Dual Acting Cd1d Immunoglobulin

Abstract

The present invention relates to the field of immunology, more in particular to the field of binding moieties and/or immunoglobulins which bind to human CD1d, including antibodies and fragments thereof that modify CD1d-mediated biological functions such as enhanced activation and reduced activation of CD1d-restricted T cells, including the natural killer T-cells and gamma-delta T-cells, and modulation of the function of cells expressing CD1d. The invention also relates to bi-, tri- or multi-specific immunoglobulins that bind to CD1d and a gamma-delta TCR and/or a tumor target. The invention further relates to pharmaceutical preparations and use of such mono-, bi-, and tri- or multi-specific binding moieties and/or immunoglobulins in the treatment of diseases or disorders.

Description

FIELD OF THE INVENTION

[0001] The present invention relates to the field of immunology, more in particular to the field of binding molecules and/or immunoglobulins which bind to human CD1d, including antibodies and fragments thereof that modify CD1d-mediated biological functions such as activation and blocking of CD1d-restricted T-cells, including natural killer T (NKT) cells and gamma(.gamma.)-delta(.delta.) T-cells, and modulation of the function of cells expressing CD1d. The invention also relates to bi-, tri- or multi-specific binding molecules and/or immunoglobulins that bind to CD1d and a .gamma..delta. T cell receptor (TCR) and/or a tumor target. The invention further relates to pharmaceutical preparations and use of such mono-, bi-, and tri-, or multi-specific binding molecules and/or immunoglobulins in the treatment of diseases or disorders.

BACKGROUND OF THE INVENTION

[0002] CD1d is a member of the CD1 (cluster of differentiation 1) family of glycoproteins (including CD1a, CD1b, CD1c, CD1d and CD1e) and is expressed on the surface of various human cells, including antigen presenting cells (APC). They are non-classical MHC proteins, related to the class I MHC proteins, and are involved in the presentation of lipid antigens to a subgroup of T cells. In human CD1d is encoded by CD1D, also known as R3G1. APC displaying CD1d include B-cells, dendritic cells (e.g. in lymph nodes), and monocytes. CD1d is also expressed by various other cell types, for example, in liver, pancreas, skin, kidney, uterus, conjunctiva, epididymis, thymus and tonsil (Canchis et al. (1992) Immunology 80:561).

[0003] Cells that are activated/stimulated via CD1d include CD1d restricted Natural Killer T-cells (NKT cells). NKT cells are a heterogeneous group of T cells that share properties of both T cells and natural killer cells. NKT cells are a subset of T cells that express an alpha(.alpha.)/beta(.beta.) T-cell receptor (TCR), as well a variety of molecular markers that are typically associated with NK cells.

[0004] Type 1 or invariant NKT (iNKT) cells are the best-studied group of NKT cells and differ from conventional .alpha..beta.-T cells in that their T-cell receptors are far more limited in diversity (`invariant`). These invariant, but also other CD1d-restricted, NKT cells (type II NKT) recognize several antigens, such as (self or foreign) lipids, glycolipids, sulfatides, phospholipids, lipopeptides, hydrophobic peptides and/or amphipathic .alpha.-helical peptides, presented by CD1d molecules present on APC (Enrico Girardi et al. (2016) J Biol Chem. 291(20): 10677). The interaction between (antigen-presenting) CD1d and TCR triggers the release of cytokines including Th1- and/or Th2-like cytokines, such as interferon-.gamma., tumor necrosis factor-.alpha., and interleukins like IL-4, IL-5 and IL-13.

[0005] An .alpha.-galactosylceramide, KRN7000, is the best studied ligand of the lipid-binding CD1d in NKT cell activation in vitro and in vivo. Other ligands comprise isoglobotrihexosylceramide (for mouse iNKT cells), (microbial-derived) glycuronosylceramides, .alpha.-C-galactosylceramides, threitol ceramide, and a variety of (human and non-human) glycolipids such as lysophophatidylcholine and lysosphingomyelin (Fox et al (2009) PLOS Biology 7:10:e1000228).

[0006] Important roles of iNKT cells have been demonstrated in the regulation of autoimmune, allergic, antimicrobial, and antitumor immune responses (van der Vliet et al. (2004) Clin Immunol 112(1): 8). Physiologically, the NKT-cells can augment or inhibit immune responses, including antitumor, autoimmune, and anti-pathogen responses, through a variety of mechanisms depending on context (Yue et al. (2010) J Immunol 184: 268), including induction of cell death in multiple myeloma cells. Conditions in which (invariant) NKT-cells may be involved include autoimmune or inflammatory diseases, including myasthenia gravis, psoriasis, ulcerative colitis, primary biliary cirrhosis, colitis, autoimmune hepatitis, atherosclerosis, and asthma. In addition to cytokine release, NKT cell effector functions which result in cell lysis, such as perforin release and granzyme release and cell death, may also be relevant in conditions in which NKT cells are implicated, such as in cancer.

[0007] Based on their T cell receptor (TCR) usage and antigen specificities, CD1d-restricted NKT cells have been divided into two main subsets: type I NKT cells that use a canonical invariant TCR .alpha.-chain and recognize .alpha.-galactosylceramide (.alpha.-GalCer), and type II NKT cells that use a more diverse .alpha..beta.-TCR repertoire and do not recognize .alpha.-GalCer. In addition, .alpha.-GalCer-reactive NKT cells that use non-canonical .alpha..beta.-TCRs and CD1d-restricted T cells that use .gamma..delta.- or .delta./.alpha..beta.-TCRs have recently been identified, revealing further diversity among CD1d-restricted T cells (Macho-Fernandez and Brigl (2015) Front Immunol 6:362).

Type I NKT Cells

[0008] The discovery of the first CD1d-presented antigen, .alpha.-galactosylceramide (.alpha.-GalCer), by Kawano and colleagues in 1997 enabled several important steps forward in our under-standing of NKT cell biology, particularly of type I or invariant NKT (iNKT) cells (Kawano et al. (1997) Science 278:1626). Type I NKT cells express an invariant V.alpha.14J.alpha.18 TCR .alpha.-chain in mice and V.alpha.24J.alpha.18 in humans, paired with a limited repertoire of TCR .beta.-chains (V.beta.8, V.beta.7, V.beta.2 in mice and exclusively V.beta.11 in humans). Type I NKT cells can be highly autoreactive even at steady state and display an activated/memory phenotype with high surface levels of the activation markers CD69, CD44, and CD122 (IL-2R .beta.-chain) and low expression of CD62L, a marker expressed by naive T cells that home to lymph nodes (Bendelac et al (1992) J Exp Med 175:731; Matsuda et al. (2000) J Exp Med 192:741). Type I NKT cells critically contribute to natural anti-tumor responses, as demonstrated by the prompt growth of spontaneous tumors in type I NKT cell-deficient J.alpha.18-/- mice compared to WT mice (Smyth et al. (2000) J Exp Med 191:661; Swann et al (2009) Blood 113:6382; Bellone et al (2010) PLoS One 5:e8646). Furthermore, the activation of type I NKT cells by .alpha.-GalCer provides potent effects against hematologic malignancies and solid tumors through their IFN-.gamma.-production and the subsequent activation of dendritic cells (DC) and NK cells (Smyth et al (2002) Blood 99:1259; Berzofsky and Terabe (2008) J Immunol 180:3627). By contrast, sulfatide-activated type II NKT cells repress anti-tumor immunity (Terabe et al (2000) Nat Immunol 1:515; Terabe et al (2005) J Exp Med 202:1627; Renukaradhya et al (2008) Blood 111:5637) by abrogating type I NKT activation in response to .alpha.-GalCer, in terms of cytokine secretion and expansion (Ambrosino et al (2007) J Immunol 179:5126). Moreover, their IL-13 production, in combination with TNF-.alpha., led to up-regulation of TGF-.beta. secretion by myeloid-derived suppressor cells (MDSC), and resulted in decreased cytotoxic T cell activity (Terabe et al (2003) J Exp Med 198:1741).

Type II NKT Cells

[0009] CD1d-restricted T cells that do not express the V.alpha.14-J.alpha.18 rearrangement and do not recognize .alpha.-GalCer were first described in MHC II-deficient mice among the remaining CD4+ T cells (Cardell S et al (1995) J Exp Med 182:993). From then called diverse NKT (dNKT), type II NKT, or variant NKT (vNKT) cells, this NKT cell population, found in both mice and humans, exhibits a more heterogeneous TCR repertoire. Several lines of evidence suggest that type II NKT cells can contribute to and modulate a range of immune responses, occasionally in opposing roles to type I NKT cells.

.gamma..delta. T Cells

[0010] In addition to CD1d-restricted T cells with .alpha..beta. TCRs, CD1d-restricted T cells expressing .gamma..delta. TCRs have recently been described in both mice and humans. According to their V.delta.-chain expression, human .gamma..delta. T cells can be divided into two major populations: V.delta.2+ and "non-V.delta.2" subsets, the latter comprise, inter alia, V.delta.1+.gamma..delta. T cells and the less prevalent V.delta.3+.gamma..delta. T cells (McVay et al (1999) Crit Rev Immunol 19:431; Vantourout and Hayday (2013) Nat Rev Immunol 13:88). V.delta.1+.gamma..delta. T cells are mainly tissue resident and are found in the skin and at mucosal surfaces, whereas V.delta.2+.gamma..delta. T cells are predominant in human blood. Compared with .alpha..beta. T cells, the types of antigens recognized by .gamma..delta. T cells and the role and function of antigen presentation in .gamma..delta. TCR recognition are much less clear. Interestingly, some .gamma..delta. T cells have recently been found to directly recognize CD1d-presented lipid antigens (Hayday and Vantourout (2013) Immunity 39:994). In 2013, Uldrich et al (2013) Nature Immunol 14: 1137) had identified a .gamma..delta.-T cell population that recognized CD1d in combination with select glycolipid antigens, including .alpha.GalCer. These T cells are referred to as CD1d-restricted V.delta.1+ T cells. Without being bound to theory, it is believed that V.delta.1+ T cells can exert an inflammatory response that can be counterproductive for an effective anti-tumor response.

SUMMARY OF THE INVENTION

[0011] For the reasons indicated above, modulation of CD1d-mediated effects is of potential therapeutic benefit. There is an ongoing need for binding molecules that can specifically bind and/or interact with CD1d, both in vitro and in vivo. In particular there is need for such binding molecules that bind and/or modulate (activate or inhibit) biological functions that involve CD1d such as, but not limited to, NKT-cell activation. Such binding molecules may, for example, show benefit in the various diseases in which CD1d-mediated functions play a role.

[0012] The inventors have previously identified a single domain antibody, designated 1D12 or VHH 12, that specifically activates iNKT (type I NKT) cells, without the need of CD1d ligand (WO2016122320). The present invention shows for the first time that 1D12 is not only able to activate iNKT cells, but at the same time enables blocking of CD1d-restricted V.delta.1+ T cell activation. This observation now leads to the notion that 1D12 can be used for the treatment of disorders caused, maintained and/or propagated by CD1d-restricted V.delta.1+ T-cell activation. The skilled person will be aware that this specific use is not restricted to 1D12, but extends to any antibody that is functionally and/or structurally similar to 1D12.

[0013] In a first aspect, the invention provides a binding molecule comprising a first binding moiety that is able to compete with single domain antibody 1D12 (SEQ ID NO: 4) in binding to a CD1d molecule, for use in the treatment of disorders caused, maintained and/or propagated by CD1d-restricted V.delta.1+ T-cell activation.

[0014] In a second aspect, the invention provides a binding molecule comprising a first binding moiety that is able to compete with 1D12 (SEQ ID NO: 4) in binding to a CD1d molecule and comprising a second binding moiety that is able to specifically bind to a V.gamma.9V.delta.2-TCR, wherein the binding molecule is able to activate V.gamma.9V.delta.2 T cells. The inventors have shown that a bispecific CD1d/V.gamma.9V.delta.2-TCR antibody can induce degranulation of iNKT cells and V.gamma.9V.delta.2-T cells and control growth of CD1d-expressing tumor cells. Furthermore, in a mouse multiple myeloma model, infusion of both iNKT cells and .gamma..delta. T cells with a bispecific CD1d/V.gamma.9V.delta.2-TCR antibody significantly prolonged survival compared to a mixture of the iNKT cells and .gamma..delta. T cells alone without the antibody.

[0015] In a further aspect, the invention provides a composition according to the second aspect of the invention and a pharmaceutically acceptable excipient.

[0016] In even further aspects, the invention provides a method of treating a disease or disorder comprising administering a binding molecule according to the invention to a subject in need thereof.

[0017] Further aspects and embodiments of the invention are described below.

BRIEF DESCRIPTION OF THE DRAWINGS

[0018] FIG. 1. Anti-CD1d VHH mediated activation and inhibition of invariant natural killer T (iNKT) cells. iNKT CD25 expression and interferon-.gamma. (IFN-.gamma.) production were determined after a 24-hr co-culture of iNKT cells with CD1d-transfected HeLa cells pulsed with vehicle control (vehicle) or .alpha.GalCer whether or not in combination with anti-CD1d VHH 1D12 (100 nM) or 1D22 (1000 nM). Representative dot-plots illustrating marked activation by 1D12 (A) or inhibition by 1D22 (B) of iNKT cells as depicted by CD25 expression, in addition to a marked increase (by 1D12) or decrease (by 1D22) in iNKT cell IFN-.gamma. production (C and D). Data represent mean+SD of 3-4 individual experiments with iNKT obtained from different donors, **P<0.01, ***P<0.001, calculated with a one-way analysis of variance with Turkey's post hoc test.

[0019] FIG. 2. V.delta.1-sulf-CD1d interaction is prevented by anti-CD1d VHH 1D12 and reduced by 1D22. Endogenous or sulfatide loaded CD1d-PE tetramers were incubated with either PBS (control), 1D12 or 1D22 (4:1VHH:CD1d ratio) after which tetramers were used to stain Jurkat-V.delta.1 cells (final concentration tetramer 2 .mu.g/ml) in combination with CD3-APC. Tetramer binding is prevented by 1D12 and reduced by 1D22 (A). C1R-CD1d cells were incubated with DMSO controls or sulfatide (25 .mu.g/ml) after which medium or anti-CD1d VHH were added at 1000 or 100 nM and incubated for 30 min. Next Jurkat-V.delta.1 cells were added and the co-culture was incubated for an additional 24 h after which CD69 expression was determined by flow cytometry (B). N=3.

[0020] FIG. 3. Dual activation of iNKT cells and V.gamma.9V.delta.2-T cells by a bispecific CD1d and V.gamma.9V.delta.2-TCR targeting VHH resulting in effector cell degranulation and rapid tumor cell lysis. CD1d-expressing CCRF-CEM cells were incubated with either iNKT cells or V.gamma.9V.delta.2-T cells or both at an effector to target ratio of 1:2 in the presence of medium only, monovalent 1D12 or bispecific 1D12-5C8. Robust degranulation (as depicted by CD107a expression) of iNKT cells in the presence of 1D12 was observed, but only simultaneous degranulation of iNKT cells and V.gamma.9V.delta.2-T cells was seen in the presence of the bispecific VHH (A). In accordance, a striking reduction in living CCRF-CEM cells (B) was observed. Data represent mean+SD of 3 individual experiments with iNKT/V.gamma.9V.delta.2-T obtained from different donors.

[0021] FIG. 4. Bispecific 1D12-5C8 supports iNKT and V.gamma.9V.delta.2-T cell expansion and induces tumor growth control. iNKT, V.gamma.9V.delta.2-T or a mixture (2:3 ratio) were incubated with MM.1s-CD1d cells at an effector to target ratio of 1:10 in the presence of medium only or bispecific 1D12-5C8. Clear induction of iNKT cell expansion was observed, however V.gamma.9V.delta.2-T expansion was only observed in the presence of 1D12-5C8 and iNKT cells (A). Noteworthy, tumor growth was contained in the presence of 1D12-5C8 (B). Data represent mean+SD of 3 individual experiments with paired iNKT/V.gamma.9V.delta.2-T obtained from different donors.

[0022] FIG. 5. Anti-CD1d VHH 1D12 and anti-CD1d 51.1 mAb, but not anti-CD1d VHH 1D22, interfere with binding of 1D12-5C8 bispecific VHH. CD1d transfected multiple myeloma cells (MM.1s) were incubated with for 45 min with PBS (negative control, NC), anti-CD1d VHH (1000 nM) or anti-CD1d mAb (100 nM) after which PBS (NC) or biotinylated 1D12-5C8 bispecific VHH (100 nM) was added and incubated for an additional 30 min. After extensive washing samples were stained with streptavidin-APC and analyzed by flow cytometry. Data represent mean+SD of 3 individual experiments, ****P<0.0001, calculated with a two-way analysis of variance with Turkeys's post hoc test.

[0023] FIG. 6. Bispecific antibody 1D12-5C8 promotes survival in a mouse multiple myeloma model in the presence of iNKT and/or .gamma..delta. T cells. Panel A shows the effects of administration of antibody 1D12-5C8 and/or iNKT cells on survival. Panel B shows the effects of administration of antibody 1D12-5C8 and/or .gamma..delta. T cells. Panel C shows the effects of administration of antibody 1D12-5C8 and/or a mixture ("mix") of iNKT and .gamma..delta. T cells.

DETAILED DESCRIPTION OF THE INVENTION

[0024] As described above, in a first main aspect, the invention provides a binding molecule comprising a first binding moiety that is able to compete with single domain antibody 1D12 (SEQ ID NO: 4) in binding to a CD1d molecule, for use in the treatment of disorders caused, maintained and/or propagated by CD1d-restricted V.delta.1+ T-cell activation.

[0025] A "disorder caused, maintained and/or propagated by CD1d-restricted V.delta.1+ T-cell activation" is a disease or disorder in which CD1d-restricted V.delta.1+ T-cell activation initiates, maintains or exacerbates the disease or disorder, or has a negative impact on the prognosis or progression of the disease or disorder. With negative impact is meant that due to the action of the CD1d-restricted V.delta.1+ T-cells the disease is sustained, aggravated, or less attenuated compared with the situation where there would be no action of the V.delta.1+ T-cells. Preferably, the negative impact is due to (anti-)inflammatory effects of activated V.delta.1+ T-cells. Such disorders or diseases in particular include those diseases that require a type 1 helper T (Th1) cell response and are negatively influenced by a T cell response of the type 2 helper T (Th2) cell. The designations "Th1" and "Th2" cells are well known in the art and it is generally believed that Th1 cells are predominantly active towards intracellular microbiota, such as intracellular bacteria and viruses, whereas Th2 cells predominantly activate the humoral immune system (B cells, eosinophils, etc.) in order to combat extracellular microbiota, such as protozoa. Further, Th1 cells promote the killing of tumor cells, whereas Th2 cells counteract such action.

