U.S. patent application number 17/372961 was filed with the patent office on 2022-03-10 for humanized anti-axl antibodies.
The applicant listed for this patent is BERGENBIO ASA. Invention is credited to PATRICIUS HENDRIKUS CORNELIS VAN BERKEL, DAVID G. WILLIAMS.
Application Number | 20220073625 17/372961 |
Document ID | / |
Family ID | |
Filed Date | 2022-03-10 |
United States Patent
Application |
20220073625 |
Kind Code |
A1 |
VAN BERKEL; PATRICIUS HENDRIKUS
CORNELIS ; et al. |
March 10, 2022 |
HUMANIZED ANTI-AXL ANTIBODIES
Abstract
The present disclosure relates to humanized anti-Axl
antibodies.
Inventors: |
VAN BERKEL; PATRICIUS HENDRIKUS
CORNELIS; (Lausanne, CH) ; WILLIAMS; DAVID G.;
(Epson, GB) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
BERGENBIO ASA |
Bergen |
|
NO |
|
|
Appl. No.: |
17/372961 |
Filed: |
July 12, 2021 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15566635 |
Oct 13, 2017 |
11059893 |
|
|
PCT/EP2016/058368 |
Apr 15, 2016 |
|
|
|
17372961 |
|
|
|
|
International
Class: |
C07K 16/28 20060101
C07K016/28 |
Foreign Application Data
Date |
Code |
Application Number |
Apr 15, 2015 |
GB |
1506411.6 |
Claims
1.-31. (canceled)
32. An isolated humanized antibody that binds to AXL, wherein the
isolated humanized antibody comprises: a heavy chain variable
region having the amino acid sequence of SEQ ID NO: 2 or SEQ ID NO:
3; and a light chain variable region having the amino acid sequence
of SEQ ID NO: 4, 5, 6, 7, or 8.
33. The isolated humanized antibody according to claim 32, wherein
the isolated humanized antibody comprises: (i) a heavy chain
variable region having the amino acid sequence of SEQ ID NO: 2 and
a light chain variable region having the amino acid sequence of SEQ
ID NO: 4; (ii) a heavy chain variable region having the amino acid
sequence of SEQ ID NO: 2 and a light chain variable region having
the amino acid sequence of SEQ ID NO: 5; (iii) a heavy chain
variable region having the amino acid sequence of SEQ ID NO: 2 and
a light chain variable region having the amino acid sequence of SEQ
ID NO: 6; (iv) a heavy chain variable region having the amino acid
sequence of SEQ ID NO: 2 and a light chain variable region having
the amino acid sequence of SEQ ID NO: 7; (v) a heavy chain variable
region having the amino acid sequence of SEQ ID NO: 2 and a light
chain variable region having the amino acid sequence of SEQ ID NO:
8; (vi) a heavy chain variable region having the amino acid
sequence of SEQ ID NO: 3 and a light chain variable region having
the amino acid sequence of SEQ ID NO: 4; (vii) a heavy chain
variable region having the amino acid sequence of SEQ ID NO: 3 and
a light chain variable region having the amino acid sequence of SEQ
ID NO: 5; (viii) a heavy chain variable region having the amino
acid sequence of SEQ ID NO: 3 and a light chain variable region
having the amino acid sequence of SEQ ID NO: 6; (viv) a heavy chain
variable region having the amino acid sequence of SEQ ID NO: 3 and
a light chain variable region having the amino acid sequence of SEQ
ID NO: 7; or (x) a heavy chain variable region having the amino
acid sequence of SEQ ID NO: 3 and a light chain variable region
having the amino acid sequence of SEQ ID NO: 8.
34. The humanized antibody according to claim 32, wherein said
antibody or antibody fragment has a constant region of isotype
IgG1, IgG2, IgG3 or IgG4, or a mutated IgG constant region.
35. The humanized antibody according to claim 32, wherein said
antibody or antibody fragment has a light chain constant region of
isotype kappa or lambda.
36. The humanized antibody according to claim 32, wherein the
humanized antibody fragment is a scFv, Fab or F(ab).sub.2.
37. A method of treating a proliferative disease in a subject,
comprising administering to the subject an antibody according to
claim 32.
38. A polynucleotide encoding a humanized antibody according to
claim 32.
39. A vector comprising the polynucleotide of claim 38.
40. The vector of claim 39 wherein the vector is an expression
vector.
41. A host cell comprising a vector according to claim 39.
42. The host cell according to claim 41 wherein the host cell is
prokaryotic, eukaryotic, or mammalian.
43. A method of making a humanized antibody that binds to AXL, the
method comprising culturing the host cell according to claim 41
under conditions for production of said antibody.
44. The method according to claim 43, further comprising isolating
said antibody.
45. The method according to claim 44, further comprising
formulating the antibody into a composition including at least one
additional component.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. patent
application Ser. No. 15/566,635, filed Oct. 13, 2017, which is a
national phase application under 35 U.S.C. .sctn. 371 of PCT
International Application No. PCT/EP2016/058368, filed Apr. 15,
2016, which claims priority to Great Britain Application No.
1506411.6, filed Apr. 15, 2015, which are hereby incorporated by
reference in its entirety.
INCORPORATION-BY-REFERENCE OF MATERIAL SUBMITTED ELECTRONICALLY
[0002] Incorporated by reference in its entirety herein is a
computer-readable nucleotide/amino acid sequence listing submitted
concurrently herewith and identified as follows: One 53,106 Byte
ASCII (Text) file named "35710-302-SQL_ST25.TXT," created on Nov.
24, 2021.
[0003] The present disclosure relates to humanized anti-Axl
antibodies.
BACKGROUND
[0004] Axl
[0005] Axl is a member of the TAM (Tyro3-Axl-Mer) receptor tyrosine
kinases (RTK) that share the vitamin K-dependent ligand Gas6
(growth arrest-specific 6). TAM family RTKs regulate a diverse
range of cellular responses including cell survival, proliferation,
autophagy, migration, angiogenesis, platelet aggregation, and
natural killer cell differentiation. Axl is expressed in many
embryonic tissues and is thought to be involved in mesenchymal and
neural development, with expression in adult tissues largely
restricted to smooth muscle cells (MGI Gene Expression Database;
www.informatics.jax.org). Axl activation is linked to several
signal transduction pathways, including Aid, MAP kinases,
NF-.kappa.B, STAT, and others. Originally identified as a
transforming gene from a patient with chronic myelogenous
leukaemia, Axl has since been associated with various high-grade
cancers and correlated with poor prognosis.
[0006] Axl receptor overexpression has been detected in a wide
range of solid tumours and myeloid leukaemia (Linger et al, Adv
Cancer Res. 100: 35, 2008; Linger et al, Expert Opin Ther Targets.
14:1073, 2010).
[0007] Axl expression correlates with malignant progression and is
an independent predictor of poor patient overall survival in
several malignancies including pancreatic (Song et al, Cancer.
117:734, 2011), prostate (Paccez et al, Oncogene. 32:698, 2013),
lung (Ishikawa et al. Ann Surg Oncol. 2012; Zhang et al, Nat Genet.
44:852, 2012), breast (Gjerdrum, Proc natl Acad Sci USA 107:1124,
2010), colon cancer (Yuen et al, PLoS One, 8:e54211, 2013) and
acute myeloid leukaemia (AML) (Ben-Batalla et al, Blood 122:2443,
2013).
[0008] Ax signal transduction is activated by a protein ligand
(Gas6) secreted by tumour associated macrophages (Loges et al,
Blood. 115:2264, 2010) or autocrine mechanisms (Gjerdrum, Proc natl
Acad Sci USA 107:1124, 2010), that drives receptor dimerization,
autophosphorylation and downstream signalling, such as via PI3
kinase (PI3K)-AKT, particularly AKT and mitogen-activated protein
kinase (MAPK) pathways (Korshunov, Clinical Science. 122:361,
2012). Heterodimerization with other tyrosine kinase receptors,
e.g. epidermal growth factor receptor (EGFR), is also reported to
occur (Linger et al, Expert Opin Ther Targets. 14:1073, 2010; Meyer
et al Science Signalling 6:ra66, 2013).
[0009] Aberrant activation of Axl in tumour cells is widely
associated with acquired drug resistance to targeted therapeutics
in vitro and in vivo (Zhang et al. Nat Genet. 44: 852, 2012; Byers
et al. Clin Cancer Res. 19: 279, 2013). Axl-targeting agents block
tumour formation, metastasis and reverse drug resistance (e.g. to
erlotinib) by reversing EMT/CSC characteristics in several
experimental cancer models, including triple negative breast
cancer, hormone resistant prostate cancer and adenocarcinoma of the
lung (Holland et al Cancer Res 70:1544, 2010; Gjerdrum, Proc natl
Acad Sci USA 107:1124, 2010; Zhang et al. Nat Genet. 44: 852, 2012;
Paccez et al, Oncogene. 32:698, 2013).
[0010] Anti-Axl Antibodies
[0011] Applications relating to Ax and anti-Axl antibodies include
EP2267454A2 [Diagnosis and prevention of cancer cell invasion
measuring . . . Axl--Max Planck]; WO2009063965 [anti Axl--Chugai
Pharmaceutical]; WO2011159980A1 [anti-Axl--Genentech],
WO2011014457A1 [combination treatments Axl and VEGF
antagonists--Genentech]; WO2012-175691A1 [Anti Axl
20G7-D9--INSERM], WO2012-175692A1 [Anti Axl 3E3E8--INSERM];
WO2009/062690A1 [anti Axl--U3 Pharma] and WO2010/130751A1
[humanised anti Axl--U3 Pharma].
[0012] GB1410826.0 discloses the murine anti-Axl antibody
designated herein as "mouse 1H12". In view of the advantageous
properties of this antibody and its potential clinical applications
in humans, it is desirable to identify humanised versions of the
murine antibody which have reduced immunogenicity to humans. The
present disclosure concerns such antibodies, along with
antibody-drug conjugates comprising the humanised 1H12 antibodies
and PBD drug-moieties.
SUMMARY
[0013] The present disclosure provides humanized anti-AXL
antibodies derived from the `mouse 1H12` antibody.
[0014] The present inventors have generated a number of humanised
heavy chain variable regions (SEQ ID NOs: 2 and 3) and humanised
light chain variable regions (SEQ ID NOs:5 to 8) with a view to
creating antibodies that have lower immunogenicity in a human
individual than the `mouse 1H12` antibody or `chimeric 1H12`
antibody whilst retaining antigen-binding potency. Surprisingly,
these humanised antibodies have also been found to have other
advantageous properties, such as increased charge at physiological
pH and improved affinity for some Axl ligands.
[0015] Accordingly, in one aspect the present disclosure comprises
an isolated humanized antibody that binds to AXL, wherein the
isolated humanized antibody comprises a heavy chain variable region
having the amino acid sequence of SEQ ID NO: 1, 2, or 3. In some
embodiments the antibody further comprises a light chain variable
region having the amino acid sequence of SEQ ID NO: 4, 5, 6, 7, or
8 and, optionally, further comprises a constant region derived from
one or more human antibodies.
[0016] In some embodiments the isolated humanized antibody that
binds to AXL comprises; a heavy chain variable region having the
amino acid sequence of SEQ ID NO: 2 or 3; a light chain variable
region having the amino acid sequence of SEQ ID NO: 5, 6, 7, or 8;
and, optionally, comprises a constant region derived from one or
more human antibodies.
[0017] In some embodiments, the humanized antibody does not
comprise a heavy chain variable region having the amino acid
sequence of SEQ ID NO: 1 and a light chain variable region having
the amino acid sequence of SEQ ID NO: 4.
[0018] In some embodiments the isolated humanized antibody that
binds to AXL comprises:
(i) a heavy chain variable region having the amino acid sequence of
SEQ ID NO: 1 and a light chain variable region having the amino
acid sequence of SEQ ID NO: 4; (ii) a heavy chain variable region
having the amino acid sequence of SEQ ID NO: 1 and a light chain
variable region having the amino acid sequence of SEQ ID NO: 5;
(iii) a heavy chain variable region having the amino acid sequence
of SEQ ID NO: 1 and a light chain variable region having the amino
acid sequence of SEQ ID NO: 6; (iv) a heavy chain variable region
having the amino acid sequence of SEQ ID NO: 1 and a light chain
variable region having the amino acid sequence of SEQ ID NO: 7; (v)
a heavy chain variable region having the amino acid sequence of SEQ
ID NO: 1 and a light chain variable region having the amino acid
sequence of SEQ ID NO: 8; (vi) a heavy chain variable region having
the amino acid sequence of SEQ ID NO: 2 and a light chain variable
region having the amino acid sequence of SEQ ID NO: 4; (vii) a
heavy chain variable region having the amino acid sequence of SEQ
ID NO: 2 and a light chain variable region having the amino acid
sequence of SEQ ID NO: 5; (viii) a heavy chain variable region
having the amino acid sequence of SEQ ID NO: 2 and a light chain
variable region having the amino acid sequence of SEQ ID NO: 6;
(ix) a heavy chain variable region having the amino acid sequence
of SEQ ID NO: 2 and a light chain variable region having the amino
acid sequence of SEQ ID NO: 7; (x) a heavy chain variable region
having the amino acid sequence of SEQ ID NO: 2 and a light chain
variable region having the amino acid sequence of SEQ ID NO: 8;
(xi) a heavy chain variable region having the amino acid sequence
of SEQ ID NO: 3 and a light chain variable region having the amino
acid sequence of SEQ ID NO: 4; (xii) a heavy chain variable region
having the amino acid sequence of SEQ ID NO: 3 and a light chain
variable region having the amino acid sequence of SEQ ID NO: 5;
(xiii) a heavy chain variable region having the amino acid sequence
of SEQ ID NO: 3 and a light chain variable region having the amino
acid sequence of SEQ ID NO: 6; (xiv) a heavy chain variable region
having the amino acid sequence of SEQ ID NO: 3 and a light chain
variable region having the amino acid sequence of SEQ ID NO: 7; or
(xv) a heavy chain variable region having the amino acid sequence
of SEQ ID NO: 3 and a light chain variable region having the amino
acid sequence of SEQ ID NO: 8.
[0019] In some embodiments AXL is human AXL.
[0020] The sequences of the antibody heavy chain variable regions
and/or the light chain variable regions disclosed herein may be
modified by, for example, insertions, substitutions and/or
deletions to the extent that the humanized antibody maintains the
ability to bind to AXL. The skilled person can ascertain the
maintenance of this activity by performing the functional assays
described herein, or known in the art.
[0021] Accordingly, in some embodiments the heavy chain variable
region comprises no more than 20 insertions, substitutions and/or
deletions, such as no more than 15, no more than 10, no more than
9, no more than 8, no more than 7, no more than 6, no more than 5,
no more than 4, no more than 3, no more than 2, or no more than 1
insertion, substitution and/or deletion. In some embodiments the
light chain variable region comprises no more than 20 insertions,
substitutions and/or deletions, such as no more than 15, no more
than 10, no more than 9, no more than 8, no more than 7, no more
than 6, no more than 5, no more than 4, no more than 3, no more
than 2, or no more than 1 insertion, substitution and/or
deletion.
[0022] In some embodiments the humanized antibodies of the
disclosure include antibodies comprising V.sub.H and V.sub.L
domains with amino acid sequences that are identical to the
sequences described herein.
DETAILED DISCLOSURE
[0023] Antibody Properties
[0024] Antigen Binding
[0025] The antibody of the conjugates described herein is an
antibody (Ab) which binds AXL. That is, the conjugates described
herein are conjugates comprising antibodies which specifically bind
to AXL.
[0026] As used herein, AXL refers to the Axl member of the TAM
family of receptor tyrosine kinases. `Human Axl` refers to the Axl
member of the human TAM family of receptor tyrosine kinases. In
some embodiments, the human Axl polypeptide corresponds to Genbank
accession no. AAH32229, version no. AAH32229.1 G1:21619004, record
update date: Mar. 6, 2012 01:18 PM (SEQ ID NO.9). In one
embodiment, the nucleic acid encoding the human Axl polypeptide
corresponds to Genbank accession no. M76125, version no. M76125.1
G1:292869, record update date: Jun. 23, 2010 08:53 AM. `Murine Axl`
refers to the Axl member of the murine TAM family of receptor
tyrosine kinases. In some embodiments, the murine Axl polypeptide
corresponds to Genbank accession no. AAH46618, version no.
AAH46618.1 G1:55777082, record update date: Mar. 6, 2012 01:36 PM
(SEQ ID NO.10). In one embodiment, the nucleic acid encoding the
murine Axl polypeptide corresponds to Genbank accession no.
NM_009465, version no. NM_009465.4 GI:300794836, record update
date: Mar. 12, 2014 03:52 PM.
[0027] Antibody Affinity
[0028] In some embodiments the humanized antibody binds human AXL
with a dissociation constant (K.sub.D) of at least 10.sup.-6 M,
such as at least 5.times.10.sup.-7 M, at least 10.sup.-7 M, at
least 5.times.10.sup.-8 M, at least 10.sup.-9 M, such as at least
5.times.10.sup.-10 M, at least 10.sup.-10 M, at least
5.times.10.sup.-11 M, at least 10.sup.-11 M, at least
5.times.10.sup.-12 M, at least 10.sup.-12 M, at least
5.times.10.sup.-13 M, at least 10.sup.-13 M, at least
5.times.10.sup.-14 M, at least 10.sup.-14 M, at least
5.times.10.sup.-15 M, or at least 10.sup.-15 M.
