U.S. patent application number 17/316141 was filed with the patent office on 2022-03-31 for glucocorticoid-induced tumor necrosis factor receptor (gitr) antibodies and methods of use thereof.
The applicant listed for this patent is Dana-Farber Cancer Institute, Inc.. Invention is credited to Wayne A. Marasco, Quan Karen Zhu.
Application Number | 20220098314 17/316141 |
Document ID | / |
Family ID | 1000006016919 |
Filed Date | 2022-03-31 |
![](/patent/app/20220098314/US20220098314A1-20220331-D00000.png)
![](/patent/app/20220098314/US20220098314A1-20220331-D00001.png)
![](/patent/app/20220098314/US20220098314A1-20220331-D00002.png)
![](/patent/app/20220098314/US20220098314A1-20220331-D00003.png)
![](/patent/app/20220098314/US20220098314A1-20220331-D00004.png)
![](/patent/app/20220098314/US20220098314A1-20220331-D00005.png)
![](/patent/app/20220098314/US20220098314A1-20220331-D00006.png)
![](/patent/app/20220098314/US20220098314A1-20220331-D00007.png)
![](/patent/app/20220098314/US20220098314A1-20220331-D00008.png)
![](/patent/app/20220098314/US20220098314A1-20220331-D00009.png)
![](/patent/app/20220098314/US20220098314A1-20220331-D00010.png)
View All Diagrams
United States Patent
Application |
20220098314 |
Kind Code |
A1 |
Marasco; Wayne A. ; et
al. |
March 31, 2022 |
GLUCOCORTICOID-INDUCED TUMOR NECROSIS FACTOR RECEPTOR (GITR)
ANTIBODIES AND METHODS OF USE THEREOF
Abstract
The present invention comprises human monoclonal antibodies that
bind to GITR (also known as glucocorticoid-induced tumor necrosis
factor receptor). Binding of the invented antibody to GITR inhibits
binding of its ligand, GITR-L, and can be used to treat cancer.
Inventors: |
Marasco; Wayne A.;
(Wellesley, MA) ; Zhu; Quan Karen; (Southborough,
MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Dana-Farber Cancer Institute, Inc. |
Boston |
MA |
US |
|
|
Family ID: |
1000006016919 |
Appl. No.: |
17/316141 |
Filed: |
May 10, 2021 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
16319590 |
Jan 22, 2019 |
11046777 |
|
|
PCT/US2017/043504 |
Jul 24, 2017 |
|
|
|
17316141 |
|
|
|
|
62365712 |
Jul 22, 2016 |
|
|
|
62375634 |
Aug 16, 2016 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 2317/565 20130101;
C07K 2317/92 20130101; A61K 38/2086 20130101; C07K 2317/24
20130101; C07K 2317/31 20130101; C07K 2317/73 20130101; C07K
2317/75 20130101; C07K 2317/622 20130101; C07K 16/2878
20130101 |
International
Class: |
C07K 16/28 20060101
C07K016/28; A61K 38/20 20060101 A61K038/20 |
Claims
1. An isolated humanized monoclonal antibody or antigen-binding
fragment thereof that binds to the human-glucocorticoid-induced
tumor necrosis factor receptor (GITR) comprising an amino acid
sequence about 80% identical to an amino acid sequence selected
from the group consisting of: a. a variable heavy chain region
comprising the amino acid sequence of SEQ ID NO: 2, and a variable
light chain region comprising the amino acid sequence of SEQ ID NO:
4; b. a variable heavy chain region comprising the amino acid
sequence of SEQ ID NO: 6, and a variable light chain region
comprising the amino acid sequence of SEQ ID NO: 8; c. a variable
heavy chain region comprising the amino acid sequence of SEQ ID NO:
10, and a variable light chain region comprising the amino acid
sequence of SEQ ID NO: 12; d. a variable heavy chain region
comprising the amino acid sequence of SEQ ID NO: 14, and a variable
light chain region comprising the amino acid sequence of SEQ ID NO:
16; e. a variable heavy chain region comprising the amino acid
sequence of SEQ ID NO: 18, and a variable light chain region
comprising the amino acid sequence of SEQ ID NO: 20; f. a variable
heavy chain region comprising the amino acid sequence of SEQ ID NO:
22, and a variable light chain region comprising the amino acid
sequence of SEQ ID NO: 24; g. a variable heavy chain region
comprising the amino acid sequence of SEQ ID NO: 26, and a variable
light chain region comprising the amino acid sequence of SEQ ID NO:
28; h. a variable heavy chain region comprising the amino acid
sequence of SEQ ID NO: 30, and a variable light chain region
comprising the amino acid sequence of SEQ ID NO: 32; i. a variable
heavy chain region comprising the amino acid sequence of SEQ ID NO:
34, and a variable light chain region comprising the amino acid
sequence of SEQ ID NO: 36; j. a variable heavy chain region
comprising the amino acid sequence of SEQ ID NO: 38, and a variable
light chain region comprising the amino acid sequence of SEQ ID NO:
40; k. a variable heavy chain region comprising the amino acid
sequence of SEQ ID NO: 42, and a variable light chain region
comprising the amino acid sequence of SEQ ID NO: 44; l. a variable
heavy chain region comprising the amino acid sequence of SEQ ID NO:
46, and a variable light chain region comprising the amino acid
sequence of SEQ ID NO: 48; or m. a variable heavy chain region
comprising the amino acid sequence of SEQ ID NO: 50, and a variable
light chain region comprising the amino acid sequence of SEQ ID NO:
52.
2. An isolated humanized monoclonal antibody or antigen-binding
fragment thereof wherein the antibody or antigen-binding fragment
comprises an amino acid sequence about 80% identical to an amino
acid sequence selected from the group consisting of: (a) a variable
heavy chain complementarity determining region 1, 2, or 3 (VH-CDR)
comprising the amino acid sequences of SEQ ID NO. 53, 54 or 55,
respectively; and, a variable light chain complementarity
determining region 1, 2 or 3 (VL-CDR) comprising the amino acid
sequences of SEQ ID NO. 56, 57, or 58; (b) a variable heavy chain
complementarity determining region 1, 2, or 3 (VH-CDR) comprising
the amino acid sequences of SEQ ID NO. 59, 60, or 61, respectively;
and, a variable light chain complementarity determining region 1, 2
or 3 (VL-CDR) comprising the amino acid sequences of SEQ ID NO. 62,
63, or 64; (c) a variable heavy chain complementarity determining
region 1, 2, or 3 (VH-CDR) comprising the amino acid sequences of
SEQ ID NO. 65, 66, or 67, respectively; and, a variable light chain
complementarity determining region 1, 2 or 3 (VL-CDR) comprising
the amino acid sequences of SEQ ID NO. 68, 69, or 70; (d) a
variable heavy chain complementarity determining region 1, 2, or 3
(VH-CDR) comprising the amino acid sequences of SEQ ID NO. 71, 72,
or 73, respectively; and, a variable light chain complementarity
determining region 1, 2 or 3 (VL-CDR) comprising the amino acid
sequences of SEQ ID NO. 74, 75, or 76; (e) a variable heavy chain
complementarity determining region 1, 2, or 3 (VH-CDR) comprising
the amino acid sequences of SEQ ID NO. 77, 78, or 79, respectively;
and, a variable light chain complementarity determining region 1, 2
or 3 (VL-CDR) comprising the amino acid sequences of SEQ ID NO. 80,
81, or 82; (f) a variable heavy chain complementarity determining
region 1, 2, or 3 (VH-CDR) comprising the amino acid sequences of
SEQ ID NO. 83, 84, or 85, respectively; and, a variable light chain
complementarity determining region 1, 2 or 3 (VL-CDR) comprising
the amino acid sequences of SEQ ID NO. 86, 87, or 88; (g) a
variable heavy chain complementarity determining region 1, 2, or 3
(VH-CDR) comprising the amino acid sequences of SEQ ID NO. 65, 72,
or 89, respectively; and, a variable light chain complementarity
determining region 1, 2 or 3 (VL-CDR) comprising the amino acid
sequences of SEQ ID NO. 90, 91, or 92; (h) a variable heavy chain
complementarity determining region 1, 2, or 3 (VH-CDR) comprising
the amino acid sequences of SEQ ID NO. 93, 94, or 95, respectively;
and, a variable light chain complementarity determining region 1, 2
or 3 (VL-CDR) comprising the amino acid sequences of SEQ ID NO. 96,
97, or 98; (i) a variable heavy chain complementarity determining
region 1, 2, or 3 (VH-CDR) comprising the amino acid sequences of
SEQ ID NO. 99, 100, or 101, respectively; and, a variable light
chain complementarity determining region 1, 2 or 3 (VL-CDR)
comprising the amino acid sequences of SEQ ID NO. 102, 103, or 104;
(j) a variable heavy chain complementarity determining region 1, 2,
or 3 (VH-CDR) comprising the amino acid sequences of SEQ ID NO. 65,
72, or 105, respectively; and, a variable light chain
complementarity determining region 1, 2 or 3 (VL-CDR) comprising
the amino acid sequences of SEQ ID NO. 106, 107, or 108; (k) a
variable heavy chain complementarity determining region 1, 2, or 3
(VH-CDR) comprising the amino acid sequences of SEQ ID NO. 109, 72,
or 110, respectively; and, a variable light chain complementarity
determining region 1, 2 or 3 (VL-CDR) comprising the amino acid
sequences of SEQ ID NO. 111, 112, or 113; (l) a variable heavy
chain complementarity determining region 1, 2, or 3 (VH-CDR)
comprising the amino acid sequences of SEQ ID NO. 65, 72, or 114,
respectively; and, a variable light chain complementarity
determining region 1, 2 or 3 (VL-CDR) comprising the amino acid
sequences of SEQ ID NO. 115, 116, or 117; or (m) a variable heavy
chain complementarity determining region 1, 2, or 3 (VH-CDR)
comprising the amino acid sequences of SEQ ID NO. 101, 118, or 119,
respectively; and, a variable light chain complementarity
determining region 1, 2 or 3 (VL-CDR) comprising the amino acid
sequences of SEQ ID NO. 120, 121, or 122, wherein said antibody or
antibody binding fragment binds human-glucocorticoid-induced tumor
necrosis factor receptor (GITR).
3. The antibody of claim 1, wherein said antibody is monovalent or
bivalent.
4. The antibody of claim 1, wherein said antibody is a single chain
antibody.
5. The antibody of claim 1, wherein said antibody has a binding
affinity within the range of 10.sup.-5 M to 10.sup.-12 M.
6. The antibody of claim 1, wherein said antibody has a IgG4 heavy
chain constant region.
7. The antibody of claim 1, wherein the Fc region contains
mutations at amino acid positions 234 and 235.
8. The antibody of claim 7, wherein the mutations are L234A and
L235A.
9. The antibody according to claim 1 wherein said antibody is a
bi-specific antibody that also binds to a tumor-associated antigen,
a cytokine or a cell surface receptor.
10. The antibody according to claim 1 or claim 2 linked to a
therapeutic agent.
11. The antibody of claim 10, wherein said therapeutic agent is a
toxin, a radiolabel, a siRNA, a small molecule, or a cytokine.
12. A cell producing the antibody of claim 1 or claim 2.
13. A method of depleting regulatory T-cells in a subject,
comprising administering to a subject in need thereof a composition
comprising an antibody according to claim 1 or claim 2.
14. A method of augmenting an immune response to an antigen
comprising administering to a subject in need thereof a composition
comprising an antibody of claim 1 or claim 2.
15. The method of claim 14, wherein said antigen is a viral
antigen, a bacterial antigen or a tumor associated antigen.
16. The method of claim 14, wherein said administration of said
antibody causes an increase in antigen specific T cell
activity.
17. The method of claim 14, wherein said administration of said
antibody causes an increase NK cell cytotoxicity.
18. The method of claim 14, further comprising administering to
said subject IL-15.
19. A method of treating or alleviating a symptom of cancer,
comprising administering to a subject in need thereof a composition
comprising an antibody according to claim 1 or claim 2.
20. The method of claim 19, wherein said cancer is a cancer in
which GITR or its ligand, GITR-L, is overexpressed.
21. The method of claim 20, comprising further administering to
said subject a cytokine or a chemotherapeutic agent.
22. The method of claim 21, wherein the cytokine is IL-15.
23. A nucleic acid comprising the nucleic acid sequence of SEQ ID
NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33,
35, 37, 39, 41, 43, 45, 47, 49, 51, or a sequence that is at least
80% identical thereto.
24. A nucleic acid encoding the polypeptide of SEQ ID NO: 2, 4, 6,
8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40,
42, 44, 46, 48, 50, 52, or a sequence that is at least 80%
identical thereto.
25. A polypeptide comprising the amino acid sequence of SEQ ID NO:
2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36,
38, 40, 42, 44, 46, 48, 50, 52, or a sequence that is at least 80%
identical thereto.
26. A vector comprising the nucleic acid claim 23 or 24.
27. A cell comprising the vector of claim 26.
Description
RELATED APPLICATIONS
[0001] This application is a Continuation of U.S. patent
application Ser. No. 16/319,590 filed on Jan. 22, 2019 which is a
National Stage Entry of PCT/US2017/043504 filed on Jul. 24, 2016
which claims priority to, and the benefit of, U.S. Provisional
Application No. 62/365,712 filed on Jul. 22, 2016 and U.S.
Provisional Application No. 62/375,634 filed Aug. 16, 2016 the
contents of which are incorporated herein by reference in their
entireties.
FIELD OF THE INVENTION
[0002] This invention relates generally to
anti-glucocorticoid-induced tumor necrosis factor receptor (GITR)
antibodies as well as to methods for use thereof.
INCORPORATION-BY-REFERENCE OF SEQUENCE LISTING
[0003] The contents of the text file named 5031461-40-US3_SL.txt],
which was created on Feb. 4, 2019 and is 51,691 bytes in size, are
hereby incorporated by reference in their entirety.
BACKGROUND OF THE INVENTION
[0004] The immune system must achieve a balance between effective
responses to eliminate pathogenic entities (e.g. in cancer), while
maintaining tolerance to prevent autoimmune disease. T cells serve
a critical role in maintaining a balance between suppression of
immune function, and active immune rejection. T regulatory cells
(Tregs) are characterized by the expression of CD25+, CD4+, FOXp3+
and glucocorticoid-induced tumor necrosis factor-related receptor
(GITR). Tregs suppress pathological immune responses, and
ultimately maintain immune homeostasis by way of regulating
immunological self-tolerance. The presence of Tregs suppresses the
activity of activated, effector T cells which are responsible for
eliminating various pathological entities.
[0005] Human epithelial malignancies have been associated with the
presence of increased amounts of Tregs both in the circulation and
within the tumor itself. The increased presence of suppressive
Tregs in cancer patients, results in a suppression of conventional
T cells, including effector cells, which in turn leads to a
downregulation in IFN-.gamma. production. Reduction of the presence
or the activity of Tregs in in vivo cancer animal models has
resulted in an increase in the amounts and activity of effector T
cells, which is often followed by a decrease in size of the tumor
and or alleviation of other cancer symptoms.
[0006] T cell activation results in an upregulation of GITR levels
in both Tregs and effector T cells. Manners of modulating the
activity of GITR, such that the Tregs immune suppressing function
is reduced, and the activity of effector T cells is increased is an
ongoing area of intense study. The GITR ligand, GITR-L, is
expressed in a variety of cells including dendritic cells,
macrophages and B cells. Previous studies have shown an association
between increased anti-tumor immune activity following
administration of exogenous GITR-L, or by alternate means of
antagonizing GITR, in cancer models.
[0007] Given the increased presence, and the role that Tregs have
in cancer, further attention to modulating the activity and
presence of Tregs, via GITR, is paramount in further understanding
and, ultimately, in the treatment of cancer. Therefore, there
exists an urgent need for agents that can specifically bind and
modulate the binding of GITR with its ligand, GITR-L, as a means to
promote effector T cell activity and, as a result, anti-tumor
activity.
SUMMARY OF THE INVENTION
[0008] In various aspects the invention provides an an isolated
humanized monoclonal antibody or antigen-binding fragment thereof
that binds to the human anti-glucocorticoid-induced tumor necrosis
factor receptor (GITR). The antibody has a variable heavy chain
region having the amino acid sequence of SEQ ID NO: 2, and a
variable light chain region having the amino acid sequence of SEQ
ID NO: 4; a variable heavy chain region having the amino acid
sequence of SEQ ID NO: 6, and a variable light chain region having
the amino acid sequence of SEQ ID NO: 8; a variable heavy chain
region comprising the amino acid sequence of SEQ ID NO: 10, and a
variable light chain region having the amino acid sequence of SEQ
ID NO: 12; a variable heavy chain region having the amino acid
sequence of SEQ ID NO: 14, and a variable light chain region having
the amino acid sequence of SEQ ID NO: 16; a variable heavy chain
region having the amino acid sequence of SEQ ID NO: 18, and a
variable light chain region having the amino acid sequence of SEQ
ID NO: 20; a variable heavy chain region having the amino acid
sequence of SEQ ID NO: 22, and a variable light chain region having
the amino acid sequence of SEQ ID NO: 24; a variable heavy chain
region having the amino acid sequence of SEQ ID NO: 26, and a
variable light chain region having the amino acid sequence of SEQ
ID NO: 28; a variable heavy chain region having the amino acid
sequence of SEQ ID NO: 30, and a variable light chain region having
the amino acid sequence of SEQ ID NO: 32; a variable heavy chain
region having the amino acid sequence of SEQ ID NO: 34, and a
variable light chain region having the amino acid sequence of SEQ
ID NO: 36; a variable heavy chain region having the amino acid
sequence of SEQ ID NO: 38, and a variable light chain region having
the amino acid sequence of SEQ ID NO: 40; a variable heavy chain
region having the amino acid sequence of SEQ ID NO: 42, and a
variable light chain region having the amino acid sequence of SEQ
ID NO: 44; a variable heavy chain region having the amino acid
sequence of SEQ ID NO: 46, and a variable light chain region having
the amino acid sequence of SEQ ID NO: 48; a variable heavy chain
region having the amino acid sequence of SEQ ID NO: 50, and a
variable light chain region having the amino acid sequence of SEQ
ID NO: 52.
[0009] In a further aspect the invention provides an isolated
humanized monoclonal antibody or antigen-binding fragment having a
variable heavy chain complementarity determining region 1, 2, or 3
(VH-CDR) having the amino acid sequences of SEQ ID NO. 53, 54 or
55, respectively; and, a variable light chain complementarity
determining region 1, 2 or 3 (VL-CDR) comprising the amino acid
sequences of SEQ ID NO. 56, 57, or 58; a variable heavy chain
complementarity determining region 1, 2, or 3 (VH-CDR) having the
amino acid sequences of SEQ ID NO. 59, 60, or 61, respectively;
and, a variable light chain complementarity determining region 1, 2
or 3 (VL-CDR) having the amino acid sequences of SEQ ID NO. 62, 63,
or 64; a variable heavy chain complementarity determining region 1,
2, or 3 (VH-CDR) having the amino acid sequences of SEQ ID NO. 65,
66, or 67, respectively; and, a variable light chain
complementarity determining region 1, 2 or 3 (VL-CDR) having the
amino acid sequences of SEQ ID NO. 68, 69, or 70; a variable heavy
chain complementarity determining region 1, 2, or 3 (VH-CDR) having
the amino acid sequences of SEQ ID NO. 71, 72, or 73, respectively;
and, a variable light chain complementarity determining region 1, 2
or 3 (VL-CDR) having the amino acid sequences of SEQ ID NO. 74, 75,
or 76; a variable heavy chain complementarity determining region 1,
2, or 3 (VH-CDR) having the amino acid sequences of SEQ ID NO. 77,
78, or 79, respectively; and, a variable light chain
complementarity determining region 1, 2 or 3 (VL-CDR) having the
amino acid sequences of SEQ ID NO. 80, 81, or 82; a variable heavy
chain complementarity determining region 1, 2, or 3 (VH-CDR) having
the amino acid sequences of SEQ ID NO. 83, 84, or 85, respectively;
and, a variable light chain complementarity determining region 1, 2
or 3 (VL-CDR) having the amino acid sequences of SEQ ID NO. 86, 87,
or 88; a variable heavy chain complementarity determining region 1,
2, or 3 (VH-CDR) having the amino acid sequences of SEQ ID NO. 65,
72, or 89, respectively; and, a variable light chain
complementarity determining region 1, 2 or 3 (VL-CDR) having the
amino acid sequences of SEQ ID NO. 90, 91, or 92; a variable heavy
chain complementarity determining region 1, 2, or 3 (VH-CDR) having
the amino acid sequences of SEQ ID NO. 93, 94, or 95, respectively;
and, a variable light chain complementarity determining region 1, 2
or 3 (VL-CDR) having the amino acid sequences of SEQ ID NO. 96, 97,
or 98; a variable heavy chain complementarity determining region 1,
2, or 3 (VH-CDR) having the amino acid sequences of SEQ ID NO. 99,
100, or 101, respectively; and, a variable light chain
complementarity determining region 1, 2 or 3 (VL-CDR) having the
amino acid sequences of SEQ ID NO. 102, 103, or 104; a variable
heavy chain complementarity determining region 1, 2, or 3 (VH-CDR)
having the amino acid sequences of SEQ ID NO. 65, 72, or 105,
respectively; and, a variable light chain complementarity
determining region 1, 2 or 3 (VL-CDR) having the amino acid
sequences of SEQ ID NO. 106, 107, or 108; a variable heavy chain
complementarity determining region 1, 2, or 3 (VH-CDR) having the
amino acid sequences of SEQ ID NO. 109, 72, or 110, respectively;
and, a variable light chain complementarity determining region 1, 2
or 3 (VL-CDR) having the amino acid sequences of SEQ ID NO. 111,
112, or 113; a variable heavy chain complementarity determining
region 1, 2, or 3 (VH-CDR) having the amino acid sequences of SEQ
ID NO. 65, 72, or 114, respectively; and, a variable light chain
complementarity determining region 1, 2 or 3 (VL-CDR) having the
amino acid sequences of SEQ ID NO. 115, 116, or 117; and a variable
heavy chain complementarity determining region 1, 2, or 3 (VH-CDR)
having the amino acid sequences of SEQ ID NO. 101, 118, or 119,
respectively; and, a variable light chain complementarity
determining region 1, 2 or 3 (VL-CDR) having the amino acid
sequences of SEQ ID NO. 120, 121, or 122.
[0010] The antibody is monovalent or bivalent. For example the
antibody is a single chain antibody. The antibody has a binding
affinity within the range of 10.sup.-5 M to 10.sup.-12 M. In some
aspects the antibody has a IgG4 heavy chain constant region. In
other aspects the antibody has an Fc region that contains mutations
at amino acid positions 234 and 235. The mutations are for example,
L234A and L235A.
[0011] In other aspects the invention includes a bi-specific
antibody containing the human GITR antibody of the invention and an
antibody that also binds to a tumor-associated antigen, a cytokine
or a cell surface receptor.
[0012] Optionally the antibodies of the invention are s linked to a
therapeutic agent, such as a toxin, a radiolabel, a siRNA, a small
molecule, or a cytokine.
[0013] Also provide by the invention are cells producing the
antibody according to the invention.
[0014] In various aspects the invention provides methods for
depleting regulatory T-cells in a subject, by administering to a
subject in need thereof a composition comprising an antibody
according to the invention.
