U.S. patent application number 17/354161 was filed with the patent office on 2022-02-10 for method for preventing or treating nosocomial pneumonia.
The applicant listed for this patent is Medlmmune Limited. Invention is credited to Brian BISHOP, Antonio DIGIANDOMENICO, Hasan JAFRI, Michael MCCARTHY, Charles K. STOVER, Xiang-Qing YU.
Application Number | 20220041695 17/354161 |
Document ID | / |
Family ID | 1000005925606 |
Filed Date | 2022-02-10 |
United States Patent
Application |
20220041695 |
Kind Code |
A1 |
JAFRI; Hasan ; et
al. |
February 10, 2022 |
METHOD FOR PREVENTING OR TREATING NOSOCOMIAL PNEUMONIA
Abstract
A method for preventing or treating nosocomial diseases, e.g.,
diseases caused by Pseudomonas aeruginosa, is provided. The method
includes administering to a susceptible human a specified dose of a
bispecific antibody that that specifically binds Pseudomonas
aeruginosa Psl and PcrV.
Inventors: |
JAFRI; Hasan; (Gaithersburg,
MD) ; DIGIANDOMENICO; Antonio; (Gaithersburg, MD)
; MCCARTHY; Michael; (Gaithersburg, MD) ; YU;
Xiang-Qing; (Gaithersburg, MD) ; STOVER; Charles
K.; (Gaithersburg, MD) ; BISHOP; Brian;
(Gaithersburg, MD) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Medlmmune Limited |
Cambridge |
|
GB |
|
|
Family ID: |
1000005925606 |
Appl. No.: |
17/354161 |
Filed: |
June 22, 2021 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
15779189 |
May 25, 2018 |
11066461 |
|
|
PCT/US2016/063865 |
Nov 28, 2016 |
|
|
|
17354161 |
|
|
|
|
62260935 |
Nov 30, 2015 |
|
|
|
Current U.S.
Class: |
1/1 |
Current CPC
Class: |
C07K 16/468 20130101;
A61K 45/06 20130101; A61P 31/04 20180101; C07K 2317/21 20130101;
A61K 2039/505 20130101; C07K 16/1214 20130101; C07K 2317/31
20130101; C07K 2317/76 20130101; A61K 39/40 20130101 |
International
Class: |
C07K 16/12 20060101
C07K016/12; A61P 31/04 20060101 A61P031/04; A61K 39/40 20060101
A61K039/40; A61K 45/06 20060101 A61K045/06; C07K 16/46 20060101
C07K016/46 |
Claims
1. A method of preventing or treating a Pseudomonas aeruginosa
infection in a susceptible human subject comprising administering
to the subject about 500 to about 3000 mg of a bispecific antibody
that specifically binds Pseudomonas aeruginosa Psl and PcrV and
monitoring the subject for symptoms for 21 days from the day of
administration; wherein at 21 days post-administration the subject
remains symptom-free or displays less severe symptoms relative to a
cohort of susceptible human subjects administered a placebo;
wherein the bispecific antibody comprises a binding domain which
specifically binds to P. aeruginosa Psl comprising a set of
complementarity determining regions (CDRs): HCDR1-Psl, HCDR2-Psl,
HCDR3-Psl, LCDR1-Psl, LCDR2-Psl, and LCDR3-Psl, wherein HCDR1-Psl
has the amino acid sequence of SEQ ID NO: 10, HCDR2-Psl has the
amino acid sequence of SEQ ID NO: 11, HCDR3-Psl has the amino acid
sequence of SEQ ID NO: 12, LCDR1-Psl has the amino acid sequence of
SEQ ID NO: 13, LCDR2-Psl has the amino acid sequence of SEQ ID NO:
14, and LCDR3-Psl has the amino acid sequence of SEQ ID NO: 15; and
a binding domain which specifically binds to P. aeruginosa PcrV
comprising a set of CDRs: HCDR1-PcrV, HCDR2-PcrV, HCDR3-PcrV,
LCDR1-PcrV, LCDR2-PcrV, and LCDR3-PcrV, wherein HCDR1-PcrV has the
amino acid sequence of SEQ ID NO: 2, HCDR2-PcrV has the amino acid
sequence of SEQ ID NO: 3, HCDR3-PcrV has the amino acid sequence of
SEQ ID NO: 4, LCDR1-PcrV has the amino acid sequence of SEQ ID NO:
6, LCDR2-PcrV has the amino acid sequence of SEQ ID NO: 7, and
LCDR3-PcrV has the amino acid sequence of SEQ ID NO: 8.
2. The method of claim 1, wherein the infection is pneumonia,
bacteremia, bone infection, joint infection, skin infection, burn
infection, wound infection, or any combination thereof.
3. The method of claim 1, wherein the infection is a nosocomial
infection.
4-5. (canceled)
6. The method of claim 1, wherein the bispecific antibody comprises
a heavy chain constant region domain-1 (CH1) comprising the amino
acid sequence of SEQ ID NO: 16.
7. The method of claim 1, wherein the bispecific antibody comprises
a first linker (L1) and a second linker (L2), wherein L1 and L2 are
the same or different, and independently comprise (a) [GGGGS]n,
wherein n is 0, 1, 2, 3, 4, or 5 (SEQ ID NO: 23), (b) [GGGG]n,
wherein n is 0, 1, 2, 3, 4, or 5 (SEQ ID NO: 24), or a combination
of (a) and (b).
8. The method of claim 1, wherein the bispecific antibody comprises
a first heavy chain hinge region fragment (H1) comprising the amino
acid sequence EPKSC (SEQ ID NO: 17).
9. The method of claim 1, wherein the bispecific antibody comprises
a second heavy chain hinge region fragment (H2) comprising the
amino acid sequence DKTHTCPPCP (SEQ ID NO: 18).
10. The method of claim 1, wherein the bispecific antibody
comprises a heavy chain constant region domain-2 (CH2) and a heavy
chain constant region domain-3 (CH3), wherein the CH2-CH3 comprises
the amino acid sequence of SEQ ID NO: 19.
11. (canceled)
12. The method of claim 1, wherein the heavy chain comprises the
amino acid sequence of SEQ ID NO: 21, and the light chain comprises
the amino acid sequence of SEQ ID NO: 22.
13. (canceled)
14. The method of claim 1, wherein at the time of the
administration the subject is colonized with Pseudomonas aeruginosa
in the respiratory tract.
15-16. (canceled)
17. The method of claim 14, wherein the subject's respiratory tract
is colonized with P. aeruginosa one, two, three, or four days prior
to administration of the bispecific antibody.
18. (canceled)
19. The method of claim 14, wherein the subject's respiratory tract
is additionally colonized by Staphylococcus aureus at the time of
administration of the bispecific antibody.
20. The method of claim 1, wherein the subject is about to be
hospitalized, is currently hospitalized, was recently hospitalized,
is on a mechanical ventilator, or a combination thereof.
21. (canceled)
22. The method of claim 1, wherein the subject is hospitalized in
an intensive care unit (ICU) and is intubated.
23. The method of claim 20, wherein the subject is mechanically
ventilated through an endotracheal or nasotracheal tube.
24. The method of claim 20, wherein the administration reduces the
risk of pneumonia while on mechanical ventilation.
25. (canceled)
26. The method of claim 1, wherein 1500 mg of the bispecific
antibody is administered.
27. The method of claim 1, wherein 3000 mg of the bispecific
antibody is administered.
28. The method of claim 14, wherein the subject has not received
antibiotics active against the P. aeruginosa strain with which the
subject is colonized prior to administration of the bispecific
antibody.
29-32. (canceled)
33. The method of claim 1, wherein the subject maintains a serum
concentration of the bispecific antibody of at least about 1
.mu.g/ml through day 21 following administration of the bispecific
antibody.
34-35. (canceled)
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a divisional application of U.S.
application Ser. No. 15/779,189, now U.S. Pat. No. 11,066,461,
which is a 35 U.S.C. .sctn. 371 National Phase Application of
International Application No. PCT/US2016/063865, filed Nov. 28,
2016, which claims the benefit of U.S. Provisional Application No.
62/260,935, filed Nov. 30, 2015, the content of each of which is
incorporated herein by reference in its entirety.
REFERENCE TO A SEQUENCE LISTING SUBMITTED ELECTRONICALLY VIA
EFS-WEB
[0002] The content of the electronically submitted sequence listing
(Name: 2943_1160002_Seqlisting_ST25.txt; Size: 22,646 bytes; and
Date of Creation: Jun. 21, 2021) is herein incorporated by
reference in its entirety.
BACKGROUND
[0003] Pseudomonas aeruginosa (P. aeruginosa) is an important
nosocomial pathogen, and pneumonia is one of its most concerning
manifestations. Mechanical ventilation is the most important risk
factor for nosocomial pneumonia caused by P. aeruginosa, with
cumulative risk increasing with the duration of ventilation (Zahar,
J R, et al. Crit Care Med. 2009 September; 37(9):2545-51). In one
study, P. aeruginosa accounted for 13% of cases of
microbiologically confirmed pneumonia acquired in the intensive
care unit (ICU) by patients who were not mechanically ventilated,
and 24% of cases in those who were (Esperatti et al, Am J Respir
Care Med. 2010 Dec. 15; 182(12):1533-9). In a review of global
epidemiology data, P. aeruginosa caused approximately 27% of
ventilator-associated pneumonia (VAP; Jones, Clin Infect Dis. 2010
Aug. 1; 51 Suppl 1:S81-7). Respiratory tract colonisation with P.
aeruginosa is another important risk factor (Rehm and Kollef,
Poster #367. 43rd Critical Care Congress, Society of Critical Care
Medicine (SCCM); 9-13 Jan. 2014, San Francisco Calif., USA).
Despite the existence of antibiotics, pneumonia, particularly VAP,
due to P. aeruginosa remains associated with significant mortality
and morbidity, increased ICU and hospital length of stay, and
substantial economic burden.
[0004] Patients in the ICU are at risk for developing serious
pneumonia infection and mechanical ventilation increases the risk
for pneumonia in the ICU. P. aeruginosa is a leading cause of ICU
pneumonia that contributes significantly to increased hospital
stays (55.4 days v. 7.2 days), ICU stays (14.8 days v. 1.1 days),
and greater need for mechanical ventilation (62.3% v. 7.4%), as
well as patient mortality (20.2% v. 3.1% of). (Kyaw M H, et al. J
Infect Dis. (2005) 192(3):377-386). Additionally, multi-drug
resistance has complicated the management of P. aeruginosa
infection. With limited antimicrobial therapeutic options,
consideration of new approaches, such as immunoprophylaxis for the
prevention of P. aeruginosa would address an important unmet
need.
[0005] MEDI3902 is a bivalent, bispecific human immunoglobulin G1
(IgG1) kappa monoclonal antibody (mAb) that selectively binds to
both the PcrV protein and Psl exopolysaccharide on the surface of
P. aeruginosa. Pharmacology studies have demonstrated that MEDI3902
is capable of mediating three distinct mechanisms of action:
anticytotoxicity, opsonophagocytosis and killing, and inhibition of
P. aeruginosa attachment to cells. Binding to PcrV on intact P.
aeruginosa prevents type 3 secretion (T3S) injectisome-mediated
cytotoxicity and damage to host cells. Binding to Psl mediates
opsonophagocytic killing (OPK) of P. aeruginosa by host effector
cells and inhibits P. aeruginosa attachment to host epithelial
cells (DiGiandomenico et al, J Exp Med. 2012 Jul.
2:209(7):1273-87).
[0006] MEDI3902 was highly protective in P. aeruginosa murine
infection models. See, e.g., in PCT Publication No. WO 2013/070615,
PCT Publication No. WO 2014/074528, PCT Application No.
PCT/US2015/029063, and PCT Application No. PCT/US2015/036576.
Moreover, MEDI3902 provided synergistic enhancement of antibiotic
therapy against P. aeruginosa pneumonia with distinct antibiotic
classes against both antibiotic-sensitive and antibiotic-resistant
P. aeruginosa.
SUMMARY
[0007] This disclosure provides a method of preventing or treating
nosocomial infection in a susceptible human subject, where the
method includes administering to the subject about 500 to about
3000 mg, e.g., about 500, 600, 700, 750, 1000, 1500 or about 3000
mg, of a bispecific antibody that specifically binds Pseudomonas
aeruginosa Psl and PcrV (e.g., MEDI3902), and monitoring the
subject for symptoms through 21 days from the day of
administration. According to the method, at 21 days
post-administration the subject can be symptom-free or can display
less severe symptoms relative to a cohort of susceptible human
subjects administered a placebo. In certain aspects the nosocomial
infection can be pneumonia, e.g., Pseudomonas aeruginosa pneumonia,
bacteremia, bone infection, joint infection, skin infection, burn
infection, wound infection, or any combination thereof.
[0008] This disclosure further provides a method of preventing or
treating pneumonia, e.g., Pseudomonas aeruginosa pneumonia, in a
susceptible human subject, where the method includes administering
to the subject about 500 to about 3000 mg, e.g., about 500, 600,
700, 750, 1000, 1500 or about 3000 mg, of a bispecific antibody
that specifically binds Pseudomonas aeruginosa Psl and PcrV (e.g.,
MEDI3902), and monitoring the subject for pneumonia symptoms
through 21 days from the day of administration. According to the
method, at least at 21 days post-administration the subject can be
pneumonia-free or can display less severe symptoms relative to a
cohort of susceptible human subjects administered a placebo.