[0029] In one embodiment the humanized antibody competitively
inhibits the in vivo and/or in vitro binding to human AXL of an
antibody comprising a heavy chain variable region having the amino
acid sequence of SEQ ID NO: 1 and a light chain variable region
having the amino acid sequence of SEQ ID NO: 4. In one embodiment
the humanized antibody competitively inhibits the in vivo and/or in
vitro binding to human-AXL of the `mouse 1H12` antibody. In some
embodiments an equimolar dose of the humanised antibody
competitively inhibits at least 20% of the binding by the `mouse
1H12` antibody, such as at least 30%, at least 40%, at least 50%,
at least 60%, at least 70%, at least 80%, or at least 90% of the
binding. Percentage binding may be measured by, for example, a
competitive ELISA assay where % inhibition of binding is calculated
as [(1-absorbance of test sample)/(absorbance of negative
control)].
[0030] In some embodiments the humanized antibody has a higher
affinity for an Axl antigen (for example the Axl-Strep-His antigen
described in Protocol 4) than an antibody comprising a VH domain
having the sequence according to SEQ ID NO. 1, a VL domain having
the sequence according to SEQ ID NO. 4, and a constant region
derived from one or more human antibodies (for example, Abi
described herein). In some embodiments the KD of the humanized
antibody with the Axl antigen (for example the Axl-Strep-His
antigen described in Protocol 4) will be no more than 0.9 of the KD
of the antibody comprising a VH domain having the sequence
according to SEQ ID NO. 1, a VL domain having the sequence
according to SEQ ID NO. 4, and a constant region derived from one
or more human antibodies, for example no more than 0.8, 0.7, 0.6,
0.5, 0.4, 0.3, 0.2, 0.1, 0.05, 0.01, or 0.001 of the KD of the
antibody comprising a VH domain having the sequence according to
SEQ ID NO. 1, a VL domain having the sequence according to SEQ ID
NO. 4, and a constant region derived from one or more human
antibodies.
[0031] In some embodiments the humanized antibody has a higher
affinity for an Axl antigen (for example the Axl-Fc antigen
described in Protocol 4) than an antibody comprising a VH domain
having the sequence according to SEQ ID NO. 1, a VL domain having
the sequence according to SEQ ID NO. 4, and a constant region
derived from one or more human antibodies (for example, Abi
described herein). In some embodiments the KD of the humanized
antibody with the Axl antigen (for example the Axl-Fc antigen
described in Protocol 4) will be no more than 0.9 of the KD of the
antibody comprising a VH domain having the sequence according to
SEQ ID NO. 1, a VL domain having the sequence according to SEQ ID
NO. 4, and a constant region derived from one or more human
antibodies, for example no more than 0.8, 0.7, 0.6, 0.5, 0.4, 0.3,
0.2, 0.1, 0.05, 0.01, or 0.001 of the KD of the antibody comprising
a VH domain having the sequence according to SEQ ID NO. 1, a VL
domain having the sequence according to SEQ ID NO. 4, and a
constant region derived from one or more human antibodies.
[0032] Antibody Isoelectric Point (pI)
[0033] A molecule carries no net charge when the pH of its
surrounding equal the molecules pI. The net charge of a molecule
affects the solubility of the molecule, with biological molecules
such as proteins typically having minimum solubility in water or
salt solutions at the pH that corresponds to their pI. Thus,
proteins whose pI is 7.35-7.45 are at their minimum solubility in
human blood, whose pH is typically in the range 7.35-7.45.
[0034] In some embodiments the humanized antibody of the disclosure
has a pI greater than an antibody comprising a heavy chain variable
region having the amino acid sequence of SEQ ID NO: 1 and a light
chain variable region having the amino acid sequence of SEQ ID NO:
4. In some embodiments the humanized antibody of the disclosure has
a pI greater than the mouse 1H12 antibody. In some embodiments the
humanized antibody of the disclosure has a pI of at least 8.00,
such as at least 8.05, at least 8.10, at least 8.15, at least 8.20,
at least 8.30, at least 8.40, at least 8.50, at least 9, at least
9.5, at least 10, at least 10.5, or at least 11.
[0035] In some embodiments the humanized antibody of the disclosure
has a pI less than an antibody comprising a heavy chain variable
region having the amino acid sequence of SEQ ID NO: 1 and a light
chain variable region having the amino acid sequence of SEQ ID NO:
4. In some embodiments the humanized antibody of the disclosure has
a pI less than the mouse 1H12 antibody. In some embodiments the
humanized antibody of the disclosure has a pI of no more than 7.0,
such as no more than 6.5, no more than 6.0, no more than 5.5, no
more than 5.0, no more than 4.5, or no more than 4.0.
[0036] Antibody Immunogenicity
[0037] Preferably the humanized antibody of the disclosure has
reduced immunogenicity in a human subject as compared to a
non-humanized antibody of the same specificity (for example, a
mouse antibody precursor prior to humanization. In one embodiment
the humanized antibody has immunogenicity in a human subject lower
than an otherwise identical antibody or antibody fragment
comprising a heavy chain variable region having the amino acid
sequence of SEQ ID NO: 1 and a light chain variable region having
the amino acid sequence of SEQ ID NO: 4. In one embodiment the
humanized antibody has immunogenicity in a human subject lower than
the `mouse 1H12` antibody.
[0038] Low or reduced immunogenicity can be characterized by the
ability to treat patients for extended periods with measurable
alleviation of symptoms and low and/or acceptable toxicity. Low or
acceptable immunogenicity and/or high affinity, as well as other
suitable properties, can contribute to the therapeutic results
achieved. "Reduced immunogenicity" is defined herein as raising
significant HAHA, HACA or HAMA responses in less 90%, such as less
than 80%, less than 70%, less than 60%, less than 50%, less than
40%, less than 30%, less than 20%, less than 10% of the proportion
of patients who show a significant HAHA, HACA or HAMA response when
treated with the mouse 1H12 antibody.
[0039] The disclosure also provided the means produce the
antibodies of the disclosure.
[0040] Accordingly, in another aspect the disclosure provides
nucleic acid molecules encoding the humanised antibodies, along
with nucleic acid molecules complementary to nucleic acid molecules
encoding the humanised antibodies.
[0041] In another aspect, the disclosure provides a pharmaceutical
composition comprising an antibody pf the disclosure, optionally
further comprising a pharmaceutically acceptable carrier or
excipient.
[0042] In another aspect the disclosure provides a vector, such as
an expression vector, comprising a nucleic acid of the
disclosure.
[0043] In another aspect, the disclosure provides host cells
transfected with a vector of the disclosure. The host cells may be
prokaryotic or eukaryotic. For example, the cells may be bacterial,
fungal, insect, or mammalian (such as mouse, primate or human).
[0044] In another aspect the disclosure provides a method of making
the antibodies by culturing the host cells of the disclosure.
[0045] The disclosure provides methods relating to the
identification of subjects particularly suitable for treatment with
the antibodies or pharmaceutical composition of the disclosure.
Also provided are methods for determining the optimum timing and
dosage of administration of the antibodies of the disclosure to a
subject. In some embodiments the subject has a proliferative
disease, such as cancer. In some embodiments the subject has an
autoimmune disease. Preferably, administration of the treatment
inhibits or reduces one or more aspects of the disease, for example
reduces tumour volume, or reduces the level of one or more
biomarkers of tumour progression, such as AXL, Akt3, or GAS6. In
some embodiments the level of the biomarker is reduced to no more
than 90% of the level immediately before treatment, such as no more
than 80%, no more than 70%, no more than 60%, no more than 50%, no
more than 40%, no more than 30%, no more than 20%, no more than
10%, or no more than 5% of the level immediately before
treatment.
[0046] In one aspect the disclosure provides a method of selecting
a subject for treatment with the antibody or pharmaceutical
composition of the disclosure, the method comprising assessing the
level of one or more biomarkers associated with disease pathology,
wherein subjects having the one or more biomarker, or subjects
having a level of the one or more biomarkers which exceeds a
threshold level, are selected for treatment. In some embodiments
the biomarker is AXL, Akt3, or GAS8. In some embodiments the
threshold is at least 10% higher than the upper boundary of the
normal clinical range, such as at least 20% higher, at least 30%
higher, at least 40% higher, at least 50% higher, at least 100%
higher, or at least 200% higher.
[0047] In another aspect the disclosure provides a method of timing
the administration of treatment of a subject with the antibody or
pharmaceutical composition of the disclosure, the method comprising
assessing the level of one or more biomarkers associated with
disease pathology, wherein the treatment is administered when the
subject has the one or more biomarker, or the subject has a level
of one or more biomarkers which exceeds a threshold level. In some
embodiments the biomarker is AXL, Akt3, or GAS6. In some
embodiments the threshold is at least 10% higher than the upper
boundary of the normal clinical range, such as at least 20% higher,
at least 30% higher, at least 40% higher, at least 50% higher, at
least 100% higher, or at least 200% higher.
[0048] In another aspect the disclosure provides a method of
determining the optimum dosage of the antibody or pharmaceutical
composition of the disclosure for administration to a subject, the
method comprising assessing the level of one or more biomarkers
associated with disease pathology, wherein subjects having the one
or more biomarker, or subjects having a level of the one or more
biomarkers which exceeds the threshold level, are selected for a
particular dosage level. In some embodiments the biomarker is AXL,
Akt3, or GAS6. In some embodiments the threshold is at least 10%
higher than the upper boundary of the normal clinical range, such
as at least 20% higher, at least 30% higher, at least 40% higher,
at least 50% higher, at least 100% higher, or at least 200%
higher.
[0049] In some embodiments the level of one or more biomarkers is
assessed in a sample of blood, urine, other body fluid, or tissue.
Level of one or more biomarkers samples can be assessed by
immunoassay, proteomic assay, nucleic acid hybridization or
amplification assays, immunohistochemistry, or in situ
hybridization assays.
Definitions
[0050] Antibody
[0051] The term "antibody" as used encompasses any molecule
comprising an antibody antigen-binding site (as, for example,
formed by a paired VH domain and a VL domain). Thus, for example,
the term "antibody" encompasses monoclonal antibodies (including
intact monoclonal antibodies), polyclonal antibodies, multispecific
antibodies formed from at least two different epitope binding
fragments (e.g., bispecific antibodies), human antibodies,
humanized antibodies, camelised antibodies, chimeric antibodies,
single-chain antibodies (such as scFv fusions with CH3), antibody
fragments that exhibit the desired biological activity (e.g. the
antigen binding portion; for example minibodies), and
anti-idiotypic (anti-Id) antibodies, intrabodies, and
epitope-binding fragments of any of the above, so long as they
exhibit the desired biological activity, for example, the ability
to bind the cognate antigen. Antibodies may be murine, human,
humanized, chimeric, or derived from other species. In one
embodiment the antibody is a single-chain Fv antibody fused to a
CH3 domain (scFv-CH3). In one embodiment the antibody is a
single-chain Fv antibody fused to a Fc region (scFv-Fc). In one
embodiment the antibody is a minibody.
[0052] An antibody is a protein generated by the immune system that
is capable of recognizing and binding to a specific antigen.
(Janeway, C., Travers, P., Walport, M., Shlomchik (2001) Immuno
Biology, 5th Ed., Garland Publishing, New York). A target antigen
generally has numerous binding sites, also called epitopes,
recognized by CDRs on multiple antibodies. Each antibody that
specifically binds to a different epitope has a different
structure. Thus, one antigen may have more than one corresponding
antibody. An antibody includes an intact immunoglobulin molecule or
an immunologically active portion of a intact immunoglobulin
molecule, i.e., a molecule that contains an antigen binding site
that immunospecifically binds an antigen of a target of interest or
part thereof, such targets including but not limited to, cancer
cell or cells that produce autoimmune antibodies associated with an
autoimmune disease.
[0053] In particular, antibodies include immunoglobulin molecules
and immunologically active fragments of immunoglobulin molecules,
i.e., molecules that contain at least one antigen binding site. The
antibody can be of any isotype (e.g. IgG, IgE, IgM, IgD, and IgA),
class (e.g. IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2) or subclass, or
allotype (e.g. human G1m1, G1m2, G1m3, non-G1m1 [that, is any
allotype other than G1m1], G1m17, G2m23, G3m21, G3m28, G3m11, G3m5,
G3m13, G3m14, G3m10, G3m15, G3m16, G3m6, G3m24, G3m26, G3m27, A2m1,
A2m2, Km1, Km2 and Km3) of antibody molecule. The immunoglobulins
can be derived from any species, including human, murine, or rabbit
origin.
[0054] An "intact antibody" herein is one comprising VL and VH
domains, as well as a light chain constant domain (CL) and heavy
chain constant domains, CH1, CH2 and CH3. The constant domains may
be native sequence constant domains (e.g. human native sequence
constant domains) or amino acid sequence variant thereof. The
intact antibody may have one or more "effector functions" which
refer to those biological activities attributable to the Fc region
(a native sequence Fc region or amino acid sequence variant Fc
region) of an antibody. Examples of antibody effector functions
include C1q binding; complement dependent cytotoxicity; Fc receptor
binding; antibody-dependent cell-mediated cytotoxicity (ADCC);
phagocytosis; and down regulation of cell surface receptors such as
B cell receptor and BCR.
[0055] In preferred embodiments the antibody is an intact IgG
antibody. That is an antibody comprising two light chains, each
having a variable and constant domain, and two heavy chains, each
having one variable domain and three constant domains.
[0056] Humanized
[0057] As used herein "humanized" antibodies include any
combination of the herein described Anti-AXL antibodies. In these
antibodies the mouse framework residues from the murine 1H12
antibody have been largely replaced with the corresponding residues
from human immunoglobulins. As many of the human amino acid
residues as possible are retained, but critical human residues may
be modified as necessary to support the antigen binding site formed
by the CDRs and recapitulate the antigen binding potency of the
original mouse antibody. Such changes or variations optionally and
preferably retain or reduce the immunogenicity in humans or other
primate species relative to non-modified antibodies.
[0058] It is pointed out that a humanized antibody can be produced
by a non-human animal or prokaryotic or eukaryotic cell that is
capable of expressing functionally rearranged human immunoglobulin
(e.g., heavy chain and/or light chain) genes. Further, when the
antibody is a single chain antibody, it can comprise a linker
peptide that is not found in native human antibodies. For example,
an Fv can comprise a linker peptide, such as two to about eight
glycine or other amino acid residues, which connects the variable
region of the heavy chain and the variable region of the light
chain. Such linker peptides are considered to be of human
origin.
[0059] For example, in some embodiments the humanised antibody of
the disclosure are produced by a method comprising he step of
grafting the CDRs of the mouse 1H12 antibody into human FW regions
such as AB021508, AB063892, AF233253, and AJ399878. In some
embodiments the method of producing the humanised antibodies of the
invention further comprises the step of back-mutating mismatches at
vernier and 5 .ANG. CDR envelope residues. In other embodiments the
method of producing the humanised antibodies of the invention
further comprises the step of back-mutating mismatched vernier
residues only.
[0060] The human constant region of the humanized antibody can be
of any class (IgG, IgA, IgM, IgE, IgD, etc.) or isotype and can
comprise a kappa or lambda light chain. In one embodiment, the
human constant region comprises an IgG heavy chain or defined
fragment, for example, at least one of isotypes, IgG1, IgG2, IgG3
or IgG4. In another embodiment, the humanized antibody comprises an
IgG1 heavy chain and a IgG1 K light chain. The isolated humanized
antibodies described herein comprise antibody amino acid sequences
disclosed herein encoded by any suitable polynucleotide.
[0061] Sequence Modifications
[0062] The sequences of the antibody heavy chain variable regions
and/or the light chain variable regions disclosed herein may be
modified by substitution, insertion or deletion. Amino acid
sequences that are substantially the same as the sequences
described herein include sequences comprising conservative amino
acid substitutions, as well as amino acid deletions and/or
insertions. A conservative amino acid substitution refers to the
replacement of a first amino acid by a second amino acid that has
chemical and/or physical properties (e.g., charge, structure,
polarity, hydrophobicity/hydrophilicity) that are similar to those
of the first amino acid. Preferred conservative substitutions are
those wherein one amino acid is substituted for another within the
groups of amino acids indicated herein below: [0063] Amino acids
having polar side chains (Asp, Glu, Lys, Arg, His, Asn, Gin, Ser,
Thr, Tyr, and Cys) [0064] Amino acids having non-polar side chains
(Gly, Ala, Val, Leu, lie, Phe, Trp, Pro, and Met) [0065] Amino
acids having aliphatic side chains (Gly, Ala Val, Leu, Ile) [0066]
Amino acids having cyclic side chains (Phe, Tyr, Trp, His, Pro)
[0067] Amino acids having aromatic side chains (Phe, Tyr, Trp)
[0068] Amino acids having acidic side chains (Asp, Glu) [0069]
Amino acids having basic side chains (Lys, Arg, His) [0070] Amino
acids having amide side chains (Asn, Gin) [0071] Amino acids having
hydroxy side chains (Ser, Thr) [0072] Amino acids having
sulphur-containing side chains (Cys, Met), [0073] Neutral, weakly
hydrophobic amino acids (Pro, Ala, Gly, Ser, Thr) [0074]
Hydrophilic, acidic amino acids (Gin, Asn, Glu, Asp), and [0075]
Hydrophobic amino acids (Leu, Ile, Val)
[0076] Particular preferred conservative amino acids substitution
groups are: Val-Leu-Ile, Phe-Tyr, Lys-Arg, Ala-Val, and
Asn-Gin.
[0077] In some embodiments, the antibody of the conjugates
described herein comprises a heavy chain having an amino acid
sequence with 80% or more amino acid sequence identity (for
example, about 85% or more, 86% or more, 87% or more, 88% or more,
89% or more, 90% or more, 91% or more, 92% or more, 93% or more,
94% or more, 95% or more, 96% or more, 97% or more, 98% or more,
99% or more sequence identity) to a heavy chain described herein.
