Tumor-specific Anti-egfr Antibody And Application Thereof

Abstract

The present invention provides a tumor-specific anti-EGFR antibody and application thereof. The antibody can be used for preparing targeted antitumor drugs and tumor diagnosis drugs.

Description

TECHNICAL FIELD

[0001] The present invention relates to the field of immunology, and in particular, the present invention relates to tumor-specific anti-EGFR antibodies and uses thereof.

BACKGROUND

[0002] EGFR is overexpressed or mutated in many tumors, and it is undoubtedly a very important scientific issue on how to selectively recognize these over-expressed or mutated EGFR. Until now, antibodies against EGFR287-302 epitope are believed to achieve the purpose of recognizing EGFR, EGFRvIII and de4 EGFR overexpressed on the surface of tumors, instead of EGFR in normal cells. Unfortunately, antibodies against this epitope still have side effects such as rashes in clinical trials (http://meetinglibrary.asco.org/content/115945-132), suggesting that targeting this epitope may identify EGFR in normal cells (such as keratinocytes).

[0003] Therefore, it is very urgent to screen anti-EGFR antibodies with higher tumor-specificity. Highly tumor-specific antibodies, whether for tumor imaging diagnosis, individual diagnosis or tumor targeting therapy, have a very large potential value.

SUMMARY OF THE INVENTION

[0004] The object of the present invention is to provide tumor-specific anti-EGFR antibodies and uses thereof.

[0005] In a first aspect of the present invention, an antibody specifically recognizing EGFRvIII expressed or EGFR overexpressed by tumor cells is provided, wherein the antibody comprises a light chain variable region and a heavy chain variable region,

[0006] CDR1 of the light chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 41, SEQ ID NO: 47, SEQ ID NO: 55;

[0007] CDR2 of the light chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 42, SEQ ID NO: 53;

[0008] CDR3 of the light chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 43, SEQ ID NO: 48, SEQ ID NO: 54, SEQ ID NO: 56, SEQ ID NO: 57;

[0009] CDR1 of the heavy chain variable region has the amino acid sequence of SEQ ID NO: 44;

[0010] CDR2 of the heavy chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 45, SEQ ID NO: 49, SEQ ID NO: 51, SEQ ID NO: 52;

[0011] CDR3 of the heavy chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 46, SEQ ID NO: 50.

[0012] In a preferred embodiment, the antibody includes:

[0013] antibody (a), wherein the light chain variable region thereof has CDR1 of SEQ ID NO: 41, CDR2 of SEQ ID NO: 42, CDR3 of SEQ ID NO: 43, or the heavy chain variable region thereof has CDR1 of SEQ ID NO: 44, CDR2 of SEQ ID NO: 45, CDR3 of SEQ ID NO: 46,

[0014] antibody (b), wherein the light chain variable region thereof has CDR1 of SEQ ID NO: 47, CDR2 of SEQ ID NO: 42, CDR3 of SEQ ID NO: 48, or the heavy chain variable region thereof has CDR1 of SEQ ID NO: 44, CDR2 of SEQ ID NO: 49, CDR3 of SEQ ID NO: 50,

[0015] antibody (c), wherein the light chain variable region thereof has CDR1 of SEQ ID NO: 41, CDR2 of SEQ ID NO: 42, CDR3 of SEQ ID NO: 48, or the heavy chain variable region thereof has CDR1 of SEQ ID NO: 44, CDR2 of SEQ ID NO: 51, CDR3 of SEQ ID NO: 50,

[0016] antibody (d), wherein the light chain variable region thereof has CDR1 of SEQ ID NO: 41, CDR2 of SEQ ID NO: 42, CDR3 of SEQ ID NO: 43, or the heavy chain variable region thereof has CDR1 of SEQ ID NO: 44, CDR2 of SEQ ID NO: 52, CDR3 of SEQ ID NO: 50,

[0017] antibody (e), wherein the light chain variable region thereof has CDR1 of SEQ ID NO: 41, CDR2 of SEQ ID NO: 42, CDR3 of SEQ ID NO: 43, or the heavy chain variable region thereof has CDR1 of SEQ ID NO: 44, CDR2 of SEQ ID NO: 45, CDR3 of SEQ ID NO: 50,

[0018] antibody (f), wherein light chain variable region thereof has CDR1 of SEQ ID NO: 41, CDR2 of SEQ ID NO: 53, CDR3 of SEQ ID NO: 54, or the heavy chain variable region thereof has CDR1 of SEQ ID NO: 44, CDR2 of SEQ ID NO: 51, CDR3 of SEQ ID NO: 50,