[0026] One example of a disorder caused, maintained, and/or propagated by CD1d-restricted V.delta.1+ T-cell activation is CD1d-restricted peripheral T cell lymphoma (PTCL (Bachy et al (2016) J Exp Med 213 No. 5: 841)). In a preferred embodiment, a binding molecule for use according to the invention is provided, for use in the treatment of hematological malignancies, such as CD1d-restricted peripheral T cell lymphoma (PTCL), CD1d+ T-cell acute lymphoblastic leukemia (ALL), CD1d+ lymphoma, CD1d+ chronic lymphocytic leukemia (CLL), CD1d+ acute myelogenous leukemia (AML), and CD1d+ mantle cell lymphoma, preferably for use in the treatment of CD1d-restricted V.delta.1+ PTCL.

[0027] The "binding molecule" according to the invention may be any kind of binding molecule, for example a complex, as long as it comprises or consists of a first binding moiety as defined by the invention. Preferably the binding molecule is a polypeptide, more preferably an antibody. In certain embodiments the binding molecule may consist of only the first binding moiety that is able to compete with 1D12 (SEQ ID NO: 4) in binding to human CD1d. In other embodiments the binding molecules may consist of the first binding moiety that is able to compete with 1D12 in binding to human CD1d and a label. In even further embodiments the binding molecule may comprise the first binding moiety that is able to compete with 1D12 in binding to human CD1d, linked to a pharmaceutical active agent and/or other binding moiety(s). Thus, a binding molecule may comprise a single binding moiety or multiple, such as two, three or four binding moieties. In a preferred embodiment, the binding molecule comprises two binding moieties, preferably capable of binding to two different epitopes. Preferably the epitopes are on different targets (proteins).

[0028] The term "antibody" as used herein is intended to refer to an immunoglobulin molecule, a fragment of an immunoglobulin molecule, or a derivative of either thereof, which has the ability to specifically bind to an antigen under typical physiological conditions with a half-life of significant periods of time, such as at least about 30 minutes, at least about 45 minutes, at least about one hour, at least about two hours, at least about four hours, at least about 8 hours, at least about 12 hours, about 24 hours or more, about 48 hours or more, about 3, 4, 5, 6, 7 or more days, etc., or any other relevant functionally-defined period (such as a time sufficient to induce, promote, enhance, and/or modulate a physiological response associated with antibody binding to the antigen and/or time sufficient for the antibody to recruit an effector activity). The binding region (or binding domain) which interacts with an antigen, comprises variable regions of both the heavy and light chains of the immunoglobulin molecule. The constant regions of the antibodies (Abs) may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (such as effector cells and T cells) and components of the complement system such as C1q, the first component in the classical pathway of complement activation. In some embodiments, however, the Fc region of the antibody has been modified to become inert, "inert" means an Fc region which is at least not able to bind any Fc.gamma. Receptors, induce Fc-mediated cross-linking of FcRs, or induce FcR-mediated cross-linking of target antigens via two Fc regions of individual proteins, such as antibodies. In a further embodiment, the inert Fc region is in addition not able to bind C1q. In one embodiment, the antibody contains mutations at positions 234 and 235 (Canfield and Morrison (1991) J Exp Med 173:1483), e.g. a Leu to Phe mutation at position 234 and a Leu to Glu mutation at position 235. In another embodiment, the antibody contains a Leu to Ala mutation at position 234, a Leu to Ala mutation at position 236 and a Pro to Gly mutation at position 329.

[0029] As indicated above, the term antibody as used herein, unless otherwise stated or clearly contradicted by context, includes fragments of an antibody that retain the ability to specifically interact, such as bind, to the antigen. It has been shown that the antigen-binding function of an antibody may be performed by fragments of a full-length antibody. Examples of binding fragments encompassed within the term "antibody" include (i) a Fab' or Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains, or a monovalent antibody as described in WO2007059782; (ii) F(ab')2 fragments, bivalent fragments comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting essentially of the VH and CH1 domains; and (iv) a Fv fragment consisting essentially of the VL and VH domains of a single arm of an antibody. Furthermore, although the two domains of the Fv fragment, VL and VH, are coded for by separate genes, they may be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain antibodies or single chain Fv (scFv), see for instance Bird et al., Science 242, 423-426 (1988) and Huston et al., PNAS USA 85, 5879-5883 (1988)). Such single chain antibodies are encompassed within the term antibody unless otherwise noted or clearly indicated by context. Although such fragments are generally included within the meaning of antibody, they collectively and each independently are unique features of the present invention, exhibiting different biological properties and utility. These and other useful antibody fragments in the context of the present invention are discussed further herein. It also should be understood that the term antibody, unless specified otherwise, also includes polyclonal antibodies, monoclonal antibodies (mAbs), chimeric antibodies and humanized antibodies, and antibody fragments retaining the ability to specifically bind to the antigen (antigen-binding fragments) provided by any known technique, such as enzymatic cleavage, peptide synthesis, and recombinant techniques. An antibody as generated can possess any isotype.

[0030] The term "immunoglobulin heavy chain", "heavy chain of an immunoglobulin" or "heavy chain" as used herein is intended to refer to one of the chains of an immunoglobulin. A heavy chain is typically comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region (abbreviated herein as CH) which defines the isotype of the immunoglobulin. The heavy chain constant region typically is comprised of three domains, CH1, CH2, and CH3. The heavy chain constant region may further comprise a hinge region. The term "immunoglobulin" as used herein is intended to refer to a class of structurally related glycoproteins consisting of two pairs of polypeptide chains, one pair of light (L) chains and one pair of heavy (H) chains, all four potentially inter-connected by disulfide bonds. Within the structure of the immunoglobulin (e.g. IgG), the two heavy chains are inter-connected via disulfide bonds in the so-called "hinge region". Equally to the heavy chains each light chain is typically comprised of several regions; a light chain variable region (abbreviated herein as VL) and a light chain constant region (abbreviated herein as CL). The light chain constant region typically is comprised of one domain, CL. Furthermore, the VH and VL regions may be further subdivided into regions of hypervariability (or hypervariable regions which may be hypervariable in sequence and/or form structurally defined loops), also termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs). Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. CDR sequences may be determined by use of various methods, e.g. the methods provided by Choitia and Lesk (1987) J. Mol. Biol. 196:901 or Kabat et al. (1991) Sequence of protein of immunological interest, fifth edition. NIH publication. Various methods for CDR determination and amino acid numbering can be compared on www.abysis.org (UCL).

[0031] The term "isotype" as used herein, refers to the immunoglobulin (sub)class (for instance IgG1, IgG2, IgG3, IgG4, IgD, IgA, IgE, or IgM) or any allotype thereof, such as IgG1m(za) and IgG1m(f) [SEQ ID NO:407]) that is encoded by heavy chain constant region genes. Thus, in one embodiment, the antibody comprises a heavy chain of an immunoglobulin of the IgG1 class or any allotype thereof. Further, each heavy chain isotype can be combined with either a kappa (.kappa.) or lambda (.lamda.) light chain.

[0032] The term "chimeric antibody" as used herein, refers to an antibody wherein the variable region is derived from a non-human species (e.g. derived from rodents) and the constant region is derived from a different species, such as human. Chimeric antibodies may be generated by antibody engineering. "Antibody engineering" is a generic term used for different kinds of modifications of antibodies, and which is a well-known process for the skilled person. Thus, the chimeric antibody may be a genetically engineered recombinant antibody. Some chimeric antibodies may be both genetically or an enzymatically engineered. It is within the knowledge of the skilled person to generate a chimeric antibody, and thus, generation of the chimeric antibody according to the present invention may be performed by other methods than described herein. Chimeric monoclonal antibodies for therapeutic applications are developed to reduce antibody immunogenicity. They may typically contain non-human (e.g. murine) variable regions, which are specific for the antigen of interest, and human constant antibody heavy and light chain domains. The terms "variable region" or "variable domains" as used in the context of chimeric antibodies, refers to a region which comprises the CDRs and framework regions of both the heavy and light chains of the immunoglobulin.

[0033] The term "humanized antibody" as used herein, refers to a genetically engineered non-human antibody, which contains human antibody constant domains and non-human variable domains modified to contain a high level of sequence homology to human variable domains. This can be achieved by grafting of the six non-human antibody complementarity-determining regions (CDRs), which together form the antigen binding site, onto a homologous human acceptor framework region (FR). In order to fully reconstitute the binding affinity and specificity of the parental antibody, the substitution of framework residues from the parental antibody (i.e. the non-human antibody) into the human framework regions (back-mutations) may be required. Structural homology modeling may help to identify the amino acid residues in the framework regions that are important for the binding properties of the antibody. Thus, a humanized antibody may comprise non-human CDR sequences, primarily human framework regions optionally comprising one or more amino acid back-mutations to the non-human amino acid sequence, and fully human constant regions. Optionally, additional amino acid modifications, which are not necessarily back-mutations, may be applied to obtain a humanized antibody with preferred characteristics, such as affinity and biochemical properties. The amino acid sequence of an antibody of non-human origin is distinct from antibodies of human origin, and therefore a non-human antibody is potentially immunogenic when administered to human patients. However, despite the non-human origin of the antibody, its CDR segments are responsible for the ability of the antibody to bind to its target antigen and humanization aims to maintain the specificity and binding affinity of the antibody. Thus, humanization of non-human therapeutic antibodies is performed to minimize its immunogenicity in man while such humanized antibodies at the same time maintain the specificity and binding affinity of the antibody of non-human origin.

[0034] In one aspect, the present invention relates to a multispecific antibody comprising at least a first binding moiety of a binding molecule according to any aspect or embodiment herein described, and one or more binding moieties which binds one or more different targets than the first binding region. Such a multispecific antibody may be a bispecific, a trispecific, or a tetraspecific antibody.

[0035] The term "multispecific antibody" refers to an antibody having specificities for at least two different, such as at least three, typically non-overlapping, epitopes. Such epitopes may be on the same or different targets. If the epitopes are on different targets, such targets may be on the same cell or different cells or cell types.

[0036] The term "bispecific antibody" refers to an antibody having specificities for at least two different, typically non-overlapping, epitopes. Such epitopes may be on the same or different targets. If the epitopes are on different targets, such targets may be on the same cell or different cells or cell types. In one embodiment, the bispecific antibody comprises a first and a second heavy chain.

[0037] Examples of bispecific antibody molecules which may be used in the present invention comprise (i) a single antibody that has two arms comprising different antigen-binding regions, (ii) a single chain antibody that has specificity to two different epitopes, e.g., via two scFvs linked in tandem by an extra peptide linker; (iii) a dual-variable-domain antibody (DVD-IgTM), where each light chain and heavy chain contains two variable domains in tandem through a short peptide linkage; (iv) a chemically-linked bispecific (Fab')2 fragment; (v) a TandAb.RTM., which is a fusion of two single chain diabodies resulting in a tetravalent bispecific antibody that has two binding sites for each of the target antigens; (vi) a flexibody, which is a combination of scFvs with a diabody resulting in a multivalent molecule; (vii) a so called "dock and lock" molecule (Dock-and-Lock.RTM.), based on the "dimerization and docking domain" in Protein Kinase A, which, when applied to Fabs, can yield a trivalent bispecific binding protein consisting of two identical Fab fragments linked to a different Fab fragment; (viii) a so-called Scorpion molecule, comprising, e.g., two scFvs fused to both termini of a human Fab-arm; and (ix) a diabody.

[0038] Examples of different classes of bispecific antibodies include but are not limited to (i) IgG-like molecules with complementary CH3 domains to force heterodimerization; (ii) recombinant IgG-like dual targeting molecules, wherein the two sides of the molecule each contain the Fab fragment or part of the Fab fragment of at least two different antibodies; (iii) IgG fusion molecules, wherein full length IgG antibodies are fused to extra Fab fragment or parts of Fab fragment; (iv) Fc fusion molecules, wherein single chain Fv molecules or stabilized diabodies are fused to heavy-chain constant-domains, Fc-regions or parts thereof; (v) Fab fusion molecules, wherein different Fab-fragments are fused together, fused to heavy-chain constant-domains, Fc-regions or parts thereof; and (vi) ScFv- and diabody-based and heavy chain antibodies (e.g., domain antibodies, Nanobodies.RTM.) wherein different single chain Fv molecules or different diabodies or different heavy-chain antibodies (e.g. domain antibodies, Nanobodies.RTM.) are fused to each other or to another protein or carrier molecule fused to heavy-chain constant-domains, Fc-regions or parts thereof.

[0039] Examples of IgG-like molecules with complementary CH3 domains molecules include but are not limited to the Triomab.RTM. (Trion Pharma/Fresenius Biotech), the Knobs-into-Holes (Genentech), CrossMAbs (Roche) and the electrostatically-matched (Amgen, Chugai, Oncomed), the LUZ-Y (Genentech, Wranik et al. J. Biol. Chem. 2012, 287(52): 43331-9, doi: 10.1074/jbc.M112.397869. Epub 2012 Nov. 1), DIG-body and PIG-body (Pharmabcine, WO2010134666, WO2014081202), the Strand Exchange Engineered Domain body (SEEDbody)(EMD Serono), the Biclonics (Merus, WO2013157953), FcAAdp (Regeneron), bispecific IgG1 and IgG2 (Pfizer/Rinat), Azymetric scaffold (Zymeworks/Merck,), mAb-Fv (Xencor), bivalent bispecific antibodies (Roche, WO2009080254) and DuoBody.RTM. molecules (Genmab).

[0040] Examples of recombinant IgG-like dual targeting molecules include but are not limited to Dual Targeting (DT)-Ig (GSK/Domantis, WO2009058383), Two-in-one Antibody (Genentech, Bostrom, et al 2009. Science 323, 1610-1614), Cross-linked Mabs (Karmanos Cancer Center), mAb2 (F-Star), Zybodies.TM. (Zyngenia, LaFleur et al. MAbs. 2013 March-April; 5(2):208-18), approaches with common light chain, KABodies (NovImmune, WO2012023053) and CovX-body (CovX/Pfizer, Doppalapudi, V. R., et al 2007. Bioorg. Med. Chem. Lett. 17, 501-506).

[0041] Examples of IgG fusion molecules include but are not limited to Dual Variable Domain (DVD)-IgTM (Abbott), Dual domain double head antibodies (Unilever; Sanofi Aventis), IgG-like Bispecific (ImClone/Eli Lilly, Lewis et al. Nat Biotechnol. 2014 February; 32(2):191-8), Ts2Ab (Medimmune/AZ, Dimasi et al. J Mol Biol. 2009 Oct. 30; 393(3):672-92) and BsAb (Zymogenetics, WO2010111625), HERCULES (Biogen Idec), scFv fusion (Novartis), scFv fusion (Changzhou Adam Biotech Inc) and TvAb (Roche).

[0042] Examples of Fc fusion molecules include but are not limited to ScFv/Fc Fusions (Academic Institution, Pearce et al Biochem Mol Biol Int. 1997 September; 42(6):1179), SCORPION (Emergent BioSolutions/Trubion, Blankenship J W, et al. AACR 100th Annual meeting 2009 (Abstract #5465); Zymogenetics/BMS, WO2010111625), Dual Affinity Retargeting Technology (Fc-DARTTM) (MacroGenics) and Dual(ScFv)2-Fab (National Research Center for Antibody Medicine--China).

[0043] Examples of Fab fusion bispecific antibodies include but are not limited to F(ab)2 (Medarex/AMGEN), Dual-Action or Bis-Fab (Genentech), Dock-and-Lock.RTM. (DNL) (ImmunoMedics), Bivalent Bispecific (Biotecnol) and Fab-Fv (UCB-Celltech).

[0044] Examples of ScFv-, diabody-based and domain antibodies include but are not limited to Bispecific T Cell Engager (BiTE.RTM.) (Micromet, Tandem Diabody (Tandab) (Affimed), Dual Affinity Retargeting Technology (DARTTM) (MacroGenics), Single-chain Diabody (Academic, Lawrence FEBS Lett. 1998 Apr. 3; 425(3):479-84), TCR-like Antibodies (AIT, ReceptorLogics), Human Serum Albumin ScFv Fusion (Merrimack, WO2010059315) and COMBODY molecules (Epigen Biotech, Zhu et al. Immunol Cell Biol. 2010 August; 88(6):667-75), dual targeting Nanobodies.RTM. (Ablynx, Hmila et al., FASEB J. 2010), dual targeting heavy chain only domain antibodies.

[0045] A "binding moiety" in the context of the present invention is a moiety, preferably a polypeptide, more preferably an antibody, that is capable of specifically binding to a target. A binding moiety may, e.g., comprise: an intact immunoglobulin molecule such as a monoclonal antibody. Alternatively, the binding moiety can comprise an antigen-binding functional fragment, including, but not limited to, Fab, F(ab'), F(ab')2, Fv, dAb, Fd, a complementarity determining region (CDR) fragment, a single chain antibody (scFv), a divalent single chain antibody, a single chain phage antibody, a bispecific double chain antibody, a triabody, a tetrabody, a single domain antibody (nanobody), a (poly)peptide containing at least an amino acid sequence that is sufficient to specifically bind to its target, and artificial immunoglobulin fragments, such as plastic antibodies (Hoshino et al (2008) J Am Chem Soc 130(46):15242). In a preferred embodiment, a binding moiety of the present invention is a single domain antibody. Preferably, a binding moiety of the present invention comprises three heavy chain CDRs.

[0046] The term "specifically binds" as used herein, refers to the binding of a binding moiety or binding molecule to a predetermined antigen or target (e.g. human CD1d) to which binding typically is with an affinity corresponding to a K.sub.D of about 10.sup.-6 M or less, e.g. 10.sup.-7 M or less, such as about 10.sup.-8 M or less, such as about 10.sup.-9 M or less, about 10.sup.-10 M or less, or about 10.sup.-11 M or even less when determined by for instance surface plasmon resonance (SPR) technology in a BIAcore 3000 instrument using the antigen as the ligand and the binding moiety or binding molecule as the analyte, and binds to the predetermined antigen with an affinity corresponding to a K.sub.D that is at least ten-fold lower, such as at least 100 fold lower, for instance at least 1,000 fold lower, such as at least 10,000 fold lower, for instance at least 100,000 fold lower than its affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely-related antigen. The degree with which the affinity is lower is dependent on the K.sub.D of the binding moiety or binding molecule, so that when the K.sub.D of the binding moiety or binding molecule is very low (that is, the binding moiety or binding molecule is highly specific), then the degree with which the affinity for the antigen is lower than the affinity for a non-specific antigen may be at least 10,000 fold. The term "K.sub.D" (M), as used herein, refers to the dissociation equilibrium constant of a particular interaction between the antigen and the binding moiety or binding molecule.