[0009] In some embodiments, the serum target level of the
bispecific antibody (e.g., MEDI3902) is at least about 1 .mu.g/mL,
at least about 2 .mu.g/mL, at least about 3 .mu.g/mL, at least
about 4 .mu.g/mL, or at least about 5 .mu.g/mL. In other
embodiments, the serum target level of the bispecific antibody
(e.g., MEDI3902) is at least about 1.7 .mu.g/mL. In further
embodiments, the serum target level of the bispecific antibody
(e.g., MEDI3902) is at least about 5.3 .mu.g/mL In some
embodiments, the administration produces a serum level of the
bispecific antibody (e.g., MEDI3902) of at least 1 .mu.g/mL, at
least about 2 .mu.g/mL, at least about 3 .mu.g/mL, at least about 4
.mu.g/mL, or at least about 5 .mu.g/mL through day 21 following
administration of the bispecific antibody. In other embodiments,
the administration produces a serum level of the bispecific
antibody (e.g., MEDI3902) of at least 1.7 .mu.g/mL through day 21
following administration of the bispecific antibody. In further
embodiments, the serum target level of the bispecific antibody
(e.g., MEDI3902) is at least about 5.3 .mu.g/mL
[0010] In some embodiments, the method of preventing or treating
nosocomial infection in a susceptible human subject comprises
administering a bispecific antibody comprising a binding domain
which specifically binds to P. aeruginosa Psl comprising a set of
complementarity determining regions (CDRs): HCDR1-Psl, HCDR2-Psl,
HCDR3-Psl, LCDR1-Psl, LCDR2-Psl, and LCDR3-Psl, wherein HCDR1-Psl
has the amino acid sequence of SEQ ID NO: 10, HCDR2-Psl has the
amino acid sequence of SEQ ID NO: 11, HCDR3-Psl has the amino acid
sequence of SEQ ID NO: 12, LCDR1-Psl has the amino acid sequence of
SEQ ID NO: 13, LCDR2-Psl has the amino acid sequence of SEQ ID NO:
14, and LCDR3-Psl has the amino acid sequence of SEQ ID NO: 15; and
a binding domain which specifically binds to P. aeruginosa PcrV
comprising a set of CDRs: HCDR1-PcrV, HCDR2-PcrV, HCDR3-PcrV,
LCDR1-PcrV, LCDR2-PcrV, and LCDR3-PcrV, wherein HCDR1-PcrV has the
amino acid sequence of SEQ ID NO: 2, HCDR2-PcrV has the amino acid
sequence of SEQ ID NO: 3, HCDR3-PcrV has the amino acid sequence of
SEQ ID NO: 4, LCDR1-PcrV has the amino acid sequence of SEQ ID NO:
6, LCDR2-PcrV has the amino acid sequence of SEQ ID NO: 7, and
LCDR3-PcrV has the amino acid sequence of SEQ ID NO: 8. In certain
aspects, the bispecific antibody has a heavy chain and a light
chain. The heavy chain includes the formula
VH-CH1-H1-L1-S-L2-H2-CH2-CH3, where VH is an anti-P. aeruginosa
PcrV heavy chain variable domain including the amino acid sequence
of SEQ ID NO: 1, CH1 is a heavy chain constant region domain-1, H1
is a first heavy chain hinge region fragment, L1 is a first linker,
S is an anti-P. aeruginosa Psl ScFv molecule including the amino
acid sequence of SEQ ID NO: 9, L2 is a second linker, H2 is a
second heavy chain hinge region fragment, CH2 is a heavy chain
constant region domain-2, and CH3 is a heavy chain constant region
domain-3. The light chain includes the formula VL-CL, where VL is
an anti-P. aeruginosa PcrV light chain variable domain including
the amino acid sequence of SEQ ID NO: 5 and CL includes an antibody
light chain kappa constant region or an antibody light chain lambda
region. In certain aspects, CH1 can include the amino acid sequence
of SEQ ID NO: 16. In certain aspects L1 and L2 can be the same or
different, and can independently include (a) [GGGGS]n, where n is
0, 1, 2, 3, 4, or 5 (SEQ ID NO: 23), (b) [GGGG]n, where n is 0, 1,
2, 3, 4, or 5 (SEQ ID NO: 24), or a combination of (a) and (b). In
certain aspects, H1 can include the amino acid sequence EPKSC (SEQ
ID NO: 17). In certain aspects, H2 can include the amino acid
sequence DKTHTCPPCP (SEQ ID NO: 18). In certain aspects, CH2-CH3
can include the amino acid sequence of SEQ ID NO: 19. In certain
aspects CH2-CH3 can include the amino acid sequence of SEQ ID NO:
20. In certain aspects, the heavy chain of the bispecific antibody
can include the amino acid sequence of SEQ ID NO: 21, and the light
chain includes the amino acid sequence of SEQ ID NO: 22.
[0011] According to the methods provided herein, the bispecific
antibody (e.g., MEDI3902) can be administered as a single
intravenous (IV) infusion.
[0012] According to the methods provided herein, at the time of the
administration of the bispecific antibody the subject can be
colonized with Pseudomonas aeruginosa in the respiratory tract,
e.g., the lower respiratory tract. In certain aspects, the subject
does not have pneumonia symptoms at the time of administration. In
certain aspects, the subject's respiratory tract is colonized with
P. aeruginosa one, two, three, or four days prior to administration
of the bispecific antibody. Colonization can be measured, e.g., by
detection of P. aeruginosa in a tracheal aspirate within 36 hours
prior to administration of the bispecific antibody. In certain
aspects, the subject's respiratory tract can be additionally
colonized by Staphylococcus aureus at the time of administration of
the bispecific antibody.
[0013] In certain aspects, the subject is about to be hospitalized,
is currently hospitalized, e.g., in an intensive care unit (ICU),
was recently hospitalized, is on a mechanical ventilator, e.g., is
intubated or ventilated through an endotracheal or nasotracheal
tube, or any combination thereof. According to the methods provided
herein, the administration of the bispecific antibody can reduce
the risk of pneumonia while on mechanical ventilation, or after
mechanical ventilation is no longer required.
[0014] In certain aspects a microbiologic confirmation of pneumonia
can include a respiratory specimen positive for P. aeruginosa by
culture, a blood culture positive for P. aeruginosa, a pleural
fluid aspirate or lung tissue culture positive for P. aeruginosa,
or any combination thereof.
[0015] In certain aspects, the subject has not received antibiotics
considered active against the P. aeruginosa strain with which the
subject is colonized prior to administration of the bispecific
antibody (e.g., MEDI3902). In other aspects, the method can further
include administering an antibiotic to the subject. In certain
aspects, the P. aeruginosa strain with which the subject is
colonized can sensitive to the antibiotic, or can be resistant or
partially resistant to the antibiotic. Where an antibiotic as
administered it can be administered prior to administration of the
bispecific antibody, concurrently with administration of the
bispecific antibody, following administration of the bispecific
antibody, or any combination thereof.
[0016] In certain aspects the method can further include
administering an antihistamine to the subject. Where an
antihistamine is administered it can be administered prior to
administration of the bispecific antibody, concurrently with
administration of the bispecific antibody, following administration
of the bispecific antibody, or any combination thereof.
BRIEF DESCRIPTION OF THE DRAWINGS/FIGURES
[0017] FIG. 1 provides a flow diagram of the Phase IIb clinical
trial study protocol. ADA=anti-drug antibody; IV=intravenous;
N=number of subjects; PK=pharmacokinetics. Efficacy will be
assessed through 21 days postdose (Day 22); safety, PK and ADA will
be assessed through 49 days postdose (Day 50). The sample size can
be modified after approximately 50% of the subjects are enrolled
and followed through 21 days postdose based on blinded assessment
of the event rate and/or attrition rate in the overall
population.
[0018] FIG. 2 Based on observed increased clearance in ICU patients
for monoclonal antibodies directed at bacterial pathogens (e.g.,
MEDI4893), pharmacokinetics were modelled for ICU patients with
mechanical ventilation following a single dose of MEDI3902. (A)
Single dose of 1500 mg MEDI3902 is predicted to maintain serum
exposure at about 1 .mu.g/mL for >21 days in >90% subjects.
(B) Single dose of 3000 mg MEDI3902 is predicted to maintain serum
exposure at about 1.7 .mu.g/mL for .gtoreq.21 days in >90%
subjects.
[0019] FIG. 3 In vivo survival study of MEDI3902-treated mice in a
6206 acute pneumonia model system. Mice (n=6) were treated with an
isotype control IgG (negative control, 0.75 mg/kg) or MEDI3902 at
three doses: 1 mg/kg, 0.5 mg/kg, or 0.2 mg/kg. Twenty-four hours
post-treatment, all mice were infected with .about.2.times.10.sup.5
CFU/animal of P. aeruginosa strain 6206. All mice were monitored
for 168 hours. All of the control mice succumbed to infection by
approximately 120 hours post-infection. All of the MEDI3902-treated
animals survived. Results are represented as Kaplan-Meier survival
curves.
DETAILED DESCRIPTION
Abbreviations
[0020] Abbreviations used in this disclosure are listed in Table
1.
TABLE-US-00001 TABLE 1 Abbreviations Abbreviation or Specialized
Term Definition ADA anti-drug antibody AE adverse event AESI
adverse event of special interest APACHE-II Acute Physiology and
Chronic Health Evaluation-II AUC area under concentration time
curve AUC.sub..infin. area under the concentration-time curve from
time zero to infinity AUC.sub.Day 22-Day 29 area under
concentration time curve from day 22 to day 29 BAL bronchoalveolar
lavage C.sub.max mean observed maximum concentration CPIS Clinical
Pulmonary Infection Score EC.sub.90 effective serum concentration
associated with 90% survival FiO.sub.2 fraction of inspired oxygen
ICU intensive care unit Ig immunoglobulin IgG1 immunoglobulin G1 IL
interleukin ITT intent-to-treat IV intravenous LLOQ lower limit of
quantification mAb monoclonal antibody O.sub.2 oxygen OPK
opsonophagocytic killing P. aeruginosa Pseudomonas aeruginosa
PaO.sub.2 partial pressure of oxygen PCR polymerase chain reaction
PD pharmacodynamic PK pharmacokinetics RBC red blood cell SAE
serious adverse event SOFA Sequential Organ Failure Assessment TEAE
treatment-emergent adverse event TESAE treatment-emergent serious
adverse event VAP ventilator-associated pneumonia Vd.sub.ss volume
of distribution at steady state WBC white blood cell w/v
weight/volume
Definitions
[0021] It is to be noted that the term "a" or "an" entity refers to
one or more of that entity; for example, "a binding molecule," is
understood to represent one or more binding molecules. As such, the
terms "a" (or "an"), "one or more," and "at least one" can be used
interchangeably herein.
[0022] Furthermore, "and/or" where used herein is to be taken as
specific disclosure of each of the two specified features or
components with or without the other. Thus, the term and/or" as
used in a phrase such as "A and/or B" herein is intended to include
"A and B," "A or B," "A" (alone), and "B" (alone). Likewise, the
term "and/or" as used in a phrase such as "A, B, and/or C" is
intended to encompass each of the following aspects: A, B, and C;
A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A
(alone); B (alone); and C (alone).
[0023] Unless defined otherwise, technical and scientific terms
used herein have the same meaning as commonly understood by one of
ordinary skill in the art to which this disclosure is related. For
example, the Concise Dictionary of Biomedicine and Molecular
Biology, Juo, Pei-Show, 2nd ed., 2002, CRC Press; The Dictionary of
Cell and Molecular Biology, 3rd ed., 1999, Academic Press; and the
Oxford Dictionary Of Biochemistry And Molecular Biology, Revised,
2000, Oxford University Press, provide one of skill with a general
dictionary of many of the terms used in this disclosure.
[0024] Units, prefixes, and symbols are denoted in their Systeme
International de Unites (SI) accepted form. Numeric ranges are
inclusive of the numbers defining the range. Unless otherwise
indicated, amino acid sequences are written left to right in amino
to carboxy orientation. The headings provided herein are not
limitations of the various aspects or aspects of the disclosure,
which can be had by reference to the specification as a whole.
Accordingly, the terms defined immediately below are more fully
defined by reference to the specification in its entirety.
[0025] Disclosed herein are certain binding molecules, or
antigen-binding fragments, variants, or derivatives thereof. Unless
specifically referring to full-sized antibodies such as
naturally-occurring antibodies, the term "binding molecule"
encompasses full-sized antibodies as well as antigen-binding
fragments, variants, analogs, or derivatives of such antibodies,
e.g., naturally-occurring antibody or immunoglobulin molecules or
engineered antibody molecules or fragments that bind antigen in a
manner similar to antibody molecules.
[0026] As used herein, the term "binding molecule" refers in its
broadest sense to a molecule that specifically binds an antigenic
determinant. As described further herein, a binding molecule can
comprise one or more "binding domains." As used herein, a "binding
domain" is a two- or three-dimensional polypeptide structure that
can specifically bind a given antigenic determinant, or epitope. A
non-limiting example of a binding molecule is a bispecific antibody
or fragment thereof that comprises at least two distinct binding
domains that specifically bind different antigenic determinants or
epitopes. In certain aspects, a bispecific antibody as provided
herein can be said to comprise a first binding domain binding to a
first epitope, and a second binding domain binding to a second
epitope.