[0015] Other methods of the invention include augmenting an immune
response to an antigen by administering to a subject in need
thereof a composition comprising an antibody according to the
invention. The antigen is a viral antigen, a bacterial antigen or a
tumor associated antigen.
[0016] In various aspects administering an antibody according to
the invention result in an increase in antigen specific T cell
activity and/or an increase NK cell cytoxicity.
[0017] In some aspects the methods of the invention further
includes administering to the subject IL-15.
[0018] In yet another aspect the invention includes methods of
treating or alleviating a symptom of cancer by administering to a
subject in need thereof a composition comprising an antibody
according to the invention. The cancer is a cancer in which GITR or
its ligand, GITR-L, is overexpressed. Optionally the subject is
further administered a cytokine, such as IL-15 or a
chemotherapeutic agent.
[0019] The invention further provides a nucleic acid having the
nucleic acid sequence of SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17,
19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43, 45, 47, 49, and
51.
[0020] In a further aspect the invention provides A nucleic acid
encoding the polypeptide of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16,
18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50,
52 or polypeptide having the amino acid sequence of SEQ ID NO: 2,
4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36,
38, 40, 42, 44, 46, 48, 50, 52. Vectors containing the nucleic
acids according to the invention are also provided. Also included
in the invention are cells containing the vectors according to the
invention.
[0021] Unless otherwise defined, all technical and scientific terms
used herein have the same meaning as commonly understood by one of
ordinary skill in the art to which this invention pertains.
Although methods and materials similar or equivalent to those
described herein can be used in the practice of the present
invention, suitable methods and materials are described below. All
publications, patent applications, patents, and other references
mentioned herein are expressly incorporated by reference in their
entirety. In cases of conflict, the present specification,
including definitions, will control. In addition, the materials,
methods, and examples described herein are illustrative only and
are not intended to be limiting.
[0022] Other features and advantages of the invention will be
apparent from and encompassed by the following detailed description
and claims.
BRIEF DESCRIPTION OF THE DRAWINGS
[0023] FIG. 1 illustrates the design and results from an ELISA in
vitro binding assay used for identifying anti-GITR antibodies.
Plates were coated with 2 ug/ml each of the A) hGITR-His; B)
hGITR-mlgG2a; C) mGITR-His; or D) mlgG2a. OD measurements for each
corresponding well are shown below the template.
[0024] FIG. 2 is a pair of graphs showing binding activity of
indicated anti-GITR phage antibodies in four different
concentrations (1E10 to 1E13 particles/mL) to two different
concentrations of hGITR-mlg determined by a meso scale discovery
immunoassay.
[0025] FIG. 3 is a pair of graphs showing binding activity for
indicated anti-GITR phage antibodies to eight different
concentrations of hGITR-mlg using a meso scale discovery
immunoassay.
[0026] FIG. 4 illustrates the data for the flow cytometry binding
assay performed using anti-GITR phage antibodies. Four
concentrations of anti-GITR phage AB were tested along with CHO
cells expressing either stable GITR or control CA9.
[0027] FIG. 5 is a graph showing flow cytometry GITR binding data
with a single concentration of phage antibodies from culture
supernatant of individual colonies. Orange bars indicate binding to
CHO cells expressing GITR and blue bars indicate binding to CHO
cells lacking GITR expression (CA9 control).
[0028] FIG. 6 illustrates ELISA GITR binding data for phage
supernatant from single colonies. The clone template, OD450 for
individual clones and the coating pattern for each plate is
shown.
[0029] FIG. 7 illustrates flow cytometry and ELISA results for
anti-GITR antibodies according to the invention.
[0030] FIG. 8 is a graph showing GITR binding of anti-GITR
antibodies expressed in full IgG1-Fc(LALA) mutant format as
analyzed by flow cytomtry assays. Anti-GITR mAb binding to the
GITR(+) CHO cell lines were tested by 5-point 2.times. serial
dilutions in duplicates.
[0031] FIG. 9 is a graph showing another flow cytometry analysis of
anti-GITR IgG1-Fc(LALA) antibodies binding to the cell surface
expressed GITR. Anti-GITR mAb binding to the GITR(+) CHO cell lines
were tested by 5-point 2.times. serial dilutions in duplicates.
[0032] FIG. 10 demonstrates GITR binding ability of representative
anti-GITR IgG1 antibodies expressed in IgG 1-Fc(LALA) format (Panel
A) or in IgG4 format (Panel B), analyzed by flow cytometry.
Anti-GITR mAb binding to the GITR(+) CHO cell lines were tested by
4-point 2.times. serial dilutions in duplicates.
[0033] FIG. 11 illustrates binding competition between GITR ligand
at 47 ng/ml and 10-point 2.times. serial dilution of anti-GITR
E1-3H7 IgG4, TT1-3C6 IgG4, or commercial GTI-10 IgG1
antibodies.
[0034] FIG. 12 illustrates that anti-GITR E1-3H7 IgG4 or TT1-3C6
synergistically increases GITR ligand induced luciferase expression
in an in vitro assay with GloResponse.TM. NF-.kappa.B-luc2P/GITR
Jurkat cells by Promega.
DETAILED DESCRIPTION
[0035] The present invention provides humanized monoclonal
antibodies specific against glucocorticoid-induced tumor necrosis
factor receptor, also known as GITR. The antibodies were identified
through the use of extensively validated Mehta I/II human
antibody-phage display libraries panning against human GITR. These
antibodies represent a new class of human monoclonal antibodies
against GITR.
[0036] These anti-GITR human monoclonal antibodies are referred to
herein as "huGITR antibodies".
[0037] There is documented evidence of an increase in the amounts
of regulatory T-cells (Tregs) in cases of epithelial cancers. There
is also evidence that GITR plays a key role in the dominant
immunological self-tolerance maintained by Tregs. This connection
between GITR expression on the Tregs, and the increase in Tregs
during cancer, allows for an opportunity to target GITR activity as
a means to promote enhanced effector T cell function. Specifically,
this makes targeting GITR, a potential immunotherapeutic approach
to cancer treatment.
[0038] Tregs express CD28, CD4, FOXP3, and GITR. The suppression of
effector T cell activity is largely mediated by way of FOXP3
dimerization with activated T cell nuclear factor, NF-AT, which in
turn results in the suppression of IFN-.gamma., IL-2 and IL-4.
Increased GITR ligation by means of binding with its ligand has
been shown to reduce the suppressive effects that Tregs have on
activated T cells. Additionally, antibodies that directly target
GITR have also been shown to reduce Treg suppressive function.
[0039] While GITR is expressed in both Tregs and in effector T
cells, the amount of expression of GITR is drastically greater in
the former. As such, GITR has been considered a good candidate
target for the modulation of the suppressive function of Tregs in
various diseases, including cancer. Murine models have indicated
that stimulation of the GITR results in reduced Treg suppressive
activity. Other studies have also indicated that antagonizing GITR
activity results in a lessening of Treg recruitment to malignant
cells. Combined, these data indicate GITR as a crucial receptor in
the pathophysiology of cancer.
[0040] The present invention provides a human monoclonal antibody
that specifically binds GITR proteins. Binding of the antibody of
the present invention to GITR interrupts the GITR ligand's ability
to bind to GITR. By a variety of mechanisms, the huGITR antibody
reduces the suppressive function that Tregs have on effector cells.
Administration of the huGITR antibody may result in Treg depletion,
increased effector T cell (Teff) proliferation, increased
antigen-specific T cell activity, and increased production of
effector cytokines. In some instances, the huGITR antibody promotes
or augments the antigen-specific immune response.
[0041] Accordingly, the huGITR antibodies of the invention are
useful in modulating T-cell activity. In particular the huGITR
antibodies can suppress Treg activity and stimulate Teff activity.
Additionally, the huGITR antibodies of the invention increase
NK-cell cytotoxicity and increase IFN.gamma. secretion.
[0042] The huGITR antibody is monovalent or bivalent and comprises
a single or double chain. Functionally, the binding affinity of the
huGITR antibody is within the range of 10.sup.-5M to 10.sup.-12 M.
For example, the binding affinity of the huGITR antibody is from
10.sup.-6 M to 10.sup.-12 M, from 10.sup.-7 M to 10.sup.-12 M, from
10.sup.-8 M to 10.sup.-12 M, from 10.sup.-9 M to 10.sup.-12 M, from
10.sup.-5 M to 10.sup.-11 M, from 10.sup.-6 M to 10.sup.-11 M, from
10.sup.-7 M to 10.sup.-11 M, from 10.sup.-8 M to 10.sup.-11 M, from
10.sup.-9 M to 10.sup.-11 M, from 10.sup.-10 M to 10.sup.-11 M,
from 10.sup.-5 M to 10.sup.-10 M, from 10.sup.-6 M to 10.sup.-10 M,
from 10.sup.-7 M to 10.sup.-10 M, from 10.sup.-8 M to 10.sup.-10 M,
from 10.sup.-9 M to 10.sup.-10 M, from 10.sup.-5 M to 10.sup.-9 M,
from 10.sup.-6 M to 10.sup.-9 M, from 10.sup.-7 M to 10.sup.-9 M,
from 10.sup.-8 M to 10.sup.-9 M, from 10.sup.-5 M to 10.sup.-8 M,
from 10.sup.-6 M to 10.sup.-8 M, from 10.sup.-7 M to 10.sup.-8 M,
from 10.sup.-5 M to 10.sup.-7 M, from 10.sup.-6 M to 10.sup.-7 M or
from 10.sup.-5 M t 10.sup.-6 M.
[0043] Furthermore, the antibody of the present invention comprises
a therapeutic agent including, but not limited to, a toxin, a
radiolabel, a siRNA, or a cytokine.
[0044] Thirteen unique monoclonal huGITR antibodies were
identified. These include mAb #E1-31B4, #E1-3E5 (and referred to as
#P2-21D12), #E1-3E9, #E1-31H7 (also referred to as #E5-31B2 and
#ET1-31B1), #ET1-31D6, #ET1-3E12, #P1-2A11, #P4-21F1, #T1- 3G7,
#TT1-3C6 (also referred to as #E1-31F6), TT1-3C8, #TT1-31F5, and
#TT5-3E2. The variable region nucleic acid sequences and amino acid
sequences are shown in Table 1A-13B. The amino acid sequences of
the CDRs associated with the variable regions of these antibodies
are shown in Table 14.
[0045] The nucleic acid and amino acid sequence of the monoclonal
human GITR antibodies are provided below:
TABLE-US-00001 TABLE 1A Ab #E1-3B4 Variable Region nucleic acid
sequences V.sub.H chain of Ab #E1-3B4 VH (IGHV3-9*01 F) (SEQ ID NO:
1)
CAGGTGCAGCTGGTGCAGTCTGGGGGAGGCGTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTG
CAGCCTCTGGATTCACCTTTGATGATTATGCCATGCACTGGGTCCGGCAAGCTCCAGGGAAGGGCCT
GGAGTGGGTCTCAAGTCTTAGTTGGAATACTGGTCGAGTAGCCTATGCGGACTCTGTGAAGGGCCGA
TTCACCATCTCCAGAGACAACGCCAAGAATTCCCTGTATCTGCAAATGAACAGTCTGAGACCTGAGG
ACACGGCCTTCTATTACTGTGCAAAAGGCTCCGCCCTTGGCTTAGTTGGCTGGTTCGACGCCTGGGG
CCAGGGCACCCTGGTCACCGTCTCCTCAG V.sub.L chain of Ab #E1-3B4
(IGLV3-19*01) (SEQ ID NO: 3)
TCTTCTGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGGGACAGACAGTCAGGATCACATGCC
AAGGAGACAGTCTCAGAACCTATTATGGAAGTTGGTACCAGCAGAAGCCAGGACAGGCCCCTCTACT
TGTCTTCTATGGCAAAGAGAGTCGGCCCTCAGGGATCCCAGACCGATTCTCTGGCTCCACCTCAGGA
AACACAGCTTCCTTGACCATCACTGGGGCTCAGGCGGAAGATGAGGCTGACTATTACTGTAACTCCC
AGGACAGCAGTGGTGACTTATTATTCGGCGGAGGGACCAAGCTGACCGTCCTAG
TABLE-US-00002 TABLE 1B Ab #E1-3B4 Variable Region amino acid
sequences V.sub.H chain of Ab #E1-3B4 VH (IGHV3-9*01) (SEQ ID NO:
2)
QVQLVQSGGGVVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSSLSWNTGRVAYADSVKGR
FTISRDNAKNSLYLQMNSLRPEDTAFYYCAKGSALGLVGWFDAWGQGTLVTVSS V.sub.L
chain of Ab #E1-3B4 (IGLV3-19*01) (SEQ ID NO: 4)
SSELTQDPAVSVALGQTVRITCQGDSLRTYYGSWYQQKPGQAPLLVFYGKESRPSGIPDRFSGSTSG
NTASLTITGAQAEDEADYYCNSQDSSGDLLFGGGTKLTVL
TABLE-US-00003 TABLE 2A Ab #E1-3E5 Variable Region nucleic acid
sequences V.sub.H chain of Ab #E1-3E5 VH (IGHV3-9*01) (SEQ ID NO:
5)
caggtgcagctggtgcaatctgggggaggcttggtccagtctgggaagtccgtgagactctcttgtg
cagcctctggattcacatttggtgattatgccatgcactgggtccggcaagctccaggaaagggcct
ggagtgggtcgcaggcattactaggaatagtggtcgcatagcctatgcggactttgtgaagggccga
ttcatcatctccagagacaacgccaagaactcactgtatctgcaaatgaacagcctgagagccgagg
acacggctgtgtattactgtgcgagcgaaatgactggggcttatgatatttggggccaagggaccac
ggtcaccgtctcctcag V.sub.L chain of Ab #E1-3E5 VL (IGLV3-19*01) (SEQ
ID NO: 7)
TCTTCTGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGGGACAGACAGTCAGGATCACATGCC
AAGGAGACGGCCTCAGATACTATTATGCAAGCTGGTACCAGCAGAAGCCAGGACAGGCCCCTATACT
TGTCCTCTTTGGTAAAAACAACCGGCCCTCAGGGATCCCAGACCGATTCTCTGGCTCCAGCTCAGGA
AATACAGCTTCCTTGACCATCACTGGGGCTCAGGCGGAAGATGAGGCTGACTATTACTGTAACTCGC
GGGACAGCAGTGGTAACCATCGATTCTTCGGAACTGGGACCAAGGTCACCGTCCTAA
TABLE-US-00004 TABLE 2B Ab #E1-3E5 Variable Region amino acid
sequences V.sub.H chain of Ab #E1-3E5 (also #P2-2D12) VH
(IGHV3-9*01) (SEQ ID NO: 6)
QVQLVQSGGGLVQSGKSVRLSCAASGFTFGDYAMHWVRQAPGKGLEWVAGITRNSGRIAYADFVKGR
FIISRDNAKNSLYLQMNSLRAEDTAVYYCASEMTGAYDIWGQGTTVTVSS V.sub.L chain of
Ab #E1-3E5 (also #P2-2D12) VL (IGLV3-19*01) (SEQ ID NO: 8)
SSELTQDPAVSVALGQTVRITCQGDGLRYYYASWYQQKPGQAPILVLFGKNNRPSGIPDRFSGSSSG
NTASLTITGAQAEDEADYYCNSRDSSGNHRFFGTGTKVTVL
TABLE-US-00005 TABLE 3A Ab #E1-3E9 Variable Region nucleic acid
sequences V.sub.H chain of Ab #E1-3E9 VH (IGHV3-30-3*01) (SEQ ID
NO: 9)
CAGGTGCAGCTGGTGCAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTG
CAGCCTCTGGATTCACCTTCAGTAGCTATGCTATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCT
GGAGTGGGTGGCAGTTATATCATATGATGGAAGCAATAAATACTACGCAGACTCCGTGAAGGGCCGA
TTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCTGAGG
ACACGGCTGTATATTACTGTGCGAAAGAGGATTACTATGATAGTAGTGGTTCGAACTACTGGGGCCA
GGGAACCCTGGTCACCGTCTCCTCAG V.sub.L chain of Ab #E1-3E9 VL
(IGLV1-47*01) (SEQ ID NO: 11)
CTGCCTGTGCTGACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGGGTCACCATCTCTTGTT
CTGGAAGCAGCTCCAACATCGGAAGTAATTATGTATACTGGTACCAGCAGCTCCCAGGAACGGCCCC
CAAACTCCTCACCTATAGGAATGATCAGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAG
TCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCGGTCCGAGGATGAGGCTGATTATTTCTGTT
CAGCTTGGGATGACAGCCTGGGTGGCGAGGTCTTCGGAACTGGGACCAAGGTCAACGTCCTAG
TABLE-US-00006 TABLE 3B Ab #E1-3E9 Variable Region amino acid
sequences V.sub.H chain of Ab #E1-3E9 VH (IGHV3-30-3*01) (SEQ ID
NO: 10)
QVQLVQSGGGVVQPGRSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGR
FTISRDNSKNTLYLQMNSLRAEDTAVYYCAKEDYYDSSGSNYWGQGTLVTVSS V.sub.L chain
of Ab #E1-3E9 VL (IGLV1-47*01) (SEQ ID NO: 12)
LPVLTQPPSASGTPGQRVTISCSGSSSNIGSNYVYWYQQLPGTAPKLLTYRNDQRPSGVPDRFSGSK
SGTSASLAISGLRSEDEADYFCSAWDDSLGGEVEGTGTKVNVL
TABLE-US-00007 TABLE 4A Ab #E1-3117 Variable Region nucleic acid
sequences V.sub.H chain of Ab #E1-3H7 VH (IGHV3-23*04) (SEQ ID NO:
13)
CAGGTGCAGCTGGTGCAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTG
CAGCCTCTGGATTCACCTTTAGCAGCCATGCCATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCT
GGAGTGGGTCTCAGCTATTAGTGGTAGTGGTGGTAGCACATACTACGCAGACTCCGTGAAGGGCCGG
TTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGG
ACACGGCCGTATATTACTGTGCGAAAATCGGTACGGCGGATGCTTTTGATATCTGGGGCCAAGGGAC
CACGGTCACCGTCTCCTCAG V.sub.L chain of Ab #E1-3H7 VL (IGLV1-44*01)
(SEQ ID NO: 15)
CAGTCTGCCCTGACTCAGCCACCCTCAGTGTCTGGGACCCCCGGACAGAGGGTCACCATCTCTTGTT
CTGGAGGCGTCCCCAACATCGGAAGTAATCCTGTAAACTGGTACCTCCACCGCCCAGGAACGGCCCC
CAAACTCCTCATCTATAATAGCAATCAGTGGCCCTCAGGGGTCCCTGACCGATTTTCTGGCTCCAGG
TCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAGGATGAGGCTGATTATTACTGTG
CAGCATGGGATGACAGCCTGGATGGTCTGGTTTTCGGCGGAGGGACCAAGTTGACCGTCCTAG
TABLE-US-00008 TABLE 4B Ab #E1-3H7 Variable Region amino acid
sequences V.sub.H chain of Ab #E1-3H7 (also #E5-3B2 and #ET1-3B1)
VH (IGHV3-23*04) (SEQ ID NO: 14)
QVQLVQSGGGLVQPGGSLRLSCAASGFTFSSHAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGR
FTISRDNSKNTLYLQMNSLRAEDTAVYYCAKIGTADAFDIWGQGTTVTVSS V.sub.L chain