[0047] As mentioned, a binding moiety described above is able to compete for binding to human CD1d with single domain antibody 1D12. In the context of the present invention, "competition" or "able to compete" or "compete" refers to any detectably significant reduction in the propensity for a particular binding molecule (e.g. a CD1d antibody) to bind a particular binding partner (e.g. CD1d) in the presence of another molecule (e.g. a different CD1d antibody) that binds the binding partner. Typically, competition means an at least about 25 percent reduction, such as an at least about 50 percent, e.g. an at least about 75 percent, such as an at least 90 percent reduction in binding between a CD1d binding molecule or moiety, caused by the presence of another CD1d binding molecule or moiety as determined by, e.g., ELISA analysis or flow cytometry using sufficient amounts of the two or more competing binding molecules or moieties. Additional methods for determining binding specificity by competitive inhibition may be found in for instance Harlow et al., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1988), Colligan et al., eds., Current Protocols in Immunology, Greene Publishing Assoc, and Wiley InterScience N. Y., (1992, 1993), and Muller, Meth. Enzymol. 92, 589-601 (1983)). Preferably, the binding molecule of the present invention binds to at least part of or in the vicinity of the same epitope on CD1d as antibody 1D12, more preferably to the same epitope as 1D12 or to an epitope that overlaps with the epitope of 1D12. Methods for determining the epitope of a binding molecule, such as an antibody are known in the art. With "in the vicinity of" is meant that it binds CD1d such that the binding molecule at least sterically hinders binding of 1D12 to CD1d. The binding molecule of the present invention may comprise identical or different CDR sequences as 1D12. In a more preferred embodiment, the binding molecule of the present invention comprises identical CDR1 (SEQ ID NO 1), CDR2 (SEQ ID NO: 2) and CDR3 (SEQ ID NO: 3) sequences as 1D12. In a most preferred embodiment, the binding molecule of the present invention comprises an identical sequence as that of 1D12 (SEQ ID NO: 4) or it comprises the sequence set forth in SEQ ID NO: 85).

[0048] As described above, in a further main aspect, the invention provides a binding molecule comprising a first binding moiety that is able to compete with 1D12 (the antibody set forth in SEQ ID NO: 4) in binding to a CD1d molecule and comprising a second binding moiety that is able to specifically bind to a V.gamma.9V.delta.2-TCR. "Specifically binds to a V.gamma.9V.delta.2-TCR" means that the binding molecule binds V.gamma.9V.delta.2-TCR, but does not exclude that the binding molecule binds to one of the separate subunits in the absence of the other subunit, i.e. to the V.gamma.9 chain alone or to the V.delta.2 chain alone. For example, as can be seen in Table 2 herein, antibody 5C8 is an antibody that binds the V.gamma.9V.delta.2-TCR, but also binds the V.delta.2 chain when the V.delta.2 chain is expressed alone.

[0049] In a preferred embodiment, the binding molecule binds the V.delta.2 chain of V.gamma.9V.delta.2-TCR. Furthermore, preferably, the binding molecule is able to activate V.gamma.9V.delta.2 T cells independently of its natural ligand. The invention provides the insight that such a binding molecule comprising a bispecific immunoglobulin-complex is able to inhibit V.delta.1+ T cells and enables activation of (V.gamma.9)V.delta.2+ T cells. Activation of V.gamma.9V.delta.2 T cells is beneficial for the treatment of a plethora of diseases. A V.delta.2 TCR chain specific immunoglobulin is preferred over a V.gamma.9 TCR chain specific immunoglobulin, as V.gamma.9 might pair with, e.g., V.delta.1 TCR chain, resulting in attracting and activating a potentially counterproductive .gamma..delta.-T cell.

[0050] The term "first" and "second" binding moiety does not refer to their orientation/position in the binding molecule, i.e. it has no meaning with regard to the N- or C-terminus. The term "first" and "second" only serves to correctly and consistently refer to the two different binding moieties in the claims and the description. In one preferred embodiment, the first binding moiety and the second binding moiety are coupled to each other through one or more amide bond(s), preferably through a linker, more preferably comprising the amino acids GGGGS (SEQ ID NO: 83). Two, non-limiting, examples of binding molecules according to the invention comprising a first and a second binding moiety linked through a peptide linker (GGGGS), are depicted in Table 1 (SEQ ID NO: 84 and SEQ ID NO: 87). In another preferred embodiment, the binding molecule is a bispecific antibody, such as a full-length bispecific antibody. The term "full-length antibody" when used herein, refers to an antibody which contains all heavy and light chain constant and variable domains corresponding to those that are normally found in a wild-type antibody of that isotype.

[0051] With "able to activate V.gamma.9V.delta.2 T cells" in the context of the present invention is meant that V.gamma.9V.delta.2 T cells are activated in the presence of the binding molecule according to the invention, in particular in the presence of a target cell expressing CD1d. Preferably the activation of the V.gamma.9V.delta.2 T cells is measurable through gene-expression and/or (surface) marker expression (e.g., activation markers, such as CD25, CD69, or CD107a) and/or secretory protein (e.g., cytokines or chemokines) profiles. In a preferred embodiment, the binding molecule is able to induce activation (e.g. upregulation of CD69 and/or CD25 expression) resulting in degranulation (marked by an increase in CD107a expression; Example 3) and cytokine production (e.g. TNF.alpha., IFN.gamma.) by V.gamma.9V.delta.2 T cells. Preferably activation of V.gamma.9V.delta.2 T cells takes place in vivo, particularly in a human body that has been administered a binding molecule according to the invention and which human body comprises V.gamma.9V.delta.2 T cells and preferably CD1d+ target cells. Preferably, a binding molecule of the present invention is able to increase CD107a expression on V.gamma.9V.delta.2 T cells to at least 10%, more preferably at least 20%, more preferably at least 40%, most preferably at least 90%, when used in an assay as described in Example 3, wherein e.g. 10% means that 10% of the total number of cells is positive for CD107a. In another embodiment, the number of cells positive for CD107a is increased 1.5-fold, such as 2-fold, e.g. 5-fold, in the presence of a binding molecule of the invention.

[0052] Similarly, for iNKT cells, "able to activate" in the context of the present invention means that iNKT cells behave differently in the presence of a binding molecule or a binding molecule for use according to the invention, in particular in the presence of a CD1d molecule, preferably in the presence of a CD1d molecule on a cell surface. Markers, such as CD25 (Example 1), CD69, CD107a (Example 3), or cytokines/chemokines, such as IFN.gamma. (Example 1), TNF.alpha., IL-2, are used to determine whether iNKT cells are activated. Preferably the activation of iNKT cells takes place in vivo, particularly in a human body that has been administered a binding molecule according to the invention and which human body comprises iNKT cells and preferably CD1d+ target cells. With CD1d+ target cells are meant CD 1d+ cells that contribute to disease pathogenicity and not normal CD1d-expressing cells. Preferably a binding molecule of the present invention is able to increase CD107a expression on iNKT cells to at least 20%, more preferably to least 30%, most preferably to least 40%, when used in an assay as described in Example 3, wherein e.g. 10% means that 10% of the total number of cells is positive for CD107a. In another embodiment, the number of cells positive for CD107a is increased 1.5-fold, such as 2-fold, e.g. 5-fold, in the presence of a binding molecule of the invention. Furthermore, preferably a binding molecule of the present invention is able to increase CD25 expression on iNKT cells to at least 10 fold, more preferably to at least 20 fold, most preferably to at least 30 fold compared to a "vehicle" control, as measured mean fluorescence intensity by flow cytometry, using allophycocyanin (APC)-conjugated CD25 in a FACS, when used in an assay as described in Example 1. Preferably, a binding molecule of the present invention is able to increase IFN.gamma. expression by iNKT cells at least 1.5-fold, such as at least 2-fold or at least 3-fold, when used in an assay as described in Example 1.

[0053] The bispecific (or multispecific) binding molecule preferably induces a Th1 type response. In a preferred embodiment, a binding molecule comprising a first and a second binding moiety according to the invention is provided for use as a medicament, preferably for use in the treatment of a tumor. With tumor within the context of the present invention is meant: An abnormal mass of tissue, either in one location (e.g. solid tumors) or distributed over the human body (e.g. metastases). In addition, abnormal mass of tissue is also meant to refer to disseminated tumors (e.g. liquid hematological tumors). Tumors are also a classical sign of inflammation. However, such inflammation (non-cancerous) tumors and other non-malignant tumors are not included within the definition here. In a preferred embodiment, the tumor is a cancer, especially one with the potential to cause death. Treatment of tumors is specific to the location and type of the tumor. Benign tumors can sometimes simply be ignored, or they may be reduced in size (debulked) or removed entirely via surgery. For malignant or some benign tumors, options include chemotherapy, radiation, and surgery. Tumors of the hematopoietic and lymphoid tissues (so called blood tumors) are also included and comprise, inter alia, leukemias, such as ALL, AML, CLL, small lymphocytic lymphoma (SLL), chronic myelogenous leukemia (CML), and acute monocytic leukemia (AMoL), lymphomas, such as Hodgkin's lymphomas and Non-Hodgkin's lymphomas, and myelomas.

[0054] In a preferred embodiment, a binding molecule comprising a first binding moiety according to the invention, or a binding molecule comprising a first and a second binding moiety, for use according to the invention is provided, wherein the binding molecule is able to reduce V.delta.1 T cell activation. Reducing V.delta.1 T cell activation in this context means that a V.delta.1 T cell is no longer able to recognize its ligand on a CD1d molecule that is bound to a binding molecule as defined in the invention. Such reduced V.delta.1 T cell activation can, e.g., be determined by measuring the expression of activation marker CD69 on V.delta.1+ T cells. Lower CD69 expression levels are observed in less activated V.delta.1+ T cells, e.g., Jurkat cells as used in Example 2. In particular when used in the context of V.delta.1+ tumor cells, blocking means that the presence of the binding molecule according to the invention has a negative impact on tumor cell growth and/or viability. Preferably, CD69 expression on Jurkat cells is increased less than 5-fold, such as less than 2-fold by a binding molecule according to the invention, as compared to "vehicle" control when tested in an assay as described in Example 2.

[0055] Preferably, the binding molecule for use according to the invention is able to activate iNKT cells. As said before, the inventors have shown that 1D12 is able to activate iNKT cells, irrespective of the presence of an exogenous ligand for iNKT cells, such as .alpha.-galactosylceramide. The present invention further provides the insight that CD1d recognition by V.delta.1+ T cells can be blocked by such binding molecules and that the presence of a second binding moiety in a binding molecule according to the invention enables the activation of V.delta.2+ T cells. Such triple acting binding molecule, i.e. capable of reducing activation of CD1d-restricted V.delta.1+ T cells and activating iNKT cells, and at the same time allowing activation of V.delta.2+ T cells, create a micro-environment that is skewed towards a Th1-type anti-tumor response. The reduced activation of V.delta.1+ T cells, the activation of iNKT cells, and the activation of V.delta.2+ T cells synergize towards a tumor-aggressive micro-environment promoting effective tumor-cell killing.

[0056] A binding molecule according to the invention can thus be modified such that it not only reduces activation of V.delta.1+ T cells and activates iNKT cells, but also binds and activates V.delta.2+ T cells through clustering of V.gamma.9V.delta.2-TCR on .gamma..delta.-T cells. For this, a second binding moiety is encompassed within the binding molecule according to the invention. This second binding moiety is able to bind to a V.gamma.9V.delta.2-TCR, preferably to the V.delta.2 chain. Several such antibodies, which bind to the V.delta.2 chain or the V.gamma.9 chain of the TCR have been described in WO2015156673 and are depicted in Table 1 and Table 2. In a further aspect, the invention provides a method of treating a subject in need thereof, comprising administering to the subject a first binding molecule according to the invention comprising a first and a second binding moiety, wherein the first moiety binds to CD1d and the second binding moiety binds to a V.gamma.9V.delta.2-TCR, in combination with a second binding molecule as defined previously, comprising a binding moiety that binds to CD1d, but not comprising a binding moiety that binds to V.gamma.9V.delta.2-TCR. Such a combination treatment might in particular be useful if the first and second binding molecules have their effects at very different concentrations. E.g. an excess of a CD1d antibody which blocks at high concentration could be combined with an CD1d/V.gamma.9V.delta.2 antibody which activates .gamma..delta.-T cells at low concentration.

TABLE-US-00001 TABLE 1 Designation of VHH (CDR), TCR chains, and sequences of the various VHHs comprised within a binding molecule according to the invention. SEQ ID. code Description Sequence 1 1D12 CDR1 DNVMG 2 1D12 CDR2 TIRTGGSTNYADSVKG 3 1D12 CDR3 TIPVPSTPYDY 4 1D12 QVQLVESGGGLVQAGGSLRLSCAASGSMFSDNVM GWYRQAPGKQRELVATIRTGGSTNYADSVKGRFT ISRDNAKNTVYLQMNSLKPEDTAVYYCRHTIPVP STPYDYWGQGTQVTVSS 5 5E3 CDR1 SYAMG 6 5E3 CDR2 AISWSGGTTYYADSVKG 7 5E3 CDR3 SLDCSGPGCHTAEYDY 8 6H1 CDR1 SYAMG 9 6H1 CDR2 AISWTGSKTYYADSVKG 10 6H1 CDR3 SSDCSGPGCHTEEYDY 11 5G3 CDR1 SYAMG 12 5G3 CDR2 AVSWSGGSTYYADSVKG 13 5G3 CDR3 SQDCSGPGCYTNEYDS 14 5C1 CDR1 NYAMA 15 5C1 CDR2 AVSWSGGRTYYADSVKG 16 5C1 CDR3 SLSCSGPGCSLEEYDY 17 5D3 CDR1 NYAMG 18 5D3 CDR2 VISWSGGSTYYADSVKG 19 5D3 CDR3 QFSGASTVVAGTALDYDY 20 6E3 CDR1 NYGMG 21 6E3 CDR2 GISWSGGSTDYADSVKG 22 6E3 CDR3 VFSGAETAYYPSDDYDY 23 6H4 CDR1 NYGMG 24 6H4 CDR2 GISWSGGSTDYADSVKG 25 6H4 CDR3 VFSGAETAYYPSDDYDY 26 6C1 CDR1 NYGMG 27 6C1 CDR2 GISWSGGSTDYADSVKG 28 6C1 CDR3 VFSGAETAYYPSDDYDY 29 6H3 CDR1 NYGMG 30 6H3 CDR2 GITWSGGSTHYADLVKG 31 6H3 CDR3 VFSGAETAYYPSTEYDY 32 6G3 CDR1 NYGMG 33 6G3 CDR2 GISWSGGSTYYADSVKG 34 6G3 CDR3 VFSGAETAQYPSYDYDY 35 5C8 CDR1 NYAMG 36 5C8 CDR2 AISWSGGSTSYADSVKG 37 5C8 CDR3 QFSGADYGFGRLGIRGYEYDY 38 5F5 CDR1 NYAMG 39 5F5 CDR2 AISWSGGSTYYADSVKG 40 5F5 CDR3 MFSGSESQLVVVITNLYEYDY 41 6A1 CDR1 NYAMG 42 6A1 CDR2 TISWSGGSTYYADSVKG 43 6A1 CDR3 AFSGSDYANTKKEVEYDY 44 6E4 CDR1 DYCIA 45 6E4 CDR2 CITTSDGSTYYADSVKG 46 6E4 CDR3 YFGYGCYGGAQDYRAMDY 47 5C7 CDR1 RYTMG 48 5C7 CDR2 AISWSGGRTNFAGSVKG 49 5C7 CDR3 DWLPVPGRESYDY 50 5D7 CDR1 NYAMG 51 5D7 CDR2 AISWSGGMTDHADSVKG 52 5D7 CDR3 AFAGDIPYGSSWYGDPTTYDY 53 5B11 CDR1 TFSMA 54 5B11 CDR2 AINWSGGSTRYADSVSD 55 5B11 CDR3 RRGGIYYSTQNDYDY 56 6C4 CDR1 DYRMG 57 6C4 CDR2 TISWSGGLTYYADSVKG 58 6C4 CDR3 GGGYAGGTYYHPEE 59 5E3 VHH EVQLVESGGGLVQAGGSLRLSCTASGRTFSSYAM GWFRQAPGKEREFVAAISWSGGTTYYADSVKGRF TISRDNAKNTVSLQMNSLKPEDTAVYFCAASLDC SGPGCHTAEYDYWGQGTQVTVSS 60 6H1 VHH EVQLVESGGGLVQAGGSLRLSCAATGRTFSEYAM GWFRQAPGKEREFAAAISWTGSKTYYADSVKGRF TISRDNAKNTVYLQMNSLKPEDTAVYYCAASSDC SGPGCHTHEYDYWGQGTQVTVSS 61 5G3 VHH EVQLVESGGGLVQAGGSLRLSCAASGRTFSSYAM GWFRQAPGKEREFVAAVSWSGGSTYYADSVKGRF TISRDNARNTVYLQMNSLNPEDTAVYYCAASQDC SGPGCYTNEYDSWGQGTQVTVSS 62 5C1 VHH EVQLVESGGGLVQPGGSLRLSCAASGSIFSNYAM AWFRQAPEKERDFLAAVSWSGGRTYYADSVKGRF TISRDNAKNTVNLQMNSLKPEDTAVYYCAASLSC SGPGCSLEEYDYWGQGTQVTVSS 63 5D3 VHH EVQLVESGGGLVQAGGSLRLSCAASGRPFSNYAM GWFRQAPGKEREFVTVISWSGGSTYYADSVKGRF TISRDNAKNTVYLQMNSLKPEDTAVYYCAAQFSG ASTVVAGTALDYDYWGQGTRVTVSS 64 6E3 VHH EVQLVESGGGLVQAGGSLRLSCAASGRPFSNYGM GWFRQAPGKKREFVAGISWSGGSTDYADSVKGRL TISRDNAKNTVYLQMNSLKPEDTAVYYCAAVFSG AETAYYPSDDYDYWGQGTQVTVSS 65 6H4 VHH EVQLVESGGGLVQAGGSLRLSCAASGRPFSNYGM GWFRQAPGKKREFVAGISWSGGSTDYADSVKGRF TISRDNAKNTVYLQMNSLKPEDTAVYYCAAVFSG AETAYYPSDDYDYWGQGTQVTVSS 66 6C1 VHH EVQLVESGGGLVQAGGSLRLSCAASGRPFSNYGM GWFRQAPGKKRESVAGISWSGGSTDYADSVKGRF TISRDNAKNTVYLQMNSLKPEDTAVYYCAAVFSG AETAYYPSDDYDYWGQGTQVTVSS 67 6H3 VHH EVQLVESGGGLVQAGGSLRLSCAVSGRPFSNYGM GWFRQAPGKEREFVAGITWSGGSTHYADLVKGRF TISRDNAKNTVHLQMNSLKPEDTAVYYCAAVFSG AETAYYPSTEYDYWGQGTQVTVSS 68 6G3 VHH EVQLVESGGGLVQAGGSLRLSCAASGRPFNNYGM GWFRQAPGKEREFVAGISWSGGSTYYADSVKGRF TISRDNAKNTVYLQMNSLKPEDTAVYYCAAVFSG AETAQYPSYDYDYWGQGTQVTVSS 69 5C8 VHH EVQLVESGGGLVQAGGSLRLSCAASGRPFSNYAM GWFRQAPGKEREFVAAISWSGGSTSYADSVKGRF TISRDNAKNTVYLQMNSPKPEDTAIYYCAAQFSG ADYGFGRLGIRGYEYDYWGQGTQVTVSS 70 555 VHH EVQLVESGGGLVQAGGSLRLSCAASGRTFSNYAM GWFRQAPGKEREFVAAISWSGGSTYYADSVKGRF TISRDNAKNTVYLQMNSLKPEDTAVYYCAAMFSG SESQLVVVITNLYEYDYWGQGTQVTVSS 71 6A1 VHH EVQLVESGGGLVQAGGSLRLSCAASGRTFSNYAM GWFRQAPGKEREFVATISWSGGSTYYADSVKGRF TISRDNAKNTVYLQMNSLKPEDTAVYYCAAAFSG SDYANTKKEVEYDYWGQGTQVIVSS 72 6E4 VHH EVQLVESGGGLVQAGGSLRLSCAASGFTFDDYCI AWFRQAPGKEREPVSCITTSDGSTYYADSVKGRF TISSDNAKNTVYLQMNRLKPEDTAVYYCAAYFGY GCYGGAQDYRAMDYWGKGTLVTVSS 73 5C7 VHH EVQLVESGGGLVQAGDSLRLSCAASGRTFSRYTM GWFRQAPGKEREFVAAISWSGGRTNFAGSVKGRF TISRDNAKNTVYLQMNSLKPEDTAVYYCAADWLP VPGRESYDYWGQGTQVTVSS 74 5D7 VHH EVQLVESGGGLVQAGGSLRLSCIASGRTFSNYAM GWFRQAPGKEREFVAAISWSGGMTDHADSVKGRF TISRDNAKNTVYLQMNSLKPEDTAVYYCAAAFAG DIPYGSSWYGDPTTYDYWGQGTQVTVSS 75 5B11 VHH EVQLVESGGGLVQAGGSLRLSCAASGRTSSTFSM AWFRQAPRKEREFVAAINWSGGSTRYADSVSDRF AISRDNAKNTVYLQMNNLKPEDTAVYYCAARRGG IYYSTQNDYDYWGQGTQVTVSS 76 6C4 VHH EVQLVESGGGLVQAGGSLRLSCAVSVRTFSDYRM GWFRQAPGKEREFVSTISWSGGLTYYADSVKGRF TISRDNSKNTLYLQMNSLKPEDTAVYYCAAGGGY AGGTYYHPEEWGQGTQVTVSS 77 Human TCR MLSLLHASTLAVLGALCVYGAGHLEQPQISSTKT V.gamma.9 LSKTARLECVVSGITISATSVYWYRERPGEVIQF chain LVSISYDGTVRKESGIPSGKFEVDRIPETSTSTL TIHNVEKQDIATYYCALWEAQQELGKKIKVFGPG TKLIITDKQLDADVSPKPTIFLPSIAETKLQKAG TYLCLLEKFFPDVIKIHWEEKKSNTILGSQEGNT MKTNDTYMKFSWLTVPEKSLDKEHRCIVRHENNK NGVDQEIIFPPIKTDVITMDPKDNCSKDANDTLL LQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRT AFCCNGEKS 78 Human TCR MQRISSLIHLSLFWAGVMSAIELVPEHQTVPVSI V.delta.2 GVPATLRCSMKGEAIGNYYINWYRKTQGNTMTFI chain YREKDIYGPGFKDNFQGDIDIAKNLAVLKILAPS ERDEGSYYCACDTLGMGGEYTDKLIFGKGTRVTV EPRSQPHTKPSVFVMKNGINVACLVKEFYPKDIR INLVSSKKITEFDPAIVISPSGKYNAVKLGKYED SNSVTCSVQHDNKTVHSTDFEVKTDSTDHVKPKE TENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLR MLFAKTVAVNFLLTAKLFFL 79 1D22 CDR1 NAMG 80 1D22 CDR2 VISSSGSTNYADSVKG 81 1D22 CDR3 HVAGFDEYNY 82 1D22 VHH QVQLVESGGGLVQAGGSLRLSCAASGSIFSINAM GWYRQAPGKQRDFLAVISSSGSTNYADSVKGRFT ISRDNAKNTAYLQMNSLKVEDTAVYYCAAHVAGF DEYNYWGQGTQVTVSS 83 GS- Linker GGGGS linker