[0027] The terms "antibody" and "immunoglobulin" can be used
interchangeably herein. An antibody (or a fragment, variant, or
derivative thereof as disclosed herein comprises at least the
variable domain of a heavy chain and at least the variable domains
of a heavy chain and a light chain. Basic immunoglobulin structures
in vertebrate systems are relatively well understood. See, e.g.,
Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor
Laboratory Press, 2nd ed. 1988).
[0028] As will be discussed in more detail below, the term
"immunoglobulin" comprises various broad classes of polypeptides
that can be distinguished biochemically. Those skilled in the art
will appreciate that heavy chains are classified as gamma, mu,
alpha, delta, or epsilon, (.gamma., .mu., .alpha., .delta.,
.epsilon.) with some subclasses among them (e.g.,
.gamma.1-.gamma.4). It is the nature of this chain that determines
the "class" of the antibody as IgG, IgM, IgA IgG, or IgE,
respectively. The immunoglobulin subclasses (isotypes) e.g.,
IgG.sub.1, IgG.sub.2, IgG.sub.3, IgG.sub.4, IgA.sub.1, etc. are
well characterized and are known to confer functional
specialization. Modified versions of each of these classes and
isotypes are readily discernible to the skilled artisan in view of
the instant disclosure and, accordingly, are within the scope of
this disclosure.
[0029] Light chains are classified as either kappa or lambda
(.kappa., .lamda.). Each heavy chain class can be bound with either
a kappa or lambda light chain. In general, the light and heavy
chains are covalently bonded to each other, and the "tail" portions
of the two heavy chains are bonded to each other by covalent
disulfide linkages or non-covalent linkages when the
immunoglobulins are generated either by hybridomas, B cells or
genetically engineered host cells. In the heavy chain, the amino
acid sequences run from an N-terminus at the forked ends of the Y
configuration to the C-terminus at the bottom of each chain.
[0030] Both the light and heavy chains are divided into regions of
structural and functional homology. The terms "constant" and
"variable" are used functionally. In this regard, it will be
appreciated that the variable domains of both the light (VL) and
heavy (VH) chain portions determine antigen recognition and
specificity. Conversely, the constant domains of the light chain
(CL) and the heavy chain (CH1, CH2 or CH3) confer important
biological properties such as secretion, transplacental mobility,
Fc receptor binding, complement binding, and the like. By
convention the numbering of the constant region domains increases
as they become more distal from the antigen binding site or
amino-terminus of the antibody. The N-terminal portion is a
variable region and at the C-terminal portion is a constant region;
the CH3 and CL domains actually comprise the carboxy-terminus of
the heavy and light chain, respectively.
[0031] As indicated above, the variable region allows the binding
molecule to selectively recognize and specifically bind epitopes on
antigens. That is, the VL domain and VH domain, or subset of the
complementarity determining regions (CDRs), of a binding molecule,
e.g., an antibody combine to form the variable region that defines
a three dimensional antigen binding site. This quaternary binding
molecule structure forms the antigen binding site present at the
end of each arm of the Y. More specifically, the antigen binding
site is defined by three CDRs on each of the VH and VL chains.
[0032] In naturally occurring antibodies, the six "complementarity
determining regions" or "CDRs" present in each antigen binding
domain are short, non-contiguous sequences of amino acids that are
specifically positioned to form the antigen binding domain as the
antibody assumes its three dimensional configuration in an aqueous
environment. The remainder of the amino acids in the antigen
binding domains, referred to as "framework" regions, show less
inter-molecular variability. The framework regions largely adopt a
.beta.-sheet conformation and the CDRs form loops that connect, and
in some cases form part of, the .beta.-sheet structure. Thus,
framework regions act to form a scaffold that provides for
positioning the CDRs in correct orientation by inter-chain,
non-covalent interactions. The antigen binding domain formed by the
positioned CDRs defines a surface complementary to the epitope on
the immunoreactive antigen. This complementary surface promotes the
non-covalent binding of the antibody to its cognate epitope. The
amino acids comprising the CDRs and the framework regions,
respectively, can be readily identified for any given heavy or
light chain variable region by one of ordinary skill in the art,
since they have been precisely defined (see, "Sequences of Proteins
of Immunological Interest," Kabat, E., et al., U.S. Department of
Health and Human Services, (1983); and Chothia and Lesk, J. Mol.
Biol., 196:901-917 (1987), which are incorporated herein by
reference in their entireties).
[0033] Antibodies or antigen-binding fragments, variants, or
derivatives thereof include, but are not limited tomonoclonal,
human, humanized, or chimeric antibodies, single chain Fvs (scFv),
and multispecific antibodies, e.g., bispecific antibodies. ScFv
molecules are known in the art and are described, e.g., in U.S.
Pat. No. 5,892,019. Immunoglobulin or antibody molecules
encompassed by this disclosure can be of any type (e.g., IgG, IgE,
IgM, IgD, IgA, and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1
and IgA2) or subclass of immunoglobulin molecule.
[0034] By "specifically binds," it is generally meant that a
binding molecule, e.g., a bispecific antibody or fragment, variant,
or derivative thereof binds to an epitope via an antigen binding
domain, and that the binding entails some complementarity between
an antigen binding domain and the epitope. A binding molecule as
provided herein can contain one, two, three, four, or more binding
domains that can be the same or different, and that can bind to the
same epitope, or to two or more different epitopes. According to
this definition, a binding molecule is said to "specifically bind"
to an epitope when it binds to that epitope, via its antigen
binding domain more readily than it would bind to a random,
unrelated epitope. The term "specificity" is used herein to qualify
the relative affinity by which a certain binding molecule binds to
a certain epitope. For example, binding molecule "A" may be deemed
to have a higher specificity for a given epitope than binding
molecule "B," or binding molecule "A" may be said to bind to
epitope "C" with a higher specificity than it has for related
epitope "D."
[0035] Antibody fragments including single-chain antibodies can
comprise the variable region(s) alone or in combination with the
entirety or a portion of the following: hinge region, CH1, CH2, and
CH3 domains. Also included are antigen-binding fragments also
comprising any combination of variable region(s) with a hinge
region, CH1, CH2, and CH3 domains. Antibodies, or antigen-binding
fragments thereof disclosed herein can be from any animal origin
including birds and mammals. The antibodies can be human, murine,
donkey, rabbit, goat, guinea pig, camel, llama, horse, or chicken
antibodies. As used herein, "human" antibodies include antibodies
having the amino acid sequence of a human immunoglobulin and
include antibodies isolated from human immunoglobulin libraries or
from animals transgenic for one or more human immunoglobulins and
that do not express endogenous immunoglobulins, as described infra
and, for example in, U.S. Pat. No. 5,939,598 by Kucherlapati et
al.
[0036] As used herein, the term "light chain portion" includes
amino acid sequences derived from an immunoglobulin light chain.
The light chain portion comprises at least one of a VL or CL
domain.
[0037] The terms "multispecific antibody" or "bispecific antibody"
as used herein refer to an antibody that has binding domains
specific for two or more different antigens or epitopes within a
single antibody molecule. It will be appreciated that other
molecules in addition to the canonical antibody structure can be
constructed with two binding specificities. It will further be
appreciated that antigen binding by bispecific antibodies can be
simultaneous or sequential. Triomas and hybrid hybridomas are two
examples of cell lines that can secrete bispecific antibodies.
Bispecific antibodies can also be constructed by recombinant means.
(Strohlein and Heiss, Future Oncol. 6:1387-94 (2010); Mabry and
Snavely, IDrugs. 13:543-9 (2010)).
[0038] As used herein, the term "engineered antibody" refers to an
antibody in which the variable domain in either the heavy and light
chain or both is altered by at least partial replacement of one or
more CDRs from an antibody of known specificity and, if necessary,
by partial framework region replacement and sequence changing.
Although the CDRs can be derived from an antibody of the same class
or even subclass as the antibody from which the framework regions
are derived, it is envisaged that the CDRs will be derived from an
antibody of different class and preferably from an antibody from a
different species. An engineered antibody in which one or more
"donor" CDRs from a non-human antibody of known specificity is
grafted into a human heavy or light chain framework region is
referred to herein as a "humanized antibody." It may not be
necessary to replace all of the CDRs with the complete CDRs from
the donor variable region to transfer the antigen binding capacity
of one variable domain to another. Rather, it may only be necessary
to transfer those residues that are necessary to maintain the
activity of the target binding site. Given the explanations set
forth in, e.g., U.S. Pat. Nos. 5,585,089, 5,693,761, 5,693,762, and
6,180,370, it will be well within the competence of those skilled
in the art, either by carrying out routine experimentation or by
trial and error testing to obtain a functional engineered or
humanized antibody.
[0039] As used herein, the terms "treat" or "treatment" refers to
therapeutic treatment, wherein the object is to clear or reduce the
bacterial burden of an infectious agent in a subject that has been
clinically diagnosed with an infection, such as pneumonia,
bacteremia, peritonitis, sepsis, and/or an abscess. "Treatment" can
also mean prolonging survival as compared to expected survival if
not receiving treatment. Those in need of treatment include those
already with the infection, condition, or disorder as well as those
prone to have the condition or disorder or those in which the
condition or disorder is to be prevented, e.g., in burn patients or
immunosuppressed patients susceptible to bacterial infection, e.g.,
P. aeruginosa infection.
[0040] As used herein, the terms "prevent" or "mitigate" refer to
prophylactic or preventative measures, wherein the object is to
prevent or slow down (lessen) an undesired physiological change,
infection, or disorder. Beneficial or desired clinical results
include, but are not limited to, alleviation of symptoms,
diminishment of extent of disease, stabilized (i.e., not worsening)
state of disease, clearance or reduction of an infectious agent
such as P. aeruginosa in a subject, a delay or slowing of disease
progression, amelioration or palliation of the disease state, and
remission (whether partial or total), whether detectable or
undetectable.
[0041] As used herein, the terms "nosocomial disease" and
"nosocomial infection" refer to a disease or infection occurring or
originating in a hospital or other healthcare facility. Nosocomial
infections are typically infections that are contracted in a
hospital or other healthcare facility, and can be caused by
infectious agents, e.g., bacteria that are resistant to
antibiotics. In certain aspects, a nosocomial infection is not
present or incubating prior to the subject being admitted to the
hospital or healthcare facility, which is acquired or contracted
after the subject's admittance to the hospital or healthcare
facility.
[0042] Similarly, an "iatrogenic disease" or "iatrogenic infection"
is one that is caused by or occurs as a result of medical care.
[0043] By "subject" or "individual" or "animal" or "patient" or
"mammal," is meant any subject, e.g., a mammalian subject, for whom
diagnosis, prognosis, or therapy is desired. Mammalian subjects
include humans, domestic animals, farm animals, and zoo, sports, or
pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice,
horses, cattle, cows, bears, and so on.
[0044] As used herein, phrases such as "a subject that would
benefit from administration of an anti-Pseudomonas aeruginosa Psl
and PcrV bispecific binding molecule" and "an animal in need of
treatment" includes subjects, such as mammalian subjects, that
would benefit from administration of an anti-Pseudomonas Psl and
PcrV bispecific binding molecule, such as a bispecific antibody.
Such binding molecules can be used, e.g., for detection of
Pseudomonas Psl or PcrV (e.g., for a diagnostic procedure) and/or
for treatment, i.e., palliation or prevention of a disease, with
anti-Pseudomonas aeruginosa Psl and PcrV bispecific binding
molecules. As described in more detail herein, the anti-Pseudomonas
aeruginosa Psl and PcrV bispecific binding molecules can be used in
unconjugated form or can be conjugated, e.g., to a drug, prodrug,
or an isotope.
[0045] As used herein the terms "susceptible subject" or
"susceptible human subject" refer to a subject, e.g., a human
patient, who is at risk, e.g., low risk, moderate risk, or high
risk, of contracting a disease, e.g., a disease associated with P.
aeruginosa, because of prior or current injury or disease, planned,
current, or prior hospitalization, e.g., in an intensive care unit,
assisted breathing, e.g., via mechanical ventilation through
intubation or a tracheostomy, and/or known colonization with P.
aeruginosa, e.g., in the respiratory tract, where the P. aeruginosa
can be, in some instances, antibiotic resistant. In certain aspects
a subject colonized with P. aeruginosa can be symptom-free, or can
exhibit mild, moderate, or severe disease symptoms, e.g, pneumonia
symptoms as described elsewhere herein. A prior or current
infection can be, e.g., a burn infection, a joint infection, a
wound infection, a skin infection, an intra-abdominal infection,
bacteremia, peritonitis, sepsis, an abscess, a bone infection, or a
combination of two or more such infections. In certain aspects the
subject can have, or be at risk of contracting acute pneumonia,
burn injury, corneal infection, cystic fibrosis, or a combination
thereof. In certain aspects, a susceptible human subject can be
treated with a bispecific antibody as provided herein to prevent
disease, e.g., nosocomial disease, iatrogenic disease, or a disease
caused by P. aeruginosa, from occurring, or to mitigate, e.g.,
alleviate, reduce, diminish, lessen, weaken, lighten, attenuate,
palliate, or relieve, disease or infection symptoms resulting from
P. aeruginosa infection, or to treat an infection resulting from P.
aeruginosa, e.g., eliminating or lowering the bacterial burden of a
P. aeruginosa infection. In certain aspects a susceptible human
subject is a subject in need of treatment, e.g., based on risk
factors (as noted above) for contracting a disease treatable by the
methods provided herein, or because of existing symptoms that
require treatment.