[0019] antibody (g), wherein the light chain variable region has CDR1 of SEQ ID NO: 41, CDR2 of SEQ ID NO: 42, CDR3 of SEQ ID NO: 54, or the heavy chain variable region thereof has CDR1 of SEQ ID NO: 44, CDR2 of SEQ ID NO: 51, CDR3 of SEQ ID NO: 50,

[0020] antibody (h), wherein the light chain variable region thereof has CDR1 of SEQ ID NO: 55, CDR2 of SEQ ID NO: 42, CDR3 of SEQ ID NO: 56, or the heavy chain variable region thereof has CDR1 of SEQ ID NO: 44, CDR2 of SEQ ID NO: 45, CDR3 of SEQ ID NO: 50,

[0021] antibody (i), wherein the light chain variable region thereof has CDR1 of SEQ ID NO: 41, CDR2 of SEQ ID NO: 53, CDR3 of SEQ ID NO: 56, or the heavy chain variable region thereof has CDR1 of SEQ ID NO: 44, CDR2 of SEQ ID NO: 52, CDR3 of SEQ ID NO: 50,

[0022] antibody (j), wherein the light chain variable region thereof has CDR1 of SEQ ID NO: 41, CDR2 of SEQ ID NO: 42, CDR3 of SEQ ID NO: 56, or the heavy chain variable region thereof has CDR1 of SEQ ID NO: 44, CDR2 of SEQ ID NO: 52, CDR3 of SEQ ID NO: 50,

[0023] antibody (k), wherein the light chain variable region thereof has CDR1 of SEQ ID NO: 41, CDR2 of SEQ ID NO: 42, CDR3 of SEQ ID NO: 57, or the heavy chain variable region thereof has CDR1 of SEQ ID NO: 44, CDR2 of SEQ ID NO: 52, CDR3 of SEQ ID NO: 50; or

[0024] antibody (l) which recognizes the same antigenic determinant as that recognized by the antibody according to any one of (a) to (k).

[0025] In another preferred embodiment, the antibody specifically recognizing EGFRvIII expressed or EGFR overexpressed by tumor cells can be: single chain antibody (scFV), monoclonal antibody, domain antibody, Fab fragment, Fd fragment, Fv fragment, F (ab').sub.2 fragment and a derivative thereof, or other forms of antibody; preferably single chain antibody.

[0026] In another preferred embodiment, the antibody specifically recognizing EGFRvIII expressed or EGFR overexpressed by tumor cells is humanized, fully humanized, chimeric or murine.

[0027] In another preferred embodiment, the amino acid sequence of the heavy chain variable region of the antibody is shown in positions 124 to 239 of SEQ ID NO: 13; or the amino acid sequence of the light chain variable region of the antibody is shown in positions 1-108 of SEQ ID NO: 13;

[0028] The amino acid sequence of the heavy chain variable region of the antibody is shown in positions 124 to 239 of SEQ ID NO: 59; or the amino acid sequence of the light chain variable region of the antibody is shown in positions 1-108 of SEQ ID NO: 59;

[0029] The amino acid sequence of the heavy chain variable region of the antibody is shown in positions 124 to 239 of SEQ ID NO: 61; or the amino acid sequence of the light chain variable region of the antibody is shown in positions 1-108 of SEQ ID NO: 61;

[0030] The amino acid sequence of the heavy chain variable region of the antibody is shown in positions 124 to 239 of SEQ ID NO: 63; or the amino acid sequence of the light chain variable region of the antibody is shown in positions 1-108 of SEQ ID NO: 63;

[0031] The amino acid sequence of the heavy chain variable region of the antibody is shown in positions 124 to 239 of SEQ ID NO: 65; or the amino acid sequence of the light chain variable region of the antibody is shown in positions 1-108 of SEQ ID NO: 65;

[0032] The amino acid sequence of the heavy chain variable region of the antibody is shown in positions 124 to 239 of SEQ ID NO: 67; or the amino acid sequence of the light chain variable region of the antibody is shown in positions 1-108 of SEQ ID NO: 67;

[0033] The amino acid sequence of the heavy chain variable region of the antibody is shown in positions 124 to 239 of SEQ ID NO: 69; or the amino acid sequence of the light chain variable region of the antibody is shown in positions 1-108 of SEQ ID NO: 69;

[0034] The amino acid sequence of the heavy chain variable region of the antibody is shown in positions 124 to 239 of SEQ ID NO: 71; or the amino acid sequence of the light chain variable region of the antibody is shown in positions 1-108 of SEQ ID NO: 71;