of Ab #E1-3H7 (also #E5-3B2 and #ET1-3B1) VL (IGLV1-44*01) (SEQ ID
NO: 16)
QSALTQPPSVSGTPGQRVTISCSGGVPNIGSNPVNWYLHRPGTAPKLLIYNSNQWPSGVPDRFSGSR
SGTSASLAISGLQSEDEADYYCAAWDDSLDGLVFGGGTKLTVL
TABLE-US-00009 TABLE 5A #ET1-3D6 Variable Region nucleic acid
sequences V.sub.H chain of #ET1-3D6 VH (IGHV1-46*01) (SEQ ID NO:
17)
CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTTTCCTGCA
AGGCATCTGGATACACCTTCACCAGCTACTATATGCACTGGGTGCGACAGGCCCCTGGACAAGGGCT
TGAGTGGATGGGAATAATCAACCCTAGTGGTGGTAGCACAAGCTACGCACAGAAGTTCCAGGGCAGA
GTCACCATGACCAGGGACACGTCCACGAGCACAGTCTACATGGAGCTGAGCAGCCTGAGATCTGAGG
ACACGGCCGTGTATTACTGTGCTAGAGAAAAAAGCAGCAGCTGGTACGGGGGGGACAACTGGTTCGA
CCCCTGGGGCCAGGGCACCCTGGTCACCGTCTCCTCAG V.sub.L chain of #ET1-3D6 VL
(IGLV2-11*01) (SEQ ID NO: 19)
CAGTCTGCCCTGACTCAGCCTCGCTCAGTGTCCGGGTCTCCTGGACAGTCAGTCACCATCTCCTGCA
CTGGAAGCAGCAGTGATGTTGGTGGTTATCATTATGTCTCCTGGTACCAACAATACCCAGGCAAGT
CCCCAAACTGATGATTTATGATGTCTCTAGGCGGCCCTCAGGGGTTTCTGATCGCTTCTCTGGCTCC
AAGTCTGGCAGCACGGCCTCCCTGACCATCTCTGGGCTCCAGGCTGAGGACGAGGCTGATTATTACT
GCAGCTCATATACAAGCAGCAGCACTGTGGTCTTCGGCGGAGGGACCAAGCTGACCGTCCTAC
TABLE-US-00010 TABLE 5B #ET1-3D6 Variable Region amino acid
sequences V.sub.H chain of #ET1-3D6 VH (IGHV1-46*01) (SEQ ID NO:
18)
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGIINPSGGSTSYAQKFQGR
VTMTRDTSTSTVYMELSSLRSEDTAVYYCAREKSSSWYGGDNWFDPWGQGTLVTVSS V.sub.L
chain of #ET1-3D6 VL (IGLV2-11*01) (SEQ ID NO: 20)
QSALTQPRSVSGSPGQSVTISCTGSSSDVGGYHYVSWYQQYPGKVPKLMIYDVSRRPSGVSDRFSGS
KSGSTASLTISGLQAEDEADYYCSSYTSSSTVVFGGGTKLTVL
TABLE-US-00011 TABLE 6A #ET1-3E12 Variable Region nucleic acid
sequences V.sub.H chain of #ET1-3E12 VH (IGHV1-18*01) (SEQ ID NO:
21)
CAGGTGCAGCTGGTGCAATCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCA
AGGCTTCTGGTTACACCTTTACCAGCTATGGTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGGCT
TGAGTGGATGGGATGGATCAGCGCTTACAATGGTAACACAAACTATGCACAGAAGCTCCAGGGCAGA
GTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACG
ACACGGCCGTGTATTACTGTGCGAGAGATGTACACCCCTTAGATATAGCAGTGGCTGCCGACGATTA
CTACTACTACGGTATGGACGTCTGGGGCCAAGGCACCCTGGTCACCGTCTCCTCA V.sub.L
chain of #ET1-3E12 VL (IGLV3-19*01) (SEQ ID NO: 23)
TCTTCTGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGGGACAGACAGTCAGGATCACATGCC
AAGGAGACAGCCTCACAACCAATTATGCAAGCTGGTACCAGCAGAAGCCAGGACAGGCCCCTGTTCT
TGTCATCTATGGTAAAAACAAGCGGCCCTCAGGGATCCCAGACCGATTCTCTGGCTCCATCTCAGGG
AACACAGCTTCCTTGACCATCACTGGGGCTCAGGCGGAGGATGAGGCTGACTATTACTGTAACTCCC
GGGACAGCAGTGGTAAGCATTATGTCTTCGGAACTGGGACCAAGGTCACCGTCCTAG
TABLE-US-00012 TABLE 6B #ET1-3E12 Variable Region amino acid
sequences V.sub.H chain of #ET1-3E12 VH (IGHV1-18*01) (SEQ ID NO:
22)
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLEWMGWISAYNGNTNYAQKLQGR
VTMTTDTSTSTAYMELRSLRSDDTAVYYCARDVHPLDIAVAADDYYYYGMDVWGQGTLVTVSS
V.sub.L chain of #ET1-3E12 VL (IGLV3-19*01) (SEQ ID NO: 24)
SSELTQDPAVSVALGQTVRITCQGDSLTTNYASWYQQKPGQAPVLVIYGKNKRPSGIPDRFSGSISG
NTASLTITGAQAEDEADYYCNSRDSSGKHYVFGTGTKVTVL
TABLE-US-00013 TABLE 7A #P1-2A11 Variable Region nucleic acid
sequences V.sub.H chain of #P1-2A11 VH (IGHV3-23*04) (SEQ ID NO:
25)
GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTG
CAGCCTCTGGATTCACCTTTAGCAGCTATGCCATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCT
GGAGTGGGTCTCAGCTATTAGTGGTAGTGGTGGTAGCACATACTACGCAGACTCCGTGAAGGGCCGG
TTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGG
ACACGGCCGTATATTACTGTGCGAAAGATTGGGGCCTAGTACAACTGGAATCCGGCTATGACTACTG
GGGCCAGGGAACCCTGGTCACCGTCTCCTCAG V.sub.L chain of #P1-2A11 VL
(IGLV1-50*01) (SEQ ID NO: 27)
CAGTCTGTGCTGACTCAGCCACCCTCAGTGTCTGGGGCCCCAGGGCAGAGGGTCACCATCTCCTGCA
CTGGGAGCAGCTCCAACATCGGGGCAGGTTATGATGTACACTGGTACCAACAGCTTCCAGGAAAAGC
CCCCAAACTCCTCATCTATGATAATACCAATCGGCCCTCGGGGGTCCCTGACCGATTCTCTGGCTCC
AAGTCTGGCACCTCAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAGGATGAGGCTGATTATTACT
GTGCAGCATGGGATGAAAGCCTGAATGGTCAGGTCTTCGGAACTGGGACCAAGGTCACCGTCCTAG
TABLE-US-00014 TABLE 7B #P1-2A11 Variable Region amino acid
sequences V.sub.H chain of #P1-2A11 VH (IGHV3-23*04 F) (SEQ ID NO:
26)
EVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGR
FTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDWGLVQLESGYDYWGQGTLVTVSS V.sub.L
chain of #P1-2A11 VL (IGLV1-50*01) (SEQ ID NO: 28)
QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGKAPKLLIYDNTNRPSGVPDRFSGS
KSGTSASLAISGLQSEDEADYYCAAWDESLNGQVFGTGTKVTVL
TABLE-US-00015 TABLE 8A #P4-2F1 Variable Region nucleic acid
sequences V.sub.H chain of #P4-2F1 VH (IGHV4-4*02) (SEQ ID NO: 29)
CAGGTACAGCTGCAGCAGTCAGGCCCAGGACTGGTGAAGCCTTCGGGGACCCTGTCCCTCACCTGCG
CTGTCTCTGGTGGCTCCATCAGCAGTAGTGACTGGTGGAGTTGGGTCCGCCAGGTCCCAGGGAAGGG
GCTGGAGTGGATTGGGGAAATCTATCACAGTGGCAGTCCCAACTACAACCCGTCCCTCAGGGGTCGA
GTCACCATATCAGTAGACAAGTCGAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGCCGCGG
ACACGGCCGTCTATTACTGTGCGAGAGAAAGAGTTGCTCCTACAGTAGACGGTGCTTTTGATGTCTG
GGGCCAAGGGACAATGGTCACCGTCTCCTCAG V.sub.L chain of #P4-2F1 VL
(IGKV1-39*01) (SEQ ID NO: 31)
GACATCGTGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTCACCATCACTT
GCCGGGCAAGTCAGAGCATTACCACCTATTTAAATTGGTATCAGCAGAAACCAGGGAAAGCCCCTAA
GCTCCTGATCTATGCTGCATCCAGTTTGCAAAGTGGGGTCCCATCAAGGTTCAGTGGCAGTGGATCT
GGGACAGAATTCACTCTCACTATCAGCAGCCTGCAGCCTGAAGATTTTGCAACTTATTATTGTCAAC
AGGCCAGCAGTTTCCCTCTCACTTTCGGCGGAGGGACCAAGGTGGATCTCAAAC
TABLE-US-00016 TABLE 8B #P4-2F1 Variable Region amino acid
sequences V.sub.H chain of #P4-2F1 VH (IGHV4-4*02) (SEQ ID NO: 30)
QVQLQQSGPGLVKPSGTLSLTCAVSGGSISSSDWWSWVRQVPGKGLEWIGEIYHSGSPNYNPSLRGR
VTISVDKSKNQFSLKLSSVTAADTAVYYCARERVAPTVDGAFDVWGQGTMVTVSS V.sub.L
chain of #P4-2F1 VL (IGKV1-39*01 F) (SEQ ID NO: 32)
DIVMTQSPSSLSASVGDRVTITCRASQSITTYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGS
GTEFTLTISSLQPEDFATYYCQQASSFPLTFGGGTKVDLK
TABLE-US-00017 TABLE 9A #T1-3G7 Variable Region nucleic acid
sequences V.sub.H chain of #T1-3G7 VH (IGHV5-51*01) (SEQ ID NO: 33)
GAGGTGCAGCTGGTGCAGTCTGGAGCTGAGGTGAAAAAGCCCGGGGAGTCTCTGAAGATCTCCTGTA
AGGGTTCGGGATACAGCTTTACCAACTACTGGATCGGCTGGGTGCGCCAGATGCCCGGGAAAGGCCT
GGAGTGGATTGGGATCATCTATCCTGGTGACTCTGATACCAGATACAGCCCGTCCTTCCAAGGCCAG
GTCACCATCTCAGCCGACAAGTCCACCAGCACTGCCTACCTGCAGTGGAGCAGCCTGAAGGCCTCGG
ACACCGCCATGTATTACTGTGCGAGGATAAAGAGTTACTATGATAGTAGTGGTTATTACCTCTGGGG
CCAGGGAACCCTGGTCACCGTCTCCTCAG V.sub.L chain of #T1-3G7 VL
(IGLV3-21*02) (SEQ ID NO: 35)
CAGTCTGTGCTGACTCAGCCACCCTCGGTGTCAGTGGCCCCAGGACAGACGGCCAGCATAACCTGTG
GGGGAAACAACATTGGGAGTAAAAGTGTGCACTGGTACCAGCAGAAGCCAGGCCAGGCCCCTGTCCT
GGTCGTCTATGATGATAGCGACCGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCAACTCTGGG
AACACGGCCACCCTGACCATCAGCAGGGTCGAAGCCGGGGATGAGGCCGACTATTACTGTCAGGTGT
GGGATAGTAGTAGTGAAGAGGTATTCGGCGGAGGGACCAAGCTGACCGTCCTAG
TABLE-US-00018 TABLE 9B #T1-3G7 Variable Region amino acid
sequences V.sub.H chain of #T1-3G7 VH (IGHV5-51*01) (SEQ ID NO: 34)
EVQLVQSGAEVKKPGESLKISCKGSGYSFTNYWIGWVRQMPGKGLEWIGIIYPGDSDTRYSPSFQGQ
VTISADKSTSTAYLQWSSLKASDTAMYYCARIKSYYDSSGYYLWGQGTLVTVSS V.sub.L
chain of #T1-3G7 VL (IGLV3-21*02) (SEQ ID NO: 36)
QSVLTQPPSVSVAPGQTASITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPERFSGSNSG
NTATLTISRVEAGDEADYYCQVWDSSSEEVFGGGTKLTVL
TABLE-US-00019 TABLE 10A #TT1-3C6 (also #E1-3F6) Variable Region
nucleic acid sequences V.sub.H chain of #TT1-3C6 VH (IGHV3-23*04)
(SEQ ID NO: 37)
GAGGTGCAGCTGGTGCAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTG
CAGCCTCTGGATTCACCTTTAGCAGCTATGCCATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCT
GGAGTGGGTCTCAGCTATTAGTGGTAGTGGTGGTAGCACATACTACGCAGACTCCGTGAAGGGCCGG
TTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGACG
ACACGGCTGTCTATTACTGTGCGAGAAGGGGGTTCATGGACGTCTGGGGCAAAGGCACCCTGGTCAC
CGTCTCCTCAG V.sub.L chain of #TT1-3C6 VL (IGLV3-19*01) (SEQ ID NO:
39)
TCTTCTGAGCTGACTCAGGACCCTGCTGTGTCTGTGGCCTTGGGACAGACAGTCACCATCACATGCC
AAGGAGACATCCTCGAAGCCTATTATGCAAGTTGGTACCAGCAGAGGCCAGGACAGGCCCCTGTCCT
TGTCATCTATGGCGAAAACAACCGGCCCTCAGGGATCCCAGACCGGTTCTCTGGCTCCAGGTCAGGA
AACACAGCCTCCTTGACCATCACTGGGGCTCAGGCGGAAGATGAGGCTGACTATTATTGTAACTCTC
GGGACAGCAGTGGTAGCCATGTGGTATTCGGCGGAGGGACCAAGATGACCGTCCTGG
TABLE-US-00020 TABLE 10B #TT1-3C6 (also #E1-3F6)Variable Region
amino acid sequences V.sub.H chain of #TT1-3C6 VH (IGHV3-23*04)
(SEQ ID NO: 38)
EVQLVQSGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGR
FTISRDNSKNTLYLQMNSLRADDTAVYYCARRGFMDVWGKGTLVTVSS V.sub.L chain of
#TT1-3C6 VL (IGLV3-19*01) (SEQ ID NO: 40)
SSELTQDPAVSVALGQTVTITCQGDILEAYYASWYQQRPGQAPVLVIYGENNRPSGIPDRFSGSRSG
NTASLTITGAQAEDEADYYCNSRDSSGSHVVFGGGTKMTVL
TABLE-US-00021 TABLE 11A #TT1-3C8 Variable Region nucleic acid
sequences V.sub.H chain of #TT1-3C8 VH (IGHV3-23*04) (SEQ ID NO:
41)
CAGGTGCAGCTGGTGCAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTG
CAGCCTCTGGATTCACCTTTAACAGCTTTGCCATGACCTGGGTCCGCCAGGCTCCAGGGAAGGGGCT
GGAGTGGGTCTCAGGTATTAGTGGTAGTGGTGGTAGCACATACTACGCAGACTCCGTGAAGGGCCGG
TTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGG
ACACGGCCGTATATTACTGTGCGAAAGGGCACGCTTTTGATATCTGGGGCCAAGGGACCACGGTCAC
CGTCTCCTCAG V.sub.L chain of #TT1-3C8 VL (IGKV2D-29*01) (SEQ ID NO:
43)
GACATCGTGATGACCCAGTCTCCACTCTCTCTGTCCGTCACCCCTGGGCAGCCGGCCTCCATCTCCT
GCAAGTCTAGTCAGAGCCTCCTGCATAGTGATGGAAAGACCTATTTGTATTGGTACCTGCAGAAGCC
AGGCCAGCCTCCACAACTCCTGATCTATGAAGTTTCCAACCGGTTCTCTGGAGTGCCAGATAGGTTC
AGTGGCAGCGGGTCAGGGACAGATTTCACACTGAAAATCAGCCGGGTGGAGGCTGAGGATGTTGGGG
TTTATTACTGCATGCAAAGTATACAGCTTCCTCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAA
AC
TABLE-US-00022 TABLE 11B #TT1-3C8 Variable Region amino acid
sequences V.sub.H chain of #TT1-3C8 VH (IGHV3-23*04) (SEQ ID NO:
42)
QVQLVQSGGGLVQPGGSLRLSCAASGFTFNSFAMTWVRQAPGKGLEWVSGISGSGGSTYYADSVKGR
FTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGHAFDIWGQGTTVTVSS V.sub.L chain of
#TT1-3C8 VL (IGKV2D-29*01) (SEQ ID NO: 44)
DIVMTQSPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQPPQLLIYEVSNRFSGVPDRF
SGSGSGTDFTLKISRVEAEDVGVYYCMQSIQLPLTFGGGTKVEIK
TABLE-US-00023 TABLE 12A #TT1-3F5 Variable Region nucleic acid
sequences V.sub.H chain of #TT1-3F5 VH (IGHV3-23*04) (SEQ ID NO:
45)
CAGGTGCAGCTGGTGCAGTCTGGGGGAGGCTTGGTACAGCCTGGGGGGTCCCTGAGACTCTCCTGTG
CAGCCTCTGGATTCACCTTTAGCAGCTATGCCATGAGCTGGGTCCGCCAGGCTCCAGGGAAGGGGCT
GGAGTGGGTCTCAGCTATTAGTGGTAGTGGTGGTAGCACATACTACGCAGACTCCGTGAAGGGCCGG
TTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGG
ACACGGCTGTGTATTACTGTGCGAAAGATAAAGGTGGGGGGTTCGACCCCTGGGGCCAGGGAACCCT
GGTCACCGTCTCCTCAG V.sub.L chain of #TT1-3F5 VL (IGLV6-57*01) (SEQ
ID NO: 47)
AATTTTATGCTGACTCAGCCCCACTCTGTGTCGGAGTCTCCGGGGAAGACGGTAACCATCTCCTGCA
CCCGCAGCAGTGGCAGCATTGCCAGCAACTATGTGCAGTGGTACCAGCAGCGCCCGGGCAGTTCCCC
CACCACTGTGATCTATGAGGATAACCAAAGACCCTCTGGGGTCCCTGATCGGTTCTCTGGCTCCATC
GACAGCTCCTCCAACTCTGCCTCCCTCACCATCTCTGGACTGAAGACTGAGGACGAGGCTGACTACT
ACTGTCAGTCTTATGATAGTACCTCTCATGTCTTCGGAACTGGGACCCAGGTCACCGTCCTAG
TABLE-US-00024 TABLE 12B #TT1-3F5 Variable Region amino acid
sequences V.sub.H chain of #TT1-3F5 VH (IGHV3-23*04) (SEQ ID NO:
46)
QVQLVQSGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGR
FTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDKGGGFDPWGQGTLVTVSS V.sub.L chain of
#TT1-3F5 VL (IGLV6-57*01) (SEQ ID NO: 48)
NFMLTQPHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSI
DSSSNSASLTISGLKTEDEADYYCQSYDSTSHVFGTGTQVTVL
TABLE-US-00025 TABLE 13A #TT5-3E2 Variable Region nucleic acid
sequences V.sub.H chain of #TT5-3E2 VH (IGHV5-51*01) (SEQ ID NO:
49)
GAGGTGCAGCTGGTGCAGTCTGGAGCAGAGGTGAAGCCCGGGGAGTCTCTGAAGATCTCCTGTA
AGGGTTCTGGATACAGCTTTACCAACTACTGGATCGGCTGGGTGCGCCAGATGCCCGGGAAAGGCCT
GGAGTGGGTGGGGATCATCTATCCTGGTGACTCTGATACCAGATACAGCCCGTCCTTCCAAGGCCAG
GTCACCATCTCAGCCGACAAGTCCATCAGCACCGCCTACCTGCAGTGGAGCAGCCTGAAGGCCTCGG
ACACCGCCATGTATTACTGTGCGAGACCAGGGTATTACTATGGTTCGGGGAGTTATTATAACGTTGA
CTACTGGGGCCAGGGCACCCTGGTCACCGTCTCCTCAG V.sub.L chain of #TT5-3E2 VL
(IGLV3-1*01) (SEQ ID NO: 51)
CAGCCTGGGCTGACTCAGCCACCCTCAGTGTCCGTGTCCCCAGGACAGACAGCCAGCATCACCTGCT
CTGGAGATGAATTGGGGGATAAATTTGCTTTCTGGTATCAACAAAAGCCAGGCCAGTCCCCTGTGCT
GGTCATCTATCAAGATAGTAAGAGGCCCTCAGGGATCCCTGAGCGATTCTCTGGCTCCATCTCTGGG
AACACGGCCACCCTGACTATCAGCAGGGTCGAGGCCGGAGATGAGGCCGACTATTTCTGTCAGGTGT
GGGATAGCAATGGTGGTCCCCCATTCGGGAGAGGGACCAAGCTGACCGTCCTAG
TABLE-US-00026 TABLE 13B #TT5-3E2 Variable Region amino acid
sequences V.sub.H chain of #TT5-3E2 VH (IGHV5-51*01) (SEQ ID NO:
50)
EVQLVQSGAEVKKPGESLKISCKGSGYSFTNYWIGWVRQMPGKGLEWVGIIYPGDSDTRYSPSFQGQ
VTISADKSISTAYLQWSSLKASDTAMYYCARPGYYYGSGSYYNVDYWGQGTLVTVSS V.sub.L
chain of #TT5-3E2 VL (IGLV3-1*01) (SEQ ID NO: 52)
QPGLTQPPSVSVSPGQTASITCSGDELGDKFAFWYQQKPGQSPVLVIYQDSKRPSGIPERFSGSISG
NTATLTISRVEAGDEADYFCQVWDSNGGPPFGRGTKLTVL
[0046] The hGITR antibodies described herein bind to GITR. In one
aspect, the hmGITR antibodies have high affinity and high
specificity for GITR. In another aspect, the hmGITR antibodies can
bind the GITR receptor and prevent, inhibit, or block the ligand
GITR-L from binding its receptor GITR.
TABLE-US-00027 TABLE 14 Amino Acid Sequences of Heavy and Light
Chains. Variable Antibody region CDR1 CDR2 CDR3 #E1-3B4 VH GFTFDDYA
LSWNTGRV AKGSALGLVGWFDA (SEQ ID (SEQ ID (SEQ ID NO: 55) NO: 53) NO:
54) #E1-3B4 VL SLRTYY GKE NSQDSSGDLL (SEQ ID (SEQ ID (SEQ ID NO:
58) NO: 56) NO: 57) #E1-3E5 VH GFTFGDYA ITRNSGRI ASEMTGAYDI (and
#P2- (SEQ ID (SEQ ID (SEQ ID NO: 61) 2D12) NO: 59) NO: 60) #E1-3E5
VL GLRYYY GKN NSRDSSGNHRF (and P2- (SEQ ID (SEQ ID (SEQ ID NO: 64)
2D12) NO: 62) NO: 63) #E1-3E9 VH GFTFSSYA ISYDGSNK AKEDYYDSSGSNY
(SEQ ID (SEQ ID (SEQ ID NO: 67) NO: 65) NO: 66) #E1-3E9 VL SSNIGSNY
RND SAWDDSLGGEV (SEQ ID (SEQ ID (SEQ ID NO: 70) NO: 68) NO: 69)
#E1-3H7 VH GFTFSSHA ISGSGGST AKIGTADAFDI (also (SEQ ID (SEQ ID (SEQ
ID NO: 73) #E5-3B2 NO: 71) NO: 72) and #ET1- 3B1) #E1-3H7 VL
VPNIGSNP NSN AAWDDSLDGLV (also (SEQ ID (SEQ ID (SEQ ID NO: 76)
#E5-3B2 NO: 74) NO: 75) and #ET1- 3B1) #ET1-3D6 VH GYTFTSYY
INPSGGST AREKSSSWYGGDNWFDP (SEQ ID (SEQ ID (SEQ ID NO: 79) NO: 77)
NO: 78) #ET1-3D6 VL SSDVGGYHY DVS SSYTSSSTVV (SEQ ID (SEQ ID (SEQ
ID NO: 82) NO: 80) NO: 81) #ET1-3E12 VH GYTFTSYG ISAYNGNT
ARDVHPLDIAVAADDYYYYGMDV (SEQ ID (SEQ ID (SEQ ID NO: 85) NO: 83) NO:
84) #ET1-3E12 VL SLTTNY GKN NSRDSSGKHYV (SEQ ID (SEQ ID (SEQ ID NO:
88) NO: 86) NO: 87) #P1-2A11 VH GFTFSSYA ISGSGGST AKDWGLVQLESGYDY
(SEQ ID (SEQ ID (SEQ ID NO: 89) NO: 65) NO: 72) #P1-2A11 VL
SSNIGAGYD DNT AAWDESLNGQV (SEQ ID (SEQ ID (SEQ ID NO: 92) NO: 90)
NO: 91) #P4-2F1 VH GGSISSSDW IYHSGSP ARERVAPTVDGAFDV (SEQ ID (SEQ
ID (SEQ ID NO: 95) NO: 93) NO: 94) #P4-2F1 VL QSITTY AAS QQASSFPLT
(SEQ ID (SEQ ID (SEQ ID NO: 98) NO: 96) NO: 97) #T1-3G7 VH GYSFTNYW
IYPGDSDT ARIKSYYDSSGYYL (SEQ ID (SEQ ID (SEQ ID NO: 101) NO: 99)
NO: 100) #T1-3G7 VL NIGSKS DDS QVWDSSSEEV (SEQ ID (SEQ ID (SEQ ID
NO: 104) NO: 102) NO: 103) #TT1-3C6 VH GFTFSSYA ISGSGGST ARRGFMDV
(and (SEQ ID (SEQ ID (SEQ ID NO: 105) #E1-3F6) NO: 65) NO: 72)
#TT1-3C6 VL ILEAYY GEN NSRDSSGSHVV (and (SEQ ID (SEQ ID (SEQ ID NO:
108) #E1-3F6) NO: 106) NO: 107) #TT1-3C8 VH GFTFNSFA ISGSGGST
AKGHAFDI (SEQ ID (SEQ ID (SEQ ID NO: 110) NO: 109) NO: 72) #TT1-3C8
VL QSLLHSDGKTY EVS MQSIQLPLT (SEQ ID (SEQ ID (SEQ ID NO: 113) NO:
111) NO: 112) #TT1-3F5 VH GFTFSSYA ISGSGGST AKDKGGGFDP (SEQ ID (SEQ
ID (SEQ ID NO: 114) NO: 65) NO: 72) #TT1-3F5 VL SGSIASNY EDN
QSYDSTSHV (SEQ ID (SEQ ID (SEQ ID NO: 117) NO: 115) NO: 116)
#TT5-3E2 VH GYSFTNYW IYPGDSDT ARPGYYYGSGSYYNVDY (SEQ ID (SEQ ID
(SEQ ID NO: 119) NO: 99) NO: 118) #TT5-3E2 VL ELGDKF QDS QVWDSNGGPP
(SEQ ID (SEQ ID (SEQ ID NO: 122) NO: 120) NO: 121)
[0047] The present invention also features antibodies that have a
specified percentage identity or similarity to the amino acid or
nucleotide sequences of the huGITR antibodies described herein. For
example, the antibodies may have 60%, 70%, 75%, 80%, 85%, 90%, 91%,
92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity when
compared a specified region or the full length of any one of the
huGITR antibodies described herein. Sequence identity or similarity
to the nucleic acids and proteins of the present invention can be
determined by sequence comparison and/or alignment by methods known
in the art. For example, sequence comparison algorithms (i.e. BLAST
or BLAST 2.0), manual alignment or visual inspection can be
utilized to determine percent sequence identity or similarity for
the nucleic acids and proteins of the present invention.