Bispecific Antibodies
[0046] The methods provided by this disclosure utilize bispecific
antibodies or antigen-binding fragments thereof, which specifically
bind to Pseudomonas aeruginosa Psl and PcrV. The bispecific
antibodies or fragments thereof as disclosed herein comprise
polypeptides, e.g., amino acid sequences encoding, for example,
Psl-specific and PcrV-specific antigen binding regions derived from
immunoglobulin molecules. A polypeptide or amino acid sequence
"derived from" a designated protein refers to the origin of the
polypeptide. In certain cases, the polypeptide or amino acid
sequence that is derived from a particular starting polypeptide or
amino acid sequence has an amino acid sequence that is essentially
identical to that of the starting sequence, or a portion thereof,
wherein the portion consists of at least 10-20 amino acids, at
least 20-30 amino acids, at least 30-50 amino acids, or that is
otherwise identifiable to one of ordinary skill in the art as
having its origin in the starting sequence.
[0047] Exemplary bispecific antibodies for use in the methods
provided herein are disclosed, e.g., in PCT Publication No. WO
2013/070615, PCT Publication No. WO 2014/074528, PCT Application
No. PCT/US2015/029063, and PCT Application No. PCT/US2015/036576,
the disclosures of which are incorporated by reference herein in
their entireties.
[0048] Exemplary portions of a bispecific antibody for use in the
methods provided herein are presented in Table 2. The CDRs in the
VH, VL, and scFv sequences are underlined. The linker sequences are
double underlined.
TABLE-US-00002 TABLE 2 Sequences SEQ ID NO: Description Amino Acid
Sequence 1 Anti-PcrV EVQLLESGGG LVQPGGSLRL SCAASGFTFS SYAMNWVRQA
PGKGLEWVS VH AITMSGITAYY TDDVKGRFTI SRDNSKNTLY LQMNSLRAED
TAVYYCAKEE FLPGTHYYYG MDVWGQGTTV TVSS 2 HCDR1-PcrV SYAMN 3
HCDR2-PcrV AITMSGITAYYTDDVKG 4 HCDR3-PcrV EEFLPGTHYYYGMDV 5
Anti-PcrV AIQMTQSPSS LSASVGDRVT ITCRASQGIR NDLGWYQQKP GKAPKLLIYS VL
ASTLQSGVPS RFSGSGSGTD FTLTISSLQP EDFATYYCLQ DYNYPWTFGQ GTKVEIK 6
LCDR1-PcrV RASQGIRNDLG 7 LCDR2-PcrV SASTLQS 8 LCDR3-PcrV LQDYNYPWT
9 Anti-PsI QVQ LQESGPGLVK PSETLSLTCT VSGGSISPYY WTWIRQPPGK
CLELIGYIHS scFv SGYTDYNPSL KSRVTISGDT SKKQFSLKLS SVTAADTAVY
YCARADWDRL RALDIWGQGT MVTVSSGGGG SGGGGSGGGG SGGGGSDIQL TQSPSSLSAS
VGDRVTITCR ASQSIRSHLN WYQQKPGKAP KLLIYGASNL QSGVPSRFSG SGSGTDFTLT
ISSLQPEDFA TYYCQQSTGA WNWFGCGTKV EIK 10 HCDR1-PsI PYYWT 11 HCDR2-
PsI YIHSSGYTDYNPSLKS 12 HCDR3- PsI ADWDRLRALDI 13 LCDR1- PsI
RASQSIRSHLN 14 LCDR2- PsI GASNLQS 15 LCDR3- PsI QQSTGAWNW 16 CH1
ASTKGP SVFPLAPSSK STSGGTAALG CLVKDYFPEP VTVSWNSGAL TSGVHTFPAV
LQSSGLYSLS SVVTVPSSSL GTQTYICNVN HKPSNTKVDK RV 17 H1 EPKSC 18 H2
DKTHTCPPCP 19 CH2-CH3
APELLGGPSVFLFPPKPKDTLX.sub.1IX.sub.2RX.sub.3PEVTCVVVDVSHED
PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVL
HQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY
TLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN
YKTTPPSLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK, wherein
X.sub.1 is M or Y, X.sub.2 is S or T, and X.sub.3 is T or E 20
CH2-CH3 APELLGG PSVFLFPPKP KDTLMISRTP EVTCVVVDVS
HEDPEVKFNWYVDGVEVHNA KTKPREEQYN STYRVVSVLT VLHQDWLNGK EYKCKVSNKA
LPAPIEKTIS KAKGQPREPQ VYTLPPSREE MTKNQVSLTC LVKGFYPSDI
AVEWESNGQPENNYKTTPPV LDSDGSFFLY SKLTVDKSRW QQGNVFSCSV MHEALHNHYT
QKSLSLSPGK 21 MEDI3902 EVQLLESGGG LVQPGGSLRL SCAASGFTFS SYAMNWVRQA
PGKGLEWVS Heavy AITMSGITAYY TDDVKGRFTI SRDNSKNTLY LQMNSLRAED
TAVYYCAKEE Chain FLPGTHYYYG MDVWGQGTTV TVSS ASTKGP SVFPLAPSSK
STSGGTAALG CLVKDYFPEP VTVSWNSGAL TSGVHTFPAV LQSSGLYSLS SVVTVPSSSL
GTQTYICNVN HKPSNTKVDK RVEPKSCGGG GSGGGGS QVQ LQESGPGLVK PSETLSLTCT
VSGGSISPYY WTWIRQPPGK CLELIGYIHS SGYTDYNPSL KSRVTISGDT SKKQFSLKLS
SVTAADTAVY YCARADWDRL RALDIWGQGT MVTVSSGGGG SGGGGSGGGG SGGGGSDIQL
TQSPSSLSAS VGDRVTITCR ASQSIRSHLN WYQQKPGKAP KLLIYGASNL QSGVPSRFSG
SGSGTDFTLT ISSLQPEDFA TYYCQQSTGA WNWFGCGTKV EIKGGGGSGG GGSDKTHTCP
PCPAPELLGG PSVFLFPPKP KDTLMISRTP EVTCVVVDVS HEDPEVKFNWYVDGVEVHNA
KTKPREEQYN STYRVVSVLT VLHQDWLNGK EYKCKVSNKA LPAPIEKTIS KAKGQPREPQ
VYTLPPSREE MTKNQVSLTC LVKGFYPSDI AVEWESNGQPENNYKTTPPV LDSDGSFFLY
SKLTVDKSRW QQGNVFSCSV MHEALHNHYT QKSLSLSPGK 22 MEDI3902 AIQMTQSPSS
LSASVGDRVT ITCRASQGIR NDLGWYQQKP GKAPKLLIYS Light ASTLQSGVPS
RFSGSGSGTD FTLTISSLQP EDFATYYCLQ DYNYPWTFGQ Chain GTKVEIK RTV
AAPSVFIFPP SDEQLKSGTA SVVCLLNNFY PREAKVQWKV DNALQSGNSQ ESVTEQDSKD
STYSLSSTLT LSKADYEKHK VYACEVTHQG LSSPVTKSFN RGEC
[0049] The bispecific antibody to be administered according to the
methods herein includes a binding domain which specifically binds
to P. aeruginosa Psl comprising a set of complementarity
determining regions (CDRs): HCDR1-Psl, HCDR2-Psl, HCDR3-Psl,
LCDR1-Psl, LCDR2-Psl, and LCDR3-Psl, wherein HCDR1-Psl has the
amino acid sequence of SEQ ID NO: 10, HCDR2-Psl has the amino acid
sequence of SEQ ID NO: 11, HCDR3-Psl has the amino acid sequence of
SEQ ID NO: 12, LCDR1-Psl has the amino acid sequence of SEQ ID NO:
13, LCDR2-Psl has the amino acid sequence of SEQ ID NO: 14, and
LCDR3-Psl has the amino acid sequence of SEQ ID NO: 15; and a
binding domain which specifically binds to P. aeruginosa PcrV
comprising a set of CDRs: HCDR1-PcrV, HCDR2-PcrV, HCDR3-PcrV,
LCDR1-PcrV, LCDR2-PcrV, and LCDR3-PcrV, wherein HCDR1-PcrV has the
amino acid sequence of SEQ ID NO: 2, HCDR2-PcrV has the amino acid
sequence of SEQ ID NO: 3, HCDR3-PcrV has the amino acid sequence of
SEQ ID NO: 4, LCDR1-PcrV has the amino acid sequence of SEQ ID NO:
6, LCDR2-PcrV has the amino acid sequence of SEQ ID NO: 7, and
LCDR3-PcrV has the amino acid sequence of SEQ ID NO: 8. In
embodiments, the bispecific antibody has a heavy chain and a light
chain. The heavy chain includes the formula
VH-CH1-H1-L1-S-L2-H2-CH2-CH3, where VH is an anti-P. aeruginosa
PcrV heavy chain variable domain including the amino acid sequence
of SEQ ID NO: 1, CH1 is a heavy chain constant region domain-1, H1
is a first heavy chain hinge region fragment, L1 is a first linker,
S is an anti-P. aeruginosa Psl ScFv molecule including the amino
acid sequence of SEQ ID NO: 9, L2 is a second linker, H2 is a
second heavy chain hinge region fragment, CH2 is a heavy chain
constant region domain-2, and CH3 is a heavy chain constant region
domain-3. The light chain includes the formula VL-CL, where VL is
an anti-P. aeruginosa PcrV light chain variable domain including
the amino acid sequence of SEQ ID NO: 5 and CL includes an antibody
light chain kappa constant region or an antibody light chain lambda
region. In certain aspects, CH1 can include the amino acid sequence
of SEQ ID NO: 16. In certain aspects L1 and L2 can be the same or
different, and can independently include (a) [GGGGS]n, where n is
0, 1, 2, 3, 4, or 5 (SEQ ID NO: 23), (b) [GGGG]n, where n is 0, 1,
2, 3, 4, or 5 (SEQ ID NO: 24), or a combination of (a) and (b). In
certain aspects, H1 can include the amino acid sequence EPKSC (SEQ
ID NO: 17). In certain aspects, H2 can include the amino acid
sequence DKTHTCPPCP (SEQ ID NO: 18). In certain aspects, CH2-CH3
can include the amino acid sequence of SEQ ID NO: 19. In certain
aspects CH2-CH3 can include the amino acid sequence of SEQ ID NO:
20. In certain aspects, the heavy chain of the bispecific antibody
can include the amino acid sequence of SEQ ID NO: 21, and the light
chain includes the amino acid sequence of SEQ ID NO: 22.
Pharmaceutical Compositions Comprising Anti-Pseudomonas aeruginosa
Psl and PcrV Bispecific Binding Molecules
[0050] Pharmaceutical compositions used in this disclosure comprise
pharmaceutically acceptable carriers well known to those of
ordinary skill in the art. Preparations for parenteral
administration include sterile aqueous or non-aqueous solutions,
suspensions, and emulsions.
[0051] The amount of an anti-Pseudomonas aeruginosa Psl and PcrV
bispecific antibody or fragment, variant or derivative thereof that
can be combined with the carrier materials to produce a single
dosage form will vary depending upon the subject treated and the
particular mode of administration. Exemplary dosage regimens
include a single intravenous infusion of an anti-Pseudomonas
aeruginosa Psl and PcrV bispecific antibody of about 500 to about
3000 mg, e.g., about 500 mg, 600, 700, 750, 1000, 1500 or about
3000 mg. Dosage regimens also can be adjusted to provide the
optimum desired response (e.g., a prophylactic response or a
therapeutic treatment response).
[0052] The route of administration of an anti-Pseudomonas
aeruginosa Psl and PcrV bispecific antibody or fragment, variant or
derivative thereof, can be, for example, parenteral. The term
parenteral as used herein includes, e.g., intravenous,
intraarterial, intraperitoneal, intramuscular, or subcutaneous
administration. A suitable form for administration would be a
solution for injection, in particular for intravenous or
intraarterial injection or drip.
[0053] Anti-Pseudomonas aeruginosa Psl and PcrV bispecific
antibodies or fragments, variants or derivatives thereof can be
administered in a pharmaceutically effective amount for the in vivo
treatment of or prevention of Pseudomonas aeruginosa infection. In
this regard, it will be appreciated that the disclosed binding
molecules can be formulated so as to facilitate administration and
promote stability of the active agent.
[0054] In keeping with the scope of the disclosure,
anti-Pseudomonas aeruginosa Psl and PcrV bispecific antibodies or
fragments, variants or derivatives thereof, can be administered to
a human or other animal in accordance with the aforementioned
methods of treatment in an amount sufficient to produce a
therapeutic effect. The anti-Pseudomonas aeruginosa Psl and PcrV
bispecific antibodies or fragments, variants or derivatives thereof
disclosed herein can be administered to such human or other animal
in a conventional dosage form prepared by combining the antibody of
the disclosure with a conventional pharmaceutically acceptable
carrier or diluent according to known techniques.
[0055] Effective doses of the compositions of the present
disclosure for treatment of Pseudomonas aeruginosa infection vary
depending upon many different factors, including means of
administration, target site, physiological state of the patient,
whether the patient is human or an animal, other medications
administered, and whether treatment is prophylactic or therapeutic.
Usually, the patient is a human but non-human mammals including
transgenic mammals can also be treated. Treatment dosages can be
titrated using routine methods known to those of skill in the art
to optimize safety and efficacy.