[0035] The amino acid sequence of the heavy chain variable region of the antibody is shown in positions 124 to 239 of SEQ ID NO: 73; or the amino acid sequence of the light chain variable region of the antibody is shown in positions 1-108 of SEQ ID NO: 73;

[0036] The amino acid sequence of the heavy chain variable region of the antibody is shown in positions 124 to 239 of SEQ ID NO: 75; or the amino acid sequence of the light chain variable region of the antibody is shown in positions 1-108 of SEQ ID NO: 75; or

[0037] The amino acid sequence of the heavy chain variable region of the antibody is shown in positions 124 to 239 of SEQ ID NO: 77; or the amino acid sequence of the light chain variable region of the antibody is shown in positions 1-108 of SEQ ID NO: 77.

[0038] In another preferred embodiment, the antibody is antibody (a); more preferably, the amino acid sequence of the heavy chain variable region of the antibody is shown in positions 124 to 239 of SEQ ID NO: 13; or the amino acid sequence of the light chain variable region of the antibody is shown in positions 1-108 of SEQ ID NO: 13.

[0039] In another aspect of the invention, a nucleic acid encoding the antibody as described above is provided.

[0040] In another aspect of the present invention, an expression vector is provided, comprising the nucleic acid. In another preferred embodiment, the expression vector is a PH/DHFR vector.

[0041] In another aspect of the present invention, a host cell is provided, comprising the expression vector or having the nucleic acid integrated into its genome. In another preferred embodiment, the host cell is a eukaryotic host cell or prokaryotic host cell; preferably a eukaryotic host cell, more preferably Chinese hamster ovary cell (CHO).

[0042] In another aspect of the invention, the use of any one of the above described antibodies is provided for the manufacture of a targeting drug, antibody drug conjugate, or multi-functional antibody specifically targeting tumor cells expressing EGFRvIIIed or over-expressing EGFR; or an agent for diagnosis of tumors that expressed EGFRvIII or overexpress EGFR; or is used to prepare a chimeric antigen receptor modified immune cell; preferably, the immune cell includes: T lymphocyte, NK cell or NKT lymphocyte.

[0043] In another aspect of the present invention, a multi-functional immunoconjugate is provided, comprising: any one of the above described antibodies; and a functional molecule linked thereto (including covalently linked, conjugated, attached, adsorbed); the functional molecule is selected from a group consisting of a molecule that targets a tumor surface marker, a tumor-suppressing molecule, a molecule that targets a surface marker of an immune cell, or a detectable label.

[0044] In a preferred embodiment, the molecule that targets the tumor surface marker is an antibody or ligand that binds to a tumor surface marker; or the tumor-suppressing molecule is an anti-tumor cytokine or an anti-tumor toxin; preferably, the cytokines include but are not limited to: IL-12, IL-15, IFN-beta, TNF-alpha.

[0045] In another preferred embodiment, in the multi-functional immunoconjugate, the detectable label includes a fluorescent label and a chromogenic label.

[0046] In another preferred embodiment, in the multi-functional immunoconjugate, the molecule targeting the surface marker of the immune cell is an antibody or ligand that binds to an immune cell surface marker; preferably, the immune cell surface markers include, but are not limited to: CD3, CD16, CD28.

[0047] In another preferred embodiment, in the multi-functional immunoconjugate, the molecule that targets the surface marker of the immune cell is an antibody that binds to a T cell surface marker, which can form a T-cell-engaging bifunctional antibody with any one of the above described antibody (bispecific T cell engager, BiTE).

[0048] In another preferred embodiment, in the multi-functional immunoconjugate, the antibody that binds to the immune cell surface marker is an anti-CD3 antibody. In another preferred embodiment, the anti-CD3 antibody is a single chain antibody (scFV), a monoclonal antibody, a Fab fragment, an Fd fragment, an Fv fragment, an F(ab').sub.2 fragment and a derivative thereof, antibody; preferably single chain antibody. In another preferred embodiment, the anti-CD3 antibody is humanized, fully human, chimeric or murine.

[0049] In another preferred embodiment, the multi-functional immunoconjugate is a fusion polypeptide, and further comprises a linker peptide (linker) between any one of the above described antibodies and the functional molecule linked thereto.

[0050] In another preferred embodiment, the linker peptide has the sequence (GlyGlyGlyGlySer)n, wherein n is an integer from 1 to 5; more preferably, n=3.

[0051] In another preferred embodiment, the multi-functional immunoconjugate is administered in a form of polypeptide or in the manner of gene administration.

[0052] In another aspect of the invention, a nucleic acid encoding the multi-functional immunoconjugate is provided.