In some embodiments, the antibody of the conjugates described
herein comprises a light chain having an amino acid sequence with
80% or more amino acid sequence identity (for example, about 85% or
more, 86% or more, 87% or more, 88% or more, 89% or more, 90% or
more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or
more, 96% or more, 97% or more, 98% or more, 99% or more sequence
identity) to a light chain described herein.
[0078] In some embodiments, the antibody of the conjugates
described herein comprises a heavy chain having an amino acid
sequence identical to the amino acid sequence of a heavy chain
described herein, except that it includes 1, 2, 3, 4, 5, 6, 7, 8, 9
or 10 amino acid modifications (e.g., substitutions, insertions
and/or deletions) relative to the amino acid sequence of the heavy
chain described herein. In some embodiments, the antibody of the
conjugates described herein comprises a light chain having an amino
acid sequence identical to the amino acid sequence of a light chain
described herein, except that it includes 1, 2, 3, 4, 5, 6, 7, 8, 9
or 10 amino acid modifications (e.g., substitutions, insertions
and/or deletions) relative to the amino acid sequence of the light
chain described herein.
[0079] Antibody Production
[0080] Humanized antibodies, fragments and regions can be produced
by cloning DNA segments encoding the H and L chain antigen-binding
regions of the anti-AXL antibody, and joining these DNA segments to
DNA segments including CH and CL regions, respectively, to produce
full length immunoglobulin-encoding genes.
[0081] For full-length antibody molecules, the immunoglobulin cDNAs
can be obtained from mRNA of hybridoma cell lines. Antibody heavy
and light chains are cloned in a mammalian expression vector
system. Assembly is documented with DNA sequence analysis. The
antibody construct can be expressed in human or other mammalian
host cell lines. The construct can be validated by transient
transfection assays and immunoassay of the expressed antibody.
Stable cell lines with the highest productivity can be isolated and
screened using rapid assay methods.
[0082] Biological Activity
[0083] In Vitro Cell Proliferation Assays
[0084] Generally, the cytotoxic or cytostatic activity of an
antibody is measured by: exposing mammalian cells having receptor
proteins to the antibody in a cell culture medium; culturing the
cells for a period from about 6 hours to about 5 to 7 days; and
measuring cell viability. Cell-based in vitro assays are used to
measure viability (proliferation), cytotoxicity, and induction of
apoptosis (caspase activation) of an antibody of the
disclosure.
[0085] The in vitro potency of antibodies can be measured by a cell
proliferation assay. The CellTiter-Glo.RTM. Luminescent Cell
Viability Assay is a commercially available (Promega Corp.,
Madison, Wis.), homogeneous assay method based on the recombinant
expression of Coleoptera luciferase (U.S. Pat. Nos. 5,583,024;
5,674,713 and 5,700,670). This cell proliferation assay determines
the number of viable cells in culture based on quantitation of the
ATP present, an indicator of metabolically active cells (Crouch et
al (1993) J. Immunol. Meth. 160:81-88; U.S. Pat. No. 6,602,677).
The CellTiter-Glo.RTM. Assay is conducted in 96 well format, making
it amenable to automated high-throughput screening (HTS) (Cree et
al (1995) AntiCancer Drugs 6:398-404). The homogeneous assay
procedure involves adding the single reagent (CellTiter-Glo.RTM.
Reagent) directly to cells cultured in serum-supplemented medium.
Cell washing, removal of medium and multiple pipetting steps are
not required. The system detects as few as 15 cells/well in a
384-well format in 10 minutes after adding reagent and mixing. The
cells may be treated continuously with antibody, or they may be
treated and separated from antibody. Generally, cells treated
briefly, i.e. 3 hours, showed the same potency effects as
continuously treated cells.
[0086] The homogeneous "add-mix-measure" format results in cell
lysis and generation of a luminescent signal proportional to the
amount of ATP present. The amount of ATP is directly proportional
to the number of cells present in culture. The CellTiter-Glo.RTM.
Assay generates a "glow-type" luminescent signal, produced by the
luciferase reaction, which has a half-life generally greater than
five hours, depending on cell type and medium used. Viable cells
are reflected in relative luminescence units (RLU). The substrate,
Beetle Luciferin, is oxidatively decarboxylated by recombinant
firefly luciferase with concomitant conversion of ATP to AMP and
generation of photons.
[0087] The in vitro potency of antibody-drug conjugates can also be
measured by a cytotoxicity assay. Cultured adherent cells are
washed with PBS, detached with trypsin, diluted in complete medium,
containing 10% FCS, centrifuged, re-suspended in fresh medium and
counted with a haemocytometer. Suspension cultures are counted
directly. Monodisperse cell suspensions suitable for counting may
require agitation of the suspension by repeated aspiration to break
up cell clumps.
[0088] The cell suspension is diluted to the desired seeding
density and dispensed (100 .mu.l per well) into black 96 well
plates. Plates of adherent cell lines are incubated overnight to
allow adherence. Suspension cell cultures can be used on the day of
seeding.
[0089] A stock solution (1 ml) of antibody (20 .mu.g/ml) is made in
the appropriate cell culture medium.
[0090] Serial 10-fold dilutions of stock antibody are made in 15 ml
centrifuge tubes by serially transferring 100 .mu.l to 900 .mu.l of
cell culture medium.
[0091] Four replicate wells of each antibody dilution (100 .mu.l)
are dispensed in 96-well black plates, previously plated with cell
suspension (100 .mu.l), resulting in a final volume of 200 .mu.l.
Control wells receive cell culture medium (100 .mu.l).
[0092] If the doubling time of the cell line is greater than 30
hours, antibody incubation is for 5 days, otherwise a four day
incubation is done.
[0093] At the end of the incubation period, cell viability is
assessed with the Alamar blue assay.
[0094] AlamarBlue (Invitrogen) is dispensed over the whole plate
(20 .mu.l per well) and incubated for 4 hours. Alamar blue
fluorescence is measured at excitation 570 nm, emission 585 nm on
the Varioskan flash plate reader. Percentage cell survival is
calculated from the mean fluorescence in the antibody treated wells
compared to the mean fluorescence in the control wells.
[0095] Use
[0096] The antibody of the disclosure may be used to target a
target location.
[0097] The target location is preferably a proliferative cell
population. The antibody is an antibody for an antigen present on a
proliferative cell population.
[0098] In one embodiment the antigen is absent or present at a
reduced level in a non-proliferative cell population compared to
the amount of antigen present in the proliferative cell population,
for example a tumour cell population.
[0099] The target location may be in vitro, in vivo or ex vivo.
[0100] The antibodies of the disclosure include those with utility
for anticancer activity. Thus, in one aspect, the present
disclosure provides an antibody as described herein for use in
therapy.
[0101] In a further aspect there is also provides an antibody as
described herein for use in the treatment of a proliferative
disease. A second aspect of the present disclosure provides the use
of an antibody in the manufacture of a medicament for treating a
proliferative disease.
[0102] One of ordinary skill in the art is readily able to
determine whether or not a candidate conjugate treats a
proliferative condition for any particular cell type. For example,
assays which may conveniently be used to assess the activity
offered by a particular compound are described in the examples
below.
[0103] The term "proliferative disease" pertains to an unwanted or
uncontrolled cellular proliferation of excessive or abnormal cells
which is undesired, such as, neoplastic or hyperplastic growth,
whether in vitro or in vivo.
[0104] Examples of proliferative conditions include, but are not
limited to, benign, pre-malignant, and malignant cellular
proliferation, including but not limited to, neoplasms and tumours
(e.g. histocytoma, glioma, astrocyoma, osteoma), cancers (e.g. lung
cancer, small cell lung cancer, gastrointestinal cancer, bowel
cancer, colon cancer, breast carinoma, ovarian carcinoma, prostate
cancer, testicular cancer, liver cancer, kidney cancer, bladder
cancer, pancreas cancer, brain cancer, sarcoma, osteosarcoma,
Kaposi's sarcoma, melanoma), lymphomas, leukemias, psoriasis, bone
diseases, fibroproliferative disorders (e.g. of connective
tissues), and atherosclerosis. Cancers of particular interest
include, but are not limited to, metastatic cancer cells, such as
circulating tumour cells, which may be found circulating in body
fluids such as blood or lymph, lymphomas (e.g., non-Hodgkin's
lymphoma, NHL), leukemia (particularly acute myeloid leukemia, AML)
and ovarian cancers.
[0105] Any type of cell may be treated, including but not limited
to, lung, gastrointestinal (including, e.g. bowel, colon), breast
(mammary), ovarian, prostate, liver (hepatic), kidney (renal),
bladder, pancreas, brain, and skin.
[0106] It is contemplated that the antibody of the present
disclosure may be used to treat various diseases or disorders, e.g.
characterized by the overexpression of a tumour antigen. Exemplary
conditions or hyperproliferative disorders include benign or
malignant tumours; leukemias, haematological, and lymphoid
malignancies. Others include neuronal, glial, astrocytal,
hypothalamic, glandular, macrophagal, epithelial, stromal,
blastocoelic, inflammatory, angiogenic and immunologic, including
autoimmune, disorders.
[0107] Generally, the disease or disorder to be treated is a
hyperproliferative disease such as cancer. Examples of cancer to be
treated herein include, but are not limited to, carcinoma,
lymphoma, blastoma, sarcoma, and leukemias or lymphoid
malignancies. More particular examples of such cancers include
squamous cell cancer (e.g. epithelial squamous cell cancer), lung
cancer including small-cell lung cancer, non-small cell lung
cancer, adenocarcinoma of the lung and squamous carcinoma of the
lung, cancer of the peritoneum, hepatocellular cancer, gastric or
stomach cancer including gastrointestinal cancer, pancreatic
cancer, glioblastoma, cervical cancer, ovarian cancer, liver
cancer, bladder cancer, hepatoma, breast cancer, colon cancer,
rectal cancer, colorectal cancer, endometrial or uterine carcinoma,
salivary gland carcinoma, kidney or renal cancer, prostate cancer,
vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma,
penile carcinoma, as well as head and neck cancer.
[0108] Autoimmune diseases for which the antibody may be used in
treatment include rheumatologic disorders (such as, for example,
rheumatoid arthritis, Sjogren's syndrome, scleroderma, lupus such
as SLE and lupus nephritis, polymyositis/dermatomyositis,
cryoglobulinemia, anti-phospholipid antibody syndrome, and
psoriatic arthritis), osteoarthritis, autoimmune gastrointestinal
and liver disorders (such as, for example, inflammatory bowel
diseases (e.g. ulcerative colitis and Crohn's disease), autoimmune
gastritis and pernicious anemia, autoimmune hepatitis, primary
biliary cirrhosis, primary sclerosing cholangitis, and celiac
disease), vasculitis (such as, for example, ANCA-associated
vasculitis, including Churg-Strauss vasculitis, Wegener's
granulomatosis, and polyarteriitis), autoimmune neurological
disorders (such as, for example, multiple sclerosis, opsocionus
myocionus syndrome, myasthenia gravis, neuromyelitis optica,
Parkinson's disease, Alzheimer's disease, and autoimmune
polyneuropathies), renal disorders (such as, for example,
glomerulonephritis, Goodpasture's syndrome, and Berger's disease),
autoimmune dermatologic disorders (such as, for example, psoriasis,
urticaria, hives, pemphigus vulgaris, bullous pemphigoid, and
cutaneous lupus erythematosus), hematologic disorders (such as, for
example, thrombocytopenic purpura, thrombotic thrombocytopenic
purpura, post-transfusion purpura, and autoimmune hemolytic
anemia), atherosclerosis, uveitis, autoimmune hearing diseases
(such as, for example, inner ear disease and hearing loss),
Behcet's disease, Raynaud's syndrome, organ transplant, and
autoimmune endocrine disorders (such as, for example,
diabetic-related autoimmune diseases such as insulin-dependent
diabetes mellitus (IDDM), Addison's disease, and autoimmune thyroid
disease (e.g. Graves' disease and thyroiditis)). More preferred
such diseases include, for example, rheumatoid arthritis,
ulcerative colitis, ANCA-associated vasculitis, lupus, multiple
sclerosis, Sjogren's syndrome, Graves' disease, IDDM, pernicious
anemia, thyroiditis, and glomerulonephritis.
[0109] Methods of Treatment
[0110] The antibody of the present disclosure may be used in a
method of therapy. Also provided is a method of treatment,
comprising administering to a subject in need of treatment a
therapeutically-effective amount of an antibody of the disclosure.
The term "therapeutically effective amount" is an amount sufficient
to show benefit to a patient. Such benefit may be at least
amelioration of at least one symptom. The actual amount
administered, and rate and time-course of administration, will
depend on the nature and severity of what is being treated.
Prescription of treatment, e.g. decisions on dosage, is within the
responsibility of general practitioners and other medical
doctors.
[0111] An antibody may be administered alone or in combination with
other treatments, either simultaneously or sequentially dependent
upon the condition to be treated. Examples of treatments and
therapies include, but are not limited to, chemotherapy (the
administration of active agents, including, e.g. drugs, such as
chemotherapeutics); surgery; and radiation therapy.
[0112] A"chemotherapeutic agent" is a chemical compound useful in
the treatment of cancer, regardless of mechanism of action. Classes
of chemotherapeutic agents include, but are not limited to:
alkylating agents, antimetabolites, spindle poison plant alkaloids,
cytotoxic/antitumor antibiotics, topoisomerase inhibitors,
antibodies, photosensitizers, and kinase inhibitors.
Chemotherapeutic agents include compounds used in "targeted
therapy" and conventional chemotherapy.
[0113] Examples of chemotherapeutic agents include: erlotinib
(TARCEVA.RTM., Genentech/OSI Pharm.), docetaxel (TAXOTERE.RTM.,
Sanofi-Aventis), 5-FU (fluorouracil, 5-fluorouracil, CAS No.
51-21-8), gemcitabine (GEMZAR.RTM., Lilly), PD-0325901 (CAS No.
391210-10-9, Pfizer), cisplatin (cis-diamine, dichloroplatinum(II),
CAS No. 15663-27-1), carboplatin (CAS No. 41575-94-4), paclitaxel
(TAXOL.RTM., Bristol-Myers Squibb Oncology, Princeton, N.J.),
trastuzumab (HERCEPTIN.RTM., Genentech), temozolomide
(4-methyl-5-oxo-2,3,4,6,8-pentazabicyclo [4.3.0]
nona-2,7,9-triene-9-carboxamide, CAS No. 85622-93-1, TEMODAR.RTM.,
TEMODAL.RTM., Schering Plough), tamoxifen
((Z)-2-[4-(1,2-diphenylbut-1-enyl)phenoxy]-N,N-dimethylethanamine,
NOLVADEX.RTM., ISTUBAL.RTM., VALODEX.RTM.), and doxorubicin
(ADRIAMYCIN.RTM.), Akti-1/2, HPPD, and rapamycin.
[0114] More examples of chemotherapeutic agents include:
oxaliplatin (ELOXATIN.RTM., Sanofi), bortezomib (VELCADE.RTM.,
Millennium Pharm.), sutent (SUNITINIB.RTM., SU11248, Pfizer),
letrozole (FEMARA.RTM., Novartis), imatinib mesylate (GLEEVEC.RTM.,
Novartis), XL-518 (Mek inhibitor, Exelixis, WO 2007/044515),
ARRY-886 (Mek inhibitor, AZD6244, Array BioPharma, Astra Zeneca),
SF-1126 (PI3K inhibitor, Semafore Pharmaceuticals), BEZ-235 (PI3K
inhibitor, Novartis), XL-147 (PI3K inhibitor, Exelixis), PTK787/ZK
222584 (Novartis), fulvestrant (FASLODEX.RTM., AstraZeneca),
leucovorin (folinic acid), rapamycin (sirolimus, RAPAMUNE.RTM.,
Wyeth), lapatinib (TYKERB.RTM., GSK572016, Glaxo Smith Kline),
lonafamib (SARASAR.TM., SCH 66336, Schering Plough), sorafenib
(NEXAVAR.RTM., BAY43-9006, Bayer Labs), gefitinib (IRESSA.RTM.,
AstraZeneca), irinotecan (CAMPTOSAR.RTM., CPT-11, Pfizer),
tipifamib (ZARNESTRA.TM., Johnson & Johnson), ABRAXANE.TM.