84 1D12- Bispecific QVQLVESGGGLVQAGGSLRLSCAASGSMFSDNVM 5C8 binding GWYRQAPGKQRELVATIRTGGSTNYADSVKGRFT molecule ISRDNAKNTVYLQMNSLKPEDTAVYYCRHTIPVP STPYDYWGQGTQVTVSSGGGGSEVQLVESGGGLV QAGGSLRLSCAASGRPFSNYAMGWFRQAPGKERE FVAAISWSGGSTSYADSVKGRFTISRDNAKNTVY LQMNSPKPEDTAIYYCAAQFSGADYGFGRLGIRG YEYDYWGQGTQVTVSS 85 1D12 VHH EVQLVESGGGLVQAGGSLRLSCAASGSMFSDNVM var GWYRQAPGKQRELVATIRTGGSTNYADSVKGRFT ISRDNAKNTVYLQMNSLKPEDTAVYYCRHTIPVP STPYDYWGQGTQVTVSS 86 5C8 VHH EVQLLESGGGSVQPGGSLRLSCAASGRPFSNYAM var 1 SWFRQAPGKEREFVSAISWSGGSTSYADSVKGRF TISRDNSKNTLYLQMNSLRAEDTAVYYCAAQFSG ADYGEGRLGIRGYEYDYWGQGTQVTVSS 87 1D12- Bispecific EVQLVESGGGLVQAGGSLRLSCAASGSMFSDNVM 5C8 binding GWYRQAPGKQRELVATIRTGGSTNYADSVKGRFT var molecule ISRDNAKNTVYLQMNSLKPEDTAVYYCRHTIPVP STPYDYWGQGTQVTVSSGGGGSEVQLLESGGGSV QPGGSLRLSCAASGRPFSNYAMSWERQAPGKERE FVSAISWSGGSTSYADSVKGRFTISRDNSKNTLY LQMNSLRAEDTAVYYCAAQFSGADYGFGRLGIRG YEYDYWGQGTQVTVSS 88 5C8 VHH EVQLLESGGGLVQPGGSLRLSCAASGRPFSNYAM var 2 SWFRQAPGKEREFVSAISWSGGSTSYADSVKGRF TISRDNSKNTLYLQMNSLRAEDTAVYYCAAQFSG ADYGFGRLGIRGYEYDYWGQGTLVTVSS

TABLE-US-00002 TABLE 2 From WO2015156673: Binding of VHHs to .gamma..delta. T- cells expressing a V.gamma.9 or V.delta.2 chain (paired with a non V.delta.2 or V.gamma.9 chain respectively), expressing the complete V.gamma.9V.delta.2 TCR, or not expressing any of the V.gamma.9V.delta.2 TCR chains. "-" indicates a Mean Fluorescence Index (MFI) below 1.5, "+/-" indicates an MFI of between 1.5 and 4.5, "+" indicates an MFI of between 4.6 and 20 and "++" indicates an MFI above 20. SEQ ID Ref V.delta.2+ V.gamma.9+ V.gamma.9V.delta.2+ V.gamma.9V.delta.2- 59 5E3 - ++ ++ - 60 6H1 - ++ ++ - 61 5G3 - ++ ++ - 62 5C1 +/- ++ ++ - 63 5D3 ++ - ++ - 64 6E3 ++ - ++ - 65 6H4 ++ - ++ - 66 6C1 ++ - ++ - 67 6H3 ++ +/- ++ - 68 6G3 ++ - ++ - 69 5C8 ++ - ++ - 70 5F5 ++ - ++ - 71 6A1 ++ - ++ - 72 6E4 ++ - ++ - 73 5C7 +/- - +/- - 74 5D7 ++ - ++ - 75 5B11 - - + - 76 6C4 +/- ++ ++ -

Thus, further provided is a binding molecule according to the invention, or a binding molecule for use according to the invention, wherein the second binding moiety is able to compete with binding to a V.gamma.9V.delta.2-TCR with single domain antibody 5E3 (SEQ ID NO: 59), 6H1 (SEQ ID NO: 60), 5G3 (SEQ ID NO: 61), 5C1 (SEQ ID NO: 62), 5D3 (SEQ ID NO: 63), 6E3 (SEQ ID NO: 64), 6H4 (SEQ ID NO: 65), 6C1 (SEQ ID NO: 66), 6H3 (SEQ ID NO: 67), 6G3 (SEQ ID NO: 68), 5C8 (SEQ ID NO: 69), 5F5 (SEQ ID NO: 70), 6A1 (SEQ ID NO: 71), 6E4 (SEQ ID NO: 72), 5C7 (SEQ ID NO: 73), 5D7 (SEQ ID NO: 74), 5B11 (SEQ ID NO: 75), or 6C4 (SEQ ID NO: 76), preferably with single domain antibody 5E3 (SEQ ID NO: 59), 6H1 (SEQ ID NO: 60), 5G3 (SEQ ID NO: 61), 5C1 (SEQ ID NO: 62), 5D3 (SEQ ID NO: 63), 6E3 (SEQ ID NO: 64), 6H4 (SEQ ID NO: 65), 6C1 (SEQ ID NO: 66), 6H3 (SEQ ID NO: 67), 6G3 (SEQ ID NO: 68), 5C8 (SEQ ID NO: 69), 5F5 (SEQ ID NO: 70), 6A1 (SEQ ID NO: 71), or 6E4 (SEQ ID NO: 72). Preferably, the second binding moiety binds to the same or partly overlapping, more preferably the same epitope sequence as recognized by binding moiety 5E3, 6H1, 5G3, 5C1, 5D3, 6E3, 6H4, 6C1, 6H3, 6G3, 5C8, 5F5, 6A1, 6E4, 5C7, 5D7, 5B11 or 6C4, preferably as recognized by binding moiety 5E3, 6H1, 5G3, 5C1, 5D3, 6E3, 6H4, 6C1, 6H3, 6G3, 5C8, 5F5, 6A1, or 6E4.

[0057] In some embodiments of the binding molecule according to the invention or the binding molecule for use according to the invention, the first binding moiety or the second binding moiety, or both, is a single domain antibody. Single domain antibodies (sdAb, also called Nanobody.RTM., or VHH) are well known to the skilled person. Single domain antibodies comprise a single CDR1, a single CDR2 and a single CDR3. Examples of single domain antibodies are variable fragments of heavy chain only antibodies, antibodies that naturally do not comprise light chains, single domain antibodies derived from conventional antibodies, and engineered antibodies. Single domain antibodies may be derived from any species including mouse, human, camel, llama, shark, goat, rabbit, and cow. For example, naturally occurring VHH molecules can be derived from antibodies raised in Camelidae species, for example in camel, dromedary, alpaca and guanaco.

[0058] Like a whole antibody, a single domain antibody is able to bind selectively to a specific antigen. Single domain antibodies may contain only the variable domain of an immunoglobulin chain, i.e. CDR1, CDR2 and CDR3 and framework regions. With a molecular weight of only about 12-15 kDa, single domain antibodies are much smaller than common antibodies (150-160 kDa) which are composed of two heavy chains and two light chains or even Fab fragments (53 kDa), composed of one light chain and part of a heavy chain. The format of a single domain antibody has the advantage of less steric hindering when bound to its target.

[0059] In a preferred embodiment, a binding molecule according to the invention or a binding molecule for use according to the invention is provided, wherein the first binding moiety comprises a CDR1 sequence GSMFSDNVMG (SEQ ID NO: 1), a CDR2 sequence TIRTGGSTNYADSVKG (SEQ ID NO: 2), and/or a CDR3 sequence TIPVPSTPYDY (SEQ ID NO: 3), or any of those sequences wherein, independently, any of the amino acids, preferably at most 4 amino acids, more preferably at most 3, more preferably at most 2, most preferably at most 1, have been substituted, preferably conservatively substituted according to table 3.

[0060] In a further preferred embodiment, a binding molecule according to the invention or a binding molecule for use according to the invention is provided, wherein the first binding moiety comprises the sequence set forth in SEQ ID NO: 4. or the sequence set forth in SEQ ID NO: 85

TABLE-US-00003 TABLE 3 conservative amino acid substitutions Residue Conservative Substitutions Ala Ser Arg Lys Asn Gln; His Asp Glu Gln Asn Cys Ser Glu Asp Gly Pro His Asn; Gln Ile Leu, Val Leu Ile; Val Lys Arg; Gln Met Leu; Ile Phe Met; Leu; Tyr Ser Thr, Gly Thr Ser; Val Trp Tyr Tyr Trp; Phe Val Ile; Leu

In a preferred embodiment, a binding molecule according to the invention or a binding molecule for use according to the invention is provided, wherein the second binding moiety comprises a CDR 1, CDR2 and CDR3 sequence in the combinations shown in table 1 for each VHH. More specifically, the second binding moiety comprises a CDR 1 sequence according SEQ ID NO: 5, a CDR 2 sequence according to SEQ ID NO: 6 and/or a CDR 3 sequence according to SEQ ID NO: 7; or a CDR 1 sequence according SEQ ID NO: 8, a CDR 2 sequence according to SEQ ID NO: 9 and/or a CDR 3 sequence according to SEQ ID NO: 10; or a CDR 1 sequence according SEQ ID NO: 11, a CDR 2 sequence according to SEQ ID NO: 12 and/or a CDR 3 sequence according to SEQ ID NO: 13; or a CDR 1 sequence according SEQ ID NO: 14, a CDR 2 sequence according to SEQ ID NO: 15 and/or a CDR 3 sequence according to SEQ ID NO: 16; or a CDR 1 sequence according SEQ ID NO: 17, a CDR 2 sequence according to SEQ ID NO: 18 and/or a CDR 3 sequence according to SEQ ID NO: 19; or a CDR 1 sequence according SEQ ID NO: 20, a CDR 2 sequence according to SEQ ID NO: 21 and/or a CDR 3 sequence according to SEQ ID NO: 22; or a CDR 1 sequence according SEQ ID NO: 23, a CDR 2 sequence according to SEQ ID NO: 24 and/or a CDR 3 sequence according to SEQ ID NO: 25; or a CDR 1 sequence according SEQ ID NO: 26, a CDR 2 sequence according to SEQ ID NO: 27 and/or a CDR 3 sequence according to SEQ ID NO: 28; or a CDR 1 sequence according SEQ ID NO: 29, a CDR 2 sequence according to SEQ ID NO: 30 and/or a CDR 3 sequence according to SEQ ID NO: 31; or a CDR 1 sequence according SEQ ID NO: 32, a CDR 2 sequence according to SEQ ID NO: 33 and/or a CDR 3 sequence according to SEQ ID NO: 34; or a CDR 1 sequence according SEQ ID NO: 35, a CDR 2 sequence according to SEQ ID NO: 36 and/or a CDR 3 sequence according to SEQ ID NO: 37; or a CDR 1 sequence according SEQ ID NO: 38, a CDR 2 sequence according to SEQ ID NO: 39 and/or a CDR 3 sequence according to SEQ ID NO: 40; or a CDR 1 sequence according SEQ ID NO: 41, a CDR 2 sequence according to SEQ ID NO: 42 and/or a CDR 3 sequence according to SEQ ID NO: 43; or a CDR 1 sequence according SEQ ID NO: 44, a CDR 2 sequence according to SEQ ID NO: 45 and/or a CDR 3 sequence according to SEQ ID NO: 46; or a CDR 1 sequence according SEQ ID NO: 47, a CDR 2 sequence according to SEQ ID NO: 48 and/or a CDR 3 sequence according to SEQ ID NO: 49; or a CDR 1 sequence according SEQ ID NO: 50, a CDR 2 sequence according to SEQ ID NO: 51 and/or a CDR 3 sequence according to SEQ ID NO: 52; or a CDR 1 sequence according SEQ ID NO: 53, a CDR 2 sequence according to SEQ ID NO: 54 and/or a CDR 3 sequence according to SEQ ID NO: 55; or a CDR 1 sequence according SEQ ID NO: 56, a CDR 2 sequence according to SEQ ID NO: 57 and/or a CDR 3 sequence according to SEQ ID NO: 58, or any of those sequences wherein, independently, any of the amino acids, preferably at most 4 amino acids, more preferably at most 3, more preferably at most 2, most preferably at most 1, has been conservatively substituted, according to table 3.

[0061] More preferred, the second binding moiety comprises a CDR 1 sequence according SEQ ID NO: 5, a CDR 2 sequence according to SEQ ID NO: 6 and/or a CDR 3 sequence according to SEQ ID NO: 7; or a CDR 1 sequence according SEQ ID NO: 8, a CDR 2 sequence according to SEQ ID NO: 9 and/or a CDR 3 sequence according to SEQ ID NO: 10; or a CDR 1 sequence according SEQ ID NO: 11, a CDR 2 sequence according to SEQ ID NO: 12 and/or a CDR 3 sequence according to SEQ ID NO: 13; or a CDR 1 sequence according SEQ ID NO: 14, a CDR 2 sequence according to SEQ ID NO: 15 and/or a CDR 3 sequence according to SEQ ID NO: 16; or a CDR 1 sequence according SEQ ID NO: 17, a CDR 2 sequence according to SEQ ID NO: 18 and/or a CDR 3 sequence according to SEQ ID NO: 19; or a CDR 1 sequence according SEQ ID NO: 20, a CDR 2 sequence according to SEQ ID NO: 21 and/or a CDR 3 sequence according to SEQ ID NO: 22; or a CDR 1 sequence according SEQ ID NO: 23, a CDR 2 sequence according to SEQ ID NO: 24 and/or a CDR 3 sequence according to SEQ ID NO: 25; or a CDR 1 sequence according SEQ ID NO: 26, a CDR 2 sequence according to SEQ ID NO: 27 and/or a CDR 3 sequence according to SEQ ID NO: 28; or a CDR 1 sequence according SEQ ID NO: 29, a CDR 2 sequence according to SEQ ID NO: 30 and/or a CDR 3 sequence according to SEQ ID NO: 31; or a CDR 1 sequence according SEQ ID NO: 32, a CDR 2 sequence according to SEQ ID NO: 33 and/or a CDR 3 sequence according to SEQ ID NO: 34; or a CDR 1 sequence according SEQ ID NO: 35, a CDR 2 sequence according to SEQ ID NO: 36 and/or a CDR 3 sequence according to SEQ ID NO: 37; or a CDR 1 sequence according SEQ ID NO: 38, a CDR 2 sequence according to SEQ ID NO: 39 and/or a CDR 3 sequence according to SEQ ID NO: 40; or a CDR 1 sequence according SEQ ID NO: 41, a CDR 2 sequence according to SEQ ID NO: 42 and/or a CDR 3 sequence according to SEQ ID NO: 43; or a CDR 1 sequence according SEQ ID NO: 44, a CDR 2 sequence according to SEQ ID NO: 45 and/or a CDR 3 sequence according to SEQ ID NO: 46, or any of those sequences wherein, independently, any of the amino acids, preferably at most 4 amino acids, more preferably at most 3, more preferably at most 2, most preferably at most 1, has been conservatively substituted, according to table 3.