[0053] In another aspect of the invention, the use of any one of the above described multi-functional immunoconjugate is provided, for the preparation of an antineoplastic agent or an agent for diagnosis of tumors that express EGFRvIII or overexpress EGFR; or for the preparation of chimeric antigen receptor modified immune cells. Preferably, the immune cells include T lymphocyte, NK cell or NKT lymphocyte.

[0054] In another aspect of the present invention, a chimeric antigen receptor comprising any one of the above described antibodies is provided, and the chimeric antigen receptor is expressed on the surface of an immune cell and comprises: any one of the above described antibodies, a transmembrane region and an intracellular signal region, which are sequentially linked; and the intracellular signal region is selected from a group consisting of intracellular signal region sequences of CD3.zeta., Fc.epsilon.RI.gamma., CD27, CD28, CD137 and CD134, or a combination thereof.

[0055] In a preferred embodiment, the transmembrane region comprises a transmembrane region of CD8 or CD28.

[0056] In another preferred embodiment, the immune cells include T lymphocyte, NK cell or NKT cell.

[0057] In another preferred embodiment, the chimeric antigen receptor comprises the following sequentially linked antibody, transmembrane region and intracellular signal region:

[0058] Any one of the above described antibodies, CD8 and CD3.zeta.;

[0059] Any one of the above described antibodies, CD8, CD137 and CD3.zeta.;

[0060] Any one of the above described antibodies, a transmembrane region of a CD28 molecule, an intracellular signal region of a CD28 molecule, and CD3.zeta.; or

[0061] Any one of the above described antibodies, a transmembrane region of a CD28 molecule, an intracellular signal region of a CD28 molecule, CD137 and CD3.zeta..

[0062] In another preferred embodiment, the antibody is a single chain antibody or a domain antibody.

[0063] In another preferred embodiment, the chimeric antigen receptor comprises:

[0064] SEQ ID NO: 36 or the amino acid sequence shown in positions 285-601; or

[0065] SEQ ID NO: 37 or the amino acid sequence shown in positions 285-702; or

[0066] SEQ ID NO: 38 or the amino acid sequence shown in positions 285-744; or

[0067] SEQ ID NO: 39 or the amino acid sequence shown in positions 285-749; or

[0068] SEQ ID NO: 40 or the amino acid sequence shown in positions 285-791.

[0069] In another aspect of the invention, a nucleic acid encoding any one of the above described chimeric antigen receptors is provided. In another preferred embodiment, the nucleic acid encoding the chimeric antigen receptor comprises:

[0070] SEQ ID NO: 31 or the nucleotide sequence shown in positions 966-1916; or

[0071] SEQ ID NO: 32 or the nucleotide sequence shown in positions 966-2219; or

[0072] SEQ ID NO: 33 or the nucleotide sequence shown in positions 966-2345; or

[0073] SEQ ID NO: 34 or the nucleotide sequence shown in positions 966-2360; or

[0074] SEQ ID NO: 35 or the nucleotide sequences shown in positions 966-2486.

[0075] In another aspect of the present invention, an expression vector comprising the above described nucleic acid is provided.

[0076] In another preferred embodiment, the expression vector is derived from lentiviral plasmid pWPT (or pWPT-eGFP).

[0077] In another aspect of the present invention, a virus comprising the above described vector is provided.

[0078] Use of any one of the above described chimeric antigen receptors or an encoding nucleic acid thereof, or an expression vector or virus comprising the nucleic acid is provided, for the preparation of genetically modified immune cells that target tumor cells that express EGFRvIII or overexpress EGFR.

[0079] In another aspect of the present invention, a genetically modified immune cell is provided, which is transduced with the nucleic acid, or the expression vector or the virus; or expresses the chimeric antigen receptor at its surface.

[0080] In a preferred embodiment, the immune cell further carries an exogenous encoding sequence for cytokine; preferably, the cytokine includes: IL-12, IL-15 or IL-21.

[0081] In another preferred embodiment, the immune cell further expresses another chimeric antigen receptor that does not contain CD3.zeta., but contains the intracellular signaling domain of CD28, the intracellular signaling domain of CD137, or a combination of both.

[0082] In another preferred embodiment, the immune cell further expresses a chemokine receptor; preferably, the chemokine receptor includes CCR2.

[0083] In another preferred embodiment, the immune cell further expresses siRNA that can reduce PD-1 expression or a protein that can block PD-L1.

[0084] In another preferred embodiment, the immune cell further expresses a safety switch; preferably, the safety switch includes iCaspase-9, Truancated EGFR or RQR8.