[0056] Anti-Pseudomonas aeruginosa Psl and PcrV bispecific
antibodies or fragments, variants or derivatives thereof can be
administered multiple occasions at various frequencies, e.g., as a
single dose, depending on various factors known to those of skill
in the art.
Methods for Preventing or Treating Nosocomial Infections
[0057] This disclosure provides a method of preventing nosocomial
infection in a susceptible human subject, where the method includes
administering to the subject a dose of about 500 mg to about 3000
mg, e.g., 500 mg, 600 mg, 700 mg, 750 mg, 1000 mg, 1500 mg or 3000
mg, of a bispecific antibody that specifically binds Pseudomonas
aeruginosa Psl and PcrV. The bispecific antibody can be
administered, e.g., as a single dose of about 500 mg to about 3000
mg, e.g., 500 mg, 600 mg, 700 mg, 750 mg, 1000 mg, 1500 mg, or 3000
mg. In certain aspects the bispecific antibody can be administered
as an IV infusion. A susceptible human subject, as described in
more detail elsewhere herein, is a person who is at risk of
contracting a nosocomial infection but at the time of
administration does not have an infection or shows no symptoms of
an infection; or a person who has contracted a nosocomial infection
that requires intervention or mitigation. The method further
includes monitoring the subject for symptoms following
administration of the bispecific antibody for, e.g., through 1 day,
3 days, 5 days, 7 days, 10 days, 15 days, 21 days, 28 days, or 30
days. In an embodiment, the method includes monitoring the subject
for symptoms through at least about 21 days or more from the day of
administration. "Nosocomial infections" are defined elsewhere
herein and include, e.g., pneumonia, bacteremia, bone infection,
joint infection, skin infection, burn infection, wound infection,
peritonitis, sepsis, and/or an abscess. Symptoms associated with
nosocomial infections, e.g., pneumonia, are known in the art, and
exemplary symptoms are described in the Examples below. In certain
aspects the nosocomial infection is caused by, or is exacerbated by
P. aeruginosa. According to this method, the human subject is
successfully treated if, e.g., at 1 day, 3 days, 5 days, 8 days, 10
days, 15 days, 21 days, 28 days, or 30 days post-administration,
the subject remains symptom-free (if the subject was symptom free
at the time of administration) or displays less severe symptoms
than would be expected if not treated with MEDI3902. In an
embodiment, the human subject is successfully treated if at 21 days
post-administration, the subject remains symptom-free (if the
subject was symptom free at the time of administration) or displays
less severe symptoms than would be expected if not treated with
MEDI3902. In another embodiment, the human subject is successfully
treated if at 28 or 30 days post-administration, the subject
remains symptom-free (if the subject was symptom free at the time
of administration) or displays less severe symptoms than would be
expected if not treated with MEDI3902.
[0058] In another aspect this disclosure provides a method of
preventing or treating pneumonia, e.g., hospital acquired or not
hospital acquired pneumonia in a susceptible human subject, where
the method includes administering to the subject a dose of about
500 mg to about 3000 mg, e.g., 500 mg, 600 mg, 700 mg, 750 mg, 1000
mg, 1500 mg or 3000 mg, of a bispecific antibody that specifically
binds Pseudomonas aeruginosa Psl and PcrV. The bispecific antibody
can be administered e.g., as a single dose of about 500 mg to about
3000 mg, e.g., 500 mg, 600 mg, 700 mg, 750 mg, 1000 mg, 1500 mg or
3000 mg. In certain aspects the bispecific antibody can be
administered as an IV infusion. In certain aspects the pneumonia is
nosocomial or iatrogenic. A susceptible human subject, as described
in more detail elsewhere herein, is a person who is at risk of
contracting pneumonia but at the time of administration does not
have pneumonia symptoms; or a person who has contracted pneumonia
that requires intervention or mitigation. The method further
includes monitoring the subject for pneumonia symptoms following
administration of the bispecific antibody for, e.g., through 1 day,
3 days, 5 days, 7 days, 10 days, 15 days, 21 days, 28 days, or 30
days. In an embodiment, the method includes monitoring the subject
for symptoms at least about 21 days from the day of administration.
Symptoms associated with pneumonia are known in the art, and
exemplary symptoms are described in the Examples below. In certain
aspects the pneumonia is caused by, or is exacerbated by, P.
aeruginosa. According to this method, the human subject is
successfully treated if, e.g., at 1 day, 3 days, 5 days, 8 days, 10
days, 15 days, 21 days, 28 days, or 30 days post-administration,
the subject remains symptom-free (if the subject was symptom free
at the time of administration) or displays less severe symptoms
than would be expected if not treated with MEDI3902. In an
embodiment, the human subject is successfully treated if at 7 days
post-administration, the subject remains symptom-free (if the
subject was symptom-free at the time of administration) or displays
less severe symptoms than would be expected if not treated with
MEDI3902. In an embodiment, the human subject is successfully
treated if at 21 days post-administration, the subject remains
symptom-free (if the subject was symptom-free at the time of
administration) or displays less severe symptoms than would be
expected if not treated with MEDI3902. In another embodiment, the
human subject is successfully treated if at 28 or 30 days
post-administration, the subject remains symptom-free (if the
subject was symptom free at the time of administration) or displays
less severe symptoms than would be expected if not treated with
MEDI3902.
[0059] In another aspect this disclosure provides a method of
preventing or treating a disease caused by Pseudomonas aeruginosa,
e.g., pneumonia, tracheobronchitis, bacteremia, endocarditis,
meningitis, otitis media, bacterial keratitis, endophthalmitis,
osteomyelitis, gastrointestinal disease, skin infection,
septicemia, or any combination thereof, in a susceptible human
subject, where the method includes administering to the subject a
dose of about 500 mg to about 3000 mg, e.g., 500 mg, 600 mg, 700
mg, 750 mg, 1000 mg, 1500 mg, or 3000 mg, of a bispecific antibody
that specifically binds Pseudomonas aeruginosa Psl and PcrV. The
bispecific antibody can be administered, e.g., as a single dose of
about 500 mg to about 3000 mg, e.g., 500 mg, 600 mg, 700 mg, 750
mg, 1000 mg, 1500 mg, or 3000 mg. In certain aspects the bispecific
antibody can be administered as an IV infusion. In certain aspects
the disease caused by Pseudomonas aeruginosa is nosocomial or
iatrogenic. A susceptible human subject, as described in more
detail elsewhere herein, is a person who is at risk of contracting
a disease treatable or preventable by the methods provided herein
but at the time of administration does not have disease symptoms;
or a person who has contracted disease caused by Pseudomonas
aeruginosa that requires treatment, intervention or mitigation. The
method further includes monitoring the subject for disease symptoms
following administration of the bispecific antibody through, e.g.,
1 day, 3 days, 5 days, 8 days, 10 days, 15 days, 21 days, 28 days,
or 30 days. In an embodiment, the method includes monitoring the
subject for symptoms through at least about 21 days from the day of
administration. Symptoms associated with pneumonia are known in the
art, and exemplary symptoms are described in the Examples below.
According to this method, the human subject is successfully treated
if, e.g., at 1 day, 3 days, 5 days, 8 days, 10 days, 15 days, 21
days, 28 days, or 30 days post-administration, the subject remains
symptom-free (if the subject was symptom free at the time of
administration) or displays less severe symptoms than would be
expected if not treated with MEDI3902. In an embodiment, the human
subject is successfully treated if at 7 days post-administration,
the subject remains symptom-free (if the subject was symptom-free
at the time of administration) or displays less severe symptoms
than would be expected if not treated with MEDI3902. In an
embodiment, the human subject is successfully treated if at 21 days
post-administration, the subject remains symptom-free (if the
subject was symptom free at the time of administration) or displays
less severe symptoms than would be expected if not treated with
MEDI3902. In another embodiment, the human subject is successfully
treated if at 28 or 30 days post-administration, the subject
remains symptom-free (if the subject was symptom free at the time
of administration) or displays less severe symptoms than would be
expected if not treated with MEDI3902.
[0060] In certain aspects the bispecific antibody to be
administered according to the methods herein includes a binding
domain which specifically binds to Psl comprising a set of
Complementarity-Determining Regions (CDRs): HCDR1-Psl, HCDR2-Psl,
HCDR3-Psl, LCDR1-Psl, LCDR2-Psl, and LCDR3-Psl, wherein HCDR1-Psl
has the amino acid sequence of SEQ ID NO: 10, HCDR2-Psl has the
amino acid sequence of SEQ ID NO: 11, HCDR3-Psl has the amino acid
sequence of SEQ ID NO: 12, LCDR1-Psl has the amino acid sequence of
SEQ ID NO: 13, LCDR2-Psl has the amino acid sequence of SEQ ID NO:
14, and LCDR3-Psl has the amino acid sequence of SEQ ID NO: 15; and
a binding domain which specifically binds to PcrV comprising
HCDR1-PcrV, HCDR2-PcrV, HCDR3-PcrV, LCDR1-PcrV, LCDR2-PcrV, and
LCDR3-PcrV, wherein HCDR1-PcrV has the amino acid sequence of SEQ
ID NO: 2, HCDR2-PcrV has the amino acid sequence of SEQ ID NO: 3,
HCDR3-PcrV has the amino acid sequence of SEQ ID NO: 4, LCDR1-PcrV
has the amino acid sequence of SEQ ID NO: 6, LCDR2-PcrV has the
amino acid sequence of SEQ ID NO: 7, and LCDR3-PcrV has the amino
acid sequence of SEQ ID NO: 8. In embodiments, the bispecific
antibody has a heavy chain and a light chain. The heavy chain
includes the formula VH-CH1-H1-L1-S-L2-H2-CH2-CH3, where VH is an
anti-PcrV heavy chain variable domain including the amino acid
sequence of SEQ ID NO: 1, CH1 is a heavy chain constant region
domain-1, H1 is a first heavy chain hinge region fragment, L1 is a
first linker, S is an anti-Psl ScFv molecule including the amino
acid sequence of SEQ ID NO: 9, L2 is a second linker, H2 is a
second heavy chain hinge region fragment, CH2 is a heavy chain
constant region domain-2, and CH3 is a heavy chain constant region
domain-3. The light chain includes the formula VL-CL, where VL is
an anti-PcrV light chain variable domain including the amino acid
sequence of SEQ ID NO: 5 and CL includes an antibody light chain
kappa constant region or an antibody light chain lambda region. In
certain aspects, CH1 can include the amino acid sequence of SEQ ID
NO: 16. In certain aspects L1 and L2 can be the same or different,
and can independently include (a) [GGGGS]n, where n is 0, 1, 2, 3,
4, or 5 (SEQ ID NO: 23), (b) [GGGG]n, where n is 0, 1, 2, 3, 4, or
5 (SEQ ID NO: 24), or a combination of (a) and (b). In certain
aspects, H1 can include the amino acid sequence EPKSC (SEQ ID NO:
17). In certain aspects, H2 can include the amino acid sequence
DKTHTCPPCP (SEQ ID NO: 18). In certain aspects, CH2-CH3 can include
the amino acid sequence of SEQ ID NO: 19. In certain aspects
CH2-CH3 can include the amino acid sequence of SEQ ID NO: 20. In
certain aspects, the heavy chain of the bispecific antibody can
include the amino acid sequence of SEQ ID NO: 21, and the light
chain includes the amino acid sequence of SEQ ID NO: 22.
[0061] The bispecific antibody for use in the methods provided
herein can be administered, e.g., as a single dose of about 500 mg
to about 3000 mg, e.g., 500 mg, 600 mg, 700 mg, 750 mg, 1000 mg,
1500 mg, or 3000 mg.
[0062] In some embodiments, the serum target level of the
bispecific antibody or antigen-binding fragments thereof is in the
range of about 1 .mu.g/mL to about 10 .mu.g/mL, about 2 .mu.g/mL to
about 9 .mu.g/mL, about 3 .mu.g/mL to about 8 .mu.g/mL, about 4
.mu.g/mL to about 7 .mu.g/mL, about 5 .mu.g/mL to about 6 .mu.g/mL,
about 5 .mu.g/mL to about 7 .mu.g/mL, 5 .mu.g/mL to about 8
.mu.g/mL, 5 .mu.g/mL to about 9 .mu.g/mL, or about 5 .mu.g/mL to
about 10 .mu.g/mL. In other embodiments, the serum target level of
the bispecific antibody or antigen-binding fragments thereof is in
the range of about 1 .mu.g/mL to about 6 .mu.g/mL, about 1 .mu.g/mL
to about 5 .mu.g/mL, about 1 .mu.g/mL to about 4 .mu.g/mL, about 1
.mu.g/mL to about 3 .mu.g/mL, or about 1 .mu.g/mL to about 2
.mu.g/mL. In one embodiment, the serum target level of the
bispecific antibody or antigen-binding fragments thereof is at
least 1.7 .mu.g/mL. In another embodiment, the serum target level
of the bispecific antibody or antigen-binding fragments thereof is
at least 5.3 .mu.g/mL. A serum target level of about 1.7 .mu.g/mL
is expected to prevent or treat infections caused by >80-90% of
P. aeruginosa strains. A serum target level of about 5.3 .mu.g/mL
is expected to prevent or treat infections caused by the toughest
P. aeruginosa strains (e.g., those strains that are highly virulent
and resistant to antibiotics, such as ARC3928 and ARC3502.)