(Cremophor-free), albumin-engineered nanoparticle formulations of
paclitaxel (American Pharmaceutical Partners, Schaumberg, II),
vandetanib (rINN, ZD6474, ZACTIMA.RTM., AstraZeneca),
chloranmbucil, AG1478, AG1571 (SU 5271; Sugen), temsirolimus
(TORISEL.RTM., Wyeth), pazopanib (GlaxoSmithKline), canfosfamide
(TELCYTA.RTM., Telik), thiotepa and cyclosphosphamide
(CYTOXAN.RTM., NEOSAR.RTM.); alkyl sulfonates such as busulfan,
improsulfan and piposulfan; aziridines such as benzodopa,
carboquone, meturedopa, and uredopa; ethylenimines and
methylamelamines including altretamine, triethylenemelamine,
triethylenephosphoramide, triethylenethiophosphoramide and
trimethylomelamine; acetogenins (especially bullatacin and
bullatacinone); a camptothecin (including the synthetic analog
topotecan); bryostatin; callystatin; CC-1065 (including its
adozelesin, carzelesin and bizelesin synthetic analogs);
cryptophycins (particularly cryptophycin 1 and cryptophycin 8);
dolastatin; duocarmycin (including the synthetic analogs, KW-2189
and CB1-TM1); eleutherobin; pancratistatin; a sarcodictyin;
spongistatin; nitrogen mustards such as chlorambucil,
chlomaphazine, chlorophosphamide, estramustine, ifosfamide,
mechlorethamine, mechlorethamine oxide hydrochloride, melphalan,
novembichin, phenesterine, prednimustine, trofosfamide, uracil
mustard; nitrosoureas such as carmustine, chlorozotocin,
fotemustine, lomustine, nimustine, and ranimnustine; antibiotics
such as the enediyne antibiotics (e.g. calicheamicin, calicheamicin
gamma1I, calicheamicin omegal1 (Angew Chem. Intl. Ed. Engl. (1994)
33:183-186); dynemicin, dynemicin A; bisphosphonates, such as
clodronate; an esperamicin; as well as neocarzinostatin chromophore
and related chromoprotein enediyne antibiotic chromophores),
aclacinomysins, actinomycin, authramycin, azaserine, bleomycins,
cactinomycin, carabicin, carminomycin, carzinophilin,
chromomycinis, dactinomycin, daunorubicin, detorubicin,
6-diazo-5-oxo-L-nordeucine, morpholino-doxorubicin,
cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and
deoxydoxorubicin), epirubicin, esorubicin, idarubicin, nemorubicin,
marcellomycin, mitomycins such as mitomycin C, mycophenolic acid,
nogalamycin, olivomycins, peplomycin, porfiromycin, puromycin,
quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin,
ubenimex, zinostatin, zorubicin; anti-metabolites such as
methotrexate and 5-fluorouracil (5-FU); folic acid analogs such as
denopterin, methotrexate, pteropterin, trimetrexate; purine analogs
such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine;
pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine,
carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine,
floxuridine; androgens such as calusterone, dromostanolone
propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals
such as aminoglutethimide, mitotane, trilostane; folic acid
replenisher such as frolinic acid; aceglatone; aldophosphamide
glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil;
bisantrene; edatraxate; defofamine; demecolcine; diaziquone;
elfornithine; elliptinium acetate; an epothilone; etoglucid;
gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids
such as maytansine and ansamitocins; mitoguazone; mitoxantrone;
mopidanmol; nitraerine; pentostatin; phenamet; pirarubicin;
losoxantrone; podophyllinic acid; 2-ethylhydrazide; procarbazine;
PSK.RTM. polysaccharide complex (JHS Natural Products, Eugene,
Oreg.); razoxane; rhizoxin; sizofiran; spirogermanium; tenuazonic
acid; triaziquone; 2,2',2''-trichlorotriethylamine; trichothecenes
(especially T-2 toxin, verracurin A, rordin A and anguidine);
urethan; vindesine; dacarbazine; mannomustine; mitobronitol;
mitolactol; pipobroman; gacytosine; arabinoside ("Ara-C");
cyclophosphamide; thiotepa; 6-thioguanine; mercaptopurine;
methotrexate; platinum analogs such as cisplatin and carboplatin;
vinblastine; etoposide (VP-16); ifosfamide; mitoxantrone;
vincristine; vinorelbine (NAVELBINE.RTM.); novantrone; teniposide;
edatrexate; daunomycin; aminopterin; capecitabine (XELODA.RTM.,
Roche); ibandronate; CPT-11; topoisomerase inhibitor RFS 2000;
difluoromethylomithine (DMFO); retinoids such as retinoic acid; and
pharmaceutically acceptable salts, acids and derivatives of any of
the above.
[0115] Also included in the definition of "chemotherapeutic agent"
are: (i) anti-hormonal agents that act to regulate or inhibit
hormone action on tumours such as anti-estrogens and selective
estrogen receptor modulators (SERMs), including, for example,
tamoxifen (including NOLVADEX.RTM.; tamoxifen citrate), raloxifene,
droloxifene, 4-hydroxytamoxifen, trioxifene, keoxifene, LY117018,
onapristone, and FARESTON.RTM. (toremifine citrate); (ii) aromatase
inhibitors that inhibit the enzyme aromatase, which regulates
estrogen production in the adrenal glands, such as, for example,
4(5)-imidazoles, aminoglutethimide, MEGASE.RTM. (megestrol
acetate), AROMASIN.RTM. (exemestane; Pfizer), formestanie,
fadrozole, RIVISOR.RTM. (vorozole), FEMARA.RTM. (letrozole;
Novartis), and ARIMIDEX.RTM. (anastrozole; AstraZeneca); (iii)
anti-androgens such as flutamide, nilutamide, bicalutamide,
leuprolide, and goserelin; as well as troxacitabine (a
1,3-dioxolane nucleoside cytosine analog); (iv) protein kinase
inhibitors such as MEK inhibitors (WO 2007/044515); (v) lipid
kinase inhibitors; (vi) antisense oligonucleotides, particularly
those which inhibit expression of genes in signaling pathways
implicated in aberrant cell proliferation, for example, PKC-alpha,
Raf and H-Ras, such as oblimersen (GENASENSE.RTM., Genta Inc.);
(vii) ribozymes such as VEGF expression inhibitors (e.g.,
ANGIOZYME.RTM.) and HER2 expression inhibitors; (viii) vaccines
such as gene therapy vaccines, for example, ALLOVECTIN.RTM.,
LEUVECTIN.RTM., and VAXID.RTM.; PROLEUKIN.RTM. rIL-2; topoisomerase
1 inhibitors such as LURTOTECAN.RTM.; ABARELIX.RTM. rmRH; (ix)
anti-angiogenic agents such as bevacizumab (AVASTIN.RTM.,
Genentech); and pharmaceutically acceptable salts, acids and
derivatives of any of the above.
[0116] Also included in the definition of "chemotherapeutic agent"
are therapeutic antibodies such as alemtuzumab (Campath),
bevacizumab (AVASTIN.RTM., Genentech); cetuximab (ERBITUX.RTM.,
Imclone); panitumumab (VECTIBIX.RTM., Amgen), rituximab
(RITUXAN.RTM., Genentech/Biogen Idec), ofatumumab (ARZERRA.RTM.,
GSK), pertuzumab (PERJETA.TM., OMNITARG.TM., 2C4, Genentech),
trastuzumab (HERCEPTIN.RTM., Genentech), tositumomab (Bexxar,
Corixia), and the antibody drug conjugate, gemtuzumab ozogamicin
(MYLOTARG.RTM., Wyeth).
[0117] Humanized monoclonal antibodies with therapeutic potential
as chemotherapeutic agents in combination with the conjugates of
the disclosure include: alemtuzumab, apolizumab, aselizumab,
atlizumab, bapineuzumab, bevacizumab, bivatuzumab mertansine,
cantuzumab mertansine, cedelizumab, certolizumab pegol,
cidfusituzumab, cidtuzumab, daclizumab, eculizumab, efalizumab,
epratuzumab, erlizumab, felvizumab, fontolizumab, gemtuzumab
ozogamicin, inotuzumab ozogamicin, ipilimumab, labetuzumab,
lintuzumab, matuzumab, mepolizumab, motavizumab, motovizumab,
natalizumab, nimotuzumab, nolovizumab, numavizumab, ocrelizumab,
omalizumab, palivizumab, pascolizumab, pecfusituzumab, pectuzumab,
pertuzumab, pexelizumab, ralivizumab, ranibizumab, reslivizumab,
reslizumab, resyvizumab, rovelizumab, ruplizumab, sibrotuzumab,
siplizumab, sontuzumab, tacatuzumab tetraxetan, tadocizumab,
talizumab, tefibazumab, tocilizumab, toralizumab, trastuzumab,
tucotuzumab celmoleukin, tucusituzumab, umavizumab, urtoxazumab,
and visilizumab.
[0118] Pharmaceutical compositions according to the present
disclosure, and for use in accordance with the present disclosure,
may comprise, in addition to the active ingredient, i.e. an
antibody, a pharmaceutically acceptable excipient, carrier, buffer,
stabiliser or other materials well known to those skilled in the
art. Such materials should be non-toxic and should not interfere
with the efficacy of the active ingredient. The precise nature of
the carrier or other material will depend on the route of
administration, which may be oral, or by injection, e.g. cutaneous,
subcutaneous, or intravenous.
[0119] Pharmaceutical compositions for oral administration may be
in tablet, capsule, powder or liquid form. A tablet may comprise a
solid carrier or an adjuvant. Liquid pharmaceutical compositions
generally comprise a liquid carrier such as water, petroleum,
animal or vegetable oils, mineral oil or synthetic oil.
Physiological saline solution, dextrose or other saccharide
solution or glycols such as ethylene glycol, propylene glycol or
polyethylene glycol may be included. A capsule may comprise a solid
carrier such a gelatin.
[0120] For intravenous, cutaneous or subcutaneous injection, or
injection at the site of affliction, the active ingredient will be
in the form of a parenterally acceptable aqueous solution which is
pyrogen-free and has suitable pH, isotonicity and stability. Those
of relevant skill in the art are well able to prepare suitable
solutions using, for example, isotonic vehicles such as Sodium
Chloride Injection, Ringer's Injection, Lactated Ringers Injection.
Preservatives, stabilisers, buffers, antioxidants and/or other
additives may be included, as required.
[0121] Formulations
[0122] While it is possible for the antibody to be used (e.g.,
administered) alone, it is often preferable to present it as a
composition or formulation.
[0123] In one embodiment, the composition is a pharmaceutical
composition (e.g., formulation, preparation, medicament) comprising
an antibody, as described herein, and a pharmaceutically acceptable
carrier, diluent, or excipient.
[0124] In one embodiment, the composition is a pharmaceutical
composition comprising at least one antibody, as described herein,
together with one or more other pharmaceutically acceptable
ingredients well known to those skilled in the art, including, but
not limited to, pharmaceutically acceptable carriers, diluents,
excipients, adjuvants, fillers, buffers, preservatives,
anti-oxidants, lubricants, stabilisers, solubilisers, surfactants
(e.g., wetting agents), masking agents, colouring agents,
flavouring agents, and sweetening agents.
[0125] In one embodiment, the composition further comprises other
active agents, for example, other therapeutic or prophylactic
agents.
[0126] Suitable carriers, diluents, excipients, etc. can be found
in standard pharmaceutical texts. See, for example, Handbook of
Pharmaceutical Additives, 2nd Edition (eds. M. Ash and I. Ash),
2001 (Synapse Information Resources, Inc., Endicott, N.Y., USA),
Remington's Pharmaceutical Sciences, 20th edition, pub. Lippincott,
Williams & Wilkins, 2000; and Handbook of Pharmaceutical
Excipients, 2nd edition, 1994.
[0127] Another aspect of the present disclosure pertains to methods
of making a pharmaceutical composition comprising admixing at least
one [.sup.11C]-radiolabelled antibody or antibody-like molecule, as
defined herein, together with one or more other pharmaceutically
acceptable ingredients well known to those skilled in the art,
e.g., carriers, diluents, excipients, etc. If formulated as
discrete units (e.g., tablets, etc.), each unit contains a
predetermined amount (dosage) of the active compound.
[0128] The term "pharmaceutically acceptable," as used herein,
pertains to compounds, ingredients, materials, compositions, dosage
forms, etc., which are, within the scope of sound medical judgment,
suitable for use in contact with the tissues of the subject in
question (e.g., human) without excessive toxicity, irritation,
allergic response, or other problem or complication, commensurate
with a reasonable benefit/risk ratio. Each carrier, diluent,
excipient, etc. must also be "acceptable" in the sense of being
compatible with the other ingredients of the formulation.
[0129] The formulations may be prepared by any methods well known
in the art of pharmacy. Such methods include the step of bringing
into association the active compound with a carrier which
constitutes one or more accessory ingredients. In general, the
formulations are prepared by uniformly and intimately bringing into
association the active compound with carriers (e.g., liquid
carriers, finely divided solid carrier, etc.), and then shaping the
product, if necessary.
[0130] The formulation may be prepared to provide for rapid or slow
release; immediate, delayed, timed, or sustained release; or a
combination thereof.
[0131] Formulations suitable for parenteral administration (e.g.,
by injection), include aqueous or non-aqueous, isotonic,
pyrogen-free, sterile liquids (e.g., solutions, suspensions), in
which the active ingredient is dissolved, suspended, or otherwise
provided (e.g., in a liposome or other microparticulate). Such
liquids may additional contain other pharmaceutically acceptable
ingredients, such as anti-oxidants, buffers, preservatives,
stabilisers, bacteriostats, suspending agents, thickening agents,
and solutes which render the formulation isotonic with the blood
(or other relevant bodily fluid) of the intended recipient.
Examples of excipients include, for example, water, alcohols,
polyols, glycerol, vegetable oils, and the like. Examples of
suitable isotonic carriers for use in such formulations include
Sodium Chloride Injection, Ringers Solution, or Lactated Ringers
Injection. Typically, the concentration of the active ingredient in
the liquid is from about 1 ng/ml to about 10 .mu.g/ml, for example
from about 10 ng/ml to about 1 .mu.g/ml. The formulations may be
presented in unit-dose or multi-dose sealed containers, for
example, ampoules and vials, and may be stored in a freeze-dried
(lyophilised) condition requiring only the addition of the sterile
liquid carrier, for example water for injections, immediately prior
to use. Extemporaneous injection solutions and suspensions may be
prepared from sterile powders, granules, and tablets.
[0132] Dosage
[0133] It will be appreciated by one of skill in the art that
appropriate dosages of the antibody, and compositions comprising
the antibody, can vary from patient to patient. Determining the
optimal dosage will generally involve the balancing of the level of
therapeutic benefit against any risk or deleterious side effects.
The selected dosage level will depend on a variety of factors
including, but not limited to, the activity of the particular
compound, the route of administration, the time of administration,
the rate of excretion of the compound, the duration of the
treatment, other drugs, compounds, and/or materials used in
combination, the severity of the condition, and the species, sex,
age, weight, condition, general health, and prior medical history
of the patient. The amount of compound and route of administration
will ultimately be at the discretion of the physician,
veterinarian, or clinician, although generally the dosage will be
selected to achieve local concentrations at the site of action
which achieve the desired effect without causing substantial
harmful or deleterious side-effects.
[0134] Administration can be effected in one dose, continuously or
intermittently (e.g., in divided doses at appropriate intervals)
throughout the course of treatment. Methods of determining the most
effective means and dosage of administration are well known to
those of skill in the art and will vary with the formulation used
for therapy, the purpose of the therapy, the target cell(s) being
treated, and the subject being treated. Single or multiple
administrations can be carried out with the dose level and pattern
being selected by the treating physician, veterinarian, or
clinician.
[0135] In general, a suitable dose of the antibody is in the range
of about 100 ng to about 25 mg (more typically about 1 .mu.g to
about 10 mg) per kilogram body weight of the subject per day. Where
the active compound is a salt, an ester, an amide, a prodrug, or
the like, the amount administered is calculated on the basis of the
parent compound and so the actual weight to be used is increased
proportionately.
[0136] In one embodiment, the antibody is administered to a human
patient according to the following dosage regime: about 100 mg, 3
times daily.
[0137] In one embodiment, the antibody is administered to a human
patient according to the following dosage regime: about 150 mg, 2
times daily.
[0138] In one embodiment, the antibody is administered to a human
patient according to the following dosage regime: about 200 mg, 2
times daily.
[0139] However in one embodiment, the antibody is administered to a
human patient according to the following dosage regime: about 50 or
about 75 mg, 3 or 4 times daily.
[0140] In one embodiment, the antibody is administered to a human
patient according to the following dosage regime: about 100 or
about 125 mg, 2 times daily.
[0141] For the prevention or treatment of disease, the appropriate
dosage of an antibody of the disclosure will depend on the type of
disease to be treated, as defined above, the severity and course of
the disease, whether the molecule is administered for preventive or
therapeutic purposes, previous therapy, the patient's clinical
history and response to the antibody, and the discretion of the
attending physician. The molecule is suitably administered to the
patient at one time or over a series of treatments. Depending on
the type and severity of the disease, about 1 .mu.g/kg to 15 mg/kg
(e.g. 0.1-20 mg/kg) of molecule is an initial candidate dosage for
administration to the patient, whether, for example, by one or more
separate administrations, or by continuous infusion. A typical
daily dosage might range from about 1 .mu.g/kg to 100 mg/kg or
more, depending on the factors mentioned above. An exemplary dosage
of antibody to be administered to a patient is in the range of
about 0.1 to about 10 mg/kg of patient weight. For repeated
administrations over several days or longer, depending on the
condition, the treatment is sustained until a desired suppression
of disease symptoms occurs. An exemplary dosing regimen comprises a
course of administering an initial loading dose of about 4 mg/kg,
followed by additional doses every week, two weeks, or three weeks
of an antibody. Other dosage regimens may be useful. The progress
of this therapy is easily monitored by conventional techniques and
assays.
[0142] Treatment
[0143] The term "treatment," as used herein in the context of
treating a condition, pertains generally to treatment and therapy,
whether of a human or an animal (e.g., in veterinary applications),
in which some desired therapeutic effect is achieved, for example,
the inhibition of the progress of the condition, and includes a
reduction in the rate of progress, a halt in the rate of progress,
regression of the condition, amelioration of the condition, and
cure of the condition. Treatment as a prophylactic measure (i.e.,
prophylaxis, prevention) is also included.
[0144] The term "therapeutically-effective amount," as used herein,
pertains to that amount of an antibody, or a material, composition
or dosage from comprising an antibody, which is effective for
producing some desired therapeutic effect, commensurate with a
reasonable benefit/risk ratio, when administered in accordance with
a desired treatment regimen.
[0145] Similarly, the term "prophylactically-effective amount," as
used herein, pertains to that amount of an antibody, or a material,
composition or dosage from comprising an antibody, which is
effective for producing some desired prophylactic effect,
commensurate with a reasonable benefit/risk ratio, when
administered in accordance with a desired treatment regimen.