[0085] In another aspect of the invention, the use of said genetically modified immune cells is provided for the preparation of a tumor-inhibiting drug, and said tumor is the tumor that expresses EGFRvIII or overexpresses EGFR.

[0086] In another aspect of the invention, a pharmaceutical composition (including medicament or diagnostic reagent) is provided, comprising:

[0087] any one of the above described antibodies or a nucleic acid encoding the antibody; or

[0088] any one of the above described immunoconjugates or a nucleic acid encoding the conjugate; or

[0089] any one of the above described chimeric antigen receptors or a nucleic acid encoding the chimeric antigen receptor; or

[0090] any one of the above described genetically modified immune cells.

[0091] Other aspects of the invention will be apparent to a person skilled in the art in view of the disclosure herein.

DESCRIPTION OF DRAWINGS

[0092] FIG. 1. Antibodies 7B3 and Y022 can specifically bind to antigens EGFRvIII and N1N2-806 (phage ELISA assay).

[0093] FIG. 2. Binding curve of antibody 7B3 vs antigen EGFRvIII.

[0094] FIG. 3. Binding curve of antibody Y022 vs antigen EGFRvIII.

[0095] FIG. 4. Electrophorogram of purification of three scFv-Fc fusion antibodies.

[0096] FIG. 5. Detection of single-chain antibodies scFv-Y022-Fc, scFv-806-Fc and scFv-C225-Fc for their ability to bind to cell surface EGFR by FACS.

[0097] FIG. 6. Structure diagram of pH-Y022/CD3 expression vector.

[0098] FIG. 7. SDS-PAGE detection of single-chain bifunctional antibodies Y022/CD3, 806/CD3 and C225/CD3.

[0099] FIG. 8. Detection of Y022/CD3 single chain bifunctional antibody for its antigen binding specificity by FACS.

[0100] FIG. 9. Cytotoxicity plots of single-chain bifunctional antibodies.

[0101] FIG. 10. Schematic illustration of the ligation order of various parts of the chimeric antigen receptor.

MODES FOR CARRYING OUT THE INVENTION

[0102] After intensive research and screening, the present inventors obtained an antibody that specifically recognizes EGFRvIII or over-expressed EGFR in tumor cells and scarcely recognizes EGFR in normal cells. The antibody of the present invention can be used to prepare various targeting anti-tumor drugs and drugs for diagnosis of tumors.

[0103] Anti-EGFR Antibody

[0104] The present inventors further conducted screening and amino acid mutations based on the humanized antibodies obtained in the previous stage, and found an anti-EGFR antibody capable of targeting EGFR of tumor cells with higher specificity, which selectively binds to a tumor overexpressing EGFR or EGFRvIII, while does not bind to EGFR on normal cells.

[0105] Antibodies of the invention may be intact immunoglobulin molecules or antigen-binding fragments, including but not limited to Fab fragments, Fd fragments, Fv fragments, F (ab').sub.2 fragments, complementarity determining region (CDR) fragments, single-chain antibody (scFv), domain antibody, bivalent single chain antibody, single chain phage antibody, bispecific diabody, triple chain antibody, quadruple chain antibody.

[0106] The antigen-binding properties of an antibody can be described by three specific regions located in variable regions of the heavy and light chains, termed complementarity determining regions (CDRs), which divide the variable regions into four framework regions (FR), and the amino acid sequences of four FRs are relatively conservative, not directly involved in binding reaction. These CDRs form a loop structure, in which j-folds formed by the FRs are located close to each other in space and the antigen binding site of the antibody is constituted by CDRs on the heavy chain and CDRs on the corresponding light chain. It is possible to determine which amino acids make up FR or CDR regions by comparing the amino acid sequences of the same type of antibody. The CDR regions are sequences of immunologically interesting proteins and the CDR regions of the antibodies of the invention are brand new. The antibody may comprise two, three, four, five, or all six of the CDR regions disclosed herein.

[0107] Another aspect of the invention includes functional variants of the antibodies described herein. If the variant is capable of competing with the parental antibody for specific binding to SEQ ID NO: 1 and its ability to recognize EGFRvIII or overexpressed EGFR in tumor cells is close to that of the specific antibodies provided in Examples of the present invention. The functional variants may have conservative sequence modifications, including nucleotide and amino acid substitutions, additions and deletions. These modifications can be introduced by standard techniques known in the art, such as directed mutagenesis and random PCR-mediated mutagenesis, and can include both natural and non-natural nucleotides and amino acids. Preferably, modification of the sequence occurs on a region outside the CDR region of the antibody.

