr Val Tyr Ala Val Thr Arg Phe65 70 75 80Arg Asp
Tyr Gln Pro Ile Ser Ile Asn Tyr Arg Thr Glu Ile Glu Lys 85 90 95Pro
Ser Thr Ser Thr Ser Thr Val Ser Asp Val Pro Arg Asp Leu Glu 100 105
110Val Val Ala Ala Thr Pro Thr Ser Leu Leu Ile Ser Trp Arg His Pro
115 120 125His Phe Pro Thr Arg Tyr Tyr Arg Ile Thr Tyr Gly Glu Thr
Gly Gly 130 135 140Asn Ser Pro Val Gln Glu Phe Thr Val Pro Leu Gln
Pro Pro Thr Ala145 150 155 160Thr Ile Ser Gly Leu Lys Pro Gly Val
Asp Tyr Thr Ile Thr Val Tyr 165 170 175Ala Val Thr Asp Gly Arg Asn
Gly Arg Leu Leu Ser Ile Pro Ile Ser 180 185 190Ile Asn Tyr Arg Thr
Glu Ile Glu Lys Pro Cys Gln 195 20049204PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
49Met Gly Val Ser Asp Val Pro Arg Asp Leu Glu Val Val Ala Ala Thr1
5 10 15Pro Thr Ser Leu Leu Ile Ser Trp Ser Ala Arg Leu Lys Val Ala
Arg 20 25 30Tyr Tyr Arg Ile Thr Tyr Gly Glu Thr Gly Gly Asn Ser Pro
Val Gln 35 40 45Glu Phe Thr Val Pro Lys Asn Val Tyr Thr Ala Thr Ile
Ser Gly Leu 50 55 60Lys Pro Gly Val Asp Tyr Thr Ile Thr Val Tyr Ala
Val Thr Arg Phe65 70 75 80Arg Asp Tyr Gln Pro Ile Ser Ile Asn Tyr
Arg Thr Glu Ile Glu Lys 85 90 95Pro Ser Thr Ser Thr Ser Thr Val Ser
Asp Val Pro Arg Asp Leu Glu 100 105 110Val Val Ala Ala Thr Pro Thr
Ser Leu Leu Ile Ser Trp Arg His Pro 115 120 125His Phe Pro Thr Arg
Tyr Tyr Arg Ile Thr Tyr Gly Glu Thr Gly Gly 130 135 140Asn Ser Pro
Val Gln Glu Phe Thr Val Pro Leu Gln Pro Pro Thr Ala145 150 155
160Thr Ile Ser Gly Leu Lys Pro Gly Val Asp Tyr Thr Ile Thr Val Tyr
165 170 175Ala Val Thr Asp Gly Arg Asn Gly Arg Leu Leu Ser Ile Pro
Ile Ser 180 185 190Ile Asn Tyr Arg Thr Glu Ile Glu Lys Pro Ser Gln
195 20050207PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptideMOD_RES(206)..(206)Ser or Cys 50Met
Gly Val Ser Asp Val Pro Arg Asp Leu Glu Val Val Ala Ala Thr1 5 10
15Pro Thr Ser Leu Leu Ile Ser Trp Ser Ala Arg Leu Lys Val Ala Arg
20 25 30Tyr Tyr Arg Ile Thr Tyr Gly Glu Thr Gly Gly Asn Ser Pro Val
Gln 35 40 45Glu Phe Thr Val Pro Lys Asn Val Tyr Thr Ala Thr Ile Ser
Gly Leu 50 55 60Lys Pro Gly Val Asp Tyr Thr Ile Thr Val Tyr Ala Val
Thr Arg Phe65 70 75 80Arg Asp Tyr Gln Pro Ile Ser Ile Asn Tyr Arg
Thr Glu Ile Glu Lys 85 90 95Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser
Val Ser Asp Val Pro Arg 100 105 110Asp Leu Glu Val Val Ala Ala Thr
Pro Thr Ser Leu Leu Ile Ser Trp 115 120 125Arg His Pro His Phe Pro
Thr Arg Tyr Tyr Arg Ile Thr Tyr Gly Glu 130 135 140Thr Gly Gly Asn
Ser Pro Val Gln Glu Phe Thr Val Pro Leu Gln Pro145 150 155 160Pro
Thr Ala Thr Ile Ser Gly Leu Lys Pro Gly Val Asp Tyr Thr Ile 165 170