[0146] The Subject/Patient
[0147] The subject/patient may be an animal, mammal, a placental
mammal, a marsupial (e.g., kangaroo, wombat), a monotreme (e.g.,
duckbilled platypus), a rodent (e.g., a guinea pig, a hamster, a
rat, a mouse), murine (e.g., a mouse), a lagomorph (e.g., a
rabbit), avian (e.g., a bird), canine (e.g., a dog), feline (e.g.,
a cat), equine (e.g., a horse), porcine (e.g., a pig), ovine (e.g.,
a sheep), bovine (e.g., a cow), a primate, simian (e.g., a monkey
or ape), a monkey (e.g., marmoset, baboon), an ape (e.g., gorilla,
chimpanzee, orangutang, gibbon), or a human.
[0148] Furthermore, the subject/patient may be any of its forms of
development, for example, a foetus. In one preferred embodiment,
the subject/patient is a human.
BRIEF DESCRIPTION OF THE FIGURES
[0149] FIG. 1: AXL binding ELISA of fully humanised constructs.
(2A) to Human AXL. (2B) to Cynomolgus monkey AXL.
[0150] FIG. 2: Accelerated stability analysis
[0151] Materials and Methods
[0152] Protocol 1: Production of DNA Plasmids for Expression
[0153] Materials [0154] For heavy chain construct selection, Zeocin
25 .mu.g/ml (Invivogen) was used. [0155] For light chain construct
selection, Blasticidin 100 .mu.g/ml (Life Technologies) was
used.
[0156] Method
[0157] Transformed bacteria were spread on LB-agar
Zeocin/Blasticidin plates, as required, incubated overnight at 37
C, then colonies were picked from each plate.
[0158] VH or VK colonies/glycerol stocks were inoculated into 3 ml
LB containing Zeocin 25 .mu.g/ml or Blasticidin 50 .mu.g/ml,
respectively.
[0159] p21, p27, pAdvantage (Promega) and pSVLT (generous gift from
Tom Vink) were inoculated in LB-Ampicillin and shaken
overnight.
[0160] 3 ml overnight colony was seeded into 200 ml of
LB-antibiotic and shaken overnight. DNA plasmids were isolated from
each culture using the Promega PureYield.TM. Plasmid Maxiprep Kit
following the manufacturer's instructions.
[0161] Protocol 2. Transient Transfection of HEK293T Cells with
Expression Constructs
[0162] Materials [0163] Cells: HEK293T cells [0164] Culture medium:
DMEM high glucose 4.5 g/L (PAA) with 10% v/v FCS, penicillin and
streptomycin [0165] Fugene HD transfection reagent (Promega #E2311)
[0166] Opti-MEM (Life Technologies #11058-021) or [0167] FreeStyle
293 Expression Medium (Life Technologies #12338-018)
[0168] Method
[0169] Grow HEK293T cells in a T75 or T175 flask in a
CO.sub.2-gassed cell culture incubator. Split cultures 1:3 every 2
days or 1:4 to 1:5 every 3-4 days. The cells adhere weakly to the
flasks and only a light trypsinisation is necessary to detach cells
during passaging.
[0170] The day before transfection: [0171] 1. Trypsinise the cells,
wash 1.times. in DMEM/10% FCS and count the cells. [0172] 2. Seed
cells in a 6 well plate in 2 ml per well containing
2.times.10.sup.5 cells.
[0173] Next day, check cells are at least 80% confluent and replace
the medium (2 ml/well). [0174] 1. 1.2 .mu.g of total DNA (0.6 ug of
each high and light chain DNA) is needed for each transfection and
better results are obtained if the DNA concentration is at or above
90 ng/.mu.l. [0175] 2. Add 0.6 ug of VH and 0.6 ug VK expression
plasmid DNAs into of Fugene HD (4.5 .mu.l) and OptiMEM/Freestyle
medium, in a total volume of 60 ul, avoiding touching the sides of
the tube with the Fugene HD. [0176] 3. Mix and leave at RT for 15
minutes. [0177] 4. Add Fugene mixture drop-wise around the well of
HEK293T cells. [0178] 5. Return the 6-well plate to the
CO.sub.2-gassed cell culture incubator for 4 days. [0179] 6.
Harvest each conditioned medium, centrifuge, and store at 4.degree.
C.
[0180] Protocol 3: IgG Quantitation by ELISA
[0181] Materials [0182] Nunc-Immuno Plate MaxiSorp (Life
Technologies, 43945A) [0183] Goat Anti-Human IgG(Fc)--AffiniPure:
Stratech Scientific, 109-005-098-JIR; 1 mg: 1.3 mg/ml [0184] Human
IgG1/kappa antibody (Sigma, 1-3889-1 mg: 1 mg/ml) [0185] Goat
anti-human kappa light chain peroxidase conjugate (Sigma, A-7164-1
ml) [0186] 1-Step Turbo TMB-ELISA, 250 mL (Thermo Scientific:
#34022) [0187] Acid stop=0.1M HCL [0188] Sample enzyme conjugate
(SEC) buffer Tween 20 (0.02% v/v), BSA 0.2% (w/v) in PBS [0189]
Washing buffer 1.times.PBS, Tween 20 (0.1% v/v)
[0190] Method [0191] 1. Coat each well of a 96-well immunoplate
with 100 .mu.l aliquots of 0.4 .mu.g/ml (dilute stock.times.3000=10
ul in 30 ml: coat 5 ml per plate) goat anti-human IgG antibody,
diluted in PBS, incubate overnight at 4.degree. C. (or 37 C 1 hr).
(Plates may be stored for 1 month at this stage). Also coat another
blank plate with BSA/PBS blocking solution. [0192] 2. wash plate
3.times. with 200 .mu.l/well of washing buffer. [0193] 3. Block
coated plate: add 200 ul 3% BSA in PBS: incubate 37 C 1 hr [0194]
4. Into blank plate, dispense 200 .mu.l SEC buffer into all wells
except row B, cols 2-11 (blue, below). [0195] 5. Prepare 1 ug/ml
solution of the human IgG1/kappa antibody in SEC buffer
(.times.1000 diln)
TABLE-US-00001 [0195] 1 2 3 4 5 6 7 8 9 10 11 12 A STD unk4 B STD
unk4 C unk1 unk5 D unk1 unk5 E unk2 unk6 F unk2 unk6 G unk3 unk7 H
unk3 unk7 200 .mu.l diluent in every well +50 .mu.l sample +50
.mu.l sample Transfer 100 .mu.l Transfer 100 .mu.l 200 66.67 22.22
7.41 2.47 0.82 200 66.67 22.22 7.41 2.47 0.82 ng/ml Stock std = 1
.mu.g/ml
[0196] BLOCKED UNCOATED PLATE: [0197] 6. Pipette 50 .mu.l/well of
stds/unknowns into rows A-H, cols 1 and 7 (makes a .times.5
dilution). [0198] 7. Serially transfer 100 .mu.l across plate to
achieve serial .times.3 dilution series. [0199] 8. Transfer 100
.mu.l from each well to the corresponding well of the BLOCKED
anti-IgG-COATED plate. [0200] BLOCKED anti-IgG COATED PLATE: [0201]
9. Incubate at 37.degree. C. for 1 hr. Rinse all the wells 3.times.
with washing buffer (200 .mu.l). [0202] 10. Dilute the goat
anti-human kappa light chain peroxidase conjugate 5000-fold in SEC
buffer and add 100 01 to each well. Repeat the incubation and
washing steps (step 9). [0203] 11. Add 100 .mu.l of TMB Turbo
substrate to each well, incubate in the dark at room temperature
for 10 min. [0204] 12. Stop the reaction by adding 50 .mu.l of acid
(0.1M HCl) to each well. [0205] 13. Read the optical density at 450
nm.
[0206] Protocol 4: AXL Binding ELISA
[0207] Materials [0208] Human AXL-Strep-His was produced by Evitria
AG in transiently transfected CHO cells and purified on Ni
Sepharose High Performance (GE Healthcare 17-5268-01) following
manufacturers instructions and stored in aliquots at -20 C. [0209]
Goat anti-human kappa light chain peroxidase conjugate (Sigma,
A-7164-1 ml) [0210] Nunc-Immuno Plate MaxiSorp (Life Technologies,
43945A) [0211] Plate washer Biotek LS405 [0212] 3% BSA: BSA 3% w/v
in PBS [0213] PBS Tween: Tween 20 0.05% v/v in PBS [0214]
PBS/Tween/BSA: BSA 0.5% w/v in PBS/Tween [0215] 1-Step Turbo
TMB-ELISA (Thermo Scientific #3402)
[0216] Protocol [0217] 1. Dispense 50 .mu.l/well of human
AXL-strep-His (1 ug/ml in PBS) [0218] 2. Cover with adhesive plate
sealer and incubate at 4 C overnight. [0219] 3. Block: Dispense 50
.mu.l/well of 3% BSA and incubate for 1 hr 37 C, [0220] 4. Wash
plate with PBS/Tween 3.times. [0221] 5. Serially 3-fold dilute 5E5
antibodies (2 ml HEK293T culture supernatants) on non-binding
polypropylene plate in PBS/Tween/BSA: serially transfer 50 ul onto
100 ul. [0222] 6. Transfer 50 ul from antibody dilution plate onto
washed, blocked AXL-coated plate [0223] 7. Incubate 37 C 1 hr
[0224] 8. Wash plate with PBS/Tween 3.times. [0225] 9. Dispense
anti-human IgG-HRP conjugate, diluted 1:1000 in PBS/Tween/BSA
[0226] 10. Incubate 37 C 1 hr [0227] 11. Wash plate with PBS/Tween
3 [0228] 12. Wash plate with PBS 3.times. [0229] 13. Dispense 100
ul/well 1-Step Turbo TMB-ELISA substrate solution [0230] 14.
Incubate 30 min at room temperature (or less if reaction is rapid)
[0231] 15. Dispense 100 ul/well 0.6M HCl to stop the substrate
reaction [0232] 16. Measure optical density at 450 nm
[0233] Protocol 4A: SPR Measurement of Antibody Affinity
[0234] Materials [0235] 1. Sensor Chip CM5 Biacore; Cat.
#BR-1000-14 [0236] 2. Amine Coupling Kit (EDC, NHS,
ethanolamine-HCl) Biacore; Cat. #BR-1000-50 [0237] 3.
Immobilization buffer (10 mM Na acetate, pH 4.0) Biacore; Cat.
#BR-1003-49 [0238] 4. 50 mM NaOH Biacore; Cat. #BR-1003-58 [0239]
5. Running buffer (PBS/Tween20 0.05% v/v) [0240] 6. Biacore T200 GE
Healthcare [0241] 7. Regeneration solution: 10 mM HCl, 1 M NaCl
[0242] Coupling Method [0243] Activate flow cell 2 with NHS-EDC
420s at Sp/min, then inject human Axl-Strep-His (Evitria) (10
.mu.g/mL in 10 mM sodium acetate, pH 4.0) to achieve a coupling of
10-20 RU. Block with ethanolamine for 420s. Repeat the process for
flow cell 1 but with no antigen to create a reference flow cell.
12RU AXL fusion protein was coated. [0244] For the Fc fusion, Human
Axl-Fc chimera (R&D Systems #154-AL) (5 .mu.g/mL in 10 mM
sodium acetate, pH 4.5) was used with the above protocol. 16RU of
AXL-Fc was coated.
[0245] Protocol with AXL-Strep-his Antigen [0246] Serial 10.times.
dilutions of antibody, from 3000 nM, were made in PBS/Tween20.
2.times. regeneration cycles were used with 10 mM HCl, 1 M NaCl for
30s at 30 .mu.l/min for both cycles. Start-up solution was
PBS/Tween20 and set to 3 cycles. [0247] Sample injection parameters
were 120s at 30 .mu.l/min, with 600s dissociation time. [0248]
Prime and normalise detector were run before sample application
with experimental conditions 25 C and sample storage at 4 C. [0249]
Kinetic analysis used BIAevaluation software with bivalent ligand
binding model. For chimeric 1H12 with AXL-Strep-His, "heterogeneous
ligand" binding model was used due to poor fit with bivalent or
monovalent algorithms. [0250] Each antibody dilution was injected
twice.
[0251] Protocol with AXL-Fc Chimera Antigen [0252] The above
protocol was used except that the running buffer was HBSEP+, serial
10.times. dilutions of antibody were from 500 nM in HBSEP+ running
buffer and were injected for 180 sec. [0253] Analysis used
BIAevaluation software with the bivalent binding model.
[0254] Protocol 5: Capillary Isoelectric Focusing
[0255] Materials [0256] PA 800 plus (AB SCIEX) [0257] Anolyte
Solution: 200 mM Phosphoric Acid (Sigma-Aldrich #345 245). [0258]
4.3M Urea (Sigma-Aldrich #U0631) in water. [0259] Catholyte
Solution: 300 mM Sodium Hydroxide. [0260] 3M Urea (Sigma-Aldrich
#U0631) in cIEF Gel (Beckman Coulter #477497). [0261] Chemical
Mobiliser 350 mM Acetic Acid (Sigma-Aldrich #537 020). [0262]
Pharmalyte 3-10 (GE Healthcare 17-0456-01). [0263] Cathodic
Stabiliser 500 mM Arginine (Sigma-Aldrich #A5006). [0264] cIEF
Peptide markers PI 4-10 (Beckman Coulter #A58481). [0265] Anodic
Stabiliser: 200 mM Iminodiacetic Acid (Sigma-Aldrich #220 000).
[0266] Neutral Capillary, 50 .mu.m i.d..times.45 cm, (Beckman
Coulter #477 441)
[0267] Method [0268] Turn on the PA800+ machine and UV lamp,
allowing it to warm up 30 mins before use. [0269] Clean the system
electrodes and interface block with a damp Kimwipe. [0270] Prepare
buffer trays as shown, with 1.5 mL reagent per vial, 1 mL of water
in the waste [0271] 1. DDI water [0272] 2. Anolyte [0273] 3. Urea
Solution [0274] 4. 3M urea/cIEF Gel [0275] 5. Chemical Mobilizer
[0276] 6. Waste [0277] 7. Catholyte [0278] 8. Chemical Mobilizer
[0279] 9. BI (Inlet Buffer Tray) [0280] 10. BO (Outlet Buffer Tray)
[0281] NOTE. Each set of buffer vials is good for 6 consecutive
runs or for 24 hours inside the instrument. [0282] Insert the
capillary cartridge into the system and close the front panel.
[0283] NOTE. Do not expose the neutral-coated capillary ends to air
for more than fifteen min. When the capillary is not in use,
submerge the capillary ends in vials filled with DDI water. [0284]
Prepare cIEF master mix using the table below. Dispense each
reagent into a centrifuge tube, vortex 1 min, invert every 15-20
sec to ensure complete mixing and store at 2.degree. C. to
8.degree. C. for up to 1 day.
TABLE-US-00002 [0284] Volume per Reagent sample (.mu.l) 3M
Urea-cIEF Gel 100 Pharmalyte 3-10 12 Cathodic Stabiliser 20 Anodic
Stabiliser 2 pI marker 10 2 pI marker 9.5 2 pI marker 7 2 pI marker
5.5 2 pI marker 4.1 2
[0285] Desalt and concentrate each antibody (to about 5 mg/ml) in
2M urea using Amicon Ultra 0.5 mL centrifugal filters (Sigma
Z677108). [0286] Mix 200 .mu.L of master mix with 10 .mu.L of
protein, vortex the cIEF sample for 1 min, inverting the tube every
15-20 sec, then centrifuge at high speed to remove any air bubbles.
Transfer 100 .mu.L of sample into a micro vial. Place the micro
vial into a universal plastic vial and cap it with a blue cap. Then
place the sample vial in the inlet sample tray. [0287] Run the
"cIEF Conditioning--PA 800 plus.met" method to condition the
column. [0288] Rinse for 5 min at 50 psi with Chemical Mobilizer.
See FIG. 2.10. [0289] 2 Rinse for 2 min at 50 psi with DDI water.
[0290] 3 Rinse for 5 min at 50 psi with cIEF gel. [0291] 4 Submerge
both of the capillary ends in vials filled with DDI water. [0292]
Use the "cIEF Separation--PA 800 plus.met" method to create a
sequence containing all protein samples and a blank. [0293] Rinse
for 3 min at 50 psi with Urea Solution. See FIG. 2.11. [0294] Rinse
for 2 min at 50 psi with DDI water. [0295] Inject sample for 99.0
sec at 25 psi. [0296] Water dip by submerging both capillary ends
in DDI water. [0297] Focusing step, 15 min at 25 kV under normal
polarity (Time=0). [0298] Chemical mobilization, 30 min at 30 kV
under normal polarity (Time=15 min). [0299] Stop data collection
(Time=45 min). [0300] Rinse for 2 min at 50 psi with DDI water
(Time=45.10 min). [0301] Submerged both of the capillary ends in
DDI water (Time=47.20 min). [0302] End the method (Time=47.30 min).
[0303] Put the "cIEF Shutdown--PA 800 plus.met" method at the end
of the sequence to rinse the capillary and turn off the UV. [0304]
Rinse for 2 min at 50 psi with DDI water. See FIG. 2.12. [0305]
Rinse for 5 min at 50 psi with cIEF gel. [0306] Turn off the UV
lamp. [0307] Submerge both of the capillary ends in vials filled
with DDI water. [0308] For short term storage (1 to 3 days), leave
the capillary on the instrument. For long term storage (over 3
days), place the capillary cartridge in the storage box with both
ends submerged in water tubes and store upright at 4 C.