[0108] Immunoconjugate

[0109] In the present invention, a multifunctional immunoconjugate is also provided, comprising the antibodies described herein and further comprising at least one functional molecule of other type. The functional molecule is selected from, but not limited to, a molecule that targets a tumor surface marker, a tumor-suppressing molecule, a molecule that targets a surface marker of an immune cell, or a detectable label. The antibody and the functional molecule may form a conjugate by covalent attachment, coupling, attachment, cross-linking, or the like.

[0110] As a preferred mode, the immunoconjugate may comprise an antibody of the invention and at least one molecule that targets a tumor surface marker or a tumor-suppressing molecule. The tumor-suppressing molecule may be anti-tumor cytokines or anti-tumor toxins. Preferably, the cytokines include but are not limited to IL-12, IL-15, IFN-beta, TNF-alpha. The molecules that target tumor surface markers, for example, can act synergistically with the antibodies of the invention to more precisely target tumor cells.

[0111] As a preferred mode, the immunoconjugate may comprise an antibody of the present invention and a detectable label. Such detectable labels include, but are not limited to, fluorescent labels, chromogenic labels such as enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, radioactive materials, positron-emitting metals and non-radioactive paramagnetic metal ion. More than one marker can also be included. The label used to label the antibody for the purpose of detection and/or analysis and/or diagnosis depends on the used particular detection/analysis/diagnosis technique and/or method, eg, immunohistochemical staining (tissue) samples, flow cytometry, and the like. Suitable labels for detection/analysis/diagnosis techniques and/or methods known in the art are well known to those skilled in the art.

[0112] As a preferred mode, the immunoconjugate may comprise an antibody of the invention as well as a molecule that targets a surface marker of an immune cell. The molecule that targets surface markers of immune cells can recognize immune cells and carry the antibodies of the invention to the immune cells, so that the antibodies of the invention can target the immune cells to the tumor cells and thus trigger immunocyte for specifically killing tumor.

[0113] As a means of chemically generating an immunoconjugate by conjugation, either directly or indirectly (eg, by a linker), the immunoconjugate can be produced as a fusion protein comprising an antibody of the invention and other suitable proteins. The fusion protein can be produced by a method known in the art, for example recombinantly produced by constructing and subsequently expressing the nucleic acid molecule which comprises the nucleotide sequence encoding the antibody in frame with a nucleotide sequence encoding a suitable label.

[0114] In another aspect of the invention, a nucleic acid molecule encoding at least one antibody of the invention, a functional variant, or an immunoconjugate thereof is provided. Once obtaining the relevant sequence, the recombination method can be used to obtain the relevant sequence in large quantities. This is usually done by cloning it into a vector, transferring it to a cell, and then isolating the relevant sequence from the proliferating host cells by conventional methods.

[0115] The present invention also relates to vectors comprising the appropriate DNA sequences described above as well as appropriate promoters or control sequences. These vectors can be used to transform an appropriate host cell to enable expression of the protein. The host cell may be a prokaryotic cell, such as a bacterial cell; or a lower eukaryotic cell, such as a yeast cell; or a higher eukaryotic cell, such as a mammalian cell.

[0116] Chimeric Antigen Receptor and Genetically Modified Immune Cell

[0117] In the present invention, a chimeric antigen receptor expressed on the surface of an immune effector cell (immune cell) is provided, wherein the chimeric antigen receptor comprises sequentially linked: extracellular binding region, transmembrane region and intracellular signal region, and the extracellular binding region comprises the antibody of the invention. By expressing the chimeric antigen receptor on the surface of immune effector cells, immune effector cells can have a highly specific cytotoxic effect on tumor cells that express EGFRvIII or overexpress EGFR.

[0118] As used herein, "immune cells" and "immune effector cells" are used interchangeably and include: T lymphocytes, NK cells or NKT cells, and the like.

[0119] As a preferred embodiment of the present invention, the antibody contained in the chimeric antigen receptor is a single chain antibody, which is connected to CD8 or the transmembrane region of CD28 through the hinge region of CD8, and the transmembrane region is immediately followed by the intracellular signal region.

[0120] The invention also includes nucleic acids encoding the chimeric antigen receptors. The present invention also relates to variants of the above described polynucleotides, which encode a polypeptide, or a fragment, analog and derivative of the polypeptide having the same amino acid sequence as the present invention.

[0121] The transmembrane region of the chimeric antigen receptor may be selected from the transmembrane region of a protein such as CD8 or CD28. The human CD8 protein is a heterodimer composed of two chains, .alpha..beta. or .gamma..delta.. In one embodiment of the invention, the transmembrane region is selected from the transmembrane region of CD8a or CD28. In addition, the CD8a hinge is a flexible region so that CD8 or CD28 and the transmembrane region as well as the hinge region are used to connect the target recognition domain scFv of the chimeric antigen receptor CAR to the intracellular signal region.