[0048] As to amino acid sequences, one of skill in the art will
readily recognize that individual substitutions, deletions or
additions to a nucleic acid, peptide, polypeptide, or protein
sequence which alters, adds, deletes, or substitutes a single amino
acid or a small percentage of amino acids in the encoded sequence
is collectively referred to herein as a "conservatively modified
variant". In some embodiments the alteration results in the
substitution of an amino acid with a chemically similar amino acid.
Conservative substitution tables providing functionally similar
amino acids are well known in the art. Such conservatively modified
variants of the huGITR antibody disclosed herein may exhibit
increased cross-reactivity to GITR in comparison to an unmodified
GITR antibody.
Antibodies
[0049] As used herein, the term "antibody" refers to immunoglobulin
molecules and immunologically active portions of immunoglobulin
(Ig) molecules, i.e., molecules that contain an antigen binding
site that specifically binds (immunoreacts with) an antigen. By
"specifically binds" or "immunoreacts with" is meant that the
antibody reacts with one or more antigenic determinants of the
desired antigen and does not react with other polypeptides.
Antibodies include, but are not limited to, polyclonal, monoclonal,
chimeric, dAb (domain antibody), single chain, F.sub.ab, F.sub.ab'
and F.sub.(ab')2 fragments, scFvs, and F.sub.ab expression
libraries.
[0050] A single chain Fv ("scFv") polypeptide molecule is a
covalently linked V.sub.H:V.sub.L heterodimer, which can be
expressed from a gene fusion including V.sub.H- and
V.sub.L-encoding genes linked by a peptide-encoding linker. (See
Huston et al. (1988) Proc Nat Acad Sci USA 85(16):5879-5883). A
number of methods have been described to discern chemical
structures for converting the naturally aggregated, but chemically
separated, light and heavy polypeptide chains from an antibody V
region into an scFv molecule, which will fold into a three
dimensional structure substantially similar to the structure of an
antigen-binding site. See, e.g., U.S. Pat. Nos. 5,091,513;
5,132,405; and 4,946,778.
[0051] Very large naive human scFv libraries have been and can be
created to offer a large source of rearranged antibody genes
against a plethora of target molecules. Smaller libraries can be
constructed from individuals with infectious diseases in order to
isolate disease-specific antibodies. (See Barbas et al., Proc.
Natl. Acad. Sci. USA 89:9339-43 (1992); Zebedee et al., Proc. Natl.
Acad. Sci. USA 89:3175-79 (1992)).
[0052] In general, antibody molecules obtained from humans relate
to any of the classes IgG, IgM, IgA, IgE and IgD, which differ from
one another by the nature of the heavy chain present in the
molecule. Certain classes have subclasses as well, such as
IgG.sub.1, IgG.sub.2, IgG.sub.3 and IgG.sub.4 and others.
Furthermore, in humans, the light chain may be a kappa chain or a
lambda chain. The term "antigen-binding site," or "binding portion"
refers to the part of the immunoglobulin molecule that participates
in antigen binding. The antigen binding site is formed by amino
acid residues of the N-terminal variable ("V") regions of the heavy
("H") and light ("L") chains. Three highly divergent stretches
within the V regions of the heavy and light chains, referred to as
"hypervariable regions," are interposed between more conserved
flanking stretches known as "framework regions," or "FRs". Thus,
the term "FR" refers to amino acid sequences which are naturally
found between, and adjacent to, hypervariable regions in
immunoglobulins. In an antibody molecule, the three hypervariable
regions of a light chain and the three hypervariable regions of a
heavy chain are disposed relative to each other in three
dimensional space to form an antigen-binding surface. The
antigen-binding surface is complementary to the three-dimensional
surface of a bound antigen, and the three hypervariable regions of
each of the heavy and light chains are referred to as
"complementarity-determining regions," or "CDRs." VH and VL
regions, which contain the CDRs, of the scFv antibodies are shown
in Tables 1A-Table 13B.
[0053] As used herein, the term "epitope" includes any protein
determinant capable of specific binding to an immunoglobulin, a
scFv, or a T-cell receptor. Epitopic determinants usually consist
of chemically active surface groupings of molecules such as amino
acids or sugar side chains and usually have specific three
dimensional structural characteristics, as well as specific charge
characteristics. For example, antibodies may be raised against
N-terminal or C-terminal peptides of a polypeptide.
[0054] As used herein, the terms "immunological binding," and
"immunological binding properties" refer to the non-covalent
interactions of the type which occur between an immunoglobulin
molecule and an antigen for which the immunoglobulin is specific.
The strength, or affinity of immunological binding interactions can
be expressed in terms of the dissociation constant (K.sub.d) of the
interaction, wherein a smaller K.sub.d represents a greater
affinity. Immunological binding properties of selected polypeptides
can be quantified using methods well known in the art. One such
method entails measuring the rates of antigen-binding site/antigen
complex formation and dissociation, wherein those rates depend on
the concentrations of the complex partners, the affinity of the
interaction, and geometric parameters that equally influence the
rate in both directions. Thus, both the "on rate constant"
(K.sub.on) and the "off rate constant" (K.sub.off) can be
determined by calculation of the concentrations and the actual
rates of association and dissociation. (See Nature 361:186-87
(1993)). The ratio of K.sub.off/K.sub.on enables the cancellation
of all parameters not related to affinity, and is equal to the
dissociation constant K.sub.d. (See, generally, Davies et al.
(1990) Annual Rev Biochem 59:439-473). An antibody of the present
invention is said to specifically bind to a GITR epitope when the
equilibrium binding constant (K.sub.d) is .ltoreq.10 .mu.M,
preferably .ltoreq.10 nM, more preferably .ltoreq.10 nM, and most
preferably .ltoreq.100 pM to about 1 pM, as measured by assays such
as radioligand binding assays or similar assays known to those
skilled in the art.
[0055] An GITR protein of the invention, or a derivative, fragment,
analog, homolog or ortholog thereof, may be utilized as an
immunogen in the generation of antibodies that immunospecifically
bind these protein components. A GITR protein or a derivative,
fragment, analog, homolog, or ortholog thereof, coupled to a
proteoliposome may be utilized as an immunogen in the generation of
antibodies that immunospecifically bind these protein
components.
[0056] Those skilled in the art will recognize that it is possible
to determine, without undue experimentation, if a human monoclonal
antibody has the same specificity as a human monoclonal antibody of
the invention by ascertaining whether the former prevents the
latter from binding to GITR. If the human monoclonal antibody being
tested competes with the human monoclonal antibody of the
invention, as shown by a decrease in binding by the human
monoclonal antibody of the invention, then it is likely that the
two monoclonal antibodies bind to the same, or to a closely
related, epitope.
[0057] Another way to determine whether a human monoclonal antibody
has the specificity of a human monoclonal antibody of the invention
is to pre-incubate the human monoclonal antibody of the invention
with the GITR protein, with which it is normally reactive, and then
add the human monoclonal antibody being tested to determine if the
human monoclonal antibody being tested is inhibited in its ability
to bind GITR. If the human monoclonal antibody being tested is
inhibited then, in all likelihood, it has the same, or functionally
equivalent, epitopic specificity as the monoclonal antibody of the
invention. Screening of human monoclonal antibodies of the
invention can be also carried out by utilizing GITR and determining
whether the test monoclonal antibody is able to neutralize
GITR.
[0058] Various procedures known within the art may be used for the
production of polyclonal or monoclonal antibodies directed against
a protein of the invention, or against derivatives, fragments,
analogs homologs or orthologs thereof (See, for example,
Antibodies: A Laboratory Manual, Harlow E, and Lane D, 1988, Cold
Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.,
incorporated herein by reference).
[0059] Antibodies can be purified by well-known techniques, such as
affinity chromatography using protein A or protein G, which provide
primarily the IgG fraction of immune serum. Subsequently, or
alternatively, the specific antigen which is the target of the
immunoglobulin sought, or an epitope thereof, may be immobilized on
a column to purify the immune specific antibody by immunoaffinity
chromatography. Purification of immunoglobulins is discussed, for
example, by D. Wilkinson (The Scientist, published by The
Scientist, Inc., Philadelphia Pa., Vol. 14, No. 8 (Apr. 17, 2000),
pp. 25-28).
[0060] The term "monoclonal antibody" or "MAb" or "monoclonal
antibody composition", as used herein, refers to a population of
antibody molecules that contain only one molecular species of
antibody molecule consisting of a unique light chain gene product
and a unique heavy chain gene product. In particular, the
complementarity determining regions (CDRs) of the monoclonal
antibody are identical in all the molecules of the population. MAbs
contain an antigen binding site capable of immunoreacting with a
particular epitope of the antigen characterized by a unique binding
affinity for it.
[0061] Monoclonal antibodies can be prepared using hybridoma
methods, such as those described by Kohler and Milstein, Nature,
256:495 (1975). In a hybridoma method, a mouse, hamster, or other
appropriate host animal, is typically immunized with an immunizing
agent to elicit lymphocytes that produce or are capable of
producing antibodies that will specifically bind to the immunizing
agent. Alternatively, the lymphocytes can be immunized in
vitro.
[0062] The immunizing agent will typically include the protein
antigen, a fragment thereof or a fusion protein thereof. Generally,
either peripheral blood lymphocytes are used if cells of human
origin are desired, or spleen cells or lymph node cells are used if
non-human mammalian sources are desired. The lymphocytes are then
fused with an immortalized cell line using a suitable fusing agent,
such as polyethylene glycol, to form a hybridoma cell (Goding,
Monoclonal Antibodies: Principles and Practice, Academic Press,
(1986) pp. 59-103). Immortalized cell lines are usually transformed
mammalian cells, particularly myeloma cells of rodent, bovine and
human origin. Usually, rat or mouse myeloma cell lines are
employed. The hybridoma cells can be cultured in a suitable culture
medium that preferably contains one or more substances that inhibit
the growth or survival of the unfused, immortalized cells. For
example, if the parental cells lack the enzyme hypoxanthine guanine
phosphoribosyl transferase (HGPRT or HPRT), the culture medium for
the hybridomas typically will include hypoxanthine, aminopterin,
and thymidine ("HAT medium"), which substances prevent the growth
of HGPRT-deficient cells.
[0063] Preferred immortalized cell lines are those that fuse
efficiently, support stable high level expression of antibody by
the selected antibody-producing cells, and are sensitive to a
medium such as HAT medium. More preferred immortalized cell lines
are murine myeloma lines, which can be obtained, for instance, from
the Salk Institute Cell Distribution Center, San Diego, Calif. and
the American Type Culture Collection, Manassas, Va. Human myeloma
and mouse-human heteromyeloma cell lines also have been described
for the production of human monoclonal antibodies. (See Kozbor, J.
Immunol., 133:3001 (1984); Brodeur et al., Monoclonal Antibody
Production Techniques and Applications, Marcel Dekker, Inc., New
York, (1987) pp. 51-63)).
[0064] The culture medium in which the hybridoma cells are cultured
can then be assayed for the presence of monoclonal antibodies
directed against the antigen. Preferably, the binding specificity
of monoclonal antibodies produced by the hybridoma cells is
determined by immunoprecipitation or by an in vitro binding assay,
such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent
assay (ELISA). Such techniques and assays are known in the art. The
binding affinity of the monoclonal antibody can, for example, be
determined by the Scatchard analysis of Munson and Pollard, Anal.
Biochem., 107:220 (1980). Moreover, in therapeutic applications of
monoclonal antibodies, it is important to identify antibodies
having a high degree of specificity and a high binding affinity for
the target antigen.
[0065] After the desired hybridoma cells are identified, the clones
can be subcloned by limiting dilution procedures and grown by
standard methods. (See Goding, Monoclonal Antibodies: Principles
and Practice, Academic Press, (1986) pp. 59-103). Suitable culture
media for this purpose include, for example, Dulbecco's Modified
Eagle's Medium and RPMI-1640 medium. Alternatively, the hybridoma
cells can be grown in vivo as ascites in a mammal.
[0066] The monoclonal antibodies secreted by the subclones can be
isolated or purified from the culture medium or ascites fluid by
conventional immunoglobulin purification procedures such as, for
example, protein A-Sepharose, hydroxylapatite chromatography, gel
electrophoresis, dialysis, or affinity chromatography.
[0067] Monoclonal antibodies can also be made by recombinant DNA
methods, such as those described in U.S. Pat. No. 4,816,567. DNA
encoding the monoclonal antibodies of the invention can be readily
isolated and sequenced using conventional procedures (e.g., by
using oligonucleotide probes that are capable of binding
specifically to genes encoding the heavy and light chains of murine
antibodies). The hybridoma cells of the invention serve as a
preferred source of such DNA. Once isolated, the DNA can be placed
into expression vectors, which are then transfected into host cells
such as simian COS cells, Chinese hamster ovary (CHO) cells, or
myeloma cells that do not otherwise produce immunoglobulin protein,
to obtain the synthesis of monoclonal antibodies in the recombinant
host cells. The DNA also can be modified, for example, by
substituting the coding sequence for human heavy and light chain
constant domains in place of the homologous murine sequences (see
U.S. Pat. No. 4,816,567; Morrison, Nature 368, 812-13 (1994)) or by
covalently joining to the immunoglobulin coding sequence all or
part of the coding sequence for a non-immunoglobulin polypeptide.
Such a non-immunoglobulin polypeptide can be substituted for the
constant domains of an antibody of the invention, or can be
substituted for the variable domains of one antigen-combining site
of an antibody of the invention to create a chimeric bivalent
antibody.
[0068] Fully human antibodies are antibody molecules in which the
entire sequence of both the light chain and the heavy chain,
including the CDRs, arise from human genes. Such antibodies are
termed "humanized antibodies", "human antibodies", or "fully human
antibodies" herein. Human monoclonal antibodies can be prepared by
using trioma technique; the human B-cell hybridoma technique (see
Kozbor, et al., 1983 Immunol Today 4: 72); and the EBV hybridoma
technique to produce human monoclonal antibodies (see Cole, et al.,
1985 In: MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss,
Inc., pp. 77-96). Human monoclonal antibodies may be utilized and
may be produced by using human hybridomas (see Cote, et al., 1983.
Proc Natl Acad Sci USA 80: 2026-2030) or by transforming human
B-cells with Epstein Barr Virus in vitro (see Cole, et al., 1985
In: MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc.,
pp. 77-96).
[0069] In addition, human antibodies can also be produced using
additional techniques, including phage display libraries. (See
Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al.,
J. Mol. Biol., 222:581 (1991)). Similarly, human antibodies can be
made by introducing human immunoglobulin loci into transgenic
animals, e.g., mice in which the endogenous immunoglobulin genes
have been partially or completely inactivated. Upon challenge,
human antibody production is observed, which closely resembles that
seen in humans in all respects, including gene rearrangement,
assembly, and antibody repertoire. This approach is described, for
example, in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825;
5,625,126; 5,633,425; 5,661,016, and in Marks et al.,
Bio/Technology 10, 779-783 (1992); Lonberg et al., Nature 368
856-859 (1994); Morrison, Nature 368, 812-13 (1994); Fishwild et
al, Nature Biotechnology 14, 845-51 (1996); Neuberger, Nature
Biotechnology 14, 826 (1996); and Lonberg and Huszar, Intern. Rev.
Immunol. 13 65-93 (1995).
[0070] Human antibodies may additionally be produced using
transgenic nonhuman animals which are modified so as to produce
fully human antibodies rather than the animal's endogenous
antibodies in response to challenge by an antigen. (See PCT
publication WO94/02602). The endogenous genes encoding the heavy
and light immunoglobulin chains in the nonhuman host have been
incapacitated, and active loci encoding human heavy and light chain
immunoglobulins are inserted into the host's genome. The human
genes are incorporated, for example, using yeast artificial
chromosomes containing the requisite human DNA segments. An animal
which provides all the desired modifications is then obtained as
progeny by crossbreeding intermediate transgenic animals containing
fewer than the full complement of the modifications. The preferred
embodiment of such a nonhuman animal is a mouse, and is termed the
Xenomouse.TM. as disclosed in PCT publications WO 96/33735 and WO
96/34096. This animal produces B cells which secrete fully human
immunoglobulins. The antibodies can be obtained directly from the
animal after immunization with an immunogen of interest, as, for
example, a preparation of a polyclonal antibody, or alternatively
from immortalized B cells derived from the animal, such as
hybridomas producing monoclonal antibodies. Additionally, the genes
encoding the immunoglobulins with human variable regions can be
recovered and expressed to obtain the antibodies directly, or can
be further modified to obtain analogs of antibodies such as, for
example, single chain Fv (scFv) molecules.
[0071] An example of a method of producing a nonhuman host,
exemplified as a mouse, lacking expression of an endogenous
immunoglobulin heavy chain is disclosed in U.S. Pat. No. 5,939,598.
It can be obtained by a method, which includes deleting the J
segment genes from at least one endogenous heavy chain locus in an
embryonic stem cell to prevent rearrangement of the locus and to
prevent formation of a transcript of a rearranged immunoglobulin
heavy chain locus, the deletion being effected by a targeting
vector containing a gene encoding a selectable marker; and
producing from the embryonic stem cell a transgenic mouse whose
somatic and germ cells contain the gene encoding the selectable
marker.
[0072] One method for producing an antibody of interest, such as a
human antibody, is disclosed in U.S. Pat. No. 5,916,771. This
method includes introducing an expression vector that contains a
nucleotide sequence encoding a heavy chain into one mammalian host
cell in culture, introducing an expression vector containing a
nucleotide sequence encoding a light chain into another mammalian
host cell, and fusing the two cells to form a hybrid cell. The
hybrid cell expresses an antibody containing the heavy chain and
the light chain.
[0073] In a further improvement on this procedure, a method for
identifying a clinically relevant epitope on an immunogen and a
correlative method for selecting an antibody that binds
immunospecifically to the relevant epitope with high affinity, are
disclosed in PCT publication WO 99/53049.
[0074] The antibody can be expressed by a vector containing a DNA
segment encoding the single chain antibody described above.
[0075] These can include vectors, liposomes, naked DNA,
adjuvant-assisted DNA, gene gun, catheters, etc. Vectors include
chemical conjugates such as described in WO 93/64701, which has
targeting moiety (e.g. a ligand to a cellular surface receptor),
and a nucleic acid binding moiety (e.g. polylysine), viral vector
(e.g. a DNA or RNA viral vector), fusion proteins such as described
in PCT/US 95/02140 (WO 95/22618) which is a fusion protein
containing a target moiety (e.g. an antibody specific for a target
cell) and a nucleic acid binding moiety (e.g. a protamine),
plasmids, phage, etc. The vectors can be chromosomal,
non-chromosomal or synthetic.
[0076] Preferred vectors include viral vectors, fusion proteins and
chemical conjugates. Retroviral vectors include moloney murine
leukemia viruses. DNA viral vectors are preferred. These vectors
include pox vectors such as orthopox or avipox vectors, herpesvirus
vectors such as a herpes simplex I virus (HSV) vector (see Geller,
A. I. et al., J. Neurochem, 64:487 (1995); Lim, F., et al., in DNA
Cloning: Mammalian Systems, D. Glover, Ed. (Oxford Univ. Press,
Oxford England) (1995); Geller, A. I. et al., Proc Natl. Acad.
Sci.: U.S.A. 90:7603 (1993); Geller, A. I., et al., Proc Natl.
Acad. Sci USA 87:1149 (1990), Adenovirus Vectors (see LeGal LaSalle
et al., Science, 259:988 (1993); Davidson, et al., Nat. Genet 3:219
(1993); Yang, et al., J. Virol. 69:2004 (1995) and Adeno-associated
Virus Vectors (see Kaplitt, M. G. et al., Nat. Genet. 8:148
(1994).
[0077] Pox viral vectors introduce the gene into the cells
cytoplasm. Avipox virus vectors result in only a short term
expression of the nucleic acid. Adenovirus vectors,
adeno-associated virus vectors and herpes simplex virus (HSV)
vectors are preferred for introducing the nucleic acid into neural
cells. The adenovirus vector results in a shorter term expression
(about 2 months) than adeno-associated virus (about 4 months),
which in turn is shorter than HSV vectors. The particular vector
chosen will depend upon the target cell and the condition being
treated. The introduction can be by standard techniques, e.g.
infection, transfection, transduction or transformation. Examples
of modes of gene transfer include e.g., naked DNA, CaPO.sub.4
precipitation, DEAE dextran, electroporation, protoplast fusion,
lipofection, cell microinjection, and viral vectors.
[0078] The vector can be employed to target essentially any desired
target cell. For example, stereotaxic injection can be used to
direct the vectors (e.g. adenovirus, HSV) to a desired location.
Additionally, the particles can be delivered by
intracerebroventricular (icv) infusion using a minipump infusion
system, such as a SynchroMed Infusion System. A method based on
bulk flow, termed convection, has also proven effective at
delivering large molecules to extended areas of the brain and may
be useful in delivering the vector to the target cell. (See Bobo et
al., Proc. Natl. Acad. Sci. USA 91:2076-2080 (1994); Morrison et
al., Am. J. Physiol. 266:292-305 (1994)). Other methods that can be
used include catheters, intravenous, parenteral, intraperitoneal
and subcutaneous injection, and oral or other known routes of
administration.
[0079] These vectors can be used to express large quantities of
antibodies that can be used in a variety of ways. For example, to
detect the presence of GITR in a sample. The antibody can also be
used to try to bind to and disrupt a GITR activity.
[0080] Techniques can be adapted for the production of single-chain
antibodies specific to an antigenic protein of the invention (see
e.g., U.S. Pat. No. 4,946,778). In addition, methods can be adapted
for the construction of F.sub.ab expression libraries (see e.g.,
Huse, et al., 1989 Science 246: 1275-1281) to allow rapid and
effective identification of monoclonal F.sub.ab fragments with the
desired specificity for a protein or derivatives, fragments,
analogs or homologs thereof. Antibody fragments that contain the
idiotypes to a protein antigen may be produced by techniques known
in the art including, but not limited to: (i) an F.sub.(ab')2
fragment produced by pepsin digestion of an antibody molecule; (ii)
an F.sub.ab fragment generated by reducing the disulfide bridges of
an F.sub.(ab')2 fragment; (iii) an F.sub.ab fragment generated by
the treatment of the antibody molecule with papain and a reducing
agent and (iv) F.sub.v fragments.
[0081] Heteroconjugate antibodies are also within the scope of the
present invention. Heteroconjugate antibodies are composed of two
covalently joined antibodies. Such antibodies have, for example,
been proposed to target immune system cells to unwanted cells (see
U.S. Pat. No. 4,676,980), and for treatment of HIV infection (see
WO 91/00360; WO 92/200373; EP 03089). It is contemplated that the
antibodies can be prepared in vitro using known methods in
synthetic protein chemistry, including those involving crosslinking
agents. For example, immunotoxins can be constructed using a
disulfide exchange reaction or by forming a thioether bond.