[0309] Protocol 6: Protein Thermal Shift Protocol
[0310] Materials [0311] 96 well optical plate semi-skirted (Stariab
cat. L1402-9700). [0312] Protein thermal shift dye kit (Life
Technologies cat. 446148). [0313] Microamp optical adhesive film
(Applied Biosystems) [0314] 7500 Real-Time PCR System (Life
Technologies) [0315] Test items: Antibodies from Evitria and
Spirogen [0316] Protein thermal shift v1.2 software (Life
Technologies)
[0317] Method
[0318] Protein thermal shift dye (2.5 .mu.L 1:1000 dilution) was
added to sample proteins (17.5 .mu.L of 0.5 mg/mL in PBS) in a 96
well optical plate and mixed thoroughly. Every sample was done in
quadruplicate. The plate was sealed with a optical adhesive film
and bubbles in the wells were removed by centrifugation 1 min at
500 g, then placed on ice. The sealed plate was introduced in the
7500 Real-Time PCR System and subsequently the experiment was set
up as follows:
TABLE-US-00003 Experiment Name Name (using up to 100
letters/numbers) Instrument type 7500 Fast (96 Wells) or 7500 (96
Wells) Experiment type Melt Curve Reagent type Other Ramp speed
Standard Reporter ROX Quencher None Passive Reference None
[0319] Temperature cycling on the ABI 7500 set up:
TABLE-US-00004 Reaction vol 20 .mu.l Ramp mode continuous Step Ramp
rate Temp .degree. C. Time (mm:ss) 1 100% 25.0 02:00 2 1% 99.0
02:00
[0320] Data analysis and derivation of Tm data were done using the
software following the manufacturers instructions.
[0321] Protocol 7: HPLC Size Exclusion Chromatography
[0322] Materials [0323] Shimadzu HPLC system, or equivalent,
consisting of the following, or equivalent: [0324] 2.times.
DGU-20A.sub.SR Prominence Degassing units [0325] 2.times.
LC-20AD.sub.XR Nexera Pumps [0326] SIL-20AC.sub.XR Nexera
Autosampler [0327] CTO-20AC Prominence Column oven [0328] SPD-M30A
Prominence DAD detector [0329] Computer with LabSolutions software.
[0330] TSKgeI Super SW mAb HTP 4 um 4.6 mm.times.15 cm [0331] 200
mM Potassium Phosphate, 250 mM Potassium Chloride, 10% v/v
i-Propanol, pH 6.95.
[0332] Sample Preparation [0333] Mobile Phase: 200 mM Potassium
Phosphate, 250 mM Potassium Chloride, 10% v/v i-Propanol, pH 6.95.
[0334] Analytical Sample: Inject 2-20 .mu.L of neat ADC sample (at
least 1 mg/ml for best results).
[0335] Typically 10 .mu.L of 5 mg/ml gives good results.
[0336] HPLC Parameters [0337] Method File name: MSOP-018 [0338]
HPLC Column: TSKgeI Super SW mAb HTP 4 um 4.6 mm.times.15 cm [0339]
Flow Rate: 0.5 ml/min [0340] Injection volume: 2-20 .mu.L [0341]
Detection, UV: 280 nm [0342] 330 nm (for information only) [0343]
Column Temp: ambient temperature [0344] Autosampler Temp:
15.degree. C. [0345] Gradient: Isocratic
[0346] Method [0347] Intact ADCs typically elute at .about.16-18
minutes. [0348] Aggregates typically elute at .about.11-14 minutes.
[0349] Low molecular weight species typically elute at
.about.>20 minutes.
[0350] Protocol 8: Hydrophobic Interaction Chromatograph
[0351] Materials [0352] HPLC system, or equivalent, consisting of
the following, or equivalent: [0353] SRD-3600 SOLVENT RACK, 6
DEGASS. LINES [0354] HPG-3400RS PUMP (Thermo Scientific) [0355]
HPG-3200RS PUMP (Thermo Scientific) [0356] WPS-3000TFC ANALYTICAL
AUTOSAMPLER (Thermo Scientific) [0357] TCC-3000RS COLUMN THERMOSTAT
(Thermo Scientific) [0358] DAD-3000RS DETECTOR (Thermo Scientific)
[0359] Computer with Chromeleon software (Thermo Scientific) [0360]
Proteomix HIC Butyl-NP5, 5 um, non-porous, 4.6.times.35 mm (Sepax)
column [0361] Ammonium sulfate ((NH.sub.4).sub.2SO.sub.4) [0362]
Sodium acetate (NaOAc) [0363] i-Propanol [0364] Water, HPLC grade
[0365] Mobile Phase A: 1.25 M (NH.sub.4).sub.2SO.sub.4, 25 mM NaOAc
(pH 5.50) [0366] Mobile Phase B: 75% 25 mM NaOAc (pH 5.50), 25%
i-Propanol [0367] Blank Solution: Water
[0368] Sample Preparation [0369] Analytical Sample: .ltoreq.10
.mu.L of neat ADC sample at a concentration of 1-5 mg/mL.
[0370] HPLC Parameters [0371] Method File name: HIC_Gradient_1_AB
[0372] HPLC Column: Proteomix HIC Butyl-NP5, Sum, non-porous,
4.6.times.35 mm (Sepax) [0373] Flow Rate: 0.8 ml/min [0374]
Injection volume: 5 10 .mu.L [0375] Detection, UV: 214 nm [0376]
330 nm (for information only) [0377] Column Temp: 25.degree. C.
[0378] Autosampler Temp: 10.degree. C.
[0379] Gradient
TABLE-US-00005 Time (min) % B 0 0 1 0 13 100 14 100 14.1 0 18 0
[0380] Method
[0381] Flush the flow-path of the HPLC and column with water. Set
up the HPLC under the operating conditions outlined above and
equilibrate the system for a minimum of 10 minutes.
[0382] Protocol 9: Reverse Phase Chromatograph
[0383] Materials [0384] HPLC system, or equivalent, consisting of
the following, or equivalent: [0385] SRD-3600 SOLVENT RACK, 6
DEGASS. LINES [0386] HPG-3400RS PUMP (Thermo Scientific) [0387]
HPG-3200RS PUMP (Thermo Scientific) [0388] WPS-3000TFC ANALYTICAL
AUTOSAMPLER (Thermo Scientific) [0389] TCC-3000RS COLUMN THERMOSTAT
(Thermo Scientific) [0390] DAD-3000RS DETECTOR (Thermo Scientific)
[0391] Computer with Chromeleon software (Thermo Scientific) [0392]
Aeris Widepore XB-C18, 200 .ANG., 3.6 .mu.m, 2.1.times.150 mm
(Phenomenex, 00F-4482-AN) [0393] Acetonitrile, HPLC grade. [0394]
Water, HPLC grade. [0395] Trifluoroacetic acid (TFA), HPLC grade.
[0396] 100 mM NaBorate, pH 8.4 [0397] 500 mM DTT [0398] 49:49:2
Acetonitrile/Water/Formic acid [0399] Mobile Phase A: Water+0.1%
v/v TFA. [0400] Mobile Phase B: Acetonitrile+0.1% v/v TFA. [0401]
Blank Solution: 1:1 v/v Acetonitrile/Water.
[0402] Sample Preparation
[0403] To 40 .mu.L of sample (5 mg/ml) add water, 30 .mu.l,
NaBorate, 20 .mu.l, and DTT (500 mM), 10 .mu.L. Incubate at
37.degree. C., 30 min, then add 100 .mu.l of 49:49:2
Acetonitrle/Water/Formic acid.
[0404] HPLC Parameters [0405] Method File name: RP_Aeris_Column6
[0406] HPLC Column: Aeris Widepore XB-C18, 200 .ANG., 3.6 .mu.m,
2.1.times.150 mm (Phenomenex, 00F-4482-AN) [0407] Flow Rate: 1.0
ml/min [0408] Injection volume: 10 .mu.l (or full loop) [0409]
Detection, UV: 214 nm [0410] 330 nm (for information only) [0411]
Column Temp: 80.degree. C. [0412] Autosampler Temp: 15.degree.
C.
[0413] Gradient
TABLE-US-00006 Time (minutes) % B 0 22.5 1 22.5 11 50 11.5 90 13.5
90 14.5 22.5 16 22.5
[0414] Method
[0415] Set up the HPLC under the operating conditions outlined
above and equilibrate the system for a minimum of 10 minutes.
Inject a blank sample, followed by the sample for analysis.
Example 1: Characterization of Humanized Antibodies
[0416] The five antibodies described below were produced,
expressed, and quantified according to Protocols 1-3 described
herein. The expression levels recorded are shown below in Table 1.
[0417] Ab1 is an anti-AXL antibody comprising a VH domain having
the sequence according to SEQ ID NO. 1, a VL domain having the
sequence according to SEQ ID NO. 4, and a constant region derived
from one or more human antibodies. [0418] Ab2 is an anti-AXL
antibody comprising a VH domain having the sequence according to
SEQ ID NO. 2, a VL domain having the sequence according to SEQ ID
NO. 5, and a constant region derived from one or more human
antibodies. [0419] Ab3 is an anti-AXL antibody comprising a VH
domain having the sequence according to SEQ ID NO. 2, a VL domain
having the sequence according to SEQ ID NO. 7, and a constant
region derived from one or more human antibodies. [0420] Ab4 is an
anti-AXL antibody comprising a VH domain having the sequence
according to SEQ ID NO. 3, a VL domain having the sequence
according to SEQ ID NO. 5, and a constant region derived from one
or more human antibodies. [0421] Ab5 is an anti-AXL antibody
comprising a VH domain having the sequence according to SEQ ID NO.
3, a VL domain having the sequence according to SEQ ID NO. 7, and a
constant region derived from one or more human antibodies.
[0422] A stability assay was performed during which the antibodies
were heated in sterile PBS at 40.degree. C. for 60 hr and analysed
for aggregation by SEC and for binding activity by human AXL ELISA.
No increase in aggregation or loss in AXL binding activity was
detected for any of the antibodies (see FIG. 2).
[0423] The antibodies were further characterised using Protocols
5-9 as described herein. The results are shown below in Table 1
(all assays were performed on the HEK293F expression product unless
otherwise stated; "F"=HEK293F, "T"=HEK293T).
TABLE-US-00007 TABLE 1 RP HPLC SEC % LC2 peak Expression (.mu.g/mL)
monomer HIC retention % protein in . . . 280 nm time min Tm 280 nm
Antibody T F CHO CHO F F CHO pl (.degree. C.) F CHO Ab1 33.7, 7.16
366 97.9 87% 4.5 4.5 8.05 69.52 0 0 40.1 Ab2 18.2 2.55 265 97.6 86%
5.2 5.2 8.06 59.71 6.4% 5.9% Ab3 15.2 2.24 287 98.3 88% 4.8 4.7
8.15 62.05 0 0 Ab4 17.8 1.91 306 96.9 96% 5.6 5.6 7.56 60.32 8.1%
5.9% Ab5 16.5 1.95 298 97.7 98% 5.0 4.9 7.54 63.06 0 0
[0424] Binding of the antibodies to AXL antigens indicated that
binding was unusually sensitive to both antigen preparation and
presentation and antibody geometry.
[0425] Initial measurements by ELISA using Axl-Strep-His antigen,
as disclosed in Protocol 4 suggested that the binding of antibodies
comprising humanised 1H12 heavy and light chains (Ab2-Ab5) were
broadly similar to the antibody comprising the murine VH and VL
domains (Abi) (see FIG. 1).
[0426] SPR measurements of antibody affinity using Axl-Strep-His
antigen indicated that Ab2, Ab3, and Ab5 had higher affinity for
Axl-Strep-His than Abi (see Table 2).
[0427] SPR measurements of antibody affinity using Axl-Fc antigen
indicated that Ab2 and Ab4 had higher affinity for Axl-Fc than Abi
(see Table 2).
TABLE-US-00008 TABLE 2 AXL-Strep-His antigen AXL-Fc antigen
Antibody ka (1/Ms) kd (1/s) KD1 (nM) ka (1/Ms) kd (1/s) KD (nM) Ab1
1.31E+04 5.33E-04 40.7** 3.09E+04 1.42E-04 4.6 Ab2 1.32E+04
4.41E-04 33.4 8.37E+04 1.54E-04 1.84 Ab3 1.92E+04 6.36E-04 33.1
2.45E+04 2.00E-04 8.5 Ab4 9759 5.90E-04 60.4 2.90E+05 3.96E-04 1.37
Ab5 1.89E+04 4.35E-04 23 2.06E+04 1.59E-04 7.69 **The observed
binding data for 1H12 chimeric antibody did not fit monovalent or
bivalent algorithms well, so in this one case, a "heterogeneous
ligand" model was used. For all other binding data, the bivalent
ligand model was used.
Abbreviations
[0428] 5 .ANG.+ set The FW residues in the 5 .ANG. CDR envelope,
defined by the homology model, together with the canonical, vernier
and VH/VK interface residues [0429] 1H12 The anti-AXL mouse
monoclonal antibody [0430] 1H12 VK VK of mouse 1H12 antibody [0431]
1H12RKA1 Humanised version, A1, of 1H12 VK [0432] 1H12RHA Humanised
version, A, of 1H12 VH [0433] 1H12RHA x IgG1k antibody comprising
the VH and VK constructs 1H12RHA and [0434] 1H12RKA 1H12RKA
respectively, functionally contiguous with the constant regions of
human IgG1 and Ig-kappa heavy and light chains respectively [0435]
A Adenine [0436] .ANG. Angstrom [0437] Ac acetyl [0438] Acm
acetamidomethyl [0439] Alloc allyloxycarbonyl [0440] B7 The
anti-LPA antibody product of mouse hybridoma clone B7 [0441] Boc
di-tert-butyl dicarbonate [0442] bp base pairs [0443] Bzl benzyl,
where Bzl-OMe is methoxybenzyl and Bzl-Me is methylbenzene [0444] C
Cytosine [0445] Cbz or Z benzyloxy-carbonyl, where Z--Cl and Z--Br
are chloro- and bromobenzyloxy carbonyl respectively [0446] CDR
Complementarity determining region in the immunoglobulin variable
regions, defined using the Kabat numbering system [0447] CHO
Chinese hamster ovary cell line [0448] D-gene Diversity gene [0449]
DMF N,N-dimethylformamide [0450] DNA Deoxyribonucleic acid [0451]
Dnp dinitrophenyl [0452] DTT dithiothreitol [0453] Fmoc
9H-fluoren-9-ylmethoxycarbonyl [0454] FW Framework region: the
immunoglobulin variable regions excluding the CDR regions [0455] G
Guanine [0456] IgG Immunoglobulin G [0457] imp N-10 imine
protecting group: 3-(2-methoxyethoxy)propanoate-Val-Ala-PAB [0458]
MC-OSu maleimidocaproyl-O--N-succinimide [0459] J-gene Joining gene
[0460] Kabat an immunoglobulin alignment and numbering system
pioneered by Elvin A Kabat [0461] mAb monoclonal antibody [0462]
Moc methoxycarbonyl [0463] MP maleimidopropanamide [0464] Mtr
4-methoxy-2,3,6-trimethtylbenzenesulfonyl [0465] PAB
para-aminobenzyloxycarbonyl [0466] PEG ethyleneoxy [0467] PNZ
p-nitrobenzyl carbamate [0468] Psec
2-(phenylsulfonyl)ethoxycarbonyl [0469] T Thymine [0470] TBDMS
tert-butyldimethylsilyl [0471] TBDPS tert-butyldiphenylsilyl [0472]
t-Bu tert-butyl [0473] Teoc 2-(trimethylsilyl)ethoxycarbonyl [0474]
Tos tosyl [0475] Troc 2,2,2-trichlorethoxycarbonyl chloride [0476]
Trt trityl [0477] V region The segment of IgG chains which is
variable in sequence between different antibodies. It extends to
Kabat residue 109 in the light chain and 113 in the heavy chain.
[0478] VCI Framework residue classified as vernier or canonical or
VH-VL interface [0479] V-gene The gene segment that is rearranged,
together with a J (and D for VH) gene, to generate a complete VK
(or VH) [0480] VH Immunoglobulin heavy chain variable region [0481]
VK Immunoglobulin kappa light chain variable region [0482] Xan
xanthyl
REFERENCES
[0482] [0483] [1] C. Chothia, et al., "Domain association in
immunoglobulin molecules. The packing of variable domains," J Mol.
Biol. 186(3), 651 (1985). [0484] [2] J. Foote and G. Winter,
"Antibody framework residues affecting the conformation of the
hypervariable loops," J Mol. Biol. 224(2), 487 (1992). [0485] [3]
E. A Kabat, et al., sequences of proteins of immunological
interest, 5 ed. (NIH National Technical Information Service, 1991).
[0486] [4] V. Morea, A. M. Lesk, and A. Tramontano, "Antibody
modeling: implications for engineering and design," Methods 20(3),
267 (2000).