175Thr Val Tyr Ala Val Thr Asp Gly Arg Asn Gly Arg Leu Leu Ser Ile
180 185 190Pro Ile Ser Ile Asn Tyr Arg Thr Glu Ile Glu Lys Pro Xaa
Gln 195 200 20551217PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptideMOD_RES(216)..(216)Ser or Cys 51Met
Gly Val Ser Asp Val Pro Arg Asp Leu Glu Val Val Ala Ala Thr1 5 10
15Pro Thr Ser Leu Leu Ile Ser Trp Ser Ala Arg Leu Lys Val Ala Arg
20 25 30Tyr Tyr Arg Ile Thr Tyr Gly Glu Thr Gly Gly Asn Ser Pro Val
Gln 35 40 45Glu Phe Thr Val Pro Lys Asn Val Tyr Thr Ala Thr Ile Ser
Gly Leu 50 55 60Lys Pro Gly Val Asp Tyr Thr Ile Thr Val Tyr Ala Val
Thr Arg Phe65 70 75 80Arg Asp Tyr Gln Pro Ile Ser Ile Asn Tyr Arg
Thr Glu Ile Glu Lys 85 90 95Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser
Gly Ser Gly Ser Gly Ser 100 105 110Gly Ser Gly Ser Val Ser Asp Val
Pro Arg Asp Leu Glu Val Val Ala 115 120 125Ala Thr Pro Thr Ser Leu
Leu Ile Ser Trp Arg His Pro His Phe Pro 130 135 140Thr Arg Tyr Tyr
Arg Ile Thr Tyr Gly Glu Thr Gly Gly Asn Ser Pro145 150 155 160Val
Gln Glu Phe Thr Val Pro Leu Gln Pro Pro Thr Ala Thr Ile Ser 165 170
175Gly Leu Lys Pro Gly Val Asp Tyr Thr Ile Thr Val Tyr Ala Val Thr
180 185 190Asp Gly Arg Asn Gly Arg Leu Leu Ser Ile Pro Ile Ser Ile
Asn Tyr 195 200 205Arg Thr Glu Ile Glu Lys Pro Xaa Gln 210
21552204PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 52Met Gly Val Ser Asp Val Pro Arg Asp Leu Glu
Val Val Ala Ala Thr1 5 10 15Pro Thr Ser Leu Leu Ile Ser Trp Arg His
Pro His Phe Pro Thr Arg 20 25 30Tyr Tyr Arg Ile Thr Tyr Gly Glu Thr
Gly Gly Asn Ser Pro Val Gln 35 40 45Glu Phe Thr Val Pro Leu Gln Pro
Pro Thr Ala Thr Ile Ser Gly Leu 50 55 60Lys Pro Gly Val Asp Tyr Thr
Ile Thr Val Tyr Ala Val Thr Asp Gly65 70 75 80Arg Asn Gly Arg Leu
Leu Ser Ile Pro Ile Ser Ile Asn Tyr Arg Thr 85 90 95Glu Ile Glu Lys
Pro Ser Thr Ser Thr Ser Thr Val Ser Asp Val Pro 100 105 110Arg Asp
Leu Glu Val Val Ala Ala Thr Pro Thr Ser Leu Leu Ile Ser 115 120
125Trp Ser Ala Arg Leu Lys Val Ala Arg Tyr Tyr Arg Ile Thr Tyr Gly
130 135 140Glu Thr Gly Gly Asn Ser Pro Val Gln Glu Phe Thr Val Pro
Lys Asn145 150 155 160Val Tyr Thr Ala Thr Ile Ser Gly Leu Lys Pro
Gly Val Asp Tyr Thr 165 170 175Ile Thr Val Tyr Ala Val Thr Arg Phe
Arg Asp Tyr Gln Pro Ile Ser 180 185 190Ile Asn Tyr Arg Thr Glu Ile
Glu Lys Pro Ser Gln 195 20053204PRTArtificial SequenceDescription
of Artificial Sequence Synthetic polypeptide 53Met Gly Val Ser Asp
Val Pro Arg Asp Leu Glu Val Val Ala Ala Thr1 5 10 15Pro Thr Ser Leu
Leu Ile Ser Trp Arg His Pro His Phe Pro Thr Arg 20 25 30Tyr Tyr Arg
Ile Thr Tyr Gly Glu Thr Gly Gly Asn Ser Pro Val Gln 35 40 45Glu Phe