Examples of suitable reagents for this purpose include
iminothiolate and methyl-4-mercaptobutyrimidate and those
disclosed, for example, in U.S. Pat. No. 4,676,980.
[0082] It can be desirable to modify the antibody of the invention
with respect to effector function, so as to enhance, e.g., the
effectiveness of the antibody in treating cancer. For example,
cysteine residue(s) can be introduced into the Fc region, thereby
allowing interchain disulfide bond formation in this region. The
homodimeric antibody thus generated can have improved
internalization capability and/or increased complement-mediated
cell killing and antibody-dependent cellular cytotoxicity (ADCC).
(See Caron et al., J. Exp Med., 176: 1191-1195 (1992) and Shopes,
J. Immunol., 148: 2918-2922 (1992)). Alternatively, an antibody can
be engineered that has dual Fc regions and can thereby have
enhanced complement lysis and ADCC capabilities. (See Stevenson et
al., Anti-Cancer Drug Design, 3: 219-230 (1989)).
[0083] In certain embodiments, an antibody of the invention may
comprise an Fc variant comprising an amino acid substitution which
alters the antigen-independent effector functions of the antibody,
in particular the circulating half-life of the antibody. Such
antibodies exhibit either increased or decreased binding to FcRn
when compared to antibodies lacking these substitutions, therefore,
have an increased or decreased half-life in serum, respectively. Fc
variants with improved affinity for FcRn are anticipated to have
longer serum half-lives, and such molecules have useful
applications in methods of treating mammals where long half-life of
the administered antibody is desired, e.g., to treat a chronic
disease or disorder. In contrast, Fc variants with decreased FcRn
binding affinity are expected to have shorter half-lives, and such
molecules are also useful, for example, for administration to a
mammal where a shortened circulation time may be advantageous, e.g.
for in vivo diagnostic imaging or in situations where the starting
antibody has toxic side effects when present in the circulation for
prolonged periods. Fc variants with decreased FcRn binding affinity
are also less likely to cross the placenta and, thus, are also
useful in the treatment of diseases or disorders in pregnant women.
In addition, other applications in which reduced FcRn binding
affinity may be desired include those applications in which
localization to the brain, kidney, and/or liver is desired. In one
exemplary embodiment, the altered antibodies of the invention
exhibit reduced transport across the epithelium of kidney glomeruli
from the vasculature. In another embodiment, the altered antibodies
of the invention exhibit reduced transport across the blood brain
barrier (BBB) from the brain, into the vascular space. In one
embodiment an antibody with altered FcRn binding comprises an Fc
domain having one or more amino acid substitutions within the "FcRn
binding loop" of an Fe domain. The FcRn binding loop is comprised
of amino acid residues 280-299 (according to EU numbering).
Exemplary amino acid substitutions which altered FcRn binding
activity are disclosed in International PCT Publication No.
WO05/047327 which is incorporated by reference herein. In certain
exemplary embodiments, the antibodies, or fragments thereof, of the
invention comprise an Fe domain having one or more of the following
substitutions: V284E, H285E, N286D, K290E and S304D (EU
numbering).
[0084] In some embodiments, mutations are introduced to the
constant regions of the mAb such that the antibody dependent
cell-mediated cytotoxicity (ADCC) activity of the mAb is altered.
For example, the mutation is an LALA mutation in the CH2 domain. In
one aspect, the bsAb contains mutations on one scFv unit of the
heterodimeric mAb, which reduces the ADCC activity. In another
aspect, the mAb contains mutations on both chains of the
heterodimeric mAb, which completely ablates the ADCC activity. For
example, the mutations introduced one or both scFv units of the mAb
are LALA mutations in the CH2 domain. These mAbs with variable ADCC
activity can be optimized such that the mAbs exhibits maximal
selective killing towards cells that express one antigen that is
recognized by the mAb, however exhibits minimal killing towards the
second antigen that is recognized by the mAb.
[0085] In other embodiments, antibodies, for use in the diagnostic
and treatment methods described herein have a constant region,
e.g., an IgG.sub.1 or IgG4 heavy chain constant region, which is
altered to reduce or eliminate glycosylation. For example, an
antibody of the invention may also comprise an Fc variant
comprising an amino acid substitution which alters the
glycosylation of the antibody. For example, said Fc variant may
have reduced glycosylation (e.g., N- or O-linked glycosylation). In
exemplary embodiments, the Fc variant comprises reduced
glycosylation of the N-linked glycan normally found at amino acid
position 297 (EU numbering). In another embodiment, the antibody
has an amino acid substitution near or within a glycosylation
motif, for example, an N-linked glycosylation motif that contains
the amino acid sequence NXT or NXS, In a particular embodiment, the
antibody comprises an Fc variant with an amino acid substitution at
amino acid position 228 or 299 (EU numbering). In more particular
embodiments, the antibody comprises an IgG1 or IgG4 constant region
comprising an S228P and a T299A mutation (EU numbering).
[0086] Exemplary amino acid substitutions which confer reduced or
altered glycosylation are disclosed in International PCT
Publication No. WO05/018572, which is incorporated by reference
herein. In preferred embodiments, the antibodies, or fragments
thereof, of the invention are modified to eliminate glycosylation.
Such antibodies, or fragments thereof, may be referred to as "agly"
antibodies, or fragments thereof, (e.g. "agly" antibodies). While
not being bound by theory, it is believed that "agly" antibodies,
or fragments thereof, may have an improved safety and stability
profile in vivo. Exemplary agly antibodies, or fragments thereof,
comprise an aglycosylated Fc region of an IgG4 antibody which is
devoid of Fc-effector function thereby eliminating the potential
for Fc mediated toxicity to the normal vital organs that express
GITR. In yet other embodiments, antibodies, or fragments thereof,
of the invention comprise an altered glycan. For example, the
antibody may have a reduced number of fucose residues on an
N-glycan at Asn297 of the Fc region, i.e., is afucosylated. In
another embodiment, the antibody may have an altered number of
sialic acid residues on the N-glycan at Asn297 of the Fc region.
iii) Covalent Attachment
[0087] The invention also pertains to immunoconjugates comprising
an antibody conjugated to a cytotoxic agent such as a toxin (e.g.,
an enzymatically active toxin of bacterial, fungal, plant, or
animal origin, or fragments thereof), or a radioactive isotope
(i.e., a radioconjugate).
[0088] Enzymatically active toxins and fragments thereof that can
be used include diphtheria A chain, nonbinding active fragments of
diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa),
ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin,
Aleurites fordii proteins, dianthin proteins, Phytolaca americana
proteins (PAPI, PAPII, and PAP-S), Momordica charantia inhibitor,
curcin, crotin, Sapaonaria officinalis inhibitor, gelonin,
mitogellin, restrictocin, phenomycin, enomycin, and the
tricothecenes. A variety of radionuclides are available for the
production of radioconjugated antibodies. Examples include
.sup.212Bi, .sup.131I, .sup.131In .sup.90Y, and .sup.186Re.
[0089] Conjugates of the antibody and cytotoxic agent are made
using a variety of bifunctional protein-coupling agents such as
N-succinimidyl-3-(2-pyridyldithiol) propionate (SPDP),
iminothiolane (IT), bifunctional derivatives of imidoesters (such
as dimethyl adipimidate HCL), active esters (such as disuccinimidyl
suberate), aldehydes (such as glutareldehyde), bis-azido compounds
(such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium
derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine),
diisocyanates (such as tolyene 2,6-diisocyanate), and bis-active
fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). For
example, a ricin immunotoxin can be prepared as described in
Vitetta et al., Science 238: 1098 (1987). Carbon-14-labeled
1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid
(MX-DTPA) is an exemplary chelating agent for conjugation of
radionucleotide to the antibody. (See WO94/11026).
[0090] Those of ordinary skill in the art will recognize that a
large variety of possible moieties can be coupled to the resultant
antibodies or to other molecules of the invention. (See, for
example, "Conjugate Vaccines", Contributions to Microbiology and
Immunology, J. M. Cruse and R. E. Lewis, Jr (eds), Carger Press,
New York, (1989), the entire contents of which are incorporated
herein by reference).
[0091] Coupling may be accomplished by any chemical reaction that
will bind the two molecules so long as the antibody and the other
moiety retain their respective activities. This linkage can include
many chemical mechanisms, for instance covalent binding, affinity
binding, intercalation, coordinate binding and complexation. The
preferred binding is, however, covalent binding. Covalent binding
can be achieved either by direct condensation of existing side
chains or by the incorporation of external bridging molecules. Many
bivalent or polyvalent linking agents are useful in coupling
protein molecules, such as the antibodies of the present invention,
to other molecules. For example, representative coupling agents can
include organic compounds such as thioesters, carbodiimides,
succinimide esters, diisocyanates, glutaraldehyde, diazobenzenes
and hexamethylene diamines. This listing is not intended to be
exhaustive of the various classes of coupling agents known in the
art but, rather, is exemplary of the more common coupling agents.
(See Killen and Lindstrom, Jour. Immun. 133:1335-2549 (1984);
Jansen et al., Immunological Reviews 62:185-216 (1982); and Vitetta
et al., Science 238:1098 (1987)). Preferred linkers are described
in the literature. (See, for example, Ramakrishnan, S. et al.,
Cancer Res. 44:201-208 (1984) describing use of MBS
(M-maleimidobenzoyl-N-hydroxysuccinimide ester). See also, U.S.
Pat. No. 5,030,719, describing use of halogenated acetyl hydrazide
derivative coupled to an antibody by way of an oligopeptide linker.
Particularly preferred linkers include: (i) EDC
(1-ethyl-3-(3-dimethylamino-propyl) carbodiimide hydrochloride;
(ii) SMPT
(4-succinimidyloxycarbonyl-alpha-methyl-alpha-(2-pridyl-dithio)-toluene
(Pierce Chem. Co., Cat. (21558G); (iii) SPDP (succinimidyl-6
[3-(2-pyridyldithio) propionamido]hexanoate (Pierce Chem. Co., Cat
#21651G); (iv) Sulfo-LC-SPDP (sulfosuccinimidyl 6
[3-(2-pyridyldithio)-propianamide] hexanoate (Pierce Chem. Co. Cat.
#2165-G); and (v) sulfo-NHS (N-hydroxysulfo-succinimide: Pierce
Chem. Co., Cat. #24510) conjugated to EDC.
[0092] The linkers described above contain components that have
different attributes, thus leading to conjugates with differing
physio-chemical properties. For example, sulfo-NHS esters of alkyl
carboxylates are more stable than sulfo-NHS esters of aromatic
carboxylates. NHS-ester containing linkers are less soluble than
sulfo-NHS esters. Further, the linker SMPT contains a sterically
hindered disulfide bond, and can form conjugates with increased
stability. Disulfide linkages, are in general, less stable than
other linkages because the disulfide linkage is cleaved in vitro,
resulting in less conjugate available. Sulfo-NHS, in particular,
can enhance the stability of carbodimide couplings. Carbodimide
couplings (such as EDC) when used in conjunction with sulfo-NHS,
forms esters that are more resistant to hydrolysis than the
carbodimide coupling reaction alone.
[0093] The antibodies disclosed herein can also be formulated as
immunoliposomes. Liposomes containing the antibody are prepared by
methods known in the art, such as described in Epstein et al.,
Proc. Natl. Acad. Sci. USA, 82: 3688 (1985); Hwang et al., Proc.
Natl Acad. Sci. USA, 77: 4030 (1980); and U.S. Pat. Nos. 4,485,045
and 4,544,545. Liposomes with enhanced circulation time are
disclosed in U.S. Pat. No. 5,013,556.
[0094] Particularly useful liposomes can be generated by the
reverse-phase evaporation method with a lipid composition
comprising phosphatidylcholine, cholesterol, and PEG-derivatized
phosphatidylethanolamine (PEG-PE). Liposomes are extruded through
filters of defined pore size to yield liposomes with the desired
diameter. Fab' fragments of the antibody of the present invention
can be conjugated to the liposomes as described in Martin et al.,
J. Biol. Chem., 257: 286-288 (1982) via a disulfide-interchange
reaction.
Use of Antibodies Against GITR
[0095] Antibodies specifically binding a GITR protein or a fragment
thereof of the invention can be administered for the treatment a
GITR associated disease or disorder. A "GITR-associated disease or
disorder" includes disease states and/or symptoms associated with a
disease state, where increased levels of GITR and/or activation of
cellular signaling pathways involving GITR are found. Exemplary
GITR-associated disease or disorder include, but are not limited
to, cancer and inflammatory diseases.
[0096] Many cancers overexpress GITR and the upregulation of GITR
is associated with high risk prognostic factors. Overexpression of
GITR or its ligand, GITR-L, in tumor cells can also indicate a
mechanism by which the tumor cells evade anti-tumor immunity. Such
cancers include solid tumor and hematologic tumor. Use of the
antibody of the invention suppress or deplete Tregs and stimulate
Teffs. In addition, the antibodies of the invention and increase
the toxicity of NK cells and increase IFN.gamma. production.
[0097] Antibodies of the invention, including bi-specific,
polyclonal, monoclonal, humanized and fully human antibodies, may
be used as therapeutic agents. Such agents will generally be
employed to treat or prevent cancer in a subject, increase vaccine
efficiency or augment a natural immune response. An antibody
preparation, preferably one having high specificity and high
affinity for its target antigen, is administered to the subject and
will generally have an effect due to its binding with the target.
Administration of the antibody may abrogate or inhibit or interfere
with an activity of the GITR protein.
[0098] Antibodies specifically binding a GITR protein or fragment
thereof of the invention can be administered for the treatment of a
cancer in the form of pharmaceutical compositions. Principles and
considerations involved in preparing therapeutic compositions
comprising the antibody, as well as guidance in the choice of
components are provided, for example, in Remington: The Science And
Practice Of Pharmacy 19th ed. (Alfonso R. Gennaro, et al., editors)
Mack Pub. Co., Easton, Pa., 1995; Drug Absorption Enhancement:
Concepts, Possibilities, Limitations, And Trends, Harwood Academic
Publishers, Langhome, Pa., 1994; and Peptide And Protein Drug
Delivery (Advances In Parenteral Sciences, Vol. 4), 1991, M.
Dekker, New York.
[0099] A therapeutically effective amount of an antibody of the
invention relates generally to the amount needed to achieve a
therapeutic objective. As noted above, this may be a binding
interaction between the antibody and its target antigen that, in
certain cases, interferes with the functioning of the target. The
amount required to be administered will furthermore depend on the
binding affinity of the antibody for its specific antigen, and will
also depend on the rate at which an administered antibody is
depleted from the free volume other subject to which it is
administered. Common ranges for therapeutically effective dosing of
an antibody or antibody fragment of the invention may be, by way of
nonlimiting example, from about 0.1 mg/kg body weight to about 50
mg/kg body weight. Common dosing frequencies may range, for
example, from twice daily to once a week.
[0100] Where antibody fragments are used, the smallest inhibitory
fragment that specifically binds to the binding domain of the
target protein is preferred. For example, based upon the
variable-region sequences of an antibody, peptide molecules can be
designed that retain the ability to bind the target protein
sequence. Such peptides can be synthesized chemically and/or
produced by recombinant DNA technology. (See, e.g., Marasco et al.,
Proc. Natl. Acad. Sci. USA, 90: 7889-7893 (1993)). The formulation
can also contain more than one active compound as necessary for the
particular indication being treated, preferably those with
complementary activities that do not adversely affect each other.
Alternatively, or in addition, the composition can comprise an
agent that enhances its function, such as, for example, a cytotoxic
agent, cytokine (e.g. IL-15), chemotherapeutic agent, or
growth-inhibitory agent. Such molecules are suitably present in
combination in amounts that are effective for the purpose
intended.
[0101] The active ingredients can also be entrapped in
microcapsules prepared, for example, by coacervation techniques or
by interfacial polymerization, for example, hydroxymethylcellulose
or gelatin-microcapsules and poly-(methylmethacrylate)
microcapsules, respectively, in colloidal drug delivery systems
(for example, liposomes, albumin microspheres, microemulsions,
nano-particles, and nanocapsules) or in macroemulsions.
[0102] The formulations to be used for in vivo administration must
be sterile. This is readily accomplished by filtration through
sterile filtration membranes.
[0103] Sustained-release preparations can be prepared. Suitable
examples of sustained-release preparations include semipermeable
matrices of solid hydrophobic polymers containing the antibody,
which matrices are in the form of shaped articles, e.g., films, or
microcapsules. Examples of sustained-release matrices include
polyesters, hydrogels (for example,
poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)),
polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic
acid and .gamma. ethyl-L-glutamate, non-degradable ethylene-vinyl
acetate, degradable lactic acid-glycolic acid copolymers such as
the LUPRON DEPOT.TM. (injectable microspheres composed of lactic
acid-glycolic acid copolymer and leuprolide acetate), and
poly-D-(-)-3-hydroxybutyric acid. While polymers such as
ethylene-vinyl acetate and lactic acid-glycolic acid enable release
of molecules for over 100 days, certain hydrogels release proteins
for shorter time periods.
[0104] An antibody according to the invention can be used as an
agent for detecting the presence of GITR (or a protein or a protein
fragment thereof) in a sample. Preferably, the antibody contains a
detectable label. Antibodies can be polyclonal, or more preferably,
monoclonal. An intact antibody, or a fragment thereof (e.g.,
F.sub.ab, scFv, or F.sub.(ab)2) can be used. The term "labeled",
with regard to the probe or antibody, is intended to encompass
direct labeling of the probe or antibody by coupling (i.e.,
physically linking) a detectable substance to the probe or
antibody, as well as indirect labeling of the probe or antibody by
reactivity with another reagent that is directly labeled. Examples
of indirect labeling include detection of a primary antibody using
a fluorescently-labeled secondary antibody and end-labeling of a
DNA probe with biotin such that it can be detected with
fluorescently-labeled streptavidin. The term "biological sample" is
intended to include tissues, cells and biological fluids isolated
from a subject, as well as tissues, cells and fluids present within
a subject. Included within the usage of the term "biological
sample", therefore, is blood and a fraction or component of blood
including blood serum, blood plasma, or lymph. That is, the
detection method of the invention can be used to detect an analyte
mRNA, protein, or genomic DNA in a biological sample in vitro as
well as in vivo. For example, in vitro techniques for detection of
an analyte mRNA includes Northern hybridizations and in situ
hybridizations. In vitro techniques for detection of an analyte
protein include enzyme linked immunosorbent assays (ELISAs),
Western blots, immunoprecipitations, and immunofluorescence. In
vitro techniques for detection of an analyte genomic DNA include
Southern hybridizations. Procedures for conducting immunoassays are
described, for example in "ELISA: Theory and Practice: Methods in
Molecular Biology", Vol. 42, J. R. Crowther (Ed.) Human Press,
Totowa, N.J., 1995; "Immunoassay", E. Diamandis and T.
Christopoulus, Academic Press, Inc., San Diego, Calif., 1996; and
"Practice and Theory of Enzyme Immunoassays", P. Tijssen, Elsevier
Science Publishers, Amsterdam, 1985. Furthermore, in vivo
techniques for detection of an analyte protein include introducing
into a subject a labeled anti-analyte protein antibody. For
example, the antibody can be labeled with a radioactive marker
whose presence and location in a subject can be detected by
standard imaging techniques.
[0105] Antibodies directed against a GITR protein (or a fragment
thereof) may be used in methods known within the art relating to
the localization and/or quantitation of a GITR protein (e.g., for
use in measuring levels of the GITR protein within appropriate
physiological samples, for use in diagnostic methods, for use in
imaging the protein, and the like). In a given embodiment,
antibodies specific to a GITR protein, or derivative, fragment,
analog or homolog thereof, that contain the antibody derived
antigen binding domain, are utilized as pharmacologically active
compounds (referred to hereinafter as "Therapeutics").
[0106] An antibody specific for a GITR protein of the invention can
be used to isolate a GITR polypeptide by standard techniques, such
as immunoaffinity, chromatography or immunoprecipitation.
Antibodies directed against a GITR protein (or a fragment thereof)
can be used diagnostically to monitor protein levels in tissue as
part of a clinical testing procedure, e.g., to, for example,
determine the efficacy of a given treatment regimen. Detection can
be facilitated by coupling (i.e., physically linking) the antibody
to a detectable substance. Examples of detectable substances
include various enzymes, prosthetic groups, fluorescent materials,
luminescent materials, bioluminescent materials, and radioactive
materials. Examples of suitable enzymes include horseradish
peroxidase, alkaline phosphatase, .beta.-galactosidase, or
acetylcholinesterase; examples of suitable prosthetic group
complexes include streptavidin/biotin and avidin/biotin; examples
of suitable fluorescent materials include umbelliferone,
fluorescein, fluorescein isothiocyanate, rhodamine,
dichlorotriazinylamine fluorescein, dansyl chloride or
phycoerythrin; an example of a luminescent material includes
luminol; examples of bioluminescent materials include luciferase,
luciferin, and aequorin, and examples of suitable radioactive
material include .sup.125I, .sup.131I, .sup.35S or .sup.3H.
Pharmaceutical Compositions
[0107] The antibodies or agents of the invention (also referred to
herein as "active compounds"), and derivatives, fragments, analogs
and homologs thereof, can be incorporated into pharmaceutical
compositions suitable for administration. Such compositions
typically comprise the antibody or agent and a pharmaceutically
acceptable carrier. As used herein, the term "pharmaceutically
acceptable carrier" is intended to include any and all solvents,
dispersion media, coatings, antibacterial and antifungal agents,
isotonic and absorption delaying agents, and the like, compatible
with pharmaceutical administration. Suitable carriers are described
in the most recent edition of Remington's Pharmaceutical Sciences,
a standard reference text in the field, which is incorporated
herein by reference. Preferred examples of such carriers or
diluents include, but are not limited to, water, saline, ringer's
solutions, dextrose solution, and 5% human serum albumin. Liposomes
and non-aqueous vehicles such as fixed oils may also be used. The
use of such media and agents for pharmaceutically active substances
is well known in the art. Except insofar as any conventional media
or agent is incompatible with the active compound, use thereof in
the compositions is contemplated. Supplementary active compounds
can also be incorporated into the compositions.
[0108] A pharmaceutical composition of the invention is formulated
to be compatible with its intended route of administration.
Examples of routes of administration include parenteral, e.g.,
intravenous, intradermal, subcutaneous, oral (e.g., inhalation),
transdermal (i.e., topical), transmucosal, and rectal
administration. Solutions or suspensions used for parenteral,
intradermal, or subcutaneous application can include the following
components: a sterile diluent such as water for injection, saline
solution, fixed oils, polyethylene glycols, glycerine, propylene
glycol or other synthetic solvents; antibacterial agents such as
benzyl alcohol or methyl parabens; antioxidants such as ascorbic
acid or sodium bisulfite; chelating agents such as
ethylenediaminetetraacetic acid (EDTA); buffers such as acetates,
citrates or phosphates, and agents for the adjustment of tonicity
such as sodium chloride or dextrose. The pH can be adjusted with
acids or bases, such as hydrochloric acid or sodium hydroxide. The
parenteral preparation can be enclosed in ampoules, disposable
syringes or multiple dose vials made of glass or plastic.