STATEMENTS OF DISCLOSURE
[0487] 1. An isolated humanized antibody that binds to AXL, wherein
the isolated humanized antibody comprises a heavy chain variable
region having the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2
or SEQ ID NO: 3. 2. The isolated humanized antibody according to
statement 1, wherein the isolated humanized antibody further
comprises a light chain variable region having the amino acid
sequence of SEQ ID NO: 4, 5, 6, 7, or 8; and, optionally, comprises
a constant region derived from one or more human antibodies. 3. The
isolated humanized antibody according to either one of statements 1
or 2, wherein the isolated humanized antibody comprises: [0488] (i)
a heavy chain variable region having the amino acid sequence of SEQ
ID NO: 1 and a light chain variable region having the amino acid
sequence of SEQ ID NO: 4; [0489] (ii) a heavy chain variable region
having the amino acid sequence of SEQ ID NO: 1 and a light chain
variable region having the amino acid sequence of SEQ ID NO: 5;
[0490] (iii) a heavy chain variable region having the amino acid
sequence of SEQ ID NO: 1 and a light chain variable region having
the amino acid sequence of SEQ ID NO: 6; [0491] (iv) a heavy chain
variable region having the amino acid sequence of SEQ ID NO: 1 and
a light chain variable region having the amino acid sequence of SEQ
ID NO: 7; [0492] (v) a heavy chain variable region having the amino
acid sequence of SEQ ID NO: 1 and a light chain variable region
having the amino acid sequence of SEQ ID NO: 8; [0493] (vi) a heavy
chain variable region having the amino acid sequence of SEQ ID NO:
2 and a light chain variable region having the amino acid sequence
of SEQ ID NO: 4; [0494] (vii) a heavy chain variable region having
the amino acid sequence of SEQ ID NO: 2 and a light chain variable
region having the amino acid sequence of SEQ ID NO: 5; [0495]
(viii) a heavy chain variable region having the amino acid sequence
of SEQ ID NO: 2 and a light chain variable region having the amino
acid sequence of SEQ ID NO: 6; [0496] (ix) a heavy chain variable
region having the amino acid sequence of SEQ ID NO: 2 and a light
chain variable region having the amino acid sequence of SEQ ID NO:
7; [0497] (x) a heavy chain variable region having the amino acid
sequence of SEQ ID NO: 2 and a light chain variable region having
the amino acid sequence of SEQ ID NO: 8; [0498] (xi) a heavy chain
variable region having the amino acid sequence of SEQ ID NO: 3 and
a light chain variable region having the amino acid sequence of SEQ
ID NO: 4; [0499] (xii) a heavy chain variable region having the
amino acid sequence of SEQ ID NO: 3 and a light chain variable
region having the amino acid sequence of SEQ ID NO: 5; [0500]
(xiii) a heavy chain variable region having the amino acid sequence
of SEQ ID NO: 3 and a light chain variable region having the amino
acid sequence of SEQ ID NO: 6; [0501] (xiv) a heavy chain variable
region having the amino acid sequence of SEQ ID NO: 3 and a light
chain variable region having the amino acid sequence of SEQ ID NO:
7; or [0502] (xv) a heavy chain variable region having the amino
acid sequence of SEQ ID NO: 3 and a light chain variable region
having the amino acid sequence of SEQ ID NO: 8. 4. The humanized
antibody according to any one of statements 1 to 3, wherein said
antibody binds human AXL with an affinity (Kd) of at least
10.sup.-6 M. 5. The humanized antibody according to statement 3,
wherein said antibody binds human AXL with an affinity (Kd) of at
least 10.sup.-9 M. 6. The humanized antibody according to any one
of statements 1 to 5, wherein said antibody competitively inhibits
the binding to human AXL of an antibody comprising a heavy chain
variable region having the amino acid sequence of SEQ ID NO: 1 and
a light chain variable region having the amino acid sequence of SEQ
ID NO: 4. 7. The humanized antibody according to any one of
statements 1 to 6, wherein said antibody binds the Axl-Strep-His
antigen with an affinity (Kd) of no more 0.6 of the Kd of an
antibody comprising a VH domain having the sequence according to
SEQ ID NO. 1, a VL domain having the sequence according to SEQ ID
NO. 4, and a constant region derived from one or more human
antibodies. 8. The humanized antibody according to any one of
statements 1 to 7, wherein said antibody binds the Axl-Fc antigen
with an affinity (Kd) of no more 0.5 of the Kd of an antibody
comprising a VH domain having the sequence according to SEQ ID NO.
1, a VL domain having the sequence according to SEQ ID NO. 4, and a
constant region derived from one or more human antibodies. 9. The
humanized antibody according to any one of statements 1 to 8,
wherein said antibody competitively inhibits the binding to human
AXL of the mouse 1H12 antibody. 10. The humanized antibody
according to any one of statements 1 to 9, wherein said antibody
has a pI of at least 8.00. 11. The humanized antibody according to
statement 10 wherein the antibody has a pI of at least 8.15. 12.
The humanized antibody according to any one of statements 1 to 11,
wherein said antibody or antibody fragment has a constant region of
either isotype IgG1, IgG2, IgG3 or IgG4, or a mutated IgG constant
region, and optionally a light chain constant region of isotype
kappa or lambda. 13. The humanized antibody according to any one of
statements 1 to 12, wherein the humanized antibody fragment is a
scFv, Fab or F(ab').sub.2. 14. The antibody according to any one of
statements 1 to 13, for use in therapy. 15. The antibody according
to any one of statements 1 to 14, for use in the treatment of a
proliferative disease in a subject. 16. The antibody according to
any one of statements 1 to 15, for use in the treatment of a
proliferative disease in a subject, wherein the subject has raised
levels of AXL, Akt3, or GAS6 and wherein the method comprises
identifying that the subject has raised levels of AXL, Akt3, or
GAS6 and administering the antibody or conjugate to the patient.
17. The antibody or drug-conjugate according to any one of
statements 1 to 16, for use in the treatment of a proliferative
disease in a subject, wherein the proliferative disease is
associated with raised levels of AXL, Akt3, or GAS6, the method
comprising administering the conjugate to the patient. 18. The
drug-conjugate according to any one of statements 15 to 17, wherein
the disease is cancer. 19. A pharmaceutical composition comprising
the antibody of any one of statements 1 to 13 and a
pharmaceutically acceptable diluent, carrier or excipient. 20. The
pharmaceutical composition of statement 19 further comprising a
therapeutically effective amount of a chemotherapeutic agent. 21.
Use of an antibody according to any one of statements 1 to 13 in
the preparation of a medicament for use in the treatment of a
proliferative disease in a subject. 22. A method of treating cancer
comprising administering to a patient the pharmaceutical
composition according to either one of statements 20 or 21. 23. The
method of statement 22 wherein the patient is administered a
chemotherapeutic agent, in combination with the composition. 24. A
polynucleotide encoding a humanized antibody according to any one
of statements 1 to 13. 25. A vector comprising the polynucleotide
of statement 24. 26. The vector of statement 25 wherein the vector
is an expression vector. 27. A host cell comprising a vector
according to either one of statements 25 or 26. 28. The host cell
according to statement 27 wherein the host cell is prokaryotic,
eukaryotic, or mammalian. 29. A method of selecting an individual
for treatment with the according to any one of statements 1 to 13,
or with the pharmaceutical composition of either one of statements
20 or 21, which method comprises assessing the level of AXL; [0503]
wherein individuals having raised levels of AXL are selected for
treatment. 30. A method of timing the application of treatment of
an individual with the antibody or drug-conjugate according to any
one of statements 1 to 13, or with the pharmaceutical composition
of either one of statements 20 or 21, which method comprises
assessing the level of AXL; [0504] wherein the treatment is applied
if the individual has raised levels of AXL. 31. The method
according to either one of statements 29 or 30, wherein the
individual has cancer and treatment reduces tumour volume.
TABLE-US-00009 [0504] SEQUENCES [1H12VH] SEQ ID NO: 1
MGFKMESQFQVFVFVFLWLSGVDGEVQLVESGGDLVKPGGSLKLSCAASG
FTFSSYGMSWVRQTPDKRLEWVATISSGGSYTYYPDSVKGRFTISRDNAK
NTLYLQMSSLKSEDTAMYYCARHPIYYTYDDTMDYWGQGTSVTVSS [1H12RHA] SEQ ID NO:
2 MGFKMESQFQVFVFVFLWLSGVDGQVQLVESGGGVVQPGRSLRLSCAASG
FTFSSYGMSWVRQAPGKGLEWVATISSGGSYTYYPDSVKGRFTISRDNSK
NTLYLQMNSLRAEDTAVYYCARHPIYYTYDDTMDYWGQGTTVTVSS [1H12RHB] SEQ ID NO:
3 MGFKMESQFQVFVFVFLWLSGVDGEVQLVESGGGLVQPGGSLRLSCAASG
FTFSSYGMSWVRQAPGKGLEWVATISSGGSYTYYPDSVKGRFTISRDNAK
NSLYLQMNSLRAEDTAVYYCARHPIYYTYDDTMDYWGQGTLVTVSS [1H12VK] SEQ ID NO:
4 MGFKMESQFQVFVFVFLWLSGVDGENVLTQSPAIMAASPGEKVTMTCSAS
SSVSSGNFHWYQQKPGTSPKLWIYRTSNLASGVPARFSGSGSGTSYSLTI
SSMEAEDAATYYCQQWSGYPWTFGGGTKLEIK [1H12RKA] SEQ ID NO: 5
MGFKMESQFQVFVFVFLWLSGVDGEIVLTQSPATLSLSPGERATLSCSAS
SSVSSGNFHWYQQKPGLAPRLLIYRTSNLASGIPDRFSGSGSGTDFTLTI
SRLEPEDFAVYYCQQWSGYPWTFGPGTKVDIK [1H12RKA1] SEQ ID NO: 6
MGFKMESQFQVFVFVFLWLSGVDGENVLTQSPATLSLSPGERATLSCSAS
SSVSSGNFHWYQQKPGLAPRLWIYRTSNLASGIPDRFSGSGSGTDYTLTI
SRLEPEDFAVYYCQQWSGYPWTFGPGTKVDIK [1H12RKB] SEQ ID NO: 7
MGFKMESQFQVFVFVFLWLSGVDGEIVLTQSPGTLSLSPGERATLSCSAS
SSVSSGNFHWYQQKPGLAPRLLIYRTSNLASGIPARFSGSGSGTDFTLTI
SSLEPEDFAVYYCQQWSGYPWTFGGGTKLEIK [1H12RKB1] SEQ ID NO: 8
MGFKMESQFQVFVFVFLWLSGVDGENVLTQSPGTLSLSPGERATLSCSAS
SSVSSGNFHWYQQKPGLAPRLWIYRTSNLASGIPARFSGSGSGTDYTLTI
SSLEPEDFAVYYCQQWSGYPWTFGGGTKLEIK [Human Axl] SEQ ID NO: 9
MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGNPGNITGARGL
TGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVS
QLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEPEDRTV
AANTPFNLSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRSLHVPGLNKT
SSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTELEVAWTPGLS
GIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLH
PHTPYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAF
VHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQGDGSVS
NLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQPVHQLVKEPSTPAFSWPW
WYVLLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVERGELVVRYRV
RKSYSRRTTEATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAV
MEGQLNQDDSILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRL
IGVCFQGSERESFPAPVVILPFMKHGDLHSFLLYSRLGDQPVYLPTQMLV
KFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNG
DYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPY
PGVENSEIYDYLRRGNRLKQPADCLDGLYALMSRCWELNPQDRPSFTELR
EDLENTLKALPPAQEPDEILYVNMDEGGGYPEPPGAAGGADPPTQPDPKD
SCSCLTAAEVHPAGRYVLCPSTTPSPAQPADRGSPAAPGQEDGA [Murine Axl] SEQ ID
NO: 10 MGRVPLAWWLALCCWGCAAHKDTQTEAGSPFVGNPGNITGARGLTGTLRC
ELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISA
LQLSDAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPF
NLSCQAQGPPEPVTLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCE
AHNAKGVTTSRTATITVLPQRPHHLHVVSRQPTELEVAWTPGLSGIYPLT
HCNLQAVLSDDGVGIWLGKSDPPEDPLTLQVSVPPHQLRLEKLLPHTPYH
IRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNGSQVLVRWQEP
RVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVSV
TAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPWWYVLLG
ALVAAACVLILALFLVHRRKKETRYGEVFEPTVERGELVVRYRVRKSYSR
RTTEATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLN
QDDSILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQ
GSDREGFPEPVVILPFMKHGDLHSFLLYSRLGDQPVFLPTQMLVKFMADI
ASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNGDYYRQG
RIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENS
EIYDYLRQGNRLKQPVDCLDGLYALMSRCWELNPRDRPSFAELREDLENT
LKALPPAQEPDEILYVNMDEGGSHLEPRGAAGGADPPTQPDPKDSCSCLT
AADVHSAGRYVLCPSTAPGPTLSADRGCPAPPGQEDGA
Sequence CWU 1
1
101146PRTArtificial sequenceSynthetic heavy chain variable region
1H12VH 1Met Gly Phe Lys Met Glu Ser Gln Phe Gln Val Phe Val Phe Val
Phe1 5 10 15Leu Trp Leu Ser Gly Val Asp Gly Glu Val Gln Leu Val Glu
Ser Gly 20 25 30Gly Asp Leu Val Lys Pro Gly Gly Ser Leu Lys Leu Ser
Cys Ala Ala 35 40 45Ser Gly Phe Thr Phe Ser Ser Tyr Gly Met Ser Trp
Val Arg Gln Thr 50 55 60Pro Asp Lys Arg Leu Glu Trp Val Ala Thr Ile
Ser Ser Gly Gly Ser65 70 75 80Tyr Thr Tyr Tyr Pro Asp Ser Val Lys
Gly Arg Phe Thr Ile Ser Arg 85 90 95Asp Asn Ala Lys Asn Thr Leu Tyr
Leu Gln Met Ser Ser Leu Lys Ser 100 105 110Glu Asp Thr Ala Met Tyr
Tyr Cys Ala Arg His Pro Ile Tyr Tyr Thr 115 120 125Tyr Asp Asp Thr
Met Asp Tyr Trp Gly Gln Gly Thr Ser Val Thr Val 130 135 140Ser
Ser1452146PRTArtificial sequenceSynthetic heavy chain variable
region 1H12RHA 2Met Gly Phe Lys Met Glu Ser Gln Phe Gln Val Phe Val
Phe Val Phe1 5 10 15Leu Trp Leu Ser Gly Val Asp Gly Gln Val Gln Leu
Val Glu Ser Gly 20 25 30Gly Gly Val Val Gln Pro Gly Arg Ser Leu Arg
Leu Ser Cys Ala Ala 35 40 45Ser Gly Phe Thr Phe Ser Ser Tyr Gly Met
Ser Trp Val Arg Gln Ala 50 55 60Pro Gly Lys Gly Leu Glu Trp Val Ala