[0063] In certain aspects the bispecific antibody for use in the
methods provided herein can be administered as an IV infusion.
[0064] The methods provided herein are suitable for use with
susceptible human subjects as described elsewhere herein. Examples
include subjects who are about to be hospitalized, are currently
hospitalized, were recently hospitalized, are about to be,
currently, or recently on a mechanical ventilator, or a combination
thereof. Hospitalization, in some instances, can be in an intensive
care unit (ICU). Mechanical ventilation, if required, can be
through intubation, e.g., through an endotracheal or nasotracheal
tube, or through a tracheostomy. Patients who are about to be, are
currently, or were recently on mechanical ventilation can have a
heightened risk of contracting a respiratory infection, e.g.,
pneumonia, e.g., Pseudomonas aeruginosa pneumonia. In those
situations where mechanical ventilation is indicated,
administration of a bispecific antibody as provided by the
disclosed methods can reduce the risk of contracting pneumonia, for
example, while currently on mechanical ventilation, after
mechanical ventilation is no longer required, or a combination
thereof.
[0065] In certain aspects the subject is colonized with Pseudomonas
aeruginosa in the respiratory tract, e.g., the lower respiratory
tract, at the time of administration of the bispecific antibody. In
certain aspects the subject's respiratory tract is colonized with
P. aeruginosa one, two, three, or four days prior to administration
of the bispecific antibody. Colonization can be measured, e.g., by
detection of P. aeruginosa in a tracheal aspirate within 6 hours,
12 hours, 24 hours, 48 hours, 72 hours, or 96 hours prior to
administration of the bispecific antibody. In certain aspects of
the methods provided herein, the subject has not received
antibiotics considered active against the P. aeruginosa strain with
which the subject is colonized prior to administration of the
bispecific antibody. In certain aspects, the subject's respiratory
tract can be additionally colonized by Staphylococcus aureus at the
time of administration of the bispecific antibody.
[0066] In certain aspects the subject does not have pneumonia
symptoms at the time of administration of the bispecific antibody.
Symptoms can be measured according to the Clinical Pulmonary
Infection Score (CPIS). A lack of symptoms can be inferred e.g., if
at 24 hours prior to the administration of the bispecific antibody
the subject has a CPIS of less than 6.
[0067] The methods provided herein include monitoring a subject for
disease symptoms, e.g., pneumonia symptoms, following
administration of the bispecific antibody. In certain aspects, the
subject can be monitored for pneumonia by chest x-ray, observation
of respiratory signs or symptoms of pneumonia, microbiologic
confirmation of pneumonia, or any combination thereof. A subject
can be determined to have pneumonia, e.g., when a new or worsening
infiltrate consistent with pneumonia is observed on a chest x-ray,
when the subject displays at least two minor or at least one major
respiratory sign or symptoms of pneumonia, when a specimen obtained
from the subject is positive for P. aeruginosa by culture, or any
combination thereof. In certain aspects the specimen is a
respiratory secretion of the subject. A respiratory secretion can
be obtained from expectorated sputum, by endotracheal aspiration,
by bronchoscopy with bronchoalveolar lavage, by use of a
protected-specimen brush sampling in an intubated subject, or any
combination thereof.
[0068] Minor respiratory signs or symptoms of pneumonia include,
without limitation, a body temperature of greater than about
38.degree. C., a core body temperature of less than about
35.degree. C., a white blood cell count of greater than about
10,000 cells per cubic millimeter (mm.sup.3), a white blood cell
count of less than about 4,500 cells per mm.sup.3, a band
neutrophil count of greater than about 15%, production of new
purulent endotracheal secretions or sputum, new auscultatory
findings, dullness to percussion, a new onset of cough, dyspnea,
tachypnea, hypoxemia, or any combination thereof. Major respiratory
signs or symptoms of pneumonia can include, without limitation, an
acute change made in the ventilatory support system to enhance
oxygenation comprising a PaO.sub.2/FiO.sub.2 ratio less than about
240 mm Hg maintained for at least four hours, a decrease in the
PaO.sub.2/FiO.sub.2 ratio of greater than about 50 mm Hg maintained
for at least four hours, the necessity to initiate or reinitiate
mechanical ventilation in a non-mechanically ventilated subject, or
any combination thereof. Microbiologic confirmation of pneumonia
can include, without limitation, a respiratory specimen positive
for P. aeruginosa by culture, a blood culture positive for P.
aeruginosa, a pleural fluid aspirate or lung tissue culture
positive for P. aeruginosa, or any combination thereof.
[0069] In certain aspects, the methods provided by this disclosure
can further include administering an antibiotic to the subject
prior to, concurrently with, and/or following administration of the
bispecific antibody. Suitable antibiotics can include, without
limitation, aminoglycosides, ticarcillin, ureidopenicillins,
ciprofloxacin, cefepime, gentamicin, amikacin, tobramycin,
ceftazidime, aztreonam, cefotaxime, or any combination thereof.
Suitable dosages and length of treatment can be readily determined
by a healthcare provider. In certain aspects, the P. aeruginosa
strain with which the subject is colonized is sensitive to the
antibiotic chosen for administration. In other aspects, however,
the P. aeruginosa strain with which the subject is colonized is
resistant or partially resistant to one or more of the available
antibiotics chosen for administration. In preclinical studies, for
example, MEDI3902 has shown synergistic enhancement of antibiotic
therapy against P. aeruginosa pneumonia with distinct antibiotic
classes against both antibiotic-sensitive and antibiotic-resistant
P. aeruginosa.
[0070] In certain aspects, the methods provided by this disclosure
can further include administering an antihistamine to the subject
prior to, concurrently with, and/or following administration of the
bispecific antibody. Suitable antihistamines can include, without
limitation, diphenhydramine, clemastine, dexchlorpheniramine,
azelastine, cetirizine, desloratadine, fexofenadine,
levocetirizine, loratadine, olopatadine, or any combination
thereof. Suitable dosages and length of treatment can be readily
determined by a healthcare provider.
[0071] In certain aspects, the methods provided by this disclosure
include monitoring a subject for serum pharmacokinetics of the
bispecific antibody, tracheal secretion pharmacokinetics of the
bispecific antibody, or a combination thereof. A subject can
maintain, e.g., a serum level of the bispecific antibody of at
least about 1 .mu.g/mL, at least about 2 .mu.g/mL, at least about 3
.mu.g/mL, at least about 4 .mu.g/mL, at least about 5 .mu.g/mL, or
at least about 5.3 .mu.g/mL or more through day 7, day 14, day 21,
day 28, day 30, day 35, day 42, or day 49 following administration
of the bispecific antibody. For example, a subject can maintain a
serum level of the bispecific antibody of at least about 1.7
.mu.g/mL, or at least about 5.3 .mu.g/mL, or more through day 7,
day 14, day 21, day 28, day 30, day 35, day 42, or day 49 following
administration of the bispecific antibody. Based on observed
increased clearance in ICU patients for monoclonal antibodies
directed at bacterial pathogens (e.g., MEDI4893), pharmacokinetics
were modelled for ICU patients with mechanical ventilation
following a single dose of MEDI3902. A single dose of 1500 mg
MEDI3902 is predicted to maintain serum exposure at about 1
.mu.g/mL for .gtoreq.21 days in >90% subjects. A single dose of
3000 mg MEDI3902 is predicted to maintain serum exposure at about
1.7 .mu.g/mL for .gtoreq.21 days in >90% subjects. Based on
pharmacokinetics in healthy volunteers (e.g., without increased
clearance like that observed in ICU patients), a single dose of 500
mg, 1500 mg or 3000 mg is expected to maintain serum exposure at
about 1 .mu.g/mL for .gtoreq.21 days in >90% subjects, for
example 1.7 .mu.g/mL for .gtoreq.21 days in >90% subjects, such
as about 5.3 .mu.g/mL for >21 days in >90% subjects. Of
course, the serum level of the bispecific antibody will vary
throughout the monitoring period, and can reach a maximal
concentration of the bispecific antibody, or C.sub.max, of about
100 .mu.g/mL, about 200 .mu.g/mL, about 300 .mu.g/mL, about 400
.mu.g/mL, about 500 .mu.g/mL, or more than about 600 .mu.g/mL,
depending on the dose of bispecific antibody administered. In
certain aspects, the area under the concentration-time curve from
time zero to infinity (AUC.sub..infin.) can be measured. For
example, the AUC.sub..infin. can be, e.g., about 2000 .mu.gday/mL
to about 6000 .mu.gday/mL, e.g., about 4000 .mu.gday/mL for a 1500
mg dose of the bispecific antibody. In certain aspects, serum
terminal half-life can be measured. In certain aspects the volume
of distribution at steady state (Vd.sub.ss) can be measured. The
subject can be monitored for pharmacokinetic parameters through day
7, day 14, day 21, day 28, day 30, day 35, day 42, day 49, or
longer following administration of the bispecific antibody. In
certain aspects the subject can be monitored through day 21. In
certain aspects the subject can be monitored through day 49.
[0072] The following disclosed embodiments are merely
representative. Thus, specific structural, functional, and
procedural details disclosed in the following examples are not to
be interpreted as limiting.
EXAMPLES
Example 1: Clinical Trial Phase 1 Study
[0073] A Phase 1, first time in human, randomised, double-blind,
placebo-controlled, dose-escalation study was conducted that
evaluated the safety and tolerability of a single ascending IV dose
of MEDI3902 in healthy adult subjects. Adverse event (AE), PK, and
ADA data were collected through the last study visit (60 days
postdose/Day 61) in the 42 subjects who received MEDI3902 at doses
of 250 mg (n=3), 750 mg (n=15), 1500 mg (n=15), or 3000 mg (n=9)
and 14 subjects who received placebo. All of the AEs in both the
MEDI3902 and placebo groups were either Grade 1 or Grade 2 in
severity. The most frequently reported AEs were Grade 1 or Grade 2
infusion-related reactions (15/42 subjects [35.7%] in the total
MEDI3902 group; none in the placebo group) and Grade 1 or Grade 2
headache (6/42 subjects [14.3%] in the total MEDI3902 group; 2/14
subjects [14.3%] in the placebo group). Adverse events of special
interest (AESIs) included the events of infusion-related reaction
(15/42 subjects [35.7%] in the total MEDI3902 group; none in the
placebo group), which were mitigated by treatment with
diphenhydramine and by slowing the infusion rate. Most events of
infusion-related reaction resolved either during or immediately
after the infusion or by the next day. Two subjects (1 subject in
the 750 mg MEDI3902 dose group and 1 subject in the 3000 mg dose
group) did not complete dosing due to infusion-related reactions.
No serious adverse events (SAEs) were reported.
[0074] PK and immunogenicity of MEDI3902 were studied in healthy
adult volunteers in the Phase 1 study. Blood samples were collected
predose and at various time points up to 60 days postdose for
quantitating MEDI3902 concentrations in serum and for detecting ADA
against MEDI3902. Following IV infusion, MEDI3902 exhibited linear
PK in healthy adult subjects. Serum peak concentrations were
observed immediately postinfusion, and declined in a bi-exponential
manner over time. MEDI3902 concentrations in the 250 mg dose cohort
were measurable up to 42 days postdose while other high-dose
cohorts had measurable serum concentration through 60 days
postdose. A single dose of 750 mg IV maintained serum exposure
above the target level of 5.3 .mu.g/mL for 28 days for most
subjects in this cohort. MEDI3902 exposure in serum increased in an
approximately dose-proportional manner from 250 mg to 1500 mg, and
in a slightly less than dose proportional manner from 1500 mg to
3000 mg. C.sub.max increased from 100 .mu.g/mL at 250 mg to 468
.mu.g/mL at 1500 mg and to 838 .mu.g/mL at 3000 mg. The area under
the concentration-time curve from time zero to infinity
(AUC.sub..infin.) increased dose-proportionally from 694
.mu.gday/mL at 250 mg to 4246 .mu.gday/mL at 1500 mg.
AUC.sub..infin. at 3000 mg was 6540 .mu.gday/mL. Serum terminal
half-life was estimated to be 7-9 days. Volume of distribution at
steady state (Vd.sub.ss) was 3.4-4.9 L, indicating limited
distribution into the extravascular space. Of the 42 subjects, 1
subject in Cohort 4 (3000 mg) tested ADA positive postdose on Day
61. The serum concentration of MEDI3902 in this subject rapidly
decreased 45 days postdose and dropped to a level below the lower
limit of quantification (LLOQ) 60 days postdose, suggesting an
impact of ADA on MEDI3902 PK.
[0075] MEDI3902 was found to be generally safe in the initial Phase
1 study.
Example 2: Clinical Trial Phase 2b Study
[0076] In the Phase 2, randomized, double-blind,
placebo-controlled, single-dose, dose-ranging, proof-of-concept,
approximately 429 subjects will be enrolled and dosed at
approximately 120 sites primarily in Europe. Subjects will be
randomly assigned in a 1:1:1 ratio to receive a single IV dose of
1500 mg or 3000 mg MEDI3902, or placebo. Dosing scheme can also be
changed to a 1:1 randomization between single IV dose of MEDI3902
at 1500 mg (or 3000 mg) or placebo. Randomization will be
stratified by geographic region and by whether subjects received
anti-P. aeruginosa antibiotic treatment (duration of .ltoreq.72
hours) within the 96 hours prior to randomization. Subjects will be
followed through Day 50 (49 days post investigational product
administration) (FIG. 1).