[0122] The intracellular signal region may be selected from a group consisting of intracellular signal region of CD3 .zeta., Fc.epsilon.RI.gamma., CD28, CD137, CD134 protein, and combinations thereof. The CD3 molecule consists of five subunits, in which CD3.zeta. subunit (also known as CD3 zeta, abbreviated as Z) contains 3 ITAM motifs that are important signal transduction regions in TCR-CD3 complex. CD3.delta.Z is a truncated CD3.zeta. sequence without ITAM motif and is generally constructed in the present invention as a negative control. Fc.epsilon.RI.gamma. is mainly distributed on the surface of mast cells and basophils, which contains an ITAM motif, which is similar to CD3.zeta. in structure, distribution and function. In addition, as mentioned above, CD28, CD137 and CD134 are co-stimulatory signaling molecules. The co-stimulatory effect of their intracellular signaling segments upon binding to the respective ligands results in the continued proliferation of immune effector cells, primarily T lymphocytes, and increase in the level of cytokines such as IL-2 and IFN-.gamma. secreted by immune effector cells, and the survival period and anti-tumor effect of CAR immune effector cells in vivo are increased.

[0123] The chimeric antigen receptor of the present invention can be sequentially linked as follows:

[0124] The antibody of the invention, CD8 and CD3.zeta.;

[0125] The antibody of the invention, CD8, CD137 and CD3.zeta.;

[0126] The antibody of the invention, the transmembrane region of CD28 molecule, the intracellular signal region of CD28 molecule and CD3 .zeta.; or

[0127] The antibodies of the invention, the transmembrane region of CD28 molecule, the intracellular signal region of CD28 molecule, CD137 and CD3.zeta..

[0128] And combinations thereof, wherein CD28a in the relevant chimeric antigen receptor protein represents the transmembrane region of CD28 molecule and CD28b represents the intracellular signal region of CD28 molecule. The various chimeric antigen receptors described above are collectively referred to as scFv (EGFR)-CAR.

[0129] The present invention also provides a vector comprising the above-mentioned nucleic acid encoding a chimeric antigen receptor protein expressed on the surface of an immune effector cell. In a specific embodiment, the vector used in the present invention is a lentiviral plasmid vector pWPT-eGFP. This plasmid belongs to the third generation of self-inactivating lentiviral vector system. The system has three plasmids, packaging plasmid psPAX2 encoding protein Gag/Pol, encoding Rev protein; envelope plasmid PMD2.G encoding VSV-G protein; and empty vector pWPT-eGFP, which can be used for recombinant introduction of a nucleic acid sequence of interest, i.e., a nucleic acid encoding CAR. In the empty vector pWPT-eGFP, the expression of enhanced green fluorescent protein (eGFP) is regulated by elongation factor-1.alpha. (EF-1.alpha.) promoter. While in the recombinant expression vector pWPT-eGFP-F2A-CAR containing the nucleic acid sequence encoding CAR, co-expression of eGFP and CAR is achieved by ribosomal skipping sequence 2A (abbreviated as F2A) from food-and-mouth disease virus (FMDV).

[0130] The invention also includes viruses comprising the vectors described above. The viruses of the invention include packaged infectious viruses as well as viruses to be packaged that contain the necessary components for packaging into infectious viruses. Other viruses known in the art that can be used to transduce exogenous genes into immune effector cells and their corresponding plasmid vectors are also useful in the present invention.

[0131] The present invention further includes a genetically modified T lymphocyte, which is transduced with a nucleic acid of the present invention or transduced with the above-mentioned recombinant plasmid containing the nucleic acid of the present invention or a viral system containing the plasmid. Conventional nucleic acid transduction methods in the art, including non-viral and viral transduction methods, can be used in the present invention. Non-viral transduction methods include electroporation and transposon methods. Recently, nucleofector nuclear transfection instrument developed by Amaxa can directly introduce foreign genes into nucleus to achieve highly efficient transduction of target genes. In addition, compared with conventional electroporation, the transduction efficiency of transposon system based on Sleeping Beauty system or PiggyBac transposon was significantly improved. The combination of nucleofector transfection instrument and SB Sleeping Beauty transposon system has been reported [Davies JK., et al. Combining CD19 redirection and alloanergization to generate tumor-specific human T cells for allogeneic cell therapy of B-cell malignancies. Cancer Res, 2010, 70(10): OF1-10.], and high transduction efficiency and site-directed integration of target genes can be achieved by this method. In one embodiment of the invention, the transduction method of a T lymphocyte modified by a chimeric antigen receptor gene is a transduction method based on a virus such as a retrovirus or a lentivirus. The method has the advantages of high transduction efficiency and stable expression of exogenous gene, and the time for in vitro culturing T lymphocytes to clinical level can be shorten. The transduced nucleic acid is expressed on the surface of the transgenic T lymphocytes by transcription, translation. In vitro cytotoxicity assay performed on various cultured tumor cells demonstrated that the immune effector cells of the present invention have highly specific tumor cell killing effects (also known as cytotoxicity). Therefore, the nucleic acid encoding a chimeric antigen receptor protein of the present invention, a plasmid comprising the nucleic acid, a virus comprising the plasmid, and a transgenic immune effector cells transfected with the nucleic acid, plasmid or virus described above can be effectively used in tumor immunotherapy.