Thr Ile Ser Ser Gly Gly Ser65 70 75 80Tyr Thr Tyr Tyr Pro Asp Ser
Val Lys Gly Arg Phe Thr Ile Ser Arg 85 90 95Asp Asn Ser Lys Asn Thr
Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala 100 105 110Glu Asp Thr Ala
Val Tyr Tyr Cys Ala Arg His Pro Ile Tyr Tyr Thr 115 120 125Tyr Asp
Asp Thr Met Asp Tyr Trp Gly Gln Gly Thr Thr Val Thr Val 130 135
140Ser Ser1453146PRTArtificial sequenceSynthetic heavy chain
variable region 1H12RHB 3Met Gly Phe Lys Met Glu Ser Gln Phe Gln
Val Phe Val Phe Val Phe1 5 10 15Leu Trp Leu Ser Gly Val Asp Gly Glu
Val Gln Leu Val Glu Ser Gly 20 25 30Gly Gly Leu Val Gln Pro Gly Gly
Ser Leu Arg Leu Ser Cys Ala Ala 35 40 45Ser Gly Phe Thr Phe Ser Ser
Tyr Gly Met Ser Trp Val Arg Gln Ala 50 55 60Pro Gly Lys Gly Leu Glu
Trp Val Ala Thr Ile Ser Ser Gly Gly Ser65 70 75 80Tyr Thr Tyr Tyr
Pro Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg 85 90 95Asp Asn Ala
Lys Asn Ser Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala 100 105 110Glu
Asp Thr Ala Val Tyr Tyr Cys Ala Arg His Pro Ile Tyr Tyr Thr 115 120
125Tyr Asp Asp Thr Met Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val
130 135 140Ser Ser1454132PRTArtificial sequenceSynthetic light
chain variable region 1H12VK 4Met Gly Phe Lys Met Glu Ser Gln Phe
Gln Val Phe Val Phe Val Phe1 5 10 15Leu Trp Leu Ser Gly Val Asp Gly
Glu Asn Val Leu Thr Gln Ser Pro 20 25 30Ala Ile Met Ala Ala Ser Pro
Gly Glu Lys Val Thr Met Thr Cys Ser 35 40 45Ala Ser Ser Ser Val Ser
Ser Gly Asn Phe His Trp Tyr Gln Gln Lys 50 55 60Pro Gly Thr Ser Pro
Lys Leu Trp Ile Tyr Arg Thr Ser Asn Leu Ala65 70 75 80Ser Gly Val
Pro Ala Arg Phe Ser Gly Ser Gly Ser Gly Thr Ser Tyr 85 90 95Ser Leu
Thr Ile Ser Ser Met Glu Ala Glu Asp Ala Ala Thr Tyr Tyr 100 105
110Cys Gln Gln Trp Ser Gly Tyr Pro Trp Thr Phe Gly Gly Gly Thr Lys
115 120 125Leu Glu Ile Lys 1305132PRTArtificial sequenceSynthetic
light chain variable region 1H12RKA 5Met Gly Phe Lys Met Glu Ser
Gln Phe Gln Val Phe Val Phe Val Phe1 5 10 15Leu Trp Leu Ser Gly Val
Asp Gly Glu Ile Val Leu Thr Gln Ser Pro 20 25 30Ala Thr Leu Ser Leu
Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Ser 35 40 45Ala Ser Ser Ser
Val Ser Ser Gly Asn Phe His Trp Tyr Gln Gln Lys 50 55 60Pro Gly Leu
Ala Pro Arg Leu Leu Ile Tyr Arg Thr Ser Asn Leu Ala65 70 75 80Ser
Gly Ile Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe 85 90
95Thr Leu Thr Ile Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr
100 105 110Cys Gln Gln Trp Ser Gly Tyr Pro Trp Thr Phe Gly Pro Gly
Thr Lys 115 120 125Val Asp Ile Lys 1306132PRTArtificial
sequenceSynthetic light chain variable region 1H12RKA1 6Met Gly Phe
Lys Met Glu Ser Gln Phe Gln Val Phe Val Phe Val Phe1 5 10 15Leu Trp
Leu Ser Gly Val Asp Gly Glu Asn Val Leu Thr Gln Ser Pro 20 25 30Ala
Thr Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Ser 35 40
45Ala Ser Ser Ser Val Ser Ser Gly Asn Phe His Trp Tyr Gln Gln Lys
50 55 60Pro Gly Leu Ala Pro Arg Leu Trp Ile Tyr Arg Thr Ser Asn Leu
Ala65 70 75 80Ser Gly Ile Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly
Thr Asp Tyr 85 90 95Thr Leu Thr Ile Ser Arg Leu Glu Pro Glu Asp Phe
Ala Val Tyr Tyr 100 105 110Cys Gln Gln Trp Ser Gly Tyr Pro Trp Thr
Phe Gly Pro Gly Thr Lys 115 120 125Val Asp Ile Lys
1307132PRTArtificial sequenceSynthetic light chain variable region
1H12RKB 7Met Gly Phe Lys Met Glu Ser Gln Phe Gln Val Phe Val Phe
Val Phe1 5 10 15Leu Trp Leu Ser Gly Val Asp Gly Glu Ile Val Leu Thr
Gln Ser Pro 20 25 30Gly Thr Leu Ser Leu Ser Pro Gly Glu Arg Ala Thr
Leu Ser Cys Ser 35 40 45Ala Ser Ser Ser Val Ser Ser Gly Asn Phe His
Trp Tyr Gln Gln Lys 50 55 60Pro Gly Leu Ala Pro Arg Leu Leu Ile Tyr
Arg Thr Ser Asn Leu Ala65 70 75 80Ser Gly Ile Pro Ala Arg Phe Ser
Gly Ser Gly Ser Gly Thr Asp Phe 85 90 95Thr Leu Thr Ile Ser Ser Leu
Glu Pro Glu Asp Phe Ala Val Tyr Tyr 100 105 110Cys Gln Gln Trp Ser
Gly Tyr Pro Trp Thr Phe Gly Gly Gly Thr Lys 115 120 125Leu Glu Ile
Lys 1308132PRTArtificial sequenceSynthetic light chain variable
region 1H12RKB1 8Met Gly Phe Lys Met Glu Ser Gln Phe Gln Val Phe
Val Phe Val Phe1 5 10 15Leu Trp Leu Ser Gly Val Asp Gly Glu Asn Val
Leu Thr Gln Ser Pro 20 25 30Gly Thr Leu Ser Leu Ser Pro Gly Glu Arg
Ala Thr Leu Ser Cys Ser 35 40 45Ala Ser Ser Ser Val Ser Ser Gly Asn
Phe His Trp Tyr Gln Gln Lys 50 55 60Pro Gly Leu Ala Pro Arg Leu Trp
Ile Tyr Arg Thr Ser Asn Leu Ala65 70 75 80Ser Gly Ile Pro Ala Arg
Phe Ser Gly Ser Gly Ser Gly Thr Asp Tyr 85 90 95Thr Leu Thr Ile Ser
Ser Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr 100 105 110Cys Gln Gln
Trp Ser Gly Tyr Pro Trp Thr Phe Gly Gly Gly Thr Lys 115 120 125Leu
Glu Ile Lys 1309894PRTHomo sapiens 9Met Ala Trp Arg Cys Pro Arg Met
Gly Arg Val Pro Leu Ala Trp Cys1 5 10 15Leu Ala Leu Cys Gly Trp Ala
Cys Met Ala Pro Arg Gly Thr Gln Ala 20 25 30Glu Glu Ser Pro Phe Val
Gly Asn Pro Gly Asn Ile Thr Gly Ala Arg 35 40 45Gly Leu Thr Gly Thr
Leu Arg Cys Gln Leu Gln Val Gln Gly Glu Pro 50 55 60Pro Glu Val His
Trp Leu Arg Asp Gly Gln Ile Leu Glu Leu Ala Asp65 70 75 80Ser Thr
Gln Thr Gln Val Pro Leu Gly Glu Asp Glu Gln Asp Asp Trp 85 90 95Ile
Val Val Ser Gln Leu Arg Ile Thr Ser Leu Gln Leu Ser Asp Thr 100 105
110Gly Gln Tyr Gln Cys Leu Val Phe Leu Gly His Gln Thr Phe Val Ser
115 120 125Gln Pro Gly Tyr Val Gly Leu Glu Gly Leu Pro Tyr Phe Leu
Glu Glu 130 135 140Pro Glu Asp Arg Thr Val Ala Ala Asn Thr Pro Phe
Asn Leu Ser Cys145 150 155 160Gln Ala Gln Gly Pro Pro Glu Pro Val
Asp Leu Leu Trp Leu Gln Asp 165 170 175Ala Val Pro Leu Ala Thr Ala
Pro Gly His Gly Pro Gln Arg Ser Leu 180 185 190His Val Pro Gly Leu
Asn Lys Thr Ser Ser Phe Ser Cys Glu Ala His 195 200 205Asn Ala Lys
Gly Val Thr Thr Ser Arg Thr Ala Thr Ile Thr Val Leu 210 215 220Pro
Gln Gln Pro Arg Asn Leu His Leu Val Ser Arg Gln Pro Thr Glu225 230
235 240Leu Glu Val Ala Trp Thr Pro Gly Leu Ser Gly Ile Tyr Pro Leu
Thr 245 250 255His Cys Thr Leu Gln Ala Val Leu Ser Asp Asp Gly Met
Gly Ile Gln 260 265 270Ala Gly Glu Pro Asp Pro Pro Glu Glu Pro Leu
Thr Ser Gln Ala Ser 275 280 285Val Pro Pro His Gln Leu Arg Leu Gly
Ser Leu His Pro His Thr Pro 290 295 300Tyr His Ile Arg Val Ala Cys
Thr Ser Ser Gln Gly Pro Ser Ser Trp305 310 315 320Thr His Trp Leu
Pro Val Glu Thr Pro Glu Gly Val Pro Leu Gly Pro 325 330 335Pro Glu
Asn Ile Ser Ala Thr Arg Asn Gly Ser Gln Ala Phe Val His 340 345
350Trp Gln Glu Pro Arg Ala Pro Leu Gln Gly Thr Leu Leu Gly Tyr Arg
355 360 365Leu Ala Tyr Gln Gly Gln Asp Thr Pro Glu Val Leu Met Asp
Ile Gly 370 375 380Leu Arg Gln Glu Val Thr Leu Glu Leu Gln Gly Asp
Gly Ser Val Ser385 390 395 400Asn Leu Thr Val Cys Val Ala Ala Tyr
Thr Ala Ala Gly Asp Gly Pro 405 410 415Trp Ser Leu Pro Val Pro Leu
Glu Ala Trp Arg Pro Gly Gln Ala Gln 420 425 430Pro Val His Gln Leu
Val Lys Glu Pro Ser Thr Pro Ala Phe Ser Trp 435 440 445Pro Trp Trp
Tyr Val Leu Leu Gly Ala Val Val Ala Ala Ala Cys Val 450 455 460Leu
Ile Leu Ala Leu Phe Leu Val His Arg Arg Lys Lys Glu Thr Arg465 470
475 480Tyr Gly Glu Val Phe Glu Pro Thr Val Glu Arg Gly Glu Leu Val
Val 485 490 495Arg Tyr Arg Val Arg Lys Ser Tyr Ser Arg Arg Thr Thr
Glu Ala Thr 500 505 510Leu Asn Ser Leu Gly Ile Ser Glu Glu Leu Lys
Glu Lys Leu Arg Asp 515 520 525Val Met Val Asp Arg His Lys Val Ala
Leu Gly Lys Thr Leu Gly Glu 530 535 540Gly Glu Phe Gly Ala Val Met
Glu Gly Gln Leu Asn Gln Asp Asp Ser545 550 555 560Ile Leu Lys Val
Ala Val Lys Thr Met Lys Ile Ala Ile Cys Thr Arg 565 570 575Ser Glu
Leu Glu Asp Phe Leu Ser Glu Ala Val Cys Met Lys Glu Phe 580 585
590Asp His Pro Asn Val Met Arg Leu Ile Gly Val Cys Phe Gln Gly Ser
595 600 605Glu Arg Glu Ser Phe Pro Ala Pro Val Val Ile Leu Pro Phe
Met Lys 610 615 620His Gly Asp Leu His Ser Phe Leu Leu Tyr Ser Arg
Leu Gly Asp Gln625 630 635 640Pro Val Tyr Leu Pro Thr Gln Met Leu
Val Lys Phe Met Ala Asp Ile 645 650 655Ala Ser Gly Met Glu Tyr Leu
Ser Thr Lys Arg Phe Ile His Arg Asp 660 665 670Leu Ala Ala Arg Asn
Cys Met Leu Asn Glu Asn Met Ser Val Cys Val 675 680 685Ala Asp Phe
Gly Leu Ser Lys Lys Ile Tyr Asn Gly Asp Tyr Tyr Arg 690 695 700Gln
Gly Arg Ile Ala Lys Met Pro Val Lys Trp Ile Ala Ile Glu Ser705 710
715 720Leu Ala Asp Arg Val Tyr Thr Ser Lys Ser Asp Val Trp Ser Phe
Gly 725 730 735Val Thr Met Trp Glu Ile Ala Thr Arg Gly Gln Thr Pro
Tyr Pro Gly 740 745 750Val Glu Asn Ser Glu Ile Tyr Asp Tyr Leu Arg
Arg Gly Asn Arg Leu 755 760 765Lys Gln Pro Ala Asp Cys Leu Asp Gly
Leu Tyr Ala Leu Met Ser Arg 770 775 780Cys Trp Glu Leu Asn Pro Gln
Asp Arg Pro Ser Phe Thr Glu Leu Arg785 790 795 800Glu Asp Leu Glu
Asn Thr Leu Lys Ala Leu Pro Pro Ala Gln Glu Pro 805 810 815Asp Glu
Ile Leu Tyr Val Asn Met Asp Glu Gly Gly Gly Tyr Pro Glu 820 825
830Pro Pro Gly Ala Ala Gly Gly Ala Asp Pro Pro Thr Gln Pro Asp Pro
835 840 845Lys Asp Ser Cys Ser Cys Leu Thr Ala Ala Glu Val His Pro
Ala Gly 850 855 860Arg Tyr Val Leu Cys Pro Ser Thr Thr Pro Ser Pro
Ala Gln Pro Ala865 870 875 880Asp Arg Gly Ser Pro Ala Ala Pro Gly
Gln Glu Asp Gly Ala 885 89010888PRTMus musculus 10Met Gly Arg Val
Pro Leu Ala Trp Trp Leu Ala Leu Cys Cys Trp Gly1 5 10 15Cys Ala Ala
His Lys Asp Thr Gln Thr Glu Ala Gly Ser Pro Phe Val 20 25 30Gly Asn
Pro Gly Asn Ile Thr Gly Ala Arg Gly Leu Thr Gly Thr Leu 35 40 45Arg
Cys Glu Leu Gln Val Gln Gly Glu Pro Pro Glu Val Val Trp Leu 50 55
60Arg Asp Gly Gln Ile Leu Glu Leu Ala Asp Asn Thr Gln Thr Gln Val65
70 75 80Pro Leu Gly Glu Asp Trp Gln Asp Glu Trp Lys Val Val Ser Gln
Leu 85 90 95Arg Ile Ser Ala Leu Gln Leu Ser Asp Ala Gly Glu Tyr Gln
Cys Met 100 105 110Val His Leu Glu Gly Arg Thr Phe Val Ser Gln Pro
Gly Phe Val Gly 115 120 125Leu Glu Gly Leu Pro Tyr Phe Leu Glu Glu
Pro Glu Asp Lys Ala Val 130 135 140Pro Ala Asn Thr Pro Phe Asn Leu
Ser Cys Gln Ala Gln Gly Pro Pro145 150 155 160Glu Pro Val Thr Leu
Leu Trp Leu Gln Asp Ala Val Pro Leu Ala Pro 165 170 175Val Thr Gly
His Ser Ser Gln His Ser Leu Gln Thr Pro Gly Leu Asn 180 185 190Lys
Thr Ser Ser Phe Ser Cys Glu Ala His Asn Ala Lys Gly Val Thr 195 200
205Thr Ser Arg Thr Ala Thr Ile Thr Val Leu Pro Gln Arg Pro His His
210 215 220Leu His Val Val Ser Arg Gln Pro Thr Glu Leu Glu Val Ala
Trp Thr225 230 235 240Pro Gly Leu Ser Gly Ile Tyr Pro Leu Thr His
Cys Asn Leu Gln Ala 245 250 255Val Leu Ser Asp Asp Gly Val Gly Ile
Trp Leu Gly Lys Ser Asp Pro 260 265 270Pro Glu Asp Pro Leu Thr Leu
Gln Val Ser Val Pro Pro His Gln Leu 275 280 285Arg Leu Glu Lys Leu
Leu Pro His Thr Pro Tyr His Ile Arg Ile Ser 290 295 300Cys Ser Ser
Ser Gln Gly Pro Ser Pro Trp Thr His Trp Leu Pro Val305 310 315
320Glu Thr Thr Glu Gly Val Pro Leu Gly Pro Pro Glu Asn Val Ser Ala
325 330 335Met Arg Asn Gly Ser Gln Val Leu Val Arg Trp Gln Glu Pro
Arg Val 340 345 350Pro Leu Gln Gly Thr Leu Leu Gly Tyr Arg Leu Ala
Tyr Arg Gly Gln 355 360 365Asp Thr Pro Glu Val Leu Met Asp Ile Gly
Leu Thr Arg Glu Val Thr 370 375 380Leu Glu Leu Arg Gly Asp Arg Pro
Val Ala Asn Leu Thr Val Ser Val385 390 395 400Thr Ala Tyr Thr Ser
Ala Gly Asp Gly Pro Trp Ser Leu Pro Val Pro
405 410 415Leu Glu Pro Trp Arg Pro Gly Gln Gly Gln Pro Leu His His
Leu Val 420 425 430Ser Glu Pro Pro Pro Arg Ala Phe Ser Trp Pro Trp
Trp Tyr Val Leu 435 440 445Leu Gly Ala Leu Val Ala Ala Ala Cys Val
Leu Ile Leu Ala Leu Phe 450 455 460Leu Val His Arg Arg Lys Lys Glu
Thr Arg Tyr Gly Glu Val Phe Glu465 470 475 480Pro Thr Val Glu Arg
Gly Glu Leu Val Val Arg Tyr Arg Val Arg Lys 485 490 495Ser Tyr Ser
Arg Arg Thr Thr Glu Ala Thr Leu Asn Ser Leu Gly Ile 500 505 510Ser
Glu Glu Leu Lys Glu Lys Leu Arg Asp Val Met Val Asp Arg His 515 520
525Lys Val Ala Leu Gly Lys Thr Leu Gly Glu Gly Glu Phe Gly Ala Val
530 535 540Met Glu Gly Gln Leu Asn Gln Asp Asp Ser Ile Leu Lys Val
Ala Val545 550 555 560Lys Thr Met Lys Ile Ala Ile Cys Thr Arg Ser
Glu Leu Glu Asp Phe 565 570 575Leu Ser Glu Ala Val Cys Met Lys Glu
Phe Asp His Pro Asn Val Met 580 585 590Arg Leu Ile Gly Val Cys Phe
Gln Gly Ser Asp Arg Glu Gly Phe Pro 595 600 605Glu Pro Val Val Ile
Leu Pro Phe Met Lys His Gly Asp Leu His Ser 610 615 620Phe Leu Leu
Tyr Ser Arg Leu Gly Asp Gln Pro Val Phe Leu Pro Thr625 630 635
640Gln Met Leu Val Lys Phe Met Ala Asp Ile Ala Ser Gly Met Glu Tyr
645 650 655Leu Ser Thr Lys Arg Phe Ile His Arg Asp Leu Ala Ala Arg
Asn Cys 660 665 670Met Leu Asn Glu Asn Met Ser Val Cys Val Ala Asp
Phe Gly Leu Ser 675 680 685Lys Lys Ile Tyr Asn Gly Asp Tyr Tyr Arg
Gln Gly Arg Ile Ala Lys 690 695 700Met Pro Val Lys Trp Ile Ala Ile
Glu Ser Leu Ala Asp Arg Val Tyr705 710 715 720Thr Ser Lys Ser Asp
Val Trp Ser Phe Gly Val Thr Met Trp Glu Ile 725 730 735Ala Thr Arg
Gly Gln Thr Pro Tyr Pro Gly Val Glu Asn Ser Glu Ile 740 745 750Tyr
Asp Tyr Leu Arg Gln Gly Asn Arg Leu Lys Gln Pro Val Asp Cys 755 760
765Leu Asp Gly Leu Tyr Ala Leu Met Ser Arg Cys Trp Glu Leu Asn Pro
770 775 780Arg Asp Arg Pro Ser Phe Ala Glu Leu Arg Glu Asp Leu Glu
Asn Thr785 790 795 800Leu Lys Ala Leu Pro Pro Ala Gln Glu Pro Asp
Glu Ile Leu Tyr Val 805 810 815Asn Met Asp Glu Gly Gly Ser His Leu
Glu Pro Arg Gly Ala Ala Gly 820 825 830Gly Ala Asp Pro Pro Thr Gln
Pro Asp Pro Lys Asp Ser Cys Ser Cys 835 840 845Leu Thr Ala Ala Asp
Val His Ser Ala Gly Arg Tyr Val Leu Cys Pro 850 855 860Ser Thr Ala
Pro Gly Pro Thr Leu Ser Ala Asp Arg Gly Cys Pro Ala865 870 875
880Pro Pro Gly Gln Glu Asp Gly Ala 885
* * * * *
References