[0062] In a preferred embodiment, a binding molecule for use according to the invention is provided, comprising a binding moiety capable of specially binding to CD1d, wherein the first binding moiety comprises a CDR1 sequence according to SEQ ID NO: 1, a CDR2 sequence according to SEQ ID NO: 2 and a CDR3 sequence according to SEQ ID NO: 3.

[0063] In a preferred embodiment, a binding molecule comprising a first binding moiety capable of specifically binding to CD1d and comprising a second binding moiety that is able to specifically bind to a V.gamma.9V.delta.2-TCR according to the invention is provided, wherein [0064] the first binding moiety comprises a CDR1 sequence according to SEQ ID NO: 1, a CDR2 sequence according to SEQ ID NO: 2 and a CDR3 sequence according to SEQ ID NO: 3, and [0065] the second binding moiety comprises a CDR 1 sequence according SEQ ID NO: 5, a CDR 2 sequence according to SEQ ID NO: 6 and a CDR 3 sequence according to SEQ ID NO: 7; or a CDR 1 sequence according SEQ ID NO: 8, a CDR 2 sequence according to SEQ ID NO: 9 and a CDR 3 sequence according to SEQ ID NO: 10; or a CDR 1 sequence according SEQ ID NO: 11, a CDR 2 sequence according to SEQ ID NO: 12 and a CDR 3 sequence according to SEQ ID NO: 13; or a CDR 1 sequence according SEQ ID NO: 14, a CDR 2 sequence according to SEQ ID NO: 15 and a CDR 3 sequence according to SEQ ID NO: 16; or a CDR 1 sequence according SEQ ID NO: 17, a CDR 2 sequence according to SEQ ID NO: 18 and a CDR 3 sequence according to SEQ ID NO: 19; or a CDR 1 sequence according SEQ ID NO: 20, a CDR 2 sequence according to SEQ ID NO: 21 and a CDR 3 sequence according to SEQ ID NO: 22; or a CDR 1 sequence according SEQ ID NO: 23, a CDR 2 sequence according to SEQ ID NO: 24 and a CDR 3 sequence according to SEQ ID NO: 25; or a CDR 1 sequence according SEQ ID NO: 26, a CDR 2 sequence according to SEQ ID NO: 27 and a CDR 3 sequence according to SEQ ID NO: 28; or a CDR 1 sequence according SEQ ID NO: 29, a CDR 2 sequence according to SEQ ID NO: 30 and a CDR 3 sequence according to SEQ ID NO: 31; or a CDR 1 sequence according SEQ ID NO: 32, a CDR 2 sequence according to SEQ ID NO: 33 and a CDR 3 sequence according to SEQ ID NO: 34; or a CDR 1 sequence according SEQ ID NO: 35, a CDR 2 sequence according to SEQ ID NO: 36 and a CDR 3 sequence according to SEQ ID NO: 37; or a CDR 1 sequence according SEQ ID NO: 38, a CDR 2 sequence according to SEQ ID NO: 39 and a CDR 3 sequence according to SEQ ID NO: 40; or a CDR 1 sequence according SEQ ID NO: 41, a CDR 2 sequence according to SEQ ID NO: 42 and a CDR 3 sequence according to SEQ ID NO: 43; or a CDR 1 sequence according SEQ ID NO: 44, a CDR 2 sequence according to SEQ ID NO: 45 and a CDR 3 sequence according to SEQ ID NO: 46; or a CDR 1 sequence according SEQ ID NO: 47, a CDR 2 sequence according to SEQ ID NO: 48 and a CDR 3 sequence according to SEQ ID NO: 49; or a CDR 1 sequence according SEQ ID NO: 50, a CDR 2 sequence according to SEQ ID NO: 51 and a CDR 3 sequence according to SEQ ID NO: 52; or a CDR 1 sequence according SEQ ID NO: 53, a CDR 2 sequence according to SEQ ID NO: 54 and a CDR 3 sequence according to SEQ ID NO: 55; or a CDR 1 sequence according SEQ ID NO: 56, a CDR 2 sequence according to SEQ ID NO: 57 and a CDR 3 sequence according to SEQ ID NO: 58. In one embodiment, a binding molecule comprising a binding moiety capable of specially binding to CD1d for use in the treatment of disorders caused, maintained and/or propagated by CD1d-restricted V.delta.1+ T-cell activation, preferably for use in the treatment of CD1d-restricted V.delta.1+ peripheral T cell lymphoma is provided, wherein the first binding moiety comprises a CDR1 sequence according to SEQ ID NO: 1, a CDR2 sequence according to SEQ ID NO: 2 and a CDR3 sequence according to SEQ ID NO: 3.

[0066] In one embodiment, the invention relates to a binding molecule comprising a first binding moiety capable of specifically binding to CD1d and comprising a second binding moiety that is able to specifically bind to a V.gamma.9V.delta.2-TCR, for use in the treatment of disorders caused, maintained and/or propagated by CD1d-restricted V.delta.1+ T-cell activation, preferably for use in the treatment of CD1d-restricted V.delta.1+ peripheral T cell lymphoma, wherein [0067] the first binding moiety comprises a CDR1 sequence according to SEQ ID NO: 1, a CDR2 sequence according to SEQ ID NO: 2 and a CDR3 sequence according to SEQ ID NO: 3, and [0068] the second binding moiety comprises a CDR 1 sequence according SEQ ID NO: 5, a CDR 2 sequence according to SEQ ID NO: 6 and a CDR 3 sequence according to SEQ ID NO: 7; or a CDR 1 sequence according SEQ ID NO: 8, a CDR 2 sequence according to SEQ ID NO: 9 and a CDR 3 sequence according to SEQ ID NO: 10; or a CDR 1 sequence according SEQ ID NO: 11, a CDR 2 sequence according to SEQ ID NO: 12 and a CDR 3 sequence according to SEQ ID NO: 13; or a CDR 1 sequence according SEQ ID NO: 14, a CDR 2 sequence according to SEQ ID NO: 15 and a CDR 3 sequence according to SEQ ID NO: 16; or a CDR 1 sequence according SEQ ID NO: 17, a CDR 2 sequence according to SEQ ID NO: 18 and a CDR 3 sequence according to SEQ ID NO: 19; or a CDR 1 sequence according SEQ ID NO: 20, a CDR 2 sequence according to SEQ ID NO: 21 and a CDR 3 sequence according to SEQ ID NO: 22; or a CDR 1 sequence according SEQ ID NO: 23, a CDR 2 sequence according to SEQ ID NO: 24 and a CDR 3 sequence according to SEQ ID NO: 25; or a CDR 1 sequence according SEQ ID NO: 26, a CDR 2 sequence according to SEQ ID NO: 27 and a CDR 3 sequence according to SEQ ID NO: 28; or a CDR 1 sequence according SEQ ID NO: 29, a CDR 2 sequence according to SEQ ID NO: 30 and a CDR 3 sequence according to SEQ ID NO: 31; or a CDR 1 sequence according SEQ ID NO: 32, a CDR 2 sequence according to SEQ ID NO: 33 and a CDR 3 sequence according to SEQ ID NO: 34; or a CDR 1 sequence according SEQ ID NO: 35, a CDR 2 sequence according to SEQ ID NO: 36 and a CDR 3 sequence according to SEQ ID NO: 37; or a CDR 1 sequence according SEQ ID NO: 38, a CDR 2 sequence according to SEQ ID NO: 39 and a CDR 3 sequence according to SEQ ID NO: 40; or a CDR 1 sequence according SEQ ID NO: 41, a CDR 2 sequence according to SEQ ID NO: 42 and a CDR 3 sequence according to SEQ ID NO: 43; or a CDR 1 sequence according SEQ ID NO: 44, a CDR 2 sequence according to SEQ ID NO: 45 and a CDR 3 sequence according to SEQ ID NO: 46; or a CDR 1 sequence according SEQ ID NO: 47, a CDR 2 sequence according to SEQ ID NO: 48 and a CDR 3 sequence according to SEQ ID NO: 49; or a CDR 1 sequence according SEQ ID NO: 50, a CDR 2 sequence according to SEQ ID NO: 51 and a CDR 3 sequence according to SEQ ID NO: 52; or a CDR 1 sequence according SEQ ID NO: 53, a CDR 2 sequence according to SEQ ID NO: 54 and a CDR 3 sequence according to SEQ ID NO: 55; or a CDR 1 sequence according SEQ ID NO: 56, a CDR 2 sequence according to SEQ ID NO: 57 and a CDR 3 sequence according to SEQ ID NO: 58. In a more preferred embodiment the second binding moiety comprises a sequence selected from any of the SEQ ID NOs: 59-76, 86 or 88, or any of those sequences wherein, independently, any of the amino acids, preferably at most 20 amino acids, more preferably at most 15, more preferably at most 10, more preferably at most 5, more preferably at most 4, more preferably at most 3, more preferably at most 2, most preferably at most 1, has been substituted, preferably conservatively substituted, according to table 3.

[0069] In a most preferred embodiment the second binding moiety comprises a sequence selected from any of the SEQ ID NOs: 59-72, 86 or 88, or any of those sequences wherein, independently, any of the amino acids, preferably at most 20 amino acids, more preferably at most 15, more preferably at most 10, more preferably at most 5, more preferably at most 4, more preferably at most 3, more preferably at most 2, most preferably at most 1, has been substituted, preferably conservatively substituted, according to table 3.

[0070] In a further preferred embodiment, the first binding moiety comprises the sequence set forth in SEQ ID NO: 85 and the second binding moiety comprises the sequence set forth in SEQ ID NO: 86.

[0071] In a further preferred embodiment, the first binding moiety comprises the sequence set forth in SEQ ID NO: 85 and the second binding moiety comprises the sequence set forth in SEQ ID NO: 88.

[0072] In a further preferred embodiment, the binding molecule comprises or consists of the sequence set forth in SEQ ID NO: 87.

[0073] CDR1, CDR2 and CDR3 sequences or framework regions may be exchanged between species. For example, from a llama immunoglobulin molecule, CDR sequences may be selected and exchanged with CDR sequences in a human immunoglobulin molecule, to obtain a human immunoglobulin molecule having the specificity that is derived from the llama CDR sequences. This may be advantageous as a human sequence may be less immunogenic to humans as compared an antibody containing the original llama framework sequence. Such an exchange of sequences is known as humanization. Hence, the immunoglobulin molecules as provided by the invention may have human derived immunoglobulin sequences or immunoglobulin sequences derived from other animals, such as but not limited to: camelid, llama, shark, and have the CDR1, CDR2 and CDR3 sequences replaced with the CDR sequences according to the invention in order to provide for human CD1d binding. In other words, the binding molecule according to the invention may comprise a humanized single-domain antibody with CDRs as disclosed herein. For example, a single domain antibody may have human framework sequences and CDR regions as disclosed herein.

[0074] The invention thus provides a binding molecule that enables activation of iNKT cells and at the same time reduces activation of V.delta.1+ T cells. In a preferred embodiment, a binding molecule according to the invention or a binding molecule for use according to the invention is provided, the binding molecule further comprises a tumor-targeting moiety. The tumor-targeting moiety comprises a binding moiety, able to specifically bind to a tumor antigen. Preferably, the binding molecule also comprises a binding moiety that is capable of binding V.gamma.9V.delta.2-TCR and is able to compete with binding to a V.gamma.9V.delta.2-TCR with any of the VHHs depicted in Table 1.

[0075] Tumor antigens are proteins that are produced by tumor cells that elicit an immune response, particularly T-cell mediated immune responses. The selection of the antigen binding moiety of the invention will depend on the particular type of cancer to be treated. Tumor antigens are well known in the art and include, for example a glioma-associated antigen, carcinoembryonic antigen (CEA), EGFRvIII, Interleukin-11 receptor alpha (IL-I IR.alpha.), Interleukin-13 receptor subunit alpha-2 (IL-13Ra or CD213A2), epidermal growth factor receptor (EGFR), B7H3 (CD276), Kit (CD117), carbonic anhydrase (CA-IX), CS-1 (also referred to as CD2 subset 1), Mucin 1, cell surface associated (MUC1), BCMA, oncogene fusion protein consisting of breakpoint cluster region (BCR) and Abelson murine leukemia viral oncogene homolog 1 (AbI) bcr-abl, Receptor tyro sine-protein kinase ERBB2 (HER2/neu), .beta.-human chorionic gonadotropin, alphafetoprotein (AFP), anaplastic lymphoma kinase (ALK), CD19, CD123, cyclin BI, lectin-reactive AFP, Fos-related antigen 1, adrenoceptor beta 3 (ADRB3), thyroglobulin, tyrosinase; ephrin type-A receptor 2 (EphA2), Receptor for Advanced Glycation Endproducts (RAGE-1), renal ubiquitous 1 (RU1), renal ubiquitous 2 (RU2), synovial sarcoma, X breakpoint 2 (SSX2), A kinase anchor protein 4 (AKAP-4), lymphocyte-specific protein tyrosine kinase (LCK), proacrosin binding protein sp32 (OY-TES1), Paired box protein Pax-5 (PAX5), Squamous Cell Carcinoma Antigen Recognized By T Cells 3 (SART3), C-type lectin-like molecule-1 (CLL-1 or CLECL1), fucosyl GM1, hexasaccharide portion of globoH glycoceramide (GloboH), MN-CA IX, Epithelial cell adhesion molecule (EPCAM), EVT6-AML, transglutaminase 5 (TGS5), human telomerase reverse transcriptase (hTERT), polysialic acid, placenta-specific 1 (PLAC1), intestinal carboxyl esterase, LewisY antigen, sialyl Lewis adhesion molecule (sLe), lymphocyte antigen 6 complex, locus K 9 (LY6K), heat shock protein 70-2 mutated (mut hsp70-2), M-CSF, v-myc avian, myelocytomatosis viral oncogene neuroblastoma derived homolog (MYCN), Ras Homolog Family Member C (RhoC), Tyrosinase-related protein 2 (TRP-2), Cytochrome P450 1B1 (CYP1B1), CCCTC-Binding Factor (Zinc Finger Protein)-Like (BORIS or Brother of the Regulator of Imprinted Sites), prostase, prostate-specific antigen (PSA), paired box protein Pax-3 (PAX3), prostatic acid phosphatase (PAP), Cancer/testis antigen 1 (NY-ESO-1), Cancer/testis antigen 2 (LAGE-Ia), LMP2, neural cell adhesion molecule (NCAM), tumor protein p53 (p53), p53 mutant, Rat sarcoma (Ras) mutant, glycoprotein 100 (gpIOO), prostein, OR51E2, pannexin 3 (PANX3), pro state-specific membrane antigen (PSMA), prostate stem cell antigen (PSCA), high molecular weight-melanoma-associated antigen (HMWMAA), Hepatitis A virus cellular receptor 1 (HAVCRI), vascular endothelial growth factor receptor 2 (VEGFR2), Platelet-derived growth factor receptor beta (PDGFR-beta), legumain, human papilloma virus E6 (HPV E6), human papilloma virus E7 (HPV E7), survivin, telomerase, sperm protein 17 (SPA17), Stage-specific embryonic antigen-4 (SSEA-4), tyrosinase, TCR Gamma Alternate Reading Frame Protein (TARP), Wilms tumor protein (WT1), prostate-carcinoma tumor antigen-1 (PCTA-1), melanoma inhibitor of apoptosis (ML-IAP), MAGE, Melanoma-associated antigen 1 (MAGE-AI), melanoma cancer testis antigen-1 (MAD-CT-1), melanoma cancer testis antigen-2 (MAD-CT-2), melanoma antigen recognized by T cells 1 (MelanA/MARTI), X Antigen Family, Member 1A (XAGE1), elongation factor 2 mutated (ELF2M), ERG (TMPRSS2 ETS fusion gene), N-Acetyl glucosaminyl-transferase V (NA17), neutrophil elastase, sarcoma translocation breakpoints, mammary gland differentiation antigen (NY-BR-1), ephrinB2, CD20, CD22, CD24, CD30, CD33, CD38, CD44v6, CD97, CD171, CD179a, androgen receptor, insulin growth factor (IGF)-I, IGF-II, IGF-I receptor, ganglioside GD2 (GD2), o-acetyl-GD2 ganglioside (OAcGD2), ganglioside GD3 (aNeu5Ac(2-8)aNeu5Ac(2-3)bDGalp(I-4)bDGlcp(I-I)Cer), ganglioside GM3 (aNeuSAc(2-3)bDGa3p(I-4)bDGlcp(I-I)Cer), G protein-coupled receptor class C group 5, member D (GPRC5D), G protein-coupled receptor 20 (GPR20), chromosome X open reading frame 61 (CXORF61), folate receptor (FR.alpha.), folate receptor beta, Receptor tyrosine kinase-like orphan receptor 1 (ROR1), Fms-Like Tyrosine Kinase 3 (Ft3), Tumor-associated glycoprotein 72 (TAG72), Tn antigen (TN Ag or (GalNAca-Ser/Thr)), angiopoietin-binding cell surface receptor 2 (Tie 2), tumor endothelial marker 1 (TEM1 or CD248), tumor endothelial marker 7-related (TEM7R), claudin 6 (CLDN6), thyroid stimulating hormone receptor (TSHR), uroplakin 2 (UPK2), mesothelin, Protease Serine 21 (Testisin or PRSS21), epidermal growth factor receptor (EGFR), fibroblast activation protein alpha (FAP), Olfactory receptor 51E2 (OR51E2), ETS translocation-variant gene 6, located on chromosome 12p (ETV6-AML), CD79a; CD79b; CD72; Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1); Fc fragment of IgA receptor (FCAR or CD89); Leukocyte immunoglobulin-like receptor subfamily A member 2 (LILRA2); CD300 molecule-like family member f (CD300LF); C-type lectin domain family 12 member A (CLEC12A); bone marrow stromal cell antigen 2 (BST2); EGF-like module-containing mucin-like hormone receptor-like 2 (EMR2); lymphocyte antigen 75 (LY75); Glypican-3 (GPC3); Fc receptor-like 5 (FCRL5); immunoglobulin lambda-like polypeptide 1 (IGLL1); folate receptor (FR.alpha.); mesothelin; EGFR variant Ill (EGFRvIII); B-cell maturation antigen (BCMA); GD2; CLL-1; CA-IX; MUC1; HER2; and any combination thereof. In one preferred embodiment, the tumor antigen is selected from the group consisting of folate receptor (FR.alpha.), mesothelin, EGFRvIII, IL-13Ra, CD123, CD19, CD33, BCMA, GD2, CLL-1, CA-IX, MUC1, HER2, and any combination thereof. In one embodiment, the tumor targeting moiety is an immunoglobulin that specifically binds to PD-L1, EGFR, CD40, Her2, PSMA, MUC-1, CEA, c-met, CD19, CD20, BCMA, Her3, AFP, CAIX, or CD38.