Thr Val Pro Leu Gln Pro Pro Thr Ala Thr Ile Ser Gly Leu 50 55 60Lys
Pro Gly Val Asp Tyr Thr Ile Thr Val Tyr Ala Val Thr Asp Gly65 70 75
80Arg Asn Gly Arg Leu Leu Ser Ile Pro Ile Ser Ile Asn Tyr Arg Thr
85 90 95Glu Ile Glu Lys Pro Ser Thr Ser Thr Ser Thr Val Ser Asp Val
Pro 100 105 110Arg Asp Leu Glu Val Val Ala Ala Thr Pro Thr Ser Leu
Leu Ile Ser 115 120 125Trp Ser Ala Arg Leu Lys Val Ala Arg Tyr Tyr
Arg Ile Thr Tyr Gly 130 135 140Glu Thr Gly Gly Asn Ser Pro Val Gln
Glu Phe Thr Val Pro Lys Asn145 150 155 160Val Tyr Thr Ala Thr Ile
Ser Gly Leu Lys Pro Gly Val Asp Tyr Thr 165 170 175Ile Thr Val Tyr
Ala Val Thr Arg Phe Arg Asp Tyr Gln Pro Ile Ser 180 185 190Ile Asn
Tyr Arg Thr Glu Ile Glu Lys Pro Cys Gln 195 20054207PRTArtificial
SequenceDescription of Artificial Sequence Synthetic
polypeptideMOD_RES(206)..(206)Ser or Cys 54Met Gly Val Ser Asp Val
Pro Arg Asp Leu Glu Val Val Ala Ala Thr1 5 10 15Pro Thr Ser Leu Leu
Ile Ser Trp Arg His Pro His Phe Pro Thr Arg 20 25 30Tyr Tyr Arg Ile
Thr Tyr Gly Glu Thr Gly Gly Asn Ser Pro Val Gln 35 40 45Glu Phe Thr
Val Pro Leu Gln Pro Pro Thr Ala Thr Ile Ser Gly Leu 50 55 60Lys Pro
Gly Val Asp Tyr Thr Ile Thr Val Tyr Ala Val Thr Asp Gly65 70 75
80Arg Asn Gly Arg Leu Leu Ser Ile Pro Ile Ser Ile Asn Tyr Arg Thr
85 90 95Glu Ile Glu Lys Gly Ser Gly Ser Gly Ser Gly Ser Gly Ser Val
Ser 100 105 110Asp Val Pro Arg Asp Leu Glu Val Val Ala Ala Thr Pro
Thr Ser Leu 115 120 125Leu Ile Ser Trp Ser Ala Arg Leu Lys Val Ala
Arg Tyr Tyr Arg Ile 130 135 140Thr Tyr Gly Glu Thr Gly Gly Asn Ser
Pro Val Gln Glu Phe Thr Val145 150 155 160Pro Lys Asn Val Tyr Thr
Ala Thr Ile Ser Gly Leu Lys Pro Gly Val 165 170 175Asp Tyr Thr Ile
Thr Val Tyr Ala Val Thr Arg Phe Arg Asp Tyr Gln 180 185 190Pro Ile
Ser Ile Asn Tyr Arg Thr Glu Ile Glu Lys Pro Xaa Gln 195 200
20555217PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptideMOD_RES(216)..(216)Ser or Cys 55Met Gly Val
Ser Asp Val Pro Arg Asp Leu Glu Val Val Ala Ala Thr1 5 10 15Pro Thr
Ser Leu Leu Ile Ser Trp Arg His Pro His Phe Pro Thr Arg 20 25 30Tyr
Tyr Arg Ile Thr Tyr Gly Glu Thr Gly Gly Asn Ser Pro Val Gln 35 40
45Glu Phe Thr Val Pro Leu Gln Pro Pro Thr Ala Thr Ile Ser Gly Leu
50 55 60Lys Pro Gly Val Asp Tyr Thr Ile Thr Val Tyr Ala Val Thr Asp
Gly65 70 75 80Arg Asn Gly Arg Leu Leu Ser Ile Pro Ile Ser Ile Asn
Tyr Arg Thr 85 90 95Glu Ile Glu Lys Gly Ser Gly Ser Gly Ser Gly Ser
Gly Ser Gly Ser 100 105 110Gly Ser Gly Ser Gly Ser Gly Ser Val Ser
Asp Val Pro Arg Asp Leu 115 120 125Glu Val Val Ala Ala Thr Pro Thr
Ser Leu Leu Ile Ser Trp Ser Ala 130 135 140Arg Leu Lys Val Ala Arg