[0077] In order to be enrolled, subjects are required to be 18
years of age or older, in the Intensive Care Unit, currently
intubated and mechanically ventilated, and expected to remain
intubated and mechanically ventilated for at least three days at
the time of study entry. Subject must also be colonized with P.
aeruginosa in the lower respiratory tract, as demonstrated by
having a tracheal sample positive for P. aeruginosa within 36 hours
prior to randomization, but are currently free of P.
aeruginosa-related disease. Subjects with evidence of resolved
pneumonia can be enrolled.
[0078] Subjects are not eligible to participate if they have acute
confirmed or suspected Pseudomonas disease at enrollment or before
receiving MEDI3902. Subjects are also not eligible to participate
if they have previously received a monoclonal antibody, if they
have a clinical pulmonary infection score (CPIS) of six or greater
within the past 24 hours prior to MEDI3902 dosing, or if they have
an Acute Physiology and Chronic Health Evaluation-II (APACHE-II)
score of greater than or equal to 25 or a SOFA score of greater
than or equal to 12 at time of randomization. Subjects with active
pulmonary disease that would impair the ability to diagnose
pneumonia (e.g., active tuberculosis or fungal disease, obstructing
lung cancer, large pleural effusion or empyema, cystic fibrosis, or
acute respiratory distress syndrome with lung "white out") are not
eligible. Subjects who are tracheostomy-dependent prior to hospital
admission and subjects with burns on more than 40% of body surface
are not eligible. In addition, subjects are not eligible if they
received an anti-P. aeruginosa antibiotic for more than 72 hours
within 96 hours prior to randomization, wherein the antibiotic is
considered active against the P. aeruginosa strain with which the
subject is colonized, or wherein ongoing receipt of the anti-P.
aeruginosa antibiotic is anticipated.
[0079] Subjects will be randomly assigned to receive a single dose
of 1500 mg MEDI3902, 3000 mg MEDI3902, or placebo administered via
IV infusion on Day 1. All subjects will be premedicated with
antihistamine, for example, 50 mg diphenhydramine IV, clemastine 2
mg IV, or dexchlorpheniramine 5 mg IV (or another antihistamine
preparation utilized in routine clinical practice for management of
acute allergic reactions) within 15-30 minutes prior to start of
study medication infusion. Additional premedication of subjects
with acetaminophen 650 mg orally and/or methylprednisolone 20 mg IV
in combination with the antihistamine, or the antihistamine
together with famotidine 20 mg orally with or without acetaminophen
and/or methylprednisolone prior to start of investigational product
infusion, can be authorized.
[0080] The primary efficacy endpoint for this study is the
incidence of nosocomial pneumonia caused by P. aeruginosa through
21 days postdose (Day 22) after a single dose of MEDI3902 in
mechanically ventilated subjects at risk for P. aeruginosa
nosocomial pneumonia. The dosage levels were selected based on data
from the Phase 1 study (see Example 1), PK/PD data from preclinical
pharmacology studies (e.g., EC.sub.90 in a murine P.
aeruginosa-induced lethal pneumonia model), PK modelling based on
observed increased clearance in ICU patients of other monoclonal
antibodies directed at bacterial pathogens (FIG. 2), and a clinical
report of median (range) time to VAP onset of 10 days. Some
mechanically ventilated subjects will continue to require
mechanical ventilation throughout the 21-day postdose period, but
some subjects may be weaned off the ventilator during this period.
Since these latter subjects may develop nosocomial pneumonia caused
by P. aeruginosa after they no longer require mechanical
ventilation, primary efficacy will be evaluated in subjects who
were on mechanical ventilation at the time of enrolment, regardless
of whether they remain on or are weaned off mechanical ventilation
during the 21-day postdose period. The secondary efficacy endpoints
will evaluate separately the incidence of nosocomial pneumonia
caused by P. aeruginosa while on mechanical ventilation and the
incidence of nosocomial pneumonia caused by P. aeruginosa after
mechanical ventilation is no longer required through 21 days
postdose.
[0081] The primary safety endpoints will assess TEAEs, TESAEs, and
AESIs through 49 days postdose.
[0082] The secondary endpoints (MEDI3902 serum concentration, PK
parameters, and ADA response to MEDI3902 through 49 days postdose)
are designed to assess the presence of MEDI3902 in vivo.
[0083] Data analysis will be performed after all subjects have
completed the study. Analysis of efficacy, pharmacokinetic (PK),
anti-drug antibody (ADA), and safety will be performed on all data
collected after the last subject has completed follow-up through 49
days postdose to demonstrate that a single IV dose of 1500 mg (and
possibly 3000 mg) of MEDI3902 has an acceptable safety profile and
is capable of reducing the incidence of P. aeruginosa pneumonia in
mechanically ventilated subjects in the Intensive Care Unit (ICU)
who are colonized with P. aeruginosa in the lower respiratory tract
through 21 days postdose (irrespective of mechanical ventilation at
the time of diagnosis).
[0084] Tracheal aspirate samples are collected for microbiological
assessment of P. aeruginosa colonization on Days 2, 4 (.+-.1 day),
8 (.+-.1 day), 15 (.+-.1 day), 29 (.+-.1 day), and 50 (.+-.1 day),
provided the subject remains intubated.
[0085] Subjects are monitored for clinical symptoms of pneumonia
and other serious P. aeruginosa infection daily while in hospital,
and in accordance with symptoms after hospital discharge. At these
times, the monitoring includes a physical examination and
evaluation of vital signs. While in the hospital, CPIS is assessed
daily while the subject remains on mechanical ventilation.
[0086] For subjects with suspected serious P. aeruginosa infection,
clinical symptoms (CPIS, SOFA, physical exam, and vital signs) are
assessed at the day of onset and then daily through resolution.
Blood samples are analyzed in all subjects with suspected serious
P. aeruginosa infection on the day of onset and the two following
days. Blood sampling analyses are repeated every other day in those
that are positive for P. aeruginosa pneumonia until they are
negative for P. aeruginosa. Tracheal or bronchial aspirates are
analyzed in subjects with suspected serious P. aeruginosa infection
that are intubated on the day of onset and the two following days.
Tracheal or bronchial aspirates analyses are repeated every day in
those that are positive for P. aeruginosa pneumonia until
resolution. Expectorated sputum is analyzed in subjects with
suspected serious P. aeruginosa infection that are not intubated
(unless bronchoscopy performed for clinical management and BAL or
PSB sample available) on the day of onset and the two following
days. Expectorated sputum analyses are repeated every other day in
those that are positive for P. aeruginosa pneumonia until
resolution. Chest X-rays are performed on subjects with suspected
serious P. aeruginosa infection on the day of onset. Chest X-rays
are repeated in those with confirmed pneumonia as clinically
indicated through resolution.
[0087] In subjects who are mechanically ventilated at the time of
diagnosis of P. aeruginosa pneumonia, the criteria for the
diagnosis requires that the subject demonstrate the following
radiographic, clinical, and microbiologic new onset symptoms/signs
that are not due to any other non-infectious cases.
1. Radiographic criteria: [0088] a. New or worsening infiltrate
consistent with pneumonia on chest x-ray obtained within 24 hours
of the event (diagnosed by a qualified radiologist)
AND
[0089] 2. Clinical criteria: At least 2 of the following minor or 1
major respiratory sign or symptom of new onset: Minor criteria:
[0090] b. Systemic signs of infection (one or more of the
following): Abnormal temperature (oral or tympanic
temperature>38.degree. C. or a core
temperature.gtoreq.38.3.degree. C. or hypothermia, defined as a
core body temperature of <35.degree. C.), and/or abnormal WBC
count (WBC count>10,000 cells/mm.sup.3, WBC count<4,500
cells/mm.sup.3, or >15% band neutrophils) [0091] c. Production
of new purulent endotracheal secretions [0092] d. New physical
examination findings consistent with pneumonia/pulmonary
consolidation such as auscultatory findings (eg, rales, rhonchi,
bronchial breath sounds) or dullness to percussion Major criteria:
[0093] e. Acute changes made in the ventilatory support system to
enhance oxygenation, as determined by: [0094] i.
PaO.sub.2/FiO.sub.2 ratio<240 mm Hg maintained for at least 4
hours OR [0095] ii. A decrease in PaO.sub.2/FiO.sub.2 by .gtoreq.50
mm Hg maintained for at least 4 hours
AND
[0096] 3. Microbiologic confirmation (obtained within 24 hours of
onset of the event): At least 1 of the following: [0097] f.
Respiratory specimen positive for P. aeruginosa by culture includes
a specimen of respiratory secretion obtained by endotracheal
aspiration or by bronchoscopy with BAL or PSB sampling in intubated
subjects. In subjects who are not intubated but meet the protocol
definition of mechanical ventilation, a specimen of expectorated
sputum would be acceptable. [0098] g. Blood culture positive for P.
aeruginosa (and no apparent primary source of infection outside the
lung) [0099] h. Pleural fluid aspirate or lung tissue culture
positive for P. aeruginosa during episode of pneumonia (only if
obtained as part of the subject's necessary clinical
management).
[0100] Subjects are considered mechanically ventilated if they are
intubated with an endotracheal or nasotracheal tube and are
receiving positive pressure ventilation support or if they are not
intubated with an endotracheal or nasotracheal tube, but require 8
or more hours of positive pressure ventilation within the past 24
hours.
[0101] In subjects who are not mechanically ventilated at the time
of diagnosis of P. aeruginosa pneumonia, the criteria for the
diagnosis requires that the subject demonstrate the following
radiographic, clinical, and microbiologic new onset symptoms/signs
that are not due to any other non-infectious cases.
4. Radiographic criteria: [0102] i. New or worsening infiltrate
consistent with pneumonia on chest x-ray obtained within 24 hours
of the event (diagnosed by qualified radiologist)
AND
[0103] 5. Clinical criteria: At least 2 of the following minor or 1
major respiratory sign or symptom of new onset: Minor criteria:
[0104] j. Systemic signs of infection (one or more of the
following): Abnormal temperature (oral or tympanic
temperature>38.degree. C. or a core
temperature.gtoreq.38.3.degree. C. or hypothermia, defined as a
core body temperature of <35.degree. C.), and/or abnormal WBC
count (WBC count>10,000 cells/mm.sup.3, WBC count<4,500
cells/mm.sup.3, or >15% band neutrophils) [0105] k. A new onset
of cough (or worsening of cough) 1. Production of purulent sputum
[0106] m. New physical examination findings consistent with
pneumonia/pulmonary consolidation such as auscultatory findings
(eg, rales, rhonchi, bronchial breath sounds), dullness to
percussion, or pleuritic chest pain [0107] n. Dyspnea, tachypnea
(respiratory rate>30 breaths/minute), or hypoxemia defined as:
[0108] iii. Oxygen (O.sub.2) saturation<90% or PaO.sub.2<60
mm Hg on room air if lower than baseline, OR [0109] iv. A need to
initiate or increase sustained (.gtoreq.3 hours) supplemental 02 to
maintain pre-event baseline 02 saturations Major criteria: [0110]
o. A need to initiate non-invasive mechanical ventilation or
re-initiate invasive mechanical ventilation because of respiratory
failure or worsening of respiratory status
AND
[0111] 6. Microbiologic confirmation (obtained within 72 hours of
onset of the event): At least 1 of the following: [0112] p.
Respiratory specimen positive for P. aeruginosa by culture.
Includes either expectorated sputum or (only if obtained as part of
the subject's necessary clinical management) a specimen of
respiratory secretions obtained by bronchoscopy with BAL or PSB
sampling [0113] q. Blood culture positive for P. aeruginosa (and no
other apparent primary source of infection outside the lung) [0114]
r. Pleural fluid aspirate or lung tissue culture positive for P.
aeruginosa (only if obtained as part of the subject's necessary
clinical management).
[0115] A subject is not considered to be mechanically ventilated
when an endotracheal or nasotracheal tube is not in place and the
subject does not require positive ventilation support for at least
8 hours.
[0116] The incidence of P. aeruginosa pneumonia through 21 days
post dose is calculated to demonstrate that administration of 1500
mg or 3000 mg MEDI3902 reduces the incidence of P. aeruginosa
pneumonia. The incidence of P. aeruginosa pneumonia through 21 days
post dose will be compared in subjects on mechanical ventilation
and subjects in whom mechanical ventilation is no longer
required.
[0117] Adverse events and new onset chronic disease are reviewed to
demonstrate that an administration of 1500 or 3000 mg MEDI3902 is
safe.
Example 3: MEDI3902 Reduces Lethality in Acute Pneumonia Model at
Lower Bacterial Burden
[0118] The in vivo effect of MEDI3902 administration was studied in
mice using an acute pneumonia model. Groups of mice (n=6) were
injected intraperitoneally (IP) with either decreasing
concentrations of MEDI3902 (1.0 mg/kg, 0.5 mg/kg, or 0.2 mg/kg) or
a isotype control IgG antibody (negative control, 0.75 mg/kg).
Twenty-four hours after treatment, all mice were infected
intranasally with 2.times.10.sup.5 CFU Pseudomonas aeruginosa
strain 6206 (1.times.LD.sub.100). As shown in FIG. 3, all control
treated animals succumbed to infection by 120 hours post infection.
However, MEDI3902 showed complete protection across all doses, even
at 1.times.LD.sub.100, suggesting that a lower target serum level
of 1.7 .mu.g/mL in humans will provide protection across most
strains of P. aeruginosa.