[0076] As already mentioned, a binding molecule according to the invention enables creating a microenvironment that is beneficial for tumor cell killing by, e.g., iNKT cells and V.gamma.9V.delta.2 T cells. A binding molecule comprising a first binding moiety and a second binding moiety according to the invention for use in the treatment of a tumor is, therefore provided. Such binding molecule is not only effective against CD1d+ tumors, but also against tumors that themselves do not express CD1d but (in part) rely on CD1d+ suppressive cells (e.g. MDSCs or tumour-associated macrophages (TAMs)) in the tumor environment. Preferably the tumor is selected from hematological malignancies, such as T cell lymphoma, multiple myeloma, acute myeloid leukemia, acute lymphoblastic leukemia, chronic lymphocytic leukemia, chronic myeloid leukemia, mantle cell lymphoma, B cell lymphoma, smoldering myeloma, non-Hodgkin lymphoma, Hodgkin lymphoma, myelomonocytic leukemias, lymphoplasmacytic lymphoma, hairy cell leukemia, and splenic marginal zone lymphoma, or solid tumors, such as renal cell carcinoma, melanoma, colorectal carcinoma, head and neck cancer, breast cancer, prostate cancer, lung cancer, pancreatic cancer, gastro-esophageal cancer, small bowel carcinoma, central nervous system tumors, medulloblastomas, hepatocellular carcinoma, ovarian cancer, glioma, neuroblastoma, Urothelial carcinomas, bladder cancer, sarcoma, penile cancer, basal cell carcinoma, merkel cell carcinoma, neuroendocrine carcinoma, neuroendocrine tumors, carcinoma of unknown primary (CUP), thymoma, vulvar cancer, cervical carcinoma, testicular cancer, cholangiocarcinoma, appendicular carcinoma, mesothelioma, ampullary carcinoma, anal cancer, and choriocarcinoma.

Pharmaceutical Compositions, Dosages, Modes of Administration and Methods of Treatment

[0077] In a further main aspect, the invention relates to a pharmaceutical composition comprising [0078] a binding molecule, such as an antibody, comprising a first binding moiety that is able to compete with antibody 1D12 in binding to a CD1d molecule and comprising a second binding moiety that is able to specifically bind to a V.gamma.9V.delta.2-TCR, wherein the binding molecule is able to activate V.gamma.9V.delta.2 T cells, and [0079] a pharmaceutically acceptable excipient.

[0080] Polypeptides, such as antibodies may be formulated with pharmaceutically acceptable carriers or diluents as well as any other known adjuvants and excipients in accordance with conventional techniques such as those disclosed in (Rowe et al., Handbook of Pharmaceutical Excipients, 2012 June, ISBN 9780857110275). The pharmaceutically acceptable carriers or diluents as well as any other known adjuvants and excipients should be suitable for the polypeptides or antibodies and the chosen mode of administration. Suitability for carriers and other components of pharmaceutical compositions is determined based on the lack of significant negative impact on the desired biological properties of the chosen compound or pharmaceutical composition of the present invention (e.g., less than a substantial impact (10% or less relative inhibition, 5% or less relative inhibition, etc.) upon antigen binding). A pharmaceutical composition may also include diluents, fillers, salts, buffers, detergents (e.g., a nonionic detergent, such as Tween-20 or Tween-80), stabilizers (e.g., sugars or protein-free amino acids), preservatives, tissue fixatives, solubilizers, and/or other materials suitable for inclusion in a pharmaceutical composition. Further pharmaceutically acceptable excipients and carriers include any and all suitable solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonicity agents, antioxidants and absorption-delaying agents, and the like that are physiologically compatible with a binding molecule of the present invention.

[0081] The invention provides methods of treating a disease or disorder comprising administering binding molecules as defined herein to a subject in need thereof. In one embodiment, the subject is human. The method of the invention involves administering an effective amount of the binding molecules. "Treatment" or "treating" refers to the administration of an effective amount of a therapeutically active polypeptide according to the present invention with the purpose of easing, ameliorating, arresting or eradicating (curing) symptoms or disease states. An "effective amount" or "therapeutically effective amount" refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result. A therapeutically effective amount of a polypeptide, such as an antibody, may vary according to factors such as the disease stage, age, sex, and weight of the individual, and the ability of the antibody to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the antibody or antibody portion are outweighed by the therapeutically beneficial effects.

[0082] Administration may be carried out by any suitable route, but will typically be parenteral, such as intravenous, intramuscular or subcutaneous. Effective dosages and the dosage regimens for the binding molecule, e.g. an antibody, depend on the disease or condition to be treated and may be determined by the persons skilled in the art.

[0083] Binding molecules, such as antibodies of the present invention may also be administered in combination therapy, i.e., combined with other therapeutic agents relevant for the disease or condition to be treated. Accordingly, in one embodiment, the antibody-containing medicament is for combination with one or more further therapeutic agents, such as cytotoxic, chemotherapeutic or anti-angiogenic agents. Such combined administration may be simultaneous, separate or sequential. Thus, in a further embodiment, the present invention provides a method for treating or preventing disease, such as cancer, which method comprises administration to a subject in need thereof of a therapeutically effective amount of a binding molecule or a pharmaceutical composition of the present invention, in combination with radiotherapy and/or surgery.

Further Aspects and Embodiments of the Invention

[0084] In a further aspect, the invention provides a binding molecule comprising a first binding moiety that is able to bind specifically to a CD1d molecule, wherein the binding molecule is able to reduce V.delta.1 T cell activation and is able to activate iNKT cells, for use in the treatment of disorders caused, maintained and/or propagated by CD1d-restricted V.delta.1+ T-cell activation, preferably for use in the treatment of CD1d-restricted V.delta.1+ peripheral T cell lymphoma.

[0085] In an even further aspect, the invention provides a binding molecule comprising a first binding moiety that is able to specifically bind to a CD1d molecule and comprising a second binding moiety that is able to specifically bind to a V.gamma.9V.delta.2-TCR, wherein the binding molecule is able to reduce V.delta.1 T cell activation, is able to activate iNKT cells, and is able to activate V.gamma.9V.delta.2 T cells.

[0086] In a further aspect, the invention relates to an antibody comprising a first binding moiety that is able to compete with single domain antibody 1D12 in binding to a CD1d molecule, for use in the treatment of disorders caused, maintained and/or propagated by CD1d-restricted V.delta.1+ T-cell activation, preferably for use in the treatment of CD1d-restricted V.delta.1+ peripheral T cell lymphoma. Preferably, the antibody is able to reduce V.delta.1 T cell activation and/or able to activate iNKT cells.

[0087] In a further aspect, the invention relates to an antibody, such as a bispecific antibody, comprising a first binding moiety that is able to compete with 1D12 in binding to a CD1d molecule and comprising a second binding moiety that is able to specifically bind to a V.gamma.9V.delta.2-TCR, wherein the binding molecule is able to activate V.gamma.9V.delta.2 T cells. Preferably, the antibody is able to reduce V.delta.1 T cell activation and/or able to activate iNKT cells. Preferably, the first and/or second binding moiety is a single domain antibody.

Methods of Preparing Binding Molecules of the Invention

[0088] Binding molecules of the invention, such as polypeptides, in particular antibodies, are typically produced recombinantly, i.e. by expression of nucleic acid constructs encoding the polypeptides in suitable host cells, followed by purification of the produced recombinant polypeptide from the cell culture. Nucleic acid constructs can be produced by standard molecular biological techniques well-known in the art. The constructs are typically introduced into the host cell using a vector. Suitable nucleic acid constructs, vectors are known in the art. Host cells suitable for the recombinant expression of polypeptides, such as antibodies are well-known in the art, and include CHO, HEK-293, Expi293F, PER-C6, NS/0 and Sp2/cells.

EXAMPLES

Materials

Cell Lines

[0089] The human Epstein-Barr virus-transformed B-lymphoblast cell line C1R, stably transduced with CD1d, and the human cell line JY were grown in Iscove's modified Dulbecco's medium (catalogue no. 12-722F; Lonza, Basel, Switzerland) supplemented with 10% (v/v) fetal calf serum (catalogue no. SV30160.03; HyClone GE Healthcare, Chalfont, St Giles, UK), 0.05 mm .beta.-mercaptoethanol, 100 IU/ml sodium penicillin, 100 .mu.g/ml streptomycin sulphate and 2.0 mm I-glutamine (catalogue no. 10378-016; Life Technologies, Carlsbad, Calif.). The human cervical adenocarcinoma cell line HeLa, stably transduced with CD1d, was cultured in Dulbecco's modified Eagle's medium (catalogue no. BE12-709F; Lonza) supplemented with 10% (v/v) fetal calf serum, 0.05 mm .beta.-mercaptoethanol, 100 IU/ml sodium penicillin, 100 .mu.g/ml streptomycin sulphate and 2.0 mm I-glutamine. The human myeloma cell line MM.1s with or without mcherry/luc and, stably transduced with CD1d, the human acute T-lymphoblastic leukemia cell line CCRF-CEM, the human acute T cell leukemia cell line Jurkat transduced with a V.delta.1 sulfatide-CD1d restricted TCR, and the human acute myeloid leukemia cell lines MOLM-13 and NOMO-1 were cultured in RPMI-1640 (catalogue no. BE12-115F; Lonza) medium supplemented with 10% (v/v) fetal calf serum, 0.05 mm .beta.-mercaptoethanol, 100 IU/ml sodium penicillin, 100 .mu.g/ml streptomycin sulphate and 2.0 mm I-glutamine. CCRF-CEM and MM1.s genetic characteristics were determined by PCR-single-locus-technology and found identical to the published DNA-profiles. Cells were tested mycoplasma-negative and frequently tested for purity (transfectants) by flow cytometry.

Flow Cytometry and Monoclonal Antibodies

[0090] The following antibodies were used in this study: fluorescein isothiocyanate (FITC) conjugated V.delta.2, FITC CD69, phycoerythrin (PE) and allophycocyanin (APC)-conjugated CD25 (catalogue nos 555432 and #340907), and APC CD3 were purchased from BD Biosciences (Franklin Lakes, N.J.). Phycoerythrin-Cyanine 7-conjugated V.alpha.24 (catalogue no. PN A66907) and V.beta.11 PE (catalogue no. IM2290) were purchased from Beckman Coulter (Brea, Calif.). 7-aminoactinomycin D (7-AAD) was purchased from Sigma (St Louis, Mo.), PE V.gamma.9 from Biolegend (San Diego, USA), PE CD107a from Miltenyi (Miltenyi Biotec, Bergisch Gladbach, Germany) and FITC annexin V from VPS Diagnostics (Hoever, the Netherlands) (catalogue no. A700). Tetramers were made in house. Flow cytometry staining was performed in FACS buffer (PBS supplemented with 0.1% BSA and 0.02% sodium azide) for 30 min at 4, unless otherwise specified. Samples were analyzed on FACS Fortessa (BD Biosciences).

Generation of DC, iNKT and V.gamma.9V.delta.2-T Cell Lines

[0091] moDC and primary human iNKT and .gamma..delta. T cells were generated as described previously (De Bruin et al (2016) Clin Immunol 169:128). Briefly, monocytes were isolated from peripheral blood mononuclear cells with the use of CD14 MicroBeads (Miltenyi Biotec, Bergisch Gladbach, Germany) and cultured in complete RPMI-1640 medium in the presence of 1000 U/ml granulocyte-macrophage colony-stimulating factor (Sanofi Leukine, Bridgewater, N.J.) and 20 ng/ml IL-4 (catalogue no. 204-IL/CF; R&D Systems, Minneapolis, Minn.) for 5-7 days and subsequently matured with 100 ng/ml lipopolysaccharide (LPS) (catalogue no. L6529; Sigma) in the presence or absence of 100 ng/ml .alpha.-GalCer (catalogue no. KRN7000; Funakoshi, Tokyo, Japan) for 48-72 hr. iNKT cells were purified from peripheral blood mononuclear cells of healthy volunteers using magnetic bead sorting, and stimulated weekly with mature .alpha.-GalCer-loaded moDC in Yssel's medium supplemented with 1% human AB serum, 10 U/ml IL-7 (catalogue no. 207-IL/CF; R&D Systems) and 10 ng/ml IL-15 (catalogue no. 34-8159; eBioscience). .gamma..delta.T cells were purified from peripheral blood mononuclear cells of healthy volunteers using magnetic bead sorting, and stimulated weekly with pamidronate (10 .mu.M) (PCH, Pharmachemie BV, Haarlem, The Netherlands) loaded moDC in Yssel's medium supplemented with 1% human AB serum, 100 U/ml IL-2 (BioVision, Mountain View, Calif., USA) 10 U/ml IL-7 and 10 ng/ml IL-15. Alternatively, .gamma..delta. T cells were weekly stimulated with irradiated feeders cells (1.times.10.sup.6 mixed PBMCs of two donors and 0.1.times.10.sup.6 JY cells), 10 IU/mL rhIL-7, 10 .mu.g/mL rhIL-15 and 50 ng/mL PHA in in RPMI-1640 medium supplemented as described above. Depending on culture density, cultured cells were split and fresh culture medium was added. Pure (>95% V.alpha.24+V.beta.11+ or V.gamma.9+V.delta.2+) iNKT and .gamma..delta.T cells were used for experiments.

Generation of Anti-CD1d and Anti-.gamma..delta.TCR Specific VHH

[0092] The anti-CD1d and anti-.gamma..delta.TCR specific VHH were identified and generated as described previously (Lameris R et al (2016) Immunology 149(1):111; De Bruin et al (2016) Clin Immunol 169:128). Tag-less 1D12, 1D22 and 1D12-5C8 was produced by UPE (Utrecht, the Netherlands).

In Vivo Xenograft Mouse Multiple Myeloma (MM) Model

[0093] A disseminated MM model was established by intravenous transfer of CD1d.sup.+ MM cells into NOD scid gamma (NSG) mice. Female 18-26-week-old NSG mice (Charles River) were irradiated with 2 Gy 24 hr prior to intravenous (i.v.) injection of 2.5.times.10.sup.6 MM.1s.mcherry/luc.CD1d cells via the tail vain (day 0). On day 7, 14 and 21, 1.times.10.sup.7 human iNKT cells, human .gamma..delta. T cells or a mixture thereof (1:1 ratio) were i.v. injected. Mice were bi-weekly intraperitoneally (i.p.) injected with PBS or bispecific antibody 1D12-5C8 (100 .mu.g/mouse). Mice were euthanized when pre-set human end-points were reached. Animal experiments were approved by the Dutch Central Authority for Scientific Procedures on Animals (CCD).

Example 1

[0094] Modulation of iNKT Cell Activation

[0095] To evaluate the capacity of 1D12 and 1D22 to stimulate or inhibit iNKT cell activation, 5.times.10.sup.4 Hela-CD1d cells were seeded per well in a 96-well tissue culture plate and pulsed overnight with vehicle control (DMSO 0.01%) or 100 ng/ml .alpha.-GalCer. Cells were then washed with PBS and incubated with medium, or the anti-CD1d specific VHH for 1 hr at the indicated concentrations. Subsequently, 5.times.10.sup.4 pure and resting iNKT were added to each well. After 24 hr, culture supernatants were analyzed for (induction or inhibition of) cytokine production by CBA (BD Biosciences) whereas iNKT cells were harvested and analyzed for CD25 expression by flow cytometry. As can be seen in FIG. 1, we identified an anti-CD1d VHH (clone 1D22) that completely blocked iNKT cell activation and cytokine production (P<0.0001) and thus recognition of the CD1d-.alpha.-GalCer complex. In sharp contrast anti-CD1d VHH clone 1D12 was found to potentiate CD1d-restricted iNKT cell activation even in the absence of exogenously added glycolipid Ag (FIGS. 1 a and c) (P<0.0001).

Example 2

Modulation of Jurkat-V.delta.1 Cell Activation

[0096] iNKT cells are known to dock over the extreme F' pocket of CD1d which contrasts with sulfatide-CD1d restricted V.delta.1-T cells that dock more towards the A' pocket. We therefore evaluated the effect of 1D12 and 1D22 on sulfatide-CD1d restricted V.delta.1-T cells. To evaluate the effect of 1D12 and 1D22 on Jurkat-V.delta.1 cell activation, 1.times.10.sup.5 C1R-CD1d cells were seeded per well in a 96-well tissue culture plate and pulsed for 2 hr with vehicle control (DMSO 0.05%) or 25 .mu.g/ml sulfatide. Cells were then incubated with medium, or the anti-CD1d specific VHH for 1 hr at 100 nM (not depicted) or 1000 nM. Subsequently, 5.times.10.sup.4 Jurkat-V.delta.1 were added to each well. After 24 hr Jurkat-V.delta.1 cells were harvested and analysed for CD69 expression by flow cytometry. As can be seen in FIG. 2B, addition of 1D12 during the co-culture completely abrogated activation of V.delta.1-Jurkat, whereas 1D22 had only a limited impact on expression of the activation marker CD69. Incubation with 100 nM or 1000 nM yielded similar results (data not shown).

[0097] To evaluate the effect of 1D12 and 1D22 on CD1d-tetramer binding on Jurkat-V.delta.1 cells, endogenous or sulfatide-loaded CD1d-PE tetramers were incubated with either PBS (control), 1D12 or 1D22 (ratio VHH:CD1d of .about.4:1) for 30 min at room temperature after which tetramers were added to Jurkat-V.delta.1 cells (final concentration tetramer 2 g/ml) in combination with CD3-APC and incubated for 45 min at 4 degrees Celsius. Data was analyzed by flow cytometry. Incubation of sulfatide-loaded CD1d tetramers with 1D12 prevented binding to Jurkat-V.delta.1 cells completely, while 1D22 had only a limited impact (FIG. 2A). These data support the ability of the anti-CD1d VHH to modulate reactivity of specific CD1d restricted T-cells, which contrast sharply with known mAb, such as 51.1 mAb, that block CD1d-TCR interaction of a broad range of CD1d-restricted T-cells (Nambiar et al. (2015) MAbs 7:638; Migalovich Sheikhet et al. (2018) Front Immunol 9:753).

Example 3

[0098] Dual Activation of iNKT and V.gamma.9V.delta.2-T Cells by a Bispecific Anti-CD1d-Anti-V.gamma.9V.delta.2 TCR VHH Previously, well characterized anti-V.gamma.9V.delta.2-TCR VHH have been fused to VHHs specific for tumor-associated antigens for anti-tumor therapeutic purposes. CD1d is expressed on various (hematological) malignancies and on tumor associated macrophages and myeloid-derived suppressor cells and could therefore be used as an anti-cancer therapeutic target. To evaluate the ability of 1D12-5C8 to induce dual activation of iNKT and V.gamma.9V.delta.2-T-cells resulting in tumor target lysis, 1.times.10.sup.5 CCRF-CEM cells were incubated with either 5.times.10.sup.4 iNKT cells, 5.times.10.sup.4 V.gamma.9V.delta.2-T cells or 5.times.10.sup.4 mixed iNKT/V.gamma.9V.delta.2-T (1:1 ratio) in the presence of medium alone, monovalent 1D12 or bispecific 1D12-5C8. After 4 hr degranulation of effector cells was measured by CD107a expression and analyzed by flow cytometry. To asses cytotoxicity towards target cells, living CCRF-CEM cells (Annexin V and 7-AAD negative) were quantified after 16 h co-culture using flow cytometry cell counting beads.