[0109] Pharmaceutical compositions suitable for injectable use
include sterile aqueous solutions (where water soluble) or
dispersions and sterile powders for the extemporaneous preparation
of sterile injectable solutions or dispersion. For intravenous
administration, suitable carriers include physiological saline,
bacteriostatic water, Cremophor EL.TM. (BASF, Parsippany, N.J.) or
phosphate buffered saline (PBS). In all cases, the composition must
be sterile and should be fluid to the extent that easy
syringeability exists. It must be stable under the conditions of
manufacture and storage and must be preserved against the
contaminating action of microorganisms such as bacteria and fungi.
The carrier can be a solvent or dispersion medium containing, for
example, water, ethanol, polyol (for example, glycerol, propylene
glycol, and liquid polyethylene glycol, and the like), and suitable
mixtures thereof. The proper fluidity can be maintained, for
example, by the use of a coating such as lecithin, by the
maintenance of the required particle size in the case of dispersion
and by the use of surfactants. Prevention of the action of
microorganisms can be achieved by various antibacterial and
antifungal agents, for example, parabens, chlorobutanol, phenol,
ascorbic acid, thimerosal, and the like. In many cases, it will be
preferable to include isotonic agents, for example, sugars,
polyalcohols such as manitol, sorbitol, sodium chloride in the
composition. Prolonged absorption of the injectable compositions
can be brought about by including in the composition an agent which
delays absorption, for example, aluminum monostearate and
gelatin.
[0110] Sterile injectable solutions can be prepared by
incorporating the active compound in the required amount in an
appropriate solvent with one or a combination of ingredients
enumerated above, as required, followed by filtered sterilization.
Generally, dispersions are prepared by incorporating the active
compound into a sterile vehicle that contains a basic dispersion
medium and the required other ingredients from those enumerated
above. In the case of sterile powders for the preparation of
sterile injectable solutions, methods of preparation are vacuum
drying and freeze-drying that yields a powder of the active
ingredient plus any additional desired ingredient from a previously
sterile-filtered solution thereof.
[0111] Oral compositions generally include an inert diluent or an
edible carrier. They can be enclosed in gelatin capsules or
compressed into tablets. For the purpose of oral therapeutic
administration, the active compound can be incorporated with
excipients and used in the form of tablets, troches, or capsules.
Oral compositions can also be prepared using a fluid carrier for
use as a mouthwash, wherein the compound in the fluid carrier is
applied orally and swished and expectorated or swallowed.
Pharmaceutically compatible binding agents, and/or adjuvant
materials can be included as part of the composition. The tablets,
pills, capsules, troches and the like can contain any of the
following ingredients, or compounds of a similar nature: a binder
such as microcrystalline cellulose, gum tragacanth or gelatin; an
excipient such as starch or lactose, a disintegrating agent such as
alginic acid, Primogel, or corn starch; a lubricant such as
magnesium stearate or Sterotes; a glidant such as colloidal silicon
dioxide; a sweetening agent such as sucrose or saccharin; or a
flavoring agent such as peppermint, methyl salicylate, or orange
flavoring.
[0112] For administration by inhalation, the compounds are
delivered in the form of an aerosol spray from pressured container
or dispenser which contains a suitable propellant, e.g., a gas such
as carbon dioxide, or a nebulizer.
[0113] Systemic administration can also be by transmucosal or
transdermal means. For transmucosal or transdermal administration,
penetrants appropriate to the barrier to be permeated are used in
the formulation. Such penetrants are generally known in the art,
and include, for example, for transmucosal administration,
detergents, bile salts, and fusidic acid derivatives. Transmucosal
administration can be accomplished through the use of nasal sprays
or suppositories. For transdermal administration, the active
compounds are formulated into ointments, salves, gels, or creams as
generally known in the art.
[0114] The compounds can also be prepared in the form of
suppositories (e.g., with conventional suppository bases such as
cocoa butter and other glycerides) or retention enemas for rectal
delivery.
[0115] In one embodiment, the active compounds are prepared with
carriers that will protect the compound against rapid elimination
from the body, such as a controlled release formulation, including
implants and microencapsulated delivery systems. Biodegradable,
biocompatible polymers can be used, such as ethylene vinyl acetate,
polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and
polylactic acid. Methods for preparation of such formulations will
be apparent to those skilled in the art. The materials can also be
obtained commercially from Alza Corporation and Nova
Pharmaceuticals, Inc. Liposomal suspensions (including liposomes
targeted to infected cells with monoclonal antibodies to viral
antigens) can also be used as pharmaceutically acceptable carriers.
These can be prepared according to methods known to those skilled
in the art, for example, as described in U.S. Pat. No.
4,522,811.
[0116] It is especially advantageous to formulate oral or
parenteral compositions in dosage unit form for ease of
administration and uniformity of dosage. Dosage unit form as used
herein refers to physically discrete units suited as unitary
dosages for the subject to be treated; each unit containing a
predetermined quantity of active compound calculated to produce the
desired therapeutic effect in association with the required
pharmaceutical carrier. The specification for the dosage unit forms
of the invention are dictated by and directly dependent on the
unique characteristics of the active compound and the particular
therapeutic effect to be achieved, and the limitations inherent in
the art of compounding such an active compound for the treatment of
individuals.
[0117] The pharmaceutical compositions can be included in a
container, pack, or dispenser together with instructions for
administration.
Diagnostic Assays
[0118] The huGITR antibodies can be used diagnostically to, for
example, monitor the development or progression of a immune cell
disorder (e.g., CLL) as part of a clinical testing procedure to,
e.g., determine the efficacy of a given treatment and/or prevention
regimen.
[0119] In some aspects, for diagnostic purposes the huGITR antibody
of the invention is linked to a detectable moiety, provides a way
for detecting T cell exhaustion in a subject suffering from a
cancer or a chronic infection.
[0120] The detectable moieties can be conjugated directly to the
antibodies or fragments, or indirectly by using, for example, a
fluorescent secondary antibody. Direct conjugation can be
accomplished by standard chemical coupling of, for example, a
fluorophore to the antibody or antibody fragment, or through
genetic engineering. Chimeras, or fusion proteins can be
constructed which contain an antibody or antibody fragment coupled
to a fluorescent or bioluminescent protein. For example, Casadei,
et al., describe a method of making a vector construct capable of
expressing a fusion protein of aequorin and an antibody gene in
mammalian cells.
[0121] As used herein, the term "labeled", with regard to the probe
or antibody, is intended to encompass direct labeling of the probe
or antibody by coupling (i.e., physically linking) a detectable
substance to the probe or antibody, as well as indirect labeling of
the probe or antibody by reactivity with another reagent that is
directly labeled. Examples of indirect labeling include detection
of a primary antibody using a fluorescently-labeled secondary
antibody and end-labeling of a DNA probe with biotin such that it
can be detected with fluorescently-labeled streptavidin. The term
"biological sample" is intended to include tissues, cells and
biological fluids isolated from a subject (such as a biopsy), as
well as tissues, cells and fluids present within a subject. That
is, the detection method of the invention can be used to detect
cells that express GITR in a biological sample in vitro as well as
in vivo. For example, in vitro techniques for detection of GITR
include enzyme linked immunosorbent assays (ELISAs), Western blots,
immunoprecipitations, and immunofluorescence. Furthermore, in vivo
techniques for detection of GITR include introducing into a subject
a labeled anti-GITR antibody. For example, the antibody can be
labeled with a radioactive marker whose presence and location in a
subject can be detected by standard imaging techniques. In the case
of "targeted" conjugates, that is, conjugates which contain a
targeting moiety--a molecule or feature designed to localize the
conjugate within a subject or animal at a particular site or sites,
localization refers to a state when an equilibrium between bound,
"localized", and unbound, "free" entities within a subject has been
essentially achieved. The rate at which such equilibrium is
achieved depends upon the route of administration. For example, a
conjugate administered by intravenous injection to localize thrombi
may achieve localization, or accumulation at the thrombi, within
minutes of injection. On the other hand, a conjugate administered
orally to localize an infection in the intestine may take hours to
achieve localization. Alternatively, localization may simply refer
to the location of the entity within the subject or animal at
selected time periods after the entity is administered. By way of
another example, localization is achieved when an moiety becomes
distributed following administration.
[0122] In all of the above cases, a reasonable estimate of the time
to achieve localization may be made by one skilled in the art.
Furthermore, the state of localization as a function of time may be
followed by imaging the detectable moiety (e.g., a light-emitting
conjugate) according to the methods of the invention, such as with
a photodetector device. The "photodetector device" used should have
a high enough sensitivity to enable the imaging of faint light from
within a mammal in a reasonable amount of time, and to use the
signal from such a device to construct an image.
[0123] In cases where it is possible to use light-generating
moieties which are extremely bright, and/or to detect
light-generating fusion proteins localized near the surface of the
subject or animal being imaged, a pair of "night-vision" goggles or
a standard high-sensitivity video camera, such as a Silicon
Intensified Tube (SIT) camera (e.g., from Hammamatsu Photonic
Systems, Bridgewater, N.J.), may be used. More typically, however,
a more sensitive method of light detection is required.
[0124] In extremely low light levels the photon flux per unit area
becomes so low that the scene being imaged no longer appears
continuous. Instead, it is represented by individual photons which
are both temporally and spatially distinct form one another. Viewed
on a monitor, such an image appears as scintillating points of
light, each representing a single detected photon. By accumulating
these detected photons in a digital image processor over time, an
image can be acquired and constructed. In contrast to conventional
cameras where the signal at each image point is assigned an
intensity value, in photon counting imaging the amplitude of the
signal carries no significance. The objective is to simply detect
the presence of a signal (photon) and to count the occurrence of
the signal with respect to its position over time.
[0125] At least two types of photodetector devices, described
below, can detect individual photons and generate a signal which
can be analyzed by an image processor. Reduced-Noise Photodetection
devices achieve sensitivity by reducing the background noise in the
photon detector, as opposed to amplifying the photon signal. Noise
is reduced primarily by cooling the detector array. The devices
include charge coupled device (CCD) cameras referred to as
"backthinned", cooled CCD cameras. In the more sensitive
instruments, the cooling is achieved using, for example, liquid
nitrogen, which brings the temperature of the CCD array to
approximately -120.degree. C. "Backthinned" refers to an ultra-thin
backplate that reduces the path length that a photon follows to be
detected, thereby increasing the quantum efficiency. A particularly
sensitive backthinned cryogenic CCD camera is the "TECH 512", a
series 200 camera available from Photometrics, Ltd. (Tucson,
Ariz.).
[0126] "Photon amplification devices" amplify photons before they
hit the detection screen. This class includes CCD cameras with
intensifiers, such as microchannel intensifiers. A microchannel
intensifier typically contains a metal array of channels
perpendicular to and co-extensive with the detection screen of the
camera. The microchannel array is placed between the sample,
subject, or animal to be imaged, and the camera. Most of the
photons entering the channels of the array contact a side of a
channel before exiting. A voltage applied across the array results
in the release of many electrons from each photon collision. The
electrons from such a collision exit their channel of origin in a
"shotgun" pattern, and are detected by the camera.
[0127] Even greater sensitivity can be achieved by placing
intensifying microchannel arrays in series, so that electrons
generated in the first stage in turn result in an amplified signal
of electrons at the second stage. Increases in sensitivity,
however, are achieved at the expense of spatial resolution, which
decreases with each additional stage of amplification. An exemplary
microchannel intensifier-based single-photon detection device is
the C2400 series, available from Hamamatsu.
[0128] Image processors process signals generated by photodetector
devices which count photons in order to construct an image which
can be, for example, displayed on a monitor or printed on a video
printer. Such image processors are typically sold as part of
systems which include the sensitive photon-counting cameras
described above, and accordingly, are available from the same
sources. The image processors are usually connected to a personal
computer, such as an IBM-compatible PC or an Apple Macintosh (Apple
Computer, Cupertino, Calif.), which may or may not be included as
part of a purchased imaging system. Once the images are in the form
of digital files, they can be manipulated by a variety of image
processing programs (such as "ADOBE PHOTOSHOP", Adobe Systems,
Adobe Systems, Mt. View, Calif.) and printed.
[0129] In one embodiment, the biological sample contains protein
molecules from the test subject. One preferred biological sample is
a peripheral blood leukocyte sample isolated by conventional means
from a subject.
[0130] The invention also encompasses kits for detecting the
presence of GITR or a GITR-expressing cell in a biological sample.
For example, the kit can comprise: a labeled compound or agent
capable of detecting a cancer or tumor cell (e.g., an anti-GITR
scFv or monoclonal antibody) in a biological sample; means for
determining the amount of GITR in the sample; and means for
comparing the amount of GITR in the sample with a standard. The
standard is, in some embodiments, a non-cancer cell or cell extract
thereof. The compound or agent can be packaged in a suitable
container. The kit can further comprise instructions for using the
kit to detect cancer in a sample.
Bi-Specific Antibodies
[0131] A bi-specific antibody (bsAb) is an antibody comprising two
variable domains or scFv units such that the resulting antibody
recognizes two different antigens. The present invention provides
for bi-specific antibodies that recognize GITR and a second
antigen. Exemplary second antigens include tumor associated
antigens, cytokines and cell surface receptors. In some
embodiments, the second antigen can be CAIX (carbonic anhydrase IX,
or G250), IL-10 or CCR4. In some embodiments, the second antigen
can be a cell surface receptor, wherein the cell surface receptor
is PD-1, PDL1, CCR4, IL21R, BTLA, HVEM or TIM3. A bi-specific
antibody of the present invention comprises a heavy chain and a
light chain combination or scFv of the huGITR antibodies disclosed
herein.
[0132] Construction of Bi-Specific Antibodies
[0133] Bi-specific antibodies of the present invention can be
constructed using methods known art. In some embodiments, the
bi-specific antibody is a single polypeptide wherein the two scFv
fragments are joined by a long linker polypeptide, of sufficient
length to allow intramolecular association between the two scFv
units to form an antibody. In other embodiments, the bi-specific
antibody is more than one polypeptide linked by covalent or
non-covalent bonds.
[0134] In another embodiment, the bi-specific antibody is
constructed using the "knob into hole" method (Ridgway et al.,
Protein Eng 7:617-621 (1996)). In this method, the Ig heavy chains
of the two different variable domains are reduced to selectively
break the heavy chain pairing while retaining the heavy-light chain
pairing. The two heavy-light chain heterodimers that recognize two
different antigens are mixed to promote heteroligation pairing,
which is mediated through the engineered "knob into holes" of the
CH3 domains.
[0135] In another embodiment, the bi-specific antibody can be
constructed through exchange of heavy-light chain dimers from two
or more different antibodies to generate a hybrid antibody where
the first heavy-light chain dimer recognizes GITR and the second
heavy-light chain dimer recognizes a second antigen. The mechanism
for heavy-light chain dimer is similar to the formation of human
IgG4, which also functions as a bispecific molecule. Dimerization
of IgG heavy chains is driven by intramolecular force, such as the
pairing the CH3 domain of each heavy chain and disulfide bridges.
Presence of a specific amino acid in the CH3 domain (R409) has been
shown to promote dimer exchange and construction of the IgG4
molecules. Heavy chain pairing is also stabilized further by
interheavy chain disulfide bridges in the hinge region of the
antibody. Specifically, in IgG4, the hinge region contains the
amino acid sequence Cys-Pro-Ser-Cys (in comparison to the stable
IgG1 hinge region which contains the sequence Cys-Pro-Pro-Cys) at
amino acids 226-230. This sequence difference of Serine at position
229 has been linked to the tendency of IgG4 to form novel
intrachain disulfides in the hinge region (Van der Neut
Kolfschoten, M. et al., 2007, Science 317:1554-1557 and Labrijn, A.
F. et al, 2011, Journal of immunol 187:3238-3246).
[0136] Therefore, bi-specific antibodies of the present invention
can be created through introduction of the R409 residue in the CH3
domain and the Cys-Pro-Ser-Cys sequence in the hinge region of
antibodies that recognize GITR or a second antigen, so that the
heavy-light chain dimers exchange to produce an antibody molecule
with one heavy-light chain dimer recognizing GITR and the second
heavy-light chain dimer recognizing a second antigen, wherein the
second antigen is any antigen disclosed herein. Known IgG4
molecules may also be altered such that the heavy and light chains
recognize GITR or a second antigen, as disclosed herein. Use of
this method for constructing the bi-specific antibodies of the
present invention may be beneficial due to the intrinsic
characteristic of IgG4 molecules wherein the Fc region differs from
other IgG subtypes in that it interacts poorly with effector
systems of the immune response, such as complement and Fc receptors
expressed by certain white blood cells. This specific property
makes these IgG4-based bi-specific antibodies attractive for
therapeutic applications, in which the antibody is required to bind
the target(s) and functionally alter the signaling pathways
associated with the target(s), however not trigger effector
activities.
[0137] In some embodiments, mutations are introduced to the
constant regions of the bsAb such that the antibody dependent
cell-mediated cytotoxicity (ADCC) activity of the bsAb is altered.
For example, the mutation is an LALA mutation in the CH2 domain. In
one aspect, the bsAb contains mutations on one scFv unit of the
heterodimeric bsAb, which reduces the ADCC activity. In another
aspect, the bsAb contains mutations on both chains of the
heterodimeric bsAb, which completely ablates the ADCC activity. For
example, the mutations introduced one or both scFv units of the
bsAb are LALA mutations in the CH2 domain. These bsAbs with
variable ADCC activity can be optimized such that the bsAbs
exhibits maximal selective killing towards cells that express one
antigen that is recognized by the bsAb, however exhibits minimal
killing towards the second antigen that is recognized by the
bsAb.
[0138] The bi-specific antibodies disclosed herein may be useful in
treatment of diseases or medical conditions, for example, cancer.
The bi-specific antibodies of the present invention may be
particularly useful in diseases or medical conditions that are
associated with increased Tregs. I
Methods of Treatment
[0139] The invention provides for both prophylactic and therapeutic
methods of treating a subject at risk of (or susceptible to) a
cancer, or other cell proliferation-related diseases or disorders.
Such diseases or disorders include but are not limited to, e.g.,
those diseases or disorders associated with aberrant expression of
GITR. For example, the methods are used to treat, prevent or
alleviate a symptom cancer. Alternatively, the methods are used to
treat, prevent or alleviate a symptom of a cancer in which GITR
plays a negative regulatory role in T cell response. Alternatively,
the methods are used to treat, prevent or alleviate a symptom of a
solid tumor such as breast cancer, lung cancer, ovarian cancer,
prostate cancer, colon cancer, cervical cancer, brain cancer, skin
cancer, liver cancer, pancreatic cancer or stomach cancer.
Additionally, the methods of the invention are used to treat
hematologic cancers such as leukemia and lymphoma. Alternatively,
the methods are used to treat, prevent or alleviate a symptom of a
cancer that has metastasized.
[0140] Accordingly, in one aspect, the invention provides methods
for preventing, treating or alleviating a symptom cancer or a cell
proliferative disease or disorder in a subject by administering to
the subject a monoclonal antibody, scFv antibody of the invention
or bi-specific antibody of the invention. For example, a huGITR
antibody may be administered in therapeutically effective
amounts.
[0141] Subjects at risk for cancer or cell proliferation-related
diseases or disorders include patients who have a family history of
cancer or a subject exposed to a known or suspected cancer-causing
agent. Administration of a prophylactic agent can occur prior to
the manifestation of cancer such that the disease is prevented or,
alternatively, delayed in its progression.
[0142] In another aspect, tumor cell growth is inhibited, Treg
activity is decreased, Teff activity is increased, or NK-cell
cytotoxicity in increased by contacting a cell with a GITR antibody
of the invention. The cell is any cell that expresses GITR. For
example the cell is T cell or an NK cell.
[0143] Also included in the invention are methods of increasing or
enhancing an immune response to an antigen. An immune response is
increased or enhanced by administering to the subject a monoclonal
antibody or scFv antibody of the invention. The immune response is
augmented for example by augmenting antigen specific T effector
function. The antigen is a viral (e.g. HIV), bacterial, parasitic
or tumor antigen. The immune response is a natural immune response.
By natural immune response is meant an immune response that is a
result of an infection. The infection is a chronic infection.
Increasing or enhancing an immune response to an antigen can be
measured by a number of methods known in the art. For example, an
immune response can be measured by measuring any one of the
following: T cell activity, T cell proliferation, T cell
activation, production of effector cytokines, and T cell
transcriptional profile.
[0144] Alternatively, the immune response is a response induced due
to a vaccination. Accordingly, in another aspect the invention
provides a method of increasing vaccine efficiency by administering
to the subject a monoclonal antibody or scFv antibody of the
invention and a vaccine. The antibody and the vaccine are
administered sequentially or concurrently. The vaccine is a tumor
vaccine a bacterial vaccine or a viral vaccine.
Combinatory Methods
[0145] The invention provides treating cancer in a patient by
administering two antibodies that bind to the same epitope of the
GITR protein or, alternatively, two different epitopes of the GITR
protein. Alternatively, the cancer is treated by administering a
first antibody that binds to GITR and a second antibody that binds
to a protein other than GITR. For example, the other protein other
than GITR may include, but is not limited to, PD-1, PD-L1, CAIX,
CCR4 and IL-10. For example, the other protein other than GITR is a
tumor-associated antigen.
[0146] In some embodiments, the invention provides administration
of a huGITR antibody alone or with an additional antibody that
recognizes another protein other than GITR, with cells that are
capable of effecting or augmenting an immune response. For example,
these cells may be peripheral blood mononuclear cells (PBMC), or
any cell type that is found in PBMC, e.g., cytotoxic T cells,
macrophages, and natural killer (NK) cells.
[0147] Additionally, the invention provides administration of an
antibody that binds to the GITR protein and an anti-neoplastic
agent, such a small molecule, a growth factor, a cytokine or other
therapeutics including biomolecules such as peptides,
peptidomimetics, peptoids, polynucleotides, lipid-derived
mediators, small biogenic amines, hormones, neuropeptides, and
proteases. Small molecules include, but are not limited to,
inorganic molecules and small organic molecules. Suitable growth
factors or cytokines include an IL-2, GM-CSF, IL-12, and TNF-alpha.
Small molecule libraries are known in the art. (See, Lam,
Anticancer Drug Des., 12:145, 1997.)
[0148] The invention will be further described in the following
examples, which do not limit the scope of the invention described
in the claims.
EXAMPLES
Example 1: Isolation of Anti-GITR Antibodies
[0149] Identification of Here is described isolation of thirteen
anti-GITR monoclonal antibodies. Panning with hGITR-mlg was
performed with the Mehta I/II phage display libraries for three
rounds with different antigen concentrations and wash conditions.
Panning with mGITR-his was performed for two rounds with different
antigen concentrations and wash conditions. ELISA assays were then
performed to screen single clones from round two and three with 2
ug/ml of hGITR-mlgG2a or mGITR-His from Round 2. ELISA positive
clones were sequenced and confirmed with a second ELISA assay
including negative control as described in FIG. 1. Forty three
unique clones were identified.
[0150] Clones were further tested for binding to hGITR using MSD
(meso scale discovery system) at two different concentrations of
the hGITR-mIgG2a antigen and four different concentrations of PEG
purified anti-GITR phage-AB (FIG. 2). A second experiment was
performed testing eight concentrations of hGITR-mlg and a constant
number of PEG purified anti-GITR phage-AB (FIG. 3).