[0119] The breadth and scope of the present disclosure should not
be limited by any of the above-described exemplary embodiments, but
should be defined only in accordance with the following claims and
their equivalents.
Sequence CWU 1
1
241124PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 1Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Asn Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Thr Met Ser Gly Ile
Thr Ala Tyr Tyr Thr Asp Asp Val 50 55 60Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Glu Glu
Phe Leu Pro Gly Thr His Tyr Tyr Tyr Gly Met Asp 100 105 110Val Trp
Gly Gln Gly Thr Thr Val Thr Val Ser Ser 115 12025PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 2Ser
Tyr Ala Met Asn1 5317PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 3Ala Ile Thr Met Ser Gly Ile
Thr Ala Tyr Tyr Thr Asp Asp Val Lys1 5 10 15Gly415PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 4Glu
Glu Phe Leu Pro Gly Thr His Tyr Tyr Tyr Gly Met Asp Val1 5 10
155107PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 5Ala Ile Gln Met Thr Gln Ser Pro Ser Ser Leu
Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser
Gln Gly Ile Arg Asn Asp 20 25 30Leu Gly Trp Tyr Gln Gln Lys Pro Gly
Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Ser Ala Ser Thr Leu Gln Ser
Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe
Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr
Tyr Tyr Cys Leu Gln Asp Tyr Asn Tyr Pro Trp 85 90 95Thr Phe Gly Gln
Gly Thr Lys Val Glu Ile Lys 100 105611PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 6Arg
Ala Ser Gln Gly Ile Arg Asn Asp Leu Gly1 5 1077PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 7Ser
Ala Ser Thr Leu Gln Ser1 589PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 8Leu Gln Asp Tyr Asn Tyr Pro
Trp Thr1 59246PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 9Gln Val Gln Leu Gln Glu Ser Gly Pro
Gly Leu Val Lys Pro Ser Glu1 5 10 15Thr Leu Ser Leu Thr Cys Thr Val
Ser Gly Gly Ser Ile Ser Pro Tyr 20 25 30Tyr Trp Thr Trp Ile Arg Gln
Pro Pro Gly Lys Cys Leu Glu Leu Ile 35 40 45Gly Tyr Ile His Ser Ser
Gly Tyr Thr Asp Tyr Asn Pro Ser Leu Lys 50 55 60Ser Arg Val Thr Ile
Ser Gly Asp Thr Ser Lys Lys Gln Phe Ser Leu65 70 75 80Lys Leu Ser
Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr Cys Ala 85 90 95Arg Ala
Asp Trp Asp Arg Leu Arg Ala Leu Asp Ile Trp Gly Gln Gly 100 105
110Thr Met Val Thr Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly
115 120 125Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Ile Gln
Leu Thr 130 135 140Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp
Arg Val Thr Ile145 150 155 160Thr Cys Arg Ala Ser Gln Ser Ile Arg
Ser His Leu Asn Trp Tyr Gln 165 170 175Gln Lys Pro Gly Lys Ala Pro
Lys Leu Leu Ile Tyr Gly Ala Ser Asn 180 185 190Leu Gln Ser Gly Val
Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly Thr 195 200 205Asp Phe Thr
Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala Thr 210 215 220Tyr
Tyr Cys Gln Gln Ser Thr Gly Ala Trp Asn Trp Phe Gly Cys Gly225 230
235 240Thr Lys Val Glu Ile Lys 245105PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 10Pro
Tyr Tyr Trp Thr1 51116PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 11Tyr Ile His Ser Ser Gly Tyr
Thr Asp Tyr Asn Pro Ser Leu Lys Ser1 5 10 151211PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 12Ala
Asp Trp Asp Arg Leu Arg Ala Leu Asp Ile1 5 101311PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 13Arg
Ala Ser Gln Ser Ile Arg Ser His Leu Asn1 5 10147PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 14Gly
Ala Ser Asn Leu Gln Ser1 5159PRTArtificial SequenceDescription of
Artificial Sequence Synthetic peptide 15Gln Gln Ser Thr Gly Ala Trp
Asn Trp1 51698PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 16Ala Ser Thr Lys Gly Pro Ser Val
Phe Pro Leu Ala Pro Ser Ser Lys1 5 10 15Ser Thr Ser Gly Gly Thr Ala
Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30Phe Pro Glu Pro Val Thr
Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45Gly Val His Thr Phe
Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60Leu Ser Ser Val
Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln Thr65 70 75 80Tyr Ile
Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95Arg
Val175PRTArtificial SequenceDescription of Artificial Sequence
Synthetic peptide 17Glu Pro Lys Ser Cys1 51810PRTArtificial
SequenceDescription of Artificial Sequence Synthetic peptide 18Asp
Lys Thr His Thr Cys Pro Pro Cys Pro1 5 1019217PRTArtificial
SequenceDescription of Artificial Sequence Synthetic
polypeptideMOD_RES(22)..(22)Met or TyrMOD_RES(24)..(24)Ser or
ThrMOD_RES(26)..(26)Thr or Glu 19Ala Pro Glu Leu Leu Gly Gly Pro
Ser Val Phe Leu Phe Pro Pro Lys1 5 10 15Pro Lys Asp Thr Leu Xaa Ile
Xaa Arg Xaa Pro Glu Val Thr Cys Val 20 25 30Val Val Asp Val Ser His
Glu Asp Pro Glu Val Lys Phe Asn Trp Tyr 35 40 45Val Asp Gly Val Glu
Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu 50 55 60Gln Tyr Asn Ser
Thr Tyr Arg Val Val Ser Val Leu Thr Val Leu His65 70 75 80Gln Asp
Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys 85 90 95Ala
Leu Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln 100 105
110Pro Arg Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met
115 120 125Thr Lys Asn Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe
Tyr Pro 130 135 140Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln
Pro Glu Asn Asn145 150 155 160Tyr Lys Thr Thr Pro Pro Ser Leu Asp
Ser Asp Gly Ser Phe Phe Leu 165 170 175Tyr Ser Lys Leu Thr Val Asp
Lys Ser Arg Trp Gln Gln Gly Asn Val 180 185 190Phe Ser Cys Ser Val
Met His Glu Ala Leu His Asn His Tyr Thr Gln 195 200 205Lys Ser Leu
Ser Leu Ser Pro Gly Lys 210 21520217PRTArtificial
SequenceDescription of Artificial Sequence Synthetic polypeptide
20Ala Pro Glu Leu Leu Gly Gly Pro Ser Val Phe Leu Phe Pro Pro Lys1
5 10 15Pro Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys
Val 20 25 30Val Val Asp Val Ser His Glu Asp Pro Glu Val Lys Phe Asn
Trp Tyr 35 40 45Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro
Arg Glu Glu 50 55 60Gln Tyr Asn Ser Thr Tyr Arg Val Val Ser Val Leu
Thr Val Leu His65 70 75 80Gln Asp Trp Leu Asn Gly Lys Glu Tyr Lys
Cys Lys Val Ser Asn Lys 85 90 95Ala Leu Pro Ala Pro Ile Glu Lys Thr
Ile Ser Lys Ala Lys Gly Gln 100 105 110Pro Arg Glu Pro Gln Val Tyr
Thr Leu Pro Pro Ser Arg Glu Glu Met 115 120 125Thr Lys Asn Gln Val
Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro 130 135 140Ser Asp Ile
Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn145 150 155
160Tyr Lys Thr Thr Pro Pro Val Leu Asp Ser Asp Gly Ser Phe Phe Leu
165 170 175Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly
Asn Val 180 185 190Phe Ser Cys Ser Val Met His Glu Ala Leu His Asn
His Tyr Thr Gln 195 200 205Lys Ser Leu Ser Leu Ser Pro Gly Lys 210
21521720PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 21Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly
Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Asn Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Thr Met Ser Gly Ile
Thr Ala Tyr Tyr Thr Asp Asp Val 50 55 60Lys Gly Arg Phe Thr Ile Ser
Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser
Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Glu Glu
Phe Leu Pro Gly Thr His Tyr Tyr Tyr Gly Met Asp 100 105 110Val Trp
Gly Gln Gly Thr Thr Val Thr Val Ser Ser Ala Ser Thr Lys 115 120
125Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser Gly
130 135 140Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro
Glu Pro145 150 155 160Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr
Ser Gly Val His Thr 165 170 175Phe Pro Ala Val Leu Gln Ser Ser Gly
Leu Tyr Ser Leu Ser Ser Val 180 185 190Val Thr Val Pro Ser Ser Ser
Leu Gly Thr Gln Thr Tyr Ile Cys Asn 195 200 205Val Asn His Lys Pro
Ser Asn Thr Lys Val Asp Lys Arg Val Glu Pro 210 215 220Lys Ser Cys
Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gln Val Gln225 230 235
240Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Glu Thr Leu Ser
245 250 255Leu Thr Cys Thr Val Ser Gly Gly Ser Ile Ser Pro Tyr Tyr
Trp Thr 260 265 270Trp Ile Arg Gln Pro Pro Gly Lys Cys Leu Glu Leu
Ile Gly Tyr Ile 275 280 285His Ser Ser Gly Tyr Thr Asp Tyr Asn Pro
Ser Leu Lys Ser Arg Val 290 295 300Thr Ile Ser Gly Asp Thr Ser Lys
Lys Gln Phe Ser Leu Lys Leu Ser305 310 315 320Ser Val Thr Ala Ala
Asp Thr Ala Val Tyr Tyr Cys Ala Arg Ala Asp 325 330 335Trp Asp Arg
Leu Arg Ala Leu Asp Ile Trp Gly Gln Gly Thr Met Val 340 345 350Thr
Val Ser Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly Gly 355 360
365Gly Gly Ser Gly Gly Gly Gly Ser Asp Ile Gln Leu Thr Gln Ser Pro
370 375 380Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr Ile Thr
Cys Arg385 390 395 400Ala Ser Gln Ser Ile Arg Ser His Leu Asn Trp
Tyr Gln Gln Lys Pro 405 410 415Gly Lys Ala Pro Lys Leu Leu Ile Tyr
Gly Ala Ser Asn Leu Gln Ser 420 425 430Gly Val Pro Ser Arg Phe Ser
Gly Ser Gly Ser Gly Thr Asp Phe Thr 435 440 445Leu Thr Ile Ser Ser
Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys 450 455 460Gln Gln Ser
Thr Gly Ala Trp Asn Trp Phe Gly Cys Gly Thr Lys Val465 470 475
480Glu Ile Lys Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Lys Thr
485 490 495His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly Gly
Pro Ser 500 505 510Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu
Met Ile Ser Arg 515 520 525Thr Pro Glu Val Thr Cys Val Val Val Asp
Val Ser His Glu Asp Pro 530 535 540Glu Val Lys Phe Asn Trp Tyr Val
Asp Gly Val Glu Val His Asn Ala545 550 555 560Lys Thr Lys Pro Arg
Glu Glu Gln Tyr Asn Ser Thr Tyr Arg Val Val 565 570 575Ser Val Leu
Thr Val Leu His Gln Asp Trp Leu Asn Gly Lys Glu Tyr 580 585 590Lys
Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile Glu Lys Thr 595 600
605Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu
610 615 620Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu
Thr Cys625 630 635 640Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
Val Glu Trp Glu Ser 645 650 655Asn Gly Gln Pro Glu Asn Asn Tyr Lys
Thr Thr Pro Pro Val Leu Asp 660 665 670Ser Asp Gly Ser Phe Phe Leu
Tyr Ser Lys Leu Thr Val Asp Lys Ser 675 680 685Arg Trp Gln Gln Gly
Asn Val Phe Ser Cys Ser Val Met His Glu Ala 690 695 700Leu His Asn
His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys705 710 715
72022214PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 22Ala Ile Gln Met Thr Gln Ser Pro Ser Ser Leu
Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys Arg Ala Ser
Gln Gly Ile Arg Asn Asp 20 25 30Leu Gly Trp Tyr Gln Gln Lys Pro Gly
Lys Ala Pro Lys Leu Leu Ile 35 40 45Tyr Ser Ala Ser Thr Leu Gln Ser
Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe
Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr
Tyr Tyr Cys Leu Gln Asp Tyr Asn Tyr Pro Trp 85 90 95Thr Phe Gly Gln
Gly Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala 100 105 110Pro Ser
Val Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120
125Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala
130 135 140Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn
Ser Gln145 150 155 160Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser
Thr Tyr Ser Leu Ser 165 170 175Ser Thr Leu Thr Leu Ser Lys Ala Asp
Tyr Glu Lys His Lys Val Tyr 180 185 190Ala Cys Glu Val Thr His Gln
Gly Leu Ser Ser Pro Val Thr Lys Ser 195 200 205Phe Asn Arg Gly Glu
Cys 2102325PRTArtificial SequenceDescription of Artificial Sequence
Synthetic linker sequenceMISC_FEATURE(1)..(25)This sequence may
encompass 0-5 'Gly Gly Gly Gly Ser' repeating units 23Gly Gly Gly
Gly Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Gly1 5 10 15Gly Gly
Gly Ser Gly Gly Gly Gly Ser 20 252420PRTArtificial
SequenceDescription of Artificial Sequence Synthetic linker
sequenceMISC_FEATURE(1)..(20)This sequence may encompass 0-5 'Gly
Gly Gly Gly' repeating units 24Gly Gly Gly Gly Gly Gly Gly Gly Gly
Gly Gly Gly Gly Gly Gly Gly1 5 10 15Gly Gly Gly Gly 20
* * * * *