[0099] To determine the capacity of 1D12-5C8 to support iNKT and V.gamma.9V.delta.2-T expansion and control tumor growth, freshly isolated iNKT and V.gamma.9V.delta.2-T from the same donor were expanded for 1 week. 5.times.10.sup.4 MM.1s-CD1d cells were subsequently incubated with medium or 1D12-5C8 (50 nM) for 30 min after which iNKT. V.gamma.9V.delta.2-T cells or a mixture thereof (2:3 ratio) was added in a 10:1 target:effector ratio. Living MM.1s-CD1d (or MOLM-13 or NOMO-1), iNKT and V.gamma.9V.delta.2-T cells (7-AAD negative) were quantified after 7 days using flow cytometry cell counting beads.

[0100] As can be seen in FIG. 3a, robust simultaneous degranulation of INKT and V.gamma.9V.delta.2-T cells was only observed in the presence of 1D12-5C8. Moreover, effector cell activation resulted in a striking reduction in living tumor cells (FIG. 3b).

[0101] The unfavourable effector to target ratio in vivo usually requires expansion of tumor targeting effector cells to control tumor growth. To investigate whether the bispecific 1D12-5C8 VHH could induce both effector cell expansion and tumor control in such a setting, MM.1s-CD1d cells were incubated with 1D12-5C8, after which iNKT, V.gamma.9V.delta.2-T cells or a mixture thereof were added at an effector to target ratio of 1:10. The ability of 1D12-5C8 to induce expansion and control tumor growth was evaluated after a 7 day co-culture by flow cytometric quantification of these cells. As can be seen in FIG. 4a expansion of iNKT was observed in the presence of the bispecific construct. However, V.gamma.9V.delta.2-T cells only showed expansion in the presence of both iNKT cells and the bispecific construct. Moreover, robust tumor growth control was induced by the bispecific construct in combination with effector cells (FIG. 4b). Similar, tumor growth control and effector cell expansion were observed with the acute myeloid leukemia tumor cell lines MOLM-13 and NOMO-1, underscoring the powerful anti-tumor efficacy and broad applicability of this bispecific anti-CD1d-anti-V.gamma.9V.delta.2-TCR VHH.

Example 4

Binding Competition of 1D12 and 1D12-5C8

[0102] To evaluate whether 1D12 binding would interfere with 1D12-5C8 binding, 1.times.105 MM1s-CD1d cells were incubated with either PBS (negative control, NC), 1D12 (1000 nM), 1D22 (1000 nM) or anti-CD1d mAb 51.1 (100 nM) for 45 min after which PBS (NC) or NHS-biotin (ThermoFischer Scientific Inc., Waltham, Mass.) linked 1D12-5C8 (100 nM) was added for an additional 30 min at 4 degrees Celsius. After extensive washing samples were stained with streptavidin-APC (eBioscience, San Diego, Calif.) and analyzed by flow cytometry.

[0103] To evaluate competition between 1D12 and 1D12-5C8, CD1d expressing MM cells were sequentially incubated with either PBS, 1D12, 1D22 (which should not interfere with 1D12-5C8 binding) or anti-CD1d mAb 51.1) followed by biotinylated 1D12-5C8. The ability of 1D12-5C8 to complex with CD1d was then determined by analysing binding of streptavidin-APC by flow cytometry. As can be seen in FIG. 5, pre-incubation of 1D12 or anti-CD1d mAb 51.1, but not 1D22, greatly reduced 1D12-5C8 binding.

Example 5

In Vivo Xenograft Mouse Multiple Myeloma (MM) Model

[0104] The anti-tumour efficacy of bispecific CD1d/V.delta.2 binding antibody 1D12-5C8 was studied in an in vivo model where mice were i.v. inoculated with MM.1s.mCherry/luc.CD1d cells to establish a disseminated MM model followed by three i.v. infusions of human iNKT cells, human .gamma..delta. T cells or a mixture thereof starting 7 days post tumour inoculation whether or not in combination with 1D12-5C8. Whereas biweekly i.p. dosing of 1D12-5C8 alone had no effect (median survival 47 days versus 49.5 days, P>0,05), combination treatment of 1D12-5C8 and iNKT cells significantly (p<0.0001) prolonged survival compared to iNKT alone (median survival 58.5 days) with all mice being alive at termination of the study (day 90). Compared to treatment with human .gamma..delta. T cells only, treatment of human .gamma..delta. T cells and 1D12-5C8 showed a trend towards increased median survival from 48 days to 60 days (p=0.16). Infusion of both iNKT cells and .gamma..delta. T cells with biweekly i.p. dosing 1D12-5C8 significantly prolonged survival with 7/8 mice being alive at study termination (day 90) (p>0.0001) compared to the mixture of the cells alone without antibody (median survival 55 days).

Sequence CWU 1

1

8815PRTArtificial Sequenceantibody sequence 1Asp Asn Val Met Gly1 5216PRTArtificial Sequenceantibody sequence 2Thr Ile Arg Thr Gly Gly Ser Thr Asn Tyr Ala Asp Ser Val Lys Gly1 5 10 15311PRTArtificial Sequenceantibody sequence 3Thr Ile Pro Val Pro Ser Thr Pro Tyr Asp Tyr1 5 104119PRTArtificial Sequenceantibody sequence 4Gln Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Met Phe Ser Asp Asn 20 25 30Val Met Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val 35 40 45Ala Thr Ile Arg Thr Gly Gly Ser Thr Asn Tyr Ala Asp Ser Val Lys 50 55 60Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr Leu65 70 75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Arg 85 90 95His Thr Ile Pro Val Pro Ser Thr Pro Tyr Asp Tyr Trp Gly Gln Gly 100 105 110Thr Gln Val Thr Val Ser Ser 11555PRTArtificial Sequenceantibody sequence 5Ser Tyr Ala Met Gly1 5617PRTArtificial Sequenceantibody sequence 6Ala Ile Ser Trp Ser Gly Gly Thr Thr Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly716PRTArtificial Sequenceantibody sequence 7Ser Leu Asp Cys Ser Gly Pro Gly Cys His Thr Ala Glu Tyr Asp Tyr1 5 10 1585PRTArtificial Sequenceantibody sequence 8Glu Tyr Ala Met Gly1 5917PRTArtificial Sequenceantibody sequence 9Ala Ile Ser Trp Thr Gly Ser Lys Thr Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly1016PRTArtificial Sequenceantibody sequence 10Ser Ser Asp Cys Ser Gly Pro Gly Cys His Thr Glu Glu Tyr Asp Tyr1 5 10 15115PRTArtificial Sequenceantibody sequence 11Ser Tyr Ala Met Gly1 51217PRTArtificial Sequenceantibody sequence 12Ala Val Ser Trp Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly1316PRTArtificial Sequenceantibody sequence 13Ser Gln Asp Cys Ser Gly Pro Gly Cys Tyr Thr Asn Glu Tyr Asp Ser1 5 10 15145PRTArtificial Sequenceantibody sequence 14Asn Tyr Ala Met Ala1 51517PRTArtificial Sequenceantibody sequence 15Ala Val Ser Trp Ser Gly Gly Arg Thr Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly1616PRTArtificial Sequenceantibody sequence 16Ser Leu Ser Cys Ser Gly Pro Gly Cys Ser Leu Glu Glu Tyr Asp Tyr1 5 10 15175PRTArtificial Sequenceantibody sequence 17Asn Tyr Ala Met Gly1 51817PRTArtificial Sequenceantibody sequence 18Val Ile Ser Trp Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly1918PRTArtificial Sequenceantibody sequence 19Gln Phe Ser Gly Ala Ser Thr Val Val Ala Gly Thr Ala Leu Asp Tyr1 5 10 15Asp Tyr205PRTArtificial Sequenceantibody sequence 20Asn Tyr Gly Met Gly1 52117PRTArtificial Sequenceantibody sequence 21Gly Ile Ser Trp Ser Gly Gly Ser Thr Asp Tyr Ala Asp Ser Val Lys1 5 10 15Gly2217PRTArtificial Sequenceantibody sequence 22Val Phe Ser Gly Ala Glu Thr Ala Tyr Tyr Pro Ser Asp Asp Tyr Asp1 5 10 15Tyr235PRTArtificial Sequenceantibody sequence 23Asn Tyr Gly Met Gly1 52417PRTArtificial Sequenceantibody sequence 24Gly Ile Ser Trp Ser Gly Gly Ser Thr Asp Tyr Ala Asp Ser Val Lys1 5 10 15Gly2517PRTArtificial Sequenceantibody sequence 25Val Phe Ser Gly Ala Glu Thr Ala Tyr Tyr Pro Ser Asp Asp Tyr Asp1 5 10 15Tyr265PRTArtificial Sequenceantibody sequence 26Asn Tyr Gly Met Gly1 52717PRTArtificial Sequenceantibody sequence 27Gly Ile Ser Trp Ser Gly Gly Ser Thr Asp Tyr Ala Asp Ser Val Lys1 5 10 15Gly2817PRTArtificial Sequenceantibody sequence 28Val Phe Ser Gly Ala Glu Thr Ala Tyr Tyr Pro Ser Asp Asp Tyr Asp1 5 10 15Tyr295PRTArtificial Sequenceantibody sequence 29Asn Tyr Gly Met Gly1 53017PRTArtificial Sequenceantibody sequence 30Gly Ile Thr Trp Ser Gly Gly Ser Thr His Tyr Ala Asp Leu Val Lys1 5 10 15Gly3117PRTArtificial Sequenceantibody sequence 31Val Phe Ser Gly Ala Glu Thr Ala Tyr Tyr Pro Ser Thr Glu Tyr Asp1 5 10 15Tyr325PRTArtificial Sequenceantibody sequence 32Asn Tyr Gly Met Gly1 53317PRTArtificial Sequenceantibody sequence 33Gly Ile Ser Trp Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly3417PRTArtificial Sequenceantibody sequence 34Val Phe Ser Gly Ala Glu Thr Ala Gln Tyr Pro Ser Tyr Asp Tyr Asp1 5 10 15Tyr355PRTArtificial Sequenceantibody sequence 35Asn Tyr Ala Met Gly1 53617PRTArtificial Sequenceantibody sequence 36Ala Ile Ser Trp Ser Gly Gly Ser Thr Ser Tyr Ala Asp Ser Val Lys1 5 10 15Gly3721PRTArtificial Sequenceantibody sequence 37Gln Phe Ser Gly Ala Asp Tyr Gly Phe Gly Arg Leu Gly Ile Arg Gly1 5 10 15Tyr Glu Tyr Asp Tyr 20385PRTArtificial Sequenceantibody sequence 38Asn Tyr Ala Met Gly1 53917PRTArtificial Sequenceantibody sequence 39Ala Ile Ser Trp Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly4021PRTArtificial Sequenceantibody sequence 40Met Phe Ser Gly Ser Glu Ser Gln Leu Val Val Val Ile Thr Asn Leu1 5 10 15Tyr Glu Tyr Asp Tyr 20415PRTArtificial Sequenceantibody sequence 41Asn Tyr Ala Met Gly1 54217PRTArtificial Sequenceantibody sequence 42Thr Ile Ser Trp Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly4318PRTArtificial Sequenceantibody sequence 43Ala Phe Ser Gly Ser Asp Tyr Ala Asn Thr Lys Lys Glu Val Glu Tyr1 5 10 15Asp Tyr445PRTArtificial Sequenceantibody sequence 44Asp Tyr Cys Ile Ala1 54517PRTArtificial Sequenceantibody sequence 45Cys Ile Thr Thr Ser Asp Gly Ser Thr Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly4618PRTArtificial Sequenceantibody sequence 46Tyr Phe Gly Tyr Gly Cys Tyr Gly Gly Ala Gln Asp Tyr Arg Ala Met1 5 10 15Asp Tyr475PRTArtificial Sequenceantibody sequence 47Arg Tyr Thr Met Gly1 54817PRTArtificial Sequenceantibody sequence 48Ala Ile Ser Trp Ser Gly Gly Arg Thr Asn Phe Ala Gly Ser Val Lys1 5 10 15Gly4913PRTArtificial Sequenceantibody sequence 49Asp Trp Leu Pro Val Pro Gly Arg Glu Ser Tyr Asp Tyr1 5 10505PRTArtificial Sequenceantibody sequence 50Asn Tyr Ala Met Gly1 55117PRTArtificial Sequenceantibody sequence 51Ala Ile Ser Trp Ser Gly Gly Met Thr Asp His Ala Asp Ser Val Lys1 5 10 15Gly5221PRTArtificial Sequenceantibody sequence 52Ala Phe Ala Gly Asp Ile Pro Tyr Gly Ser Ser Trp Tyr Gly Asp Pro1 5 10 15Thr Thr Tyr Asp Tyr 20535PRTArtificial Sequenceantibody sequence 53Thr Phe Ser Met Ala1 55417PRTArtificial Sequenceantibody sequence 54Ala Ile Asn Trp Ser Gly Gly Ser Thr Arg Tyr Ala Asp Ser Val Ser1 5 10 15Asp5515PRTArtificial Sequenceantibody sequence 55Arg Arg Gly Gly Ile Tyr Tyr Ser Thr Gln Asn Asp Tyr Asp Tyr1 5 10 15565PRTArtificial Sequenceantibody sequence 56Asp Tyr Arg Met Gly1 55717PRTArtificial Sequenceantibody sequence 57Thr Ile Ser Trp Ser Gly Gly Leu Thr Tyr Tyr Ala Asp Ser Val Lys1 5 10 15Gly5814PRTArtificial Sequenceantibody sequence 58Gly Gly Gly Tyr Ala Gly Gly Thr Tyr Tyr His Pro Glu Glu1 5 1059125PRTArtificial Sequenceantibody sequence 59Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Thr Ala Ser Gly Arg Thr Phe Ser Ser Tyr 20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Ser Trp Ser Gly Gly Thr Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Ser65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Phe Cys 85 90 95Ala Ala Ser Leu Asp Cys Ser Gly Pro Gly Cys His Thr Ala Glu Tyr 100 105 110Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120 12560125PRTArtificial Sequenceantibody sequence 60Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Thr Gly Arg Thr Phe Ser Glu Tyr 20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Ala 35 40 45Ala Ala Ile Ser Trp Thr Gly Ser Lys Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Ser Ser Asp Cys Ser Gly Pro Gly Cys His Thr Glu Glu Tyr 100 105 110Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120 12561125PRTArtificial Sequenceantibody sequence 61Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Ser Tyr 20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Val Ser Trp Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Arg Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Asn Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Ser Gln Asp Cys Ser Gly Pro Gly Cys Tyr Thr Asn Glu Tyr 100 105 110Asp Ser Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120 12562125PRTArtificial Sequenceantibody sequence 62Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Ile Phe Ser Asn Tyr 20 25 30Ala Met Ala Trp Phe Arg Gln Ala Pro Glu Lys Glu Arg Asp Phe Leu 35 40 45Ala Ala Val Ser Trp Ser Gly Gly Arg Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Asn65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Ser Leu Ser Cys Ser Gly Pro Gly Cys Ser Leu Glu Glu Tyr 100 105 110Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120 12563127PRTArtificial Sequenceantibody sequence 63Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Pro Phe Ser Asn Tyr 20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Thr Val Ile Ser Trp Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Gln Phe Ser Gly Ala Ser Thr Val Val Ala Gly Thr Ala Leu 100 105 110Asp Tyr Asp Tyr Trp Gly Gln Gly Thr Arg Val Thr Val Ser Ser 115 120 12564126PRTArtificial Sequenceantibody sequence 64Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Pro Phe Ser Asn Tyr 20 25 30Gly Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Lys Arg Glu Phe Val 35 40 45Ala Gly Ile Ser Trp Ser Gly Gly Ser Thr Asp Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Leu Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Val Phe Ser Gly Ala Glu Thr Ala Tyr Tyr Pro Ser Asp Asp 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120 12565126PRTArtificial Sequenceantibody sequence 65Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Pro Phe Ser Asn Tyr 20 25 30Gly Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Lys Arg Glu Phe Val 35 40 45Ala Gly Ile Ser Trp Ser Gly Gly Ser Thr Asp Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Val Phe Ser Gly Ala Glu Thr Ala Tyr Tyr Pro Ser Asp Asp 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120 12566126PRTArtificial Sequenceantibody sequence 66Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Pro Phe Ser Asn Tyr 20 25 30Gly Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Lys Arg Glu Ser Val 35 40 45Ala Gly Ile Ser Trp Ser Gly Gly Ser Thr Asp Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Val Phe Ser Gly Ala Glu Thr Ala Tyr Tyr Pro Ser Asp Asp 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120 12567126PRTArtificial Sequenceantibody sequence 67Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Val Ser Gly Arg Pro Phe Ser Asn Tyr 20 25 30Gly Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Gly Ile Thr Trp Ser Gly Gly Ser Thr His Tyr Ala Asp Leu Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val His65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Val Phe Ser Gly Ala Glu Thr Ala Tyr Tyr Pro Ser Thr Glu 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120 12568126PRTArtificial Sequenceantibody sequence 68Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Pro Phe Asn Asn Tyr 20 25 30Gly Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35