Example 2: Characterization of ELISA Positive and FACS Positive
Clones from HGITR and MGITR Panning
[0151] In total, twenty nine unique clones were identified after
initial ELISA and FACS screening using hGITR-mlg panning. After
ELISA analysis ten of these clones were identified as binding to
anti-hGITR but not hGITR-His. Nineteen of these clones bound both
hGITR-mlg and His, with four of these having weak binding
efficiency. Fifteen clones were positive in FACS analysis, with
three having weaker binding than the others. There were also six
total ELISA unique positive clones after two rounds of mGITR-His
panning. Four of these clones bound to anti-mGITR-His only, and two
bound to both mGITR-His and hGITR-his. One scFV was selected
against mGITR but it strongly reacts with hGITR-mlg and -His.
Example 3: Characterization of Anti-GITR Antibodies
[0152] Binding of anti-GITR was tested using four different
concentrations of anti-GITR phage-AB. In addition, stable CHO cells
expressing either GITR or CA9 were tested for anti-GITR antibody
binding. Percentage of FITC positive CHO cells using FACS analysis
to assay GITR binding is shown in FIG. 4. A third FACS GITR binding
assay was performed using single concentration with phage
supernatant from single colonies (FIG. 5). This analysis revealed
anti-GITR antibodies that bound GITR expressing CHO cells and not
CA9 expressing CHO cells. Those positive for GITR binding were
selected for further ELISA analysis using a single concentration of
phage supernatant from single colonies (FIG. 6). A final list of
selected anti-GITR antibodies that were both flow cytometry and
ELISA positive are listed in FIG. 7.
Example 4: Construction and Expression of Anti-GITR Mab in
IGG1-Fc(LALA) Mutant Format and IGG4 Format
[0153] VH and VL fragments of our newly discovered anti-GITR phage
scFv antibodies were PCR cloned into mammalian expression vector
TCAE to be expressed either in IgG1 Fc (LALA) mutant form or in
IgG4 form, both formats with reduced or minimal ADCC activities.
Upon in vitro transfection of 293F cells, cell supernatants were
harvested and IgG concentration were quantitated by human IgG
quantitation assays. The supernatants were then used to test GITR
binding activities of these IgG mAbs to GITR(+) CHO cells using
flow cytometry. Results provided in FIGS. 8-10 demonstrate that
most of the anti-GITR antibodies retain their GITR binding
activities upon conversion to IgG format.
Example 5: Binding Competition Between GITR Ligand and Anti-GITR
Antibodies
[0154] In order to further characterize our newly discovered
anti-GITR antibodies, a competition binding assay was performed
between increasing amount of purified anti-GITR E1-3H7 IgG4 or
TT1-3C6 IgG4 with a constant concentration of GITR ligand by flow
cytometry, respectively. FIG. 11 shows that the binding of GITR
ligand (detected by Alexa 488 labeled anti-HA-tag) is reduced by
increasing amounts of anti-GITR antibodies (detected by PE-labeled
mouse-anti-human antibody, a feature shared with the commercial
GTI10 antibody although to a lesser degree. When
NF-.kappa.B-luc2P/GITR Jurkat reporter cells were incubated with
increasing concentration of anti-GITR ET-3H7 IgG4 or TT1-3C6 IgG4
antibodies together with a constant concentration of GITR ligand,
the luciferase activities increased to the level well above when
the cells incubated with the ligand or anti-GITR antibodies alone,
a feature not shared by the commercial GTI10 antibody (FIG. 12).
These results indicate that anti-GITR ET-3H7 IgG4 or TT1-3C6 may
synergistically increase GITR ligand induced luciferase expression
in GloResponse.TM. NF-.kappa.B-luc2P/GITR Jurkat cells by
Promega.
OTHER EMBODIMENTS
[0155] While the invention has been described in conjunction with
the detailed description thereof, the foregoing description is
intended to illustrate and not limit the scope of the invention,
which is defined by the scope of the appended claims. Other
aspects, advantages, and modifications are within the scope of the
following claims.
Sequence CWU 1
1
1221364DNAHomo sapiens 1caggtgcagc tggtgcagtc tgggggaggc gtggtacagc
ctggggggtc cctgagactc 60tcctgtgcag cctctggatt cacctttgat gattatgcca
tgcactgggt ccggcaagct 120ccagggaagg gcctggagtg ggtctcaagt
cttagttgga atactggtcg agtagcctat 180gcggactctg tgaagggccg
attcaccatc tccagagaca acgccaagaa ttccctgtat 240ctgcaaatga
acagtctgag acctgaggac acggccttct attactgtgc aaaaggctcc
300gcccttggct tagttggctg gttcgacgcc tggggccagg gcaccctggt
caccgtctcc 360tcag 3642121PRTHomo sapiens 2Gln Val Gln Leu Val Gln
Ser Gly Gly Gly Val Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Asp Asp Tyr 20 25 30Ala Met His Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ser Leu
Ser Trp Asn Thr Gly Arg Val Ala Tyr Ala Asp Ser Val 50 55 60Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Pro Glu Asp Thr Ala Phe Tyr Tyr Cys
85 90 95Ala Lys Gly Ser Ala Leu Gly Leu Val Gly Trp Phe Asp Ala Trp
Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115
1203322DNAHomo sapiens 3tcttctgagc tgactcagga ccctgctgtg tctgtggcct
tgggacagac agtcaggatc 60acatgccaag gagacagtct cagaacctat tatggaagtt
ggtaccagca gaagccagga 120caggcccctc tacttgtctt ctatggcaaa
gagagtcggc cctcagggat cccagaccga 180ttctctggct ccacctcagg
aaacacagct tccttgacca tcactggggc tcaggcggaa 240gatgaggctg
actattactg taactcccag gacagcagtg gtgacttatt attcggcgga
300gggaccaagc tgaccgtcct ag 3224107PRTHomo sapiens 4Ser Ser Glu Leu
Thr Gln Asp Pro Ala Val Ser Val Ala Leu Gly Gln1 5 10 15Thr Val Arg
Ile Thr Cys Gln Gly Asp Ser Leu Arg Thr Tyr Tyr Gly 20 25 30Ser Trp
Tyr Gln Gln Lys Pro Gly Gln Ala Pro Leu Leu Val Phe Tyr 35 40 45Gly
Lys Glu Ser Arg Pro Ser Gly Ile Pro Asp Arg Phe Ser Gly Ser 50 55
60Thr Ser Gly Asn Thr Ala Ser Leu Thr Ile Thr Gly Ala Gln Ala Glu65
70 75 80Asp Glu Ala Asp Tyr Tyr Cys Asn Ser Gln Asp Ser Ser Gly Asp
Leu 85 90 95Leu Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100
1055352DNAHomo sapiens 5caggtgcagc tggtgcaatc tgggggaggc ttggtccagt
ctgggaagtc cgtgagactc 60tcttgtgcag cctctggatt cacatttggt gattatgcca
tgcactgggt ccggcaagct 120ccaggaaagg gcctggagtg ggtcgcaggc
attactagga atagtggtcg catagcctat 180gcggactttg tgaagggccg
attcatcatc tccagagaca acgccaagaa ctcactgtat 240ctgcaaatga
acagcctgag agccgaggac acggctgtgt attactgtgc gagcgaaatg
300actggggctt atgatatttg gggccaaggg accacggtca ccgtctcctc ag
3526117PRTHomo sapiens 6Gln Val Gln Leu Val Gln Ser Gly Gly Gly Leu
Val Gln Ser Gly Lys1 5 10 15Ser Val Arg Leu Ser Cys Ala Ala Ser Gly
Phe Thr Phe Gly Asp Tyr 20 25 30Ala Met His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Ala Gly Ile Thr Arg Asn Ser Gly
Arg Ile Ala Tyr Ala Asp Phe Val 50 55 60Lys Gly Arg Phe Ile Ile Ser
Arg Asp Asn Ala Lys Asn Ser Leu Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ser Glu Met
Thr Gly Ala Tyr Asp Ile Trp Gly Gln Gly Thr Thr 100 105 110Val Thr
Val Ser Ser 1157325DNAHomo sapiens 7tcttctgagc tgactcagga
ccctgctgtg tctgtggcct tgggacagac agtcaggatc 60acatgccaag gagacggcct
cagatactat tatgcaagct ggtaccagca gaagccagga 120caggccccta
tacttgtcct ctttggtaaa aacaaccggc cctcagggat cccagaccga
180ttctctggct ccagctcagg aaatacagct tccttgacca tcactggggc
tcaggcggaa 240gatgaggctg actattactg taactcgcgg gacagcagtg
gtaaccatcg attcttcgga 300actgggacca aggtcaccgt cctaa 3258108PRTHomo
sapiens 8Ser Ser Glu Leu Thr Gln Asp Pro Ala Val Ser Val Ala Leu
Gly Gln1 5 10 15Thr Val Arg Ile Thr Cys Gln Gly Asp Gly Leu Arg Tyr
Tyr Tyr Ala 20 25 30Ser Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Ile
Leu Val Leu Phe 35 40 45Gly Lys Asn Asn Arg Pro Ser Gly Ile Pro Asp
Arg Phe Ser Gly Ser 50 55 60Ser Ser Gly Asn Thr Ala Ser Leu Thr Ile
Thr Gly Ala Gln Ala Glu65 70 75 80Asp Glu Ala Asp Tyr Tyr Cys Asn
Ser Arg Asp Ser Ser Gly Asn His 85 90 95Arg Phe Phe Gly Thr Gly Thr
Lys Val Thr Val Leu 100 1059361DNAHomo sapiens 9caggtgcagc
tggtgcagtc tgggggaggc gtggtccagc ctgggaggtc cctgagactc 60tcctgtgcag
cctctggatt caccttcagt agctatgcta tgcactgggt ccgccaggct
120ccaggcaagg ggctggagtg ggtggcagtt atatcatatg atggaagcaa
taaatactac 180gcagactccg tgaagggccg attcaccatc tccagagaca
attccaagaa cacgctgtat 240ctgcaaatga acagcctgag agctgaggac
acggctgtat attactgtgc gaaagaggat 300tactatgata gtagtggttc
gaactactgg ggccagggaa ccctggtcac cgtctcctca 360g 36110120PRTHomo
sapiens 10Gln Val Gln Leu Val Gln Ser Gly Gly Gly Val Val Gln Pro
Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe
Ser Ser Tyr 20 25 30Ala Met His Trp Val Arg Gln Ala Pro Gly Lys Gly
Leu Glu Trp Val 35 40 45Ala Val Ile Ser Tyr Asp Gly Ser Asn Lys Tyr
Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn
Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala
Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Glu Asp Tyr Tyr Asp
Ser Ser Gly Ser Asn Tyr Trp Gly Gln 100 105 110Gly Thr Leu Val Thr
Val Ser Ser 115 12011331DNAHomo sapiens 11ctgcctgtgc tgactcagcc
accctcagcg tctgggaccc ccgggcagag ggtcaccatc 60tcttgttctg gaagcagctc
caacatcgga agtaattatg tatactggta ccagcagctc 120ccaggaacgg
cccccaaact cctcacctat aggaatgatc agcggccctc aggggtccct
180gaccgattct ctggctccaa gtctggcacc tcagcctccc tggccatcag
tgggctccgg 240tccgaggatg aggctgatta tttctgttca gcttgggatg
acagcctggg tggcgaggtc 300ttcggaactg ggaccaaggt caacgtccta g
33112110PRTHomo sapiens 12Leu Pro Val Leu Thr Gln Pro Pro Ser Ala
Ser Gly Thr Pro Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser Gly Ser
Ser Ser Asn Ile Gly Ser Asn 20 25 30Tyr Val Tyr Trp Tyr Gln Gln Leu
Pro Gly Thr Ala Pro Lys Leu Leu 35 40 45Thr Tyr Arg Asn Asp Gln Arg
Pro Ser Gly Val Pro Asp Arg Phe Ser 50 55 60Gly Ser Lys Ser Gly Thr
Ser Ala Ser Leu Ala Ile Ser Gly Leu Arg65 70 75 80Ser Glu Asp Glu
Ala Asp Tyr Phe Cys Ser Ala Trp Asp Asp Ser Leu 85 90 95Gly Gly Glu
Val Phe Gly Thr Gly Thr Lys Val Asn Val Leu 100 105 11013355DNAHomo
sapiens 13caggtgcagc tggtgcagtc tgggggaggc ttggtacagc ctggggggtc
cctgagactc 60tcctgtgcag cctctggatt cacctttagc agccatgcca tgagctgggt
ccgccaggct 120ccagggaagg ggctggagtg ggtctcagct attagtggta
gtggtggtag cacatactac 180gcagactccg tgaagggccg gttcaccatc
tccagagaca attccaagaa cacgctgtat 240ctgcaaatga acagcctgag
agccgaggac acggccgtat attactgtgc gaaaatcggt 300acggcggatg
cttttgatat ctggggccaa gggaccacgg tcaccgtctc ctcag 35514118PRTHomo
sapiens 14Gln Val Gln Leu Val Gln Ser Gly Gly Gly Leu Val Gln Pro
Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe
Ser Ser His 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly
Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr
Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn
Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala
Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Ile Gly Thr Ala Asp
Ala Phe Asp Ile Trp Gly Gln Gly Thr 100 105 110Thr Val Thr Val Ser
Ser 11515331DNAHomo sapiens 15cagtctgccc tgactcagcc accctcagtg
tctgggaccc ccggacagag ggtcaccatc 60tcttgttctg gaggcgtccc caacatcgga
agtaatcctg taaactggta cctccaccgc 120ccaggaacgg cccccaaact
cctcatctat aatagcaatc agtggccctc aggggtccct 180gaccgatttt
ctggctccag gtctggcacc tcagcctccc tggccatcag tgggctccag
240tctgaggatg aggctgatta ttactgtgca gcatgggatg acagcctgga
tggtctggtt 300ttcggcggag ggaccaagtt gaccgtccta g 33116110PRTHomo
sapiens 16Gln Ser Ala Leu Thr Gln Pro Pro Ser Val Ser Gly Thr Pro
Gly Gln1 5 10 15Arg Val Thr Ile Ser Cys Ser Gly Gly Val Pro Asn Ile
Gly Ser Asn 20 25 30Pro Val Asn Trp Tyr Leu His Arg Pro Gly Thr Ala
Pro Lys Leu Leu 35 40 45Ile Tyr Asn Ser Asn Gln Trp Pro Ser Gly Val
Pro Asp Arg Phe Ser 50 55 60Gly Ser Arg Ser Gly Thr Ser Ala Ser Leu
Ala Ile Ser Gly Leu Gln65 70 75 80Ser Glu Asp Glu Ala Asp Tyr Tyr
Cys Ala Ala Trp Asp Asp Ser Leu 85 90 95Asp Gly Leu Val Phe Gly Gly
Gly Thr Lys Leu Thr Val Leu 100 105 11017373DNAHomo sapiens
17caggtgcagc tggtgcagtc tggggctgag gtgaagaagc ctggggcctc agtgaaggtt
60tcctgcaagg catctggata caccttcacc agctactata tgcactgggt gcgacaggcc
120cctggacaag ggcttgagtg gatgggaata atcaacccta gtggtggtag
cacaagctac 180gcacagaagt tccagggcag agtcaccatg accagggaca
cgtccacgag cacagtctac 240atggagctga gcagcctgag atctgaggac
acggccgtgt attactgtgc tagagaaaaa 300agcagcagct ggtacggggg
ggacaactgg ttcgacccct ggggccaggg caccctggtc 360accgtctcct cag
37318124PRTHomo sapiens 18Gln Val Gln Leu Val Gln Ser Gly Ala Glu
Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser
Gly Tyr Thr Phe Thr Ser Tyr 20 25 30Tyr Met His Trp Val Arg Gln Ala
Pro Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Ile Ile Asn Pro Ser Gly
Gly Ser Thr Ser Tyr Ala Gln Lys Phe 50 55 60Gln Gly Arg Val Thr Met
Thr Arg Asp Thr Ser Thr Ser Thr Val Tyr65 70 75 80Met Glu Leu Ser
Ser Leu Arg Ser Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu
Lys Ser Ser Ser Trp Tyr Gly Gly Asp Asn Trp Phe Asp 100 105 110Pro
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 12019331DNAHomo
sapiens 19cagtctgccc tgactcagcc tcgctcagtg tccgggtctc ctggacagtc
agtcaccatc 60tcctgcactg gaagcagcag tgatgttggt ggttatcatt atgtctcctg
gtaccaacaa 120tacccaggca aagtccccaa actgatgatt tatgatgtct
ctaggcggcc ctcaggggtt 180tctgatcgct tctctggctc caagtctggc
agcacggcct ccctgaccat ctctgggctc 240caggctgagg acgaggctga
ttattactgc agctcatata caagcagcag cactgtggtc 300ttcggcggag
ggaccaagct gaccgtccta c 33120110PRTHomo sapiens 20Gln Ser Ala Leu
Thr Gln Pro Arg Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Val Thr
Ile Ser Cys Thr Gly Ser Ser Ser Asp Val Gly Gly Tyr 20 25 30His Tyr
Val Ser Trp Tyr Gln Gln Tyr Pro Gly Lys Val Pro Lys Leu 35 40 45Met
Ile Tyr Asp Val Ser Arg Arg Pro Ser Gly Val Ser Asp Arg Phe 50 55
60Ser Gly Ser Lys Ser Gly Ser Thr Ala Ser Leu Thr Ile Ser Gly Leu65
70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Ser Ser Tyr Thr Ser
Ser 85 90 95Ser Thr Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu
100 105 11021390DNAHomo sapiens 21caggtgcagc tggtgcaatc tggagctgag
gtgaagaagc ctggggcctc agtgaaggtc 60tcctgcaagg cttctggtta cacctttacc
agctatggta tcagctgggt gcgacaggcc 120cctggacaag ggcttgagtg
gatgggatgg atcagcgctt acaatggtaa cacaaactat 180gcacagaagc
tccagggcag agtcaccatg accacagaca catccacgag cacagcctac
240atggagctga ggagcctgag atctgacgac acggccgtgt attactgtgc
gagagatgta 300caccccttag atatagcagt ggctgccgac gattactact
actacggtat ggacgtctgg 360ggccaaggca ccctggtcac cgtctcctca
39022130PRTHomo sapiens 22Gln Val Gln Leu Val Gln Ser Gly Ala Glu
Val Lys Lys Pro Gly Ala1 5 10 15Ser Val Lys Val Ser Cys Lys Ala Ser
Gly Tyr Thr Phe Thr Ser Tyr 20 25 30Gly Ile Ser Trp Val Arg Gln Ala
Pro Gly Gln Gly Leu Glu Trp Met 35 40 45Gly Trp Ile Ser Ala Tyr Asn
Gly Asn Thr Asn Tyr Ala Gln Lys Leu 50 55 60Gln Gly Arg Val Thr Met
Thr Thr Asp Thr Ser Thr Ser Thr Ala Tyr65 70 75 80Met Glu Leu Arg
Ser Leu Arg Ser Asp Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp
Val His Pro Leu Asp Ile Ala Val Ala Ala Asp Asp Tyr 100 105 110Tyr
Tyr Tyr Gly Met Asp Val Trp Gly Gln Gly Thr Leu Val Thr Val 115 120
125Ser Ser 13023325DNAHomo sapiens 23tcttctgagc tgactcagga
ccctgctgtg tctgtggcct tgggacagac agtcaggatc 60acatgccaag gagacagcct
cacaaccaat tatgcaagct ggtaccagca gaagccagga 120caggcccctg
ttcttgtcat ctatggtaaa aacaagcggc cctcagggat cccagaccga
180ttctctggct ccatctcagg gaacacagct tccttgacca tcactggggc
tcaggcggag 240gatgaggctg actattactg taactcccgg gacagcagtg
gtaagcatta tgtcttcgga 300actgggacca aggtcaccgt cctag
32524108PRTHomo sapiens 24Ser Ser Glu Leu Thr Gln Asp Pro Ala Val
Ser Val Ala Leu Gly Gln1 5 10 15Thr Val Arg Ile Thr Cys Gln Gly Asp
Ser Leu Thr Thr Asn Tyr Ala 20 25 30Ser Trp Tyr Gln Gln Lys Pro Gly
Gln Ala Pro Val Leu Val Ile Tyr 35 40 45Gly Lys Asn Lys Arg Pro Ser
Gly Ile Pro Asp Arg Phe Ser Gly Ser 50 55 60Ile Ser Gly Asn Thr Ala
Ser Leu Thr Ile Thr Gly Ala Gln Ala Glu65 70 75 80Asp Glu Ala Asp
Tyr Tyr Cys Asn Ser Arg Asp Ser Ser Gly Lys His 85 90 95Tyr Val Phe
Gly Thr Gly Thr Lys Val Thr Val Leu 100 10525367DNAHomo sapiens
25gaggtgcagc tggtggagtc tgggggaggc gtggtccagc ctgggaggtc cctgagactc
60tcctgtgcag cctctggatt cacctttagc agctatgcca tgagctgggt ccgccaggct
120ccagggaagg ggctggagtg ggtctcagct attagtggta gtggtggtag
cacatactac 180gcagactccg tgaagggccg gttcaccatc tccagagaca
attccaagaa cacgctgtat 240ctgcaaatga acagcctgag agccgaggac
acggccgtat attactgtgc gaaagattgg 300ggcctagtac aactggaatc
cggctatgac tactggggcc agggaaccct ggtcaccgtc 360tcctcag
36726122PRTHomo sapiens 26Glu Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly
Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Asp