Tyr Tyr Arg Ile Thr Tyr Gly Glu Thr Gly145 150 155 160Gly Asn Ser
Pro Val Gln Glu Phe Thr Val Pro Lys Asn Val Tyr Thr 165 170 175Ala
Thr Ile Ser Gly Leu Lys Pro Gly Val Asp Tyr Thr Ile Thr Val 180 185
190Tyr Ala Val Thr Arg Phe Arg Asp Tyr Gln Pro Ile Ser Ile Asn Tyr
195 200 205Arg Thr Glu Ile Glu Lys Pro Xaa Gln 210
21556203PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 56Gly Val Ser Asp Val Pro Arg Asp Leu Glu Val
Val Ala Ala Thr Pro1 5 10 15Thr Ser Leu Leu Ile Ser Trp Ser Ala Arg
Leu Lys Val Ala Arg Tyr 20 25 30Tyr Arg Ile Thr Tyr Gly Glu Thr Gly
Gly Asn Ser Pro Val Gln Glu 35 40 45Phe Thr Val Pro Lys Asn Val Tyr
Thr Ala Thr Ile Ser Gly Leu Lys 50 55 60Pro Gly Val Asp Tyr Thr Ile
Thr Val Tyr Ala Val Thr Arg Phe Arg65 70 75 80Asp Tyr Gln Pro Ile
Ser Ile Asn Tyr Arg Thr Glu Ile Asp Lys Pro 85 90 95Ser Thr Ser Thr
Ser Thr Val Ser Asp Val Pro Arg Asp Leu Glu Val 100 105 110Val Ala
Ala Thr Pro Thr Ser Leu Leu Ile Ser Trp Arg His Pro His 115 120
125Phe Pro Thr Arg Tyr Tyr Arg Ile Thr Tyr Gly Glu Thr Gly Gly Asn
130 135 140Ser Pro Val Gln Glu Phe Thr Val Pro Leu Gln Pro Pro Thr
Ala Thr145 150 155 160Ile Ser Gly Leu Lys Pro Gly Val Asp Tyr Thr
Ile Thr Val Tyr Ala 165 170 175Val Thr Asp Gly Arg Asn Gly Arg Leu
Leu Ser Ile Pro Ile Ser Ile 180 185 190Asn Tyr Arg Thr Glu Ile Asp
Lys Pro Cys Gln 195 20057203PRTArtificial SequenceDescription of
Artificial Sequence Synthetic polypeptide 57Gly Val Ser Asp Val Pro
Arg Asp Leu Glu Val Val Ala Ala Thr Pro1 5 10 15Thr Ser Leu Leu Ile
Ser Trp Ser Ala Arg Leu Lys Val Ala Arg Tyr 20 25 30Tyr Arg Ile Thr
Tyr Gly Glu Thr Gly Gly Asn Ser Pro Val Gln Glu 35 40 45Phe Thr Val
Pro Lys Asn Val Tyr Thr Ala Thr Ile Ser Gly Leu Lys 50 55 60Pro Gly
Val Asp Tyr Thr Ile Thr Val Tyr Ala Val Thr Arg Phe Arg65 70 75
80Asp Tyr Gln Pro Ile Ser Ile Asn Tyr Arg Thr Glu Ile Glu Lys Pro
85 90 95Ser Thr Ser Thr Ser Thr Val Ser Asp Val Pro Arg Asp Leu Glu
Val 100 105 110Val Ala Ala Thr Pro Thr Ser Leu Leu Ile Ser Trp Arg
His Pro His 115 120 125Phe Pro Thr Arg Tyr Tyr Arg Ile Thr Tyr Gly
Glu Thr Gly Gly Asn 130 135 140Ser Pro Val Gln Glu Phe Thr Val Pro
Leu Gln Pro Pro Thr Ala Thr145 150 155 160Ile Ser Gly Leu Lys Pro
Gly Val Asp Tyr Thr Ile Thr Val Tyr Ala 165 170 175Val Thr Asp Gly
Arg Asn Gly Arg Leu Leu Ser Ile Pro Ile Ser Ile 180 185 190Asn Tyr
Arg Thr Glu Ile Glu Lys Pro Cys Gln 195 200586PRTArtificial
SequenceDescription of Artificial Sequence Synthetic 6xHis tag
58His His His His His His1 5594PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 59Gly Ser Gly Cys1
* * * * *