40 45Ala Gly Ile Ser Trp Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Val Phe Ser Gly Ala Glu Thr Ala Gln Tyr Pro Ser Tyr Asp 100 105 110Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120 12569130PRTArtificial Sequenceantibody sequence 69Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Pro Phe Ser Asn Tyr 20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Ser Trp Ser Gly Gly Ser Thr Ser Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser Pro Lys Pro Glu Asp Thr Ala Ile Tyr Tyr Cys 85 90 95Ala Ala Gln Phe Ser Gly Ala Asp Tyr Gly Phe Gly Arg Leu Gly Ile 100 105 110Arg Gly Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val 115 120 125Ser Ser 13070130PRTArtificial Sequenceantibody sequence 70Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Asn Tyr 20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Ser Trp Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Met Phe Ser Gly Ser Glu Ser Gln Leu Val Val Val Ile Thr 100 105 110Asn Leu Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val 115 120 125Ser Ser 13071127PRTArtificial Sequenceantibody sequence 71Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Asn Tyr 20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Thr Ile Ser Trp Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Ala Phe Ser Gly Ser Asp Tyr Ala Asn Thr Lys Lys Glu Val 100 105 110Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 120 12572127PRTArtificial Sequenceantibody sequence 72Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Asp Asp Tyr 20 25 30Cys Ile Ala Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Pro Val 35 40 45Ser Cys Ile Thr Thr Ser Asp Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Ser Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Arg Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Tyr Phe Gly Tyr Gly Cys Tyr Gly Gly Ala Gln Asp Tyr Arg 100 105 110Ala Met Asp Tyr Trp Gly Lys Gly Thr Leu Val Thr Val Ser Ser 115 120 12573122PRTArtificial Sequenceantibody sequence 73Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Asp1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Phe Ser Arg Tyr 20 25 30Thr Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Ser Trp Ser Gly Gly Arg Thr Asn Phe Ala Gly Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Asp Trp Leu Pro Val Pro Gly Arg Glu Ser Tyr Asp Tyr Trp 100 105 110Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 12074130PRTArtificial Sequenceantibody sequence 74Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ile Ala Ser Gly Arg Thr Phe Ser Asn Tyr 20 25 30Ala Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Ser Trp Ser Gly Gly Met Thr Asp His Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Ala Phe Ala Gly Asp Ile Pro Tyr Gly Ser Ser Trp Tyr Gly 100 105 110Asp Pro Thr Thr Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val 115 120 125Ser Ser 13075124PRTArtificial Sequenceantibody sequence 75Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Thr Ser Ser Thr Phe 20 25 30Ser Met Ala Trp Phe Arg Gln Ala Pro Arg Lys Glu Arg Glu Phe Val 35 40 45Ala Ala Ile Asn Trp Ser Gly Gly Ser Thr Arg Tyr Ala Asp Ser Val 50 55 60Ser Asp Arg Phe Ala Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr65 70 75 80Leu Gln Met Asn Asn Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Arg Arg Gly Gly Ile Tyr Tyr Ser Thr Gln Asn Asp Tyr Asp 100 105 110Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 12076123PRTArtificial Sequenceantibody sequence 76Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Val Ser Val Arg Thr Phe Ser Asp Tyr 20 25 30Arg Met Gly Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ser Thr Ile Ser Trp Ser Gly Gly Leu Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Gly Gly Gly Tyr Ala Gly Gly Thr Tyr Tyr His Pro Glu Glu 100 105 110Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 115 12077315PRTHomo sapiens 77Met Leu Ser Leu Leu His Ala Ser Thr Leu Ala Val Leu Gly Ala Leu1 5 10 15Cys Val Tyr Gly Ala Gly His Leu Glu Gln Pro Gln Ile Ser Ser Thr 20 25 30Lys Thr Leu Ser Lys Thr Ala Arg Leu Glu Cys Val Val Ser Gly Ile 35 40 45Thr Ile Ser Ala Thr Ser Val Tyr Trp Tyr Arg Glu Arg Pro Gly Glu 50 55 60Val Ile Gln Phe Leu Val Ser Ile Ser Tyr Asp Gly Thr Val Arg Lys65 70 75 80Glu Ser Gly Ile Pro Ser Gly Lys Phe Glu Val Asp Arg Ile Pro Glu 85 90 95Thr Ser Thr Ser Thr Leu Thr Ile His Asn Val Glu Lys Gln Asp Ile 100 105 110Ala Thr Tyr Tyr Cys Ala Leu Trp Glu Ala Gln Gln Glu Leu Gly Lys 115 120 125Lys Ile Lys Val Phe Gly Pro Gly Thr Lys Leu Ile Ile Thr Asp Lys 130 135 140Gln Leu Asp Ala Asp Val Ser Pro Lys Pro Thr Ile Phe Leu Pro Ser145 150 155 160Ile Ala Glu Thr Lys Leu Gln Lys Ala Gly Thr Tyr Leu Cys Leu Leu 165 170 175Glu Lys Phe Phe Pro Asp Val Ile Lys Ile His Trp Glu Glu Lys Lys 180 185 190Ser Asn Thr Ile Leu Gly Ser Gln Glu Gly Asn Thr Met Lys Thr Asn 195 200 205Asp Thr Tyr Met Lys Phe Ser Trp Leu Thr Val Pro Glu Lys Ser Leu 210 215 220Asp Lys Glu His Arg Cys Ile Val Arg His Glu Asn Asn Lys Asn Gly225 230 235 240Val Asp Gln Glu Ile Ile Phe Pro Pro Ile Lys Thr Asp Val Ile Thr 245 250 255Met Asp Pro Lys Asp Asn Cys Ser Lys Asp Ala Asn Asp Thr Leu Leu 260 265 270Leu Gln Leu Thr Asn Thr Ser Ala Tyr Tyr Met Tyr Leu Leu Leu Leu 275 280 285Leu Lys Ser Val Val Tyr Phe Ala Ile Ile Thr Cys Cys Leu Leu Arg 290 295 300Arg Thr Ala Phe Cys Cys Asn Gly Glu Lys Ser305 310 31578292PRTHomo sapiens 78Met Gln Arg Ile Ser Ser Leu Ile His Leu Ser Leu Phe Trp Ala Gly1 5 10 15Val Met Ser Ala Ile Glu Leu Val Pro Glu His Gln Thr Val Pro Val 20 25 30Ser Ile Gly Val Pro Ala Thr Leu Arg Cys Ser Met Lys Gly Glu Ala 35 40 45Ile Gly Asn Tyr Tyr Ile Asn Trp Tyr Arg Lys Thr Gln Gly Asn Thr 50 55 60Met Thr Phe Ile Tyr Arg Glu Lys Asp Ile Tyr Gly Pro Gly Phe Lys65 70 75 80Asp Asn Phe Gln Gly Asp Ile Asp Ile Ala Lys Asn Leu Ala Val Leu 85 90 95Lys Ile Leu Ala Pro Ser Glu Arg Asp Glu Gly Ser Tyr Tyr Cys Ala 100 105 110Cys Asp Thr Leu Gly Met Gly Gly Glu Tyr Thr Asp Lys Leu Ile Phe 115 120 125Gly Lys Gly Thr Arg Val Thr Val Glu Pro Arg Ser Gln Pro His Thr 130 135 140Lys Pro Ser Val Phe Val Met Lys Asn Gly Thr Asn Val Ala Cys Leu145 150 155 160Val Lys Glu Phe Tyr Pro Lys Asp Ile Arg Ile Asn Leu Val Ser Ser 165 170 175Lys Lys Ile Thr Glu Phe Asp Pro Ala Ile Val Ile Ser Pro Ser Gly 180 185 190Lys Tyr Asn Ala Val Lys Leu Gly Lys Tyr Glu Asp Ser Asn Ser Val 195 200 205Thr Cys Ser Val Gln His Asp Asn Lys Thr Val His Ser Thr Asp Phe 210 215 220Glu Val Lys Thr Asp Ser Thr Asp His Val Lys Pro Lys Glu Thr Glu225 230 235 240Asn Thr Lys Gln Pro Ser Lys Ser Cys His Lys Pro Lys Ala Ile Val 245 250 255His Thr Glu Lys Val Asn Met Met Ser Leu Thr Val Leu Gly Leu Arg 260 265 270Met Leu Phe Ala Lys Thr Val Ala Val Asn Phe Leu Leu Thr Ala Lys 275 280 285Leu Phe Phe Leu 290794PRTArtificial Sequenceantibody sequence 79Asn Ala Met Gly18016PRTArtificial Sequenceantibody sequence 80Val Ile Ser Ser Ser Gly Ser Thr Asn Tyr Ala Asp Ser Val Lys Gly1 5 10 158110PRTArtificial Sequenceantibody sequence 81His Val Ala Gly Phe Asp Glu Tyr Asn Tyr1 5 1082118PRTArtificial Sequenceantibody sequence 82Gln Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Ile Phe Ser Ile Asn 20 25 30Ala Met Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Asp Phe Leu 35 40 45Ala Val Ile Ser Ser Ser Gly Ser Thr Asn Tyr Ala Asp Ser Val Lys 50 55 60Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Ala Tyr Leu65 70 75 80Gln Met Asn Ser Leu Lys Val Glu Asp Thr Ala Val Tyr Tyr Cys Ala 85 90 95Ala His Val Ala Gly Phe Asp Glu Tyr Asn Tyr Trp Gly Gln Gly Thr 100 105 110Gln Val Thr Val Ser Ser 115835PRTArtificial Sequencelinker sequence 83Gly Gly Gly Gly Ser1 584254PRTArtificial Sequenceantibody sequence 84Gln Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Met Phe Ser Asp Asn 20 25 30Val Met Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val 35 40 45Ala Thr Ile Arg Thr Gly Gly Ser Thr Asn Tyr Ala Asp Ser Val Lys 50 55 60Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr Leu65 70 75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Arg 85 90 95His Thr Ile Pro Val Pro Ser Thr Pro Tyr Asp Tyr Trp Gly Gln Gly 100 105 110Thr Gln Val Thr Val Ser Ser Gly Gly Gly Gly Ser Glu Val Gln Leu 115 120 125Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly Ser Leu Arg Leu 130 135 140Ser Cys Ala Ala Ser Gly Arg Pro Phe Ser Asn Tyr Ala Met Gly Trp145 150 155 160Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ala Ala Ile Ser 165 170 175Trp Ser Gly Gly Ser Thr Ser Tyr Ala Asp Ser Val Lys Gly Arg Phe 180 185 190Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr Leu Gln Met Asn 195 200 205Ser Pro Lys Pro Glu Asp Thr Ala Ile Tyr Tyr Cys Ala Ala Gln Phe 210 215 220Ser Gly Ala Asp Tyr Gly Phe Gly Arg Leu Gly Ile Arg Gly Tyr Glu225 230 235 240Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 245 25085119PRTArtificial Sequenceantibody sequence 85Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Met Phe Ser Asp Asn 20 25 30Val Met Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val 35 40 45Ala Thr Ile Arg Thr Gly Gly Ser Thr Asn Tyr Ala Asp Ser Val Lys 50 55 60Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr Leu65 70 75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Arg 85 90 95His Thr Ile Pro Val Pro Ser Thr Pro Tyr Asp Tyr Trp Gly Gln Gly 100 105 110Thr Gln Val Thr Val Ser Ser 11586130PRTArtificial Sequenceantibody sequence 86Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Ser Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Pro Phe Ser Asn Tyr 20 25 30Ala Met Ser Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ser Ala Ile Ser Trp Ser Gly Gly Ser Thr Ser Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Gln Phe Ser Gly Ala Asp Tyr Gly Phe Gly Arg Leu Gly Ile 100 105 110Arg Gly Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val 115 120 125Ser Ser 13087254PRTArtificial Sequenceantibody sequence 87Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Ala Gly

Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ser Met Phe Ser Asp Asn 20 25 30Val Met Gly Trp Tyr Arg Gln Ala Pro Gly Lys Gln Arg Glu Leu Val 35 40 45Ala Thr Ile Arg Thr Gly Gly Ser Thr Asn Tyr Ala Asp Ser Val Lys 50 55 60Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Thr Val Tyr Leu65 70 75 80Gln Met Asn Ser Leu Lys Pro Glu Asp Thr Ala Val Tyr Tyr Cys Arg 85 90 95His Thr Ile Pro Val Pro Ser Thr Pro Tyr Asp Tyr Trp Gly Gln Gly 100 105 110Thr Gln Val Thr Val Ser Ser Gly Gly Gly Gly Ser Glu Val Gln Leu 115 120 125Leu Glu Ser Gly Gly Gly Ser Val Gln Pro Gly Gly Ser Leu Arg Leu 130 135 140Ser Cys Ala Ala Ser Gly Arg Pro Phe Ser Asn Tyr Ala Met Ser Trp145 150 155 160Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val Ser Ala Ile Ser 165 170 175Trp Ser Gly Gly Ser Thr Ser Tyr Ala Asp Ser Val Lys Gly Arg Phe 180 185 190Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr Leu Gln Met Asn 195 200 205Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Ala Gln Phe 210 215 220Ser Gly Ala Asp Tyr Gly Phe Gly Arg Leu Gly Ile Arg Gly Tyr Glu225 230 235 240Tyr Asp Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser 245 25088130PRTArtificial Sequenceantibody sequence 88Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Arg Pro Phe Ser Asn Tyr 20 25 30Ala Met Ser Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Phe Val 35 40 45Ser Ala Ile Ser Trp Ser Gly Gly Ser Thr Ser Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ala Gln Phe Ser Gly Ala Asp Tyr Gly Phe Gly Arg Leu Gly Ile 100 105 110Arg Gly Tyr Glu Tyr Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val 115 120 125Ser Ser 130

Claims

1. A method for the treatment of disorders caused, maintained and/or propagated by CD1d-restricted V.delta.1+ T-cell activation comprising administering to a subject a binding molecule comprising a binding moiety that is able to compete with the single domain antibody set forth in SEQ ID NO:4 in binding to a CD1d molecule.

2. A binding molecule comprising a first binding moiety that is able to compete with the antibody set forth in SEQ ID NO:4 in binding to a CD1d molecule and comprising a second binding moiety that is able to specifically bind to a V.gamma.9V.delta.2-TCR, wherein the binding molecule is able to activate V.gamma.9V.delta.2 T cells.

3. (canceled)

4. A method for the treatment of a tumor comprising administering to a subject the binding molecule according to claim 2.

5. The binding molecule according to claim 2, wherein the binding molecule is able to reduce V.delta.1 T cell activation.

6. The binding molecule according to claim 2, wherein the binding molecule is able to activate iNKT cells.

7. The binding molecule according to claim 2, wherein the binding molecule binds to the same epitope on CD1d as the antibody set forth in SEQ ID NO:4.

8. The binding molecule according to claim 2, wherein the second binding moiety is able to compete with a single domain antibody having a sequence according to any one of SEQ ID NOs: 59-76 in binding to a V.gamma.9V.delta.2-TCR.

9. The binding molecule according to claim 2, wherein the first and/or second-binding moiety is a binding moiety of an antibody.

10. The binding molecule according to claim 2, wherein the binding molecule binds to the same epitope on CD1d as the antibody set forth in SEQ ID NO:4, wherein the binding molecule is able to activate iNKT cells and wherein the first and second binding moieties are binding moieties of an antibody.

11. The binding molecule according to claim 2, wherein the first and/or second binding moiety is a single domain antibody.

12. The binding molecule according to claim 2, wherein the first binding moiety comprises a CDR1 sequence according to SEQ ID NO: 1, a CDR2 sequence according to SEQ ID NO: 2, and/or a CDR3 sequence according to SEQ ID NO: 3, or any of those sequences wherein, independently, any of the amino acids has been conservatively substituted, according to table 3.

13. The binding molecule according to claim 2, wherein the first binding moiety comprises the sequence set forth in SEQ ID NO: 85.

14. The binding molecule according to claim 2, wherein the second binding moiety comprises a CDR 1 sequence according SEQ ID NO: 5, a CDR 2 sequence according to SEQ ID NO: 6 and/or a CDR 3 sequence according to SEQ ID NO: 7; or a CDR 1 sequence according SEQ ID NO: 8, a CDR 2 sequence according to SEQ ID NO: 9 and/or a CDR 3 sequence according to SEQ ID NO: 10; or a CDR 1 sequence according SEQ ID NO: 11, a CDR 2 sequence according to SEQ ID NO: 12 and/or a CDR 3 sequence according to SEQ ID NO: 13; or a CDR 1 sequence according SEQ ID NO: 14, a CDR 2 sequence according to SEQ ID NO: 15 and/or a CDR 3 sequence according to SEQ ID NO: 16; or a CDR 1 sequence according SEQ ID NO: 17, a CDR 2 sequence according to SEQ ID NO: 18 and/or a CDR 3 sequence according to SEQ ID NO: 19; or a CDR 1 sequence according SEQ ID NO: 20, a CDR 2 sequence according to SEQ ID NO: 21 and/or a CDR 3 sequence according to SEQ ID NO: 22; or a CDR 1 sequence according SEQ ID NO: 23, a CDR 2 sequence according to SEQ ID NO: 24 and/or a CDR 3 sequence according to SEQ ID NO: 25; or a CDR 1 sequence according SEQ ID NO: 26, a CDR 2 sequence according to SEQ ID NO: 27 and/or a CDR 3 sequence according to SEQ ID NO: 28; or a CDR 1 sequence according SEQ ID NO: 29, a CDR 2 sequence according to SEQ ID NO: 30 and/or a CDR 3 sequence according to SEQ ID NO: 31; or a CDR 1 sequence according SEQ ID NO: 32, a CDR 2 sequence according to SEQ ID NO: 33 and/or a CDR 3 sequence according to SEQ ID NO: 34; or a CDR 1 sequence according SEQ ID NO: 35, a CDR 2 sequence according to SEQ ID NO: 36 and/or a CDR 3 sequence according to SEQ ID NO: 37; or a CDR 1 sequence according SEQ ID NO: 38, a CDR 2 sequence according to SEQ ID NO: 39 and/or a CDR 3 sequence according to SEQ ID NO: 40; or a CDR 1 sequence according SEQ ID NO: 41, a CDR 2 sequence according to SEQ ID NO: 42 and/or a CDR 3 sequence according to SEQ ID NO: 43; or a CDR 1 sequence according SEQ ID NO: 44, a CDR 2 sequence according to SEQ ID NO: 45 and/or a CDR 3 sequence according to SEQ ID NO: 46; or a CDR 1 sequence according SEQ ID NO: 47, a CDR 2 sequence according to SEQ ID NO: 48 and/or a CDR 3 sequence according to SEQ ID NO: 49; or a CDR 1 sequence according SEQ ID NO: 50, a CDR 2 sequence according to SEQ ID NO: 51 and/or a CDR 3 sequence according to SEQ ID NO: 52; or a CDR 1 sequence according SEQ ID NO: 53, a CDR 2 sequence according to SEQ ID NO: 54 and/or a CDR 3 sequence according to SEQ ID NO: 55; or a CDR 1 sequence according SEQ ID NO: 56, a CDR 2 sequence according to SEQ ID NO: 57 and/or a CDR 3 sequence according to SEQ ID NO: 58, or any of those sequences wherein, independently, any of the amino acids has been conservatively substituted, according to table 3.

15. The binding molecule according to claim 2, wherein the second binding moiety comprises the sequence set forth in SEQ ID NO: 86 or SEQ ID NO: 88.

16. The binding molecule according to claim 2, wherein the binding molecule comprises the sequence set forth in SEQ ID NO: 87.

17. The binding molecule according to claim 2, further comprising a tumor targeting moiety.

18. The method according to claim 4, wherein the tumor is selected from hematological malignancies such as T cell lymphoma, multiple myeloma, acute myeloid leukemia, acute lymphoblastic leukemia, chronic lymphocytic leukemia, mantle cell lymphoma, B cell lymphoma, smoldering myeloma, Hodgkin lymphoma, myelomonocytic leukemias, lymphoplasmacytic lymphoma, hairy cell leukemia, and splenic marginal zone lymphoma, or solid tumors, such as renal cell carcinoma, melanoma, colorectal carcinoma, head and neck cancer, breast cancer, prostate cancer, lung cancer, pancreatic cancer, gastro-esophageal cancer, small bowel carcinoma, central nervous system tumors, medulloblastomas, hepatocellular carcinoma, ovarian cancer, glioma, neuroblastoma, urothelial carcinomas, bladder cancer, sarcoma, penile cancer, basal cell carcinoma, merkel cell carcinoma, neuroendocrine carcinoma, neuroendocrine tumors, carcinoma of unknown primary (CUP), thymoma, vulvar cancer, cervical carcinoma, testicular cancer, cholangiocarcinoma, appendicular carcinoma, mesothelioma, ampullary carcinoma, anal cancer, and choriocarcinoma.

19. A pharmaceutical composition comprising a binding molecule according to claim 2 and a pharmaceutically acceptable excipient.

Images