Trp Gly Leu Val Gln Leu Glu Ser Gly Tyr Asp Tyr Trp 100 105 110Gly
Gln Gly Thr Leu Val Thr Val Ser Ser 115 12027334DNAHomo sapiens
27cagtctgtgc tgactcagcc accctcagtg tctggggccc cagggcagag ggtcaccatc
60tcctgcactg ggagcagctc caacatcggg gcaggttatg atgtacactg gtaccaacag
120cttccaggaa aagcccccaa actcctcatc tatgataata ccaatcggcc
ctcgggggtc 180cctgaccgat tctctggctc caagtctggc acctcagcct
ccctggccat cagtgggctc 240cagtctgagg atgaggctga ttattactgt
gcagcatggg atgaaagcct gaatggtcag 300gtcttcggaa ctgggaccaa
ggtcaccgtc ctag 33428111PRTHomo sapiens 28Gln Ser Val Leu Thr Gln
Pro Pro Ser Val Ser Gly Ala Pro Gly Gln1
5 10 15Arg Val Thr Ile Ser Cys Thr Gly Ser Ser Ser Asn Ile Gly Ala
Gly 20 25 30Tyr Asp Val His Trp Tyr Gln Gln Leu Pro Gly Lys Ala Pro
Lys Leu 35 40 45Leu Ile Tyr Asp Asn Thr Asn Arg Pro Ser Gly Val Pro
Asp Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Thr Ser Ala Ser Leu Ala
Ile Ser Gly Leu65 70 75 80Gln Ser Glu Asp Glu Ala Asp Tyr Tyr Cys
Ala Ala Trp Asp Glu Ser 85 90 95Leu Asn Gly Gln Val Phe Gly Thr Gly
Thr Lys Val Thr Val Leu 100 105 11029367DNAHomo sapiens
29caggtacagc tgcagcagtc aggcccagga ctggtgaagc cttcggggac cctgtccctc
60acctgcgctg tctctggtgg ctccatcagc agtagtgact ggtggagttg ggtccgccag
120gtcccaggga aggggctgga gtggattggg gaaatctatc acagtggcag
tcccaactac 180aacccgtccc tcaggggtcg agtcaccata tcagtagaca
agtcgaagaa ccagttctcc 240ctgaagctga gctctgtgac cgccgcggac
acggccgtct attactgtgc gagagaaaga 300gttgctccta cagtagacgg
tgcttttgat gtctggggcc aagggacaat ggtcaccgtc 360tcctcag
36730122PRTHomo sapiens 30Gln Val Gln Leu Gln Gln Ser Gly Pro Gly
Leu Val Lys Pro Ser Gly1 5 10 15Thr Leu Ser Leu Thr Cys Ala Val Ser
Gly Gly Ser Ile Ser Ser Ser 20 25 30Asp Trp Trp Ser Trp Val Arg Gln
Val Pro Gly Lys Gly Leu Glu Trp 35 40 45Ile Gly Glu Ile Tyr His Ser
Gly Ser Pro Asn Tyr Asn Pro Ser Leu 50 55 60Arg Gly Arg Val Thr Ile
Ser Val Asp Lys Ser Lys Asn Gln Phe Ser65 70 75 80Leu Lys Leu Ser
Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu
Arg Val Ala Pro Thr Val Asp Gly Ala Phe Asp Val Trp 100 105 110Gly
Gln Gly Thr Met Val Thr Val Ser Ser 115 12031322DNAHomo sapiens
31gacatcgtga tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga cagagtcacc
60atcacttgcc gggcaagtca gagcattacc acctatttaa attggtatca gcagaaacca
120gggaaagccc ctaagctcct gatctatgct gcatccagtt tgcaaagtgg
ggtcccatca 180aggttcagtg gcagtggatc tgggacagaa ttcactctca
ctatcagcag cctgcagcct 240gaagattttg caacttatta ttgtcaacag
gccagcagtt tccctctcac tttcggcgga 300gggaccaagg tggatctcaa ac
32232107PRTHomo sapiens 32Asp Ile Val Met Thr Gln Ser Pro Ser Ser
Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala
Ser Gln Ser Ile Thr Thr Tyr 20 25 30Leu Asn Trp Tyr Gln Gln Lys Pro
Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Ala Ala Ser Ser Leu Gln
Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Glu
Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala
Thr Tyr Tyr Cys Gln Gln Ala Ser Ser Phe Pro Leu 85 90 95Thr Phe Gly
Gly Gly Thr Lys Val Asp Leu Lys 100 10533364DNAHomo sapiens
33gaggtgcagc tggtgcagtc tggagctgag gtgaaaaagc ccggggagtc tctgaagatc
60tcctgtaagg gttcgggata cagctttacc aactactgga tcggctgggt gcgccagatg
120cccgggaaag gcctggagtg gattgggatc atctatcctg gtgactctga
taccagatac 180agcccgtcct tccaaggcca ggtcaccatc tcagccgaca
agtccaccag cactgcctac 240ctgcagtgga gcagcctgaa ggcctcggac
accgccatgt attactgtgc gaggataaag 300agttactatg atagtagtgg
ttattacctc tggggccagg gaaccctggt caccgtctcc 360tcag 36434121PRTHomo
sapiens 34Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro
Gly Glu1 5 10 15Ser Leu Lys Ile Ser Cys Lys Gly Ser Gly Tyr Ser Phe
Thr Asn Tyr 20 25 30Trp Ile Gly Trp Val Arg Gln Met Pro Gly Lys Gly
Leu Glu Trp Ile 35 40 45Gly Ile Ile Tyr Pro Gly Asp Ser Asp Thr Arg
Tyr Ser Pro Ser Phe 50 55 60Gln Gly Gln Val Thr Ile Ser Ala Asp Lys
Ser Thr Ser Thr Ala Tyr65 70 75 80Leu Gln Trp Ser Ser Leu Lys Ala
Ser Asp Thr Ala Met Tyr Tyr Cys 85 90 95Ala Arg Ile Lys Ser Tyr Tyr
Asp Ser Ser Gly Tyr Tyr Leu Trp Gly 100 105 110Gln Gly Thr Leu Val
Thr Val Ser Ser 115 12035322DNAHomo sapiens 35cagtctgtgc tgactcagcc
accctcggtg tcagtggccc caggacagac ggccagcata 60acctgtgggg gaaacaacat
tgggagtaaa agtgtgcact ggtaccagca gaagccaggc 120caggcccctg
tcctggtcgt ctatgatgat agcgaccggc cctcagggat ccctgagcga
180ttctctggct ccaactctgg gaacacggcc accctgacca tcagcagggt
cgaagccggg 240gatgaggccg actattactg tcaggtgtgg gatagtagta
gtgaagaggt attcggcgga 300gggaccaagc tgaccgtcct ag 32236107PRTHomo
sapiens 36Gln Ser Val Leu Thr Gln Pro Pro Ser Val Ser Val Ala Pro
Gly Gln1 5 10 15Thr Ala Ser Ile Thr Cys Gly Gly Asn Asn Ile Gly Ser
Lys Ser Val 20 25 30His Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Val
Leu Val Val Tyr 35 40 45Asp Asp Ser Asp Arg Pro Ser Gly Ile Pro Glu
Arg Phe Ser Gly Ser 50 55 60Asn Ser Gly Asn Thr Ala Thr Leu Thr Ile
Ser Arg Val Glu Ala Gly65 70 75 80Asp Glu Ala Asp Tyr Tyr Cys Gln
Val Trp Asp Ser Ser Ser Glu Glu 85 90 95Val Phe Gly Gly Gly Thr Lys
Leu Thr Val Leu 100 10537346DNAHomo sapiens 37gaggtgcagc tggtgcagtc
tgggggaggc ttggtacagc ctggggggtc cctgagactc 60tcctgtgcag cctctggatt
cacctttagc agctatgcca tgagctgggt ccgccaggct 120ccagggaagg
ggctggagtg ggtctcagct attagtggta gtggtggtag cacatactac
180gcagactccg tgaagggccg gttcaccatc tccagagaca attccaagaa
cacgctgtat 240ctgcaaatga acagcctgag agccgacgac acggctgtct
attactgtgc gagaaggggg 300ttcatggacg tctggggcaa aggcaccctg
gtcaccgtct cctcag 34638115PRTHomo sapiens 38Glu Val Gln Leu Val Gln
Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile
Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Asp Asp Thr Ala Val Tyr Tyr Cys
85 90 95Ala Arg Arg Gly Phe Met Asp Val Trp Gly Lys Gly Thr Leu Val
Thr 100 105 110Val Ser Ser 11539325DNAHomo sapiens 39tcttctgagc
tgactcagga ccctgctgtg tctgtggcct tgggacagac agtcaccatc 60acatgccaag
gagacatcct cgaagcctat tatgcaagtt ggtaccagca gaggccagga
120caggcccctg tccttgtcat ctatggcgaa aacaaccggc cctcagggat
cccagaccgg 180ttctctggct ccaggtcagg aaacacagcc tccttgacca
tcactggggc tcaggcggaa 240gatgaggctg actattattg taactctcgg
gacagcagtg gtagccatgt ggtattcggc 300ggagggacca agatgaccgt cctgg
32540108PRTHomo sapiens 40Ser Ser Glu Leu Thr Gln Asp Pro Ala Val
Ser Val Ala Leu Gly Gln1 5 10 15Thr Val Thr Ile Thr Cys Gln Gly Asp
Ile Leu Glu Ala Tyr Tyr Ala 20 25 30Ser Trp Tyr Gln Gln Arg Pro Gly
Gln Ala Pro Val Leu Val Ile Tyr 35 40 45Gly Glu Asn Asn Arg Pro Ser
Gly Ile Pro Asp Arg Phe Ser Gly Ser 50 55 60Arg Ser Gly Asn Thr Ala
Ser Leu Thr Ile Thr Gly Ala Gln Ala Glu65 70 75 80Asp Glu Ala Asp
Tyr Tyr Cys Asn Ser Arg Asp Ser Ser Gly Ser His 85 90 95Val Val Phe
Gly Gly Gly Thr Lys Met Thr Val Leu 100 10541346DNAHomo sapiens
41caggtgcagc tggtgcagtc tgggggaggc ttggtacagc ctggggggtc cctgagactc
60tcctgtgcag cctctggatt cacctttaac agctttgcca tgacctgggt ccgccaggct
120ccagggaagg ggctggagtg ggtctcaggt attagtggta gtggtggtag
cacatactac 180gcagactccg tgaagggccg gttcaccatc tccagagaca
attccaagaa cacgctgtat 240ctgcaaatga acagcctgag agccgaggac
acggccgtat attactgtgc gaaagggcac 300gcttttgata tctggggcca
agggaccacg gtcaccgtct cctcag 34642115PRTHomo sapiens 42Gln Val Gln
Leu Val Gln Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Asn Ser Phe 20 25 30Ala
Met Thr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40
45Ser Gly Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val
50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu
Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95Ala Lys Gly His Ala Phe Asp Ile Trp Gly Gln Gly
Thr Thr Val Thr 100 105 110Val Ser Ser 11543337DNAHomo sapiens
43gacatcgtga tgacccagtc tccactctct ctgtccgtca cccctgggca gccggcctcc
60atctcctgca agtctagtca gagcctcctg catagtgatg gaaagaccta tttgtattgg
120tacctgcaga agccaggcca gcctccacaa ctcctgatct atgaagtttc
caaccggttc 180tctggagtgc cagataggtt cagtggcagc gggtcaggga
cagatttcac actgaaaatc 240agccgggtgg aggctgagga tgttggggtt
tattactgca tgcaaagtat acagcttcct 300ctcactttcg gcggagggac
caaggtggag atcaaac 33744112PRTHomo sapiens 44Asp Ile Val Met Thr
Gln Ser Pro Leu Ser Leu Ser Val Thr Pro Gly1 5 10 15Gln Pro Ala Ser
Ile Ser Cys Lys Ser Ser Gln Ser Leu Leu His Ser 20 25 30Asp Gly Lys
Thr Tyr Leu Tyr Trp Tyr Leu Gln Lys Pro Gly Gln Pro 35 40 45Pro Gln
Leu Leu Ile Tyr Glu Val Ser Asn Arg Phe Ser Gly Val Pro 50 55 60Asp
Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile65 70 75
80Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Met Gln Ser
85 90 95Ile Gln Leu Pro Leu Thr Phe Gly Gly Gly Thr Lys Val Glu Ile
Lys 100 105 11045352DNAHomo sapiens 45caggtgcagc tggtgcagtc
tgggggaggc ttggtacagc ctggggggtc cctgagactc 60tcctgtgcag cctctggatt
cacctttagc agctatgcca tgagctgggt ccgccaggct 120ccagggaagg
ggctggagtg ggtctcagct attagtggta gtggtggtag cacatactac
180gcagactccg tgaagggccg gttcaccatc tccagagaca attccaagaa
cacgctgtat 240ctgcaaatga acagcctgag agccgaggac acggctgtgt
attactgtgc gaaagataaa 300ggtggggggt tcgacccctg gggccaggga
accctggtca ccgtctcctc ag 35246117PRTHomo sapiens 46Gln Val Gln Leu
Val Gln Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met
Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser
Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55
60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65
70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95Ala Lys Asp Lys Gly Gly Gly Phe Asp Pro Trp Gly Gln Gly
Thr Leu 100 105 110Val Thr Val Ser Ser 11547331DNAHomo sapiens
47aattttatgc tgactcagcc ccactctgtg tcggagtctc cggggaagac ggtaaccatc
60tcctgcaccc gcagcagtgg cagcattgcc agcaactatg tgcagtggta ccagcagcgc
120ccgggcagtt cccccaccac tgtgatctat gaggataacc aaagaccctc
tggggtccct 180gatcggttct ctggctccat cgacagctcc tccaactctg
cctccctcac catctctgga 240ctgaagactg aggacgaggc tgactactac
tgtcagtctt atgatagtac ctctcatgtc 300ttcggaactg ggacccaggt
caccgtccta g 33148110PRTHomo sapiens 48Asn Phe Met Leu Thr Gln Pro
His Ser Val Ser Glu Ser Pro Gly Lys1 5 10 15Thr Val Thr Ile Ser Cys
Thr Arg Ser Ser Gly Ser Ile Ala Ser Asn 20 25 30Tyr Val Gln Trp Tyr
Gln Gln Arg Pro Gly Ser Ser Pro Thr Thr Val 35 40 45Ile Tyr Glu Asp
Asn Gln Arg Pro Ser Gly Val Pro Asp Arg Phe Ser 50 55 60Gly Ser Ile
Asp Ser Ser Ser Asn Ser Ala Ser Leu Thr Ile Ser Gly65 70 75 80Leu
Lys Thr Glu Asp Glu Ala Asp Tyr Tyr Cys Gln Ser Tyr Asp Ser 85 90
95Thr Ser His Val Phe Gly Thr Gly Thr Gln Val Thr Val Leu 100 105
11049373DNAHomo sapiens 49gaggtgcagc tggtgcagtc tggagcagag
gtgaaaaagc ccggggagtc tctgaagatc 60tcctgtaagg gttctggata cagctttacc
aactactgga tcggctgggt gcgccagatg 120cccgggaaag gcctggagtg
ggtggggatc atctatcctg gtgactctga taccagatac 180agcccgtcct
tccaaggcca ggtcaccatc tcagccgaca agtccatcag caccgcctac
240ctgcagtgga gcagcctgaa ggcctcggac accgccatgt attactgtgc
gagaccaggg 300tattactatg gttcggggag ttattataac gttgactact
ggggccaggg caccctggtc 360accgtctcct cag 37350124PRTHomo sapiens
50Glu Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Glu1
5 10 15Ser Leu Lys Ile Ser Cys Lys Gly Ser Gly Tyr Ser Phe Thr Asn
Tyr 20 25 30Trp Ile Gly Trp Val Arg Gln Met Pro Gly Lys Gly Leu Glu
Trp Val 35 40 45Gly Ile Ile Tyr Pro Gly Asp Ser Asp Thr Arg Tyr Ser
Pro Ser Phe 50 55 60Gln Gly Gln Val Thr Ile Ser Ala Asp Lys Ser Ile
Ser Thr Ala Tyr65 70 75 80Leu Gln Trp Ser Ser Leu Lys Ala Ser Asp
Thr Ala Met Tyr Tyr Cys 85 90 95Ala Arg Pro Gly Tyr Tyr Tyr Gly Ser
Gly Ser Tyr Tyr Asn Val Asp 100 105 110Tyr Trp Gly Gln Gly Thr Leu
Val Thr Val Ser Ser 115 12051322DNAHomo sapiens 51cagcctgggc
tgactcagcc accctcagtg tccgtgtccc caggacagac agccagcatc 60acctgctctg
gagatgaatt gggggataaa tttgctttct ggtatcaaca aaagccaggc
120cagtcccctg tgctggtcat ctatcaagat agtaagaggc cctcagggat
ccctgagcga 180ttctctggct ccatctctgg gaacacggcc accctgacta
tcagcagggt cgaggccgga 240gatgaggccg actatttctg tcaggtgtgg
gatagcaatg gtggtccccc attcgggaga 300gggaccaagc tgaccgtcct ag
32252107PRTHomo sapiens 52Gln Pro Gly Leu Thr Gln Pro Pro Ser Val
Ser Val Ser Pro Gly Gln1 5 10 15Thr Ala Ser Ile Thr Cys Ser Gly Asp
Glu Leu Gly Asp Lys Phe Ala 20 25 30Phe Trp Tyr Gln Gln Lys Pro Gly
Gln Ser Pro Val Leu Val Ile Tyr 35 40 45Gln Asp Ser Lys Arg Pro Ser
Gly Ile Pro Glu Arg Phe Ser Gly Ser 50 55 60Ile Ser Gly Asn Thr Ala
Thr Leu Thr Ile Ser Arg Val Glu Ala Gly65 70 75 80Asp Glu Ala Asp
Tyr Phe Cys Gln Val Trp Asp Ser Asn Gly Gly Pro 85 90 95Pro Phe Gly
Arg Gly Thr Lys Leu Thr Val Leu 100 105538PRTHomo sapiens 53Gly Phe
Thr Phe Asp Asp Tyr Ala1 5548PRTHomo sapiens 54Leu Ser Trp Asn Thr
Gly Arg Val1 55514PRTHomo sapiens 55Ala Lys Gly Ser Ala Leu Gly Leu
Val Gly Trp Phe Asp Ala1 5 10566PRTHomo sapiens 56Ser Leu Arg Thr
Tyr Tyr1 5573PRTHomo sapiens 57Gly Lys Glu15810PRTHomo sapiens
58Asn Ser Gln Asp Ser Ser Gly Asp Leu Leu1 5 10598PRTHomo sapiens
59Gly Phe Thr Phe Gly Asp Tyr Ala1 5608PRTHomo sapiens 60Ile Thr
Arg Asn Ser Gly Arg Ile1 56110PRTHomo sapiens 61Ala Ser Glu Met Thr
Gly Ala Tyr Asp Ile1 5 10626PRTHomo sapiens 62Gly Leu Arg Tyr Tyr
Tyr1 5633PRTHomo sapiens 63Gly Lys Asn16411PRTHomo sapiens 64Asn
Ser Arg Asp Ser Ser Gly Asn His Arg Phe1 5 10658PRTHomo sapiens
65Gly Phe Thr Phe Ser Ser Tyr Ala1 5668PRTHomo sapiens 66Ile Ser
Tyr Asp Gly Ser Asn Lys1 56713PRTHomo sapiens 67Ala Lys Glu Asp Tyr
Tyr Asp Ser Ser Gly Ser Asn Tyr1 5 10688PRTHomo sapiens 68Ser Ser
Asn Ile Gly Ser Asn Tyr1 5693PRTHomo sapiens 69Arg Asn
Asp17011PRTHomo sapiens 70Ser Ala Trp Asp Asp Ser Leu Gly Gly Glu
Val1 5 10718PRTHomo sapiens 71Gly Phe Thr Phe Ser Ser His Ala1
5728PRTHomo sapiens 72Ile Ser Gly Ser Gly Gly
Ser Thr1 57311PRTHomo sapiens 73Ala Lys Ile Gly Thr Ala Asp Ala Phe
Asp Ile1 5 10748PRTHomo sapiens 74Val Pro Asn Ile Gly Ser Asn Pro1
5753PRTHomo sapiens 75Asn Ser Asn17611PRTHomo sapiens 76Ala Ala Trp
Asp Asp Ser Leu Asp Gly Leu Val1 5 10778PRTHomo sapiens 77Gly Tyr
Thr Phe Thr Ser Tyr Tyr1 5788PRTHomo sapiens 78Ile Asn Pro Ser Gly
Gly Ser Thr1 57917PRTHomo sapiens 79Ala Arg Glu Lys Ser Ser Ser Trp
Tyr Gly Gly Asp Asn Trp Phe Asp1 5 10 15Pro809PRTHomo sapiens 80Ser
Ser Asp Val Gly Gly Tyr His Tyr1 5813PRTHomo sapiens 81Asp Val
Ser18210PRTHomo sapiens 82Ser Ser Tyr Thr Ser Ser Ser Thr Val Val1
5 10838PRTHomo sapiens 83Gly Tyr Thr Phe Thr Ser Tyr Gly1
5848PRTHomo sapiens 84Ile Ser Ala Tyr Asn Gly Asn Thr1 58523PRTHomo
sapiens 85Ala Arg Asp Val His Pro Leu Asp Ile Ala Val Ala Ala Asp
Asp Tyr1 5 10 15Tyr Tyr Tyr Gly Met Asp Val 20866PRTHomo sapiens
86Ser Leu Thr Thr Asn Tyr1 5873PRTHomo sapiens 87Gly Lys
Asn18811PRTHomo sapiens 88Asn Ser Arg Asp Ser Ser Gly Lys His Tyr
Val1 5 108915PRTHomo sapiens 89Ala Lys Asp Trp Gly Leu Val Gln Leu
Glu Ser Gly Tyr Asp Tyr1 5 10 15909PRTHomo sapiens 90Ser Ser Asn
Ile Gly Ala Gly Tyr Asp1 5913PRTHomo sapiens 91Asp Asn
Thr19211PRTHomo sapiens 92Ala Ala Trp Asp Glu Ser Leu Asn Gly Gln
Val1 5 10939PRTHomo sapiens 93Gly Gly Ser Ile Ser Ser Ser Asp Trp1
5947PRTHomo sapiens 94Ile Tyr His Ser Gly Ser Pro1 59515PRTHomo
sapiens 95Ala Arg Glu Arg Val Ala Pro Thr Val Asp Gly Ala Phe Asp
Val1 5 10 15966PRTHomo sapiens 96Gln Ser Ile Thr Thr Tyr1
5973PRTHomo sapiens 97Ala Ala Ser1989PRTHomo sapiens 98Gln Gln Ala
Ser Ser Phe Pro Leu Thr1 5998PRTHomo sapiens 99Gly Tyr Ser Phe Thr
Asn Tyr Trp1 51008PRTHomo sapiens 100Ile Tyr Pro Gly Asp Ser Asp
Thr1 510114PRTHomo sapiens 101Ala Arg Ile Lys Ser Tyr Tyr Asp Ser
Ser Gly Tyr Tyr Leu1 5 101026PRTHomo sapiens 102Asn Ile Gly Ser Lys
Ser1 51033PRTHomo sapiens 103Asp Asp Ser110410PRTHomo sapiens
104Gln Val Trp Asp Ser Ser Ser Glu Glu Val1 5 101058PRTHomo sapiens
105Ala Arg Arg Gly Phe Met Asp Val1 51066PRTHomo sapiens 106Ile Leu
Glu Ala Tyr Tyr1 51073PRTHomo sapiens 107Gly Glu Asn110811PRTHomo
sapiens 108Asn Ser Arg Asp Ser Ser Gly Ser His Val Val1 5
101098PRTHomo sapiens 109Gly Phe Thr Phe Asn Ser Phe Ala1
51108PRTHomo sapiens 110Ala Lys Gly His Ala Phe Asp Ile1
511111PRTHomo sapiens 111Gln Ser Leu Leu His Ser Asp Gly Lys Thr
Tyr1 5 101123PRTHomo sapiens 112Glu Val Ser11139PRTHomo sapiens
113Met Gln Ser Ile Gln Leu Pro Leu Thr1 511410PRTHomo sapiens
114Ala Lys Asp Lys Gly Gly Gly Phe Asp Pro1 5 101158PRTHomo sapiens
115Ser Gly Ser Ile Ala Ser Asn Tyr1 51163PRTHomo sapiens 116Glu Asp
Asn11179PRTHomo sapiens 117Gln Ser Tyr Asp Ser Thr Ser His Val1
51188PRTHomo sapiens 118Ile Tyr Pro Gly Asp Ser Asp Thr1
511917PRTHomo sapiens 119Ala Arg Pro Gly Tyr Tyr Tyr Gly Ser Gly
Ser Tyr Tyr Asn Val Asp1 5 10 15Tyr1206PRTHomo sapiens 120Glu Leu
Gly Asp Lys Phe1 51213PRTHomo sapiens 121Gln Asp Ser112210PRTHomo
sapiens 122Gln Val Trp Asp Ser Asn Gly Gly Pro Pro1 5 10
* * * * *