[0132] The immune cells of the present invention may also carry exogenous encoding sequences for cytokines, including but not limited to IL-12, IL-15 or IL-21. These cytokines have immunomodulatory or antitumor activity, enhance the function of effector T cells and activated NK cells, or directly exert anti-tumor effects. Therefore, those skilled in the art will understand that the use of these cytokines will help the immune cells to function better.

[0133] In addition to the chimeric antigen receptor described above, the immune cells of the present invention may also express another chimeric antigen receptor, which does not contain CD3, but contains intracellular signaling domain of CD28 and intracellular signal domain of CD137, or a combination of both.

[0134] The immune cells of the present invention may also express chemokine receptors; the chemokine receptors include, but are not limited to, CCR2. A skilled person will understand that the CCR2 chemokine receptor can competitively bind CCR2 in the body and is beneficial for blocking the metastasis of the tumor.

[0135] The immune cells of the present invention may also express siRNAs that can reduce PD-1 expression or PD-L1-blocking proteins. A skilled person will understand that competitive blocking of the interaction between PD-L1 and its receptor PD-1 will facilitate the recovery of anti-tumor T-cell responses, thereby inhibiting tumor growth.

[0136] The immune cells of the present invention may also express a safety switch; preferably, the safety switch includes iCaspase-9, Truancated EGFR or RQR8.

[0137] Pharmaceutical Composition

[0138] The antibodies, immunoconjugates comprising the antibodies, and genetically modified immune cells of the present invention can be used in the preparation of a pharmaceutical composition or diagnostic reagent. In addition to an effective amount of the antibody, immunological conjugate, or immune cell, the composition may further comprise a pharmaceutically acceptable carrier. The term "pharmaceutically acceptable" means that when the molecular entities and compositions are properly administered to animals or humans, they do not cause adverse, allergic or other untoward reactions.

[0139] Specific examples of some of the substances which may be used as pharmaceutically acceptable carriers or components thereof are sugars, such as lactose, dextrose and sucrose; starches, such as corn starch and potato starch; cellulose and its derivatives, such as carboxymethylcellulose sodium, ethylcellulose and methylcellulose; gum tragacanth; malt; gelatin; talc; solid lubricants such as stearic acid and magnesium stearate; calcium sulfate; vegetable oils, such as peanut oil, cottonseed oil, sesame oil, olive oil, corn oil and cocoa butter; polyhydric alcohols such as propylene glycol, glycerin, sorbitol, mannitol and polyethylene glycol; alginic acid; emulsifiers such as Tween.RTM.; wetting agents such as sodium lauryl sulfate; coloring agents; flavoring agents; tablets, stabilizers; antioxidants; preservatives; pyrogen-free water; isotonic saline solutions; and phosphate buffers and the like.

[0140] The composition of the present invention can be prepared into various dosage forms as needed, and the dosage to be administered to a patient can be determined by a physician according to factors, such as type, age, body weight, and general disease condition of a patient, mode of administration, and the like. For example, injection or other treatment may be used.

[0141] The present invention is further described below with reference to specific embodiments. It should be understood that these examples are only for illustrating the present invention and are not intended to limit the scope of the present invention. Experimental procedures in the following examples where no specific conditions are indicated are generally carried out in accordance with the conditions described in customary conditions such as those compiled by J. Sambrook et al., Molecular Cloning Experiments Guide, Third Edition, Science Press, 2002, or according to the manufacturer Suggested conditions.

Example 1. Construction of Affinity Mature Library of Single Chain Antibody 7B3

[0142] The single chain antibody 7B3 is a humanized antibody fragment that specifically recognizes a cryptic epitope (.sup.287CGADSYEMEEDGVRKC.sup.302 (SEQ ID NO: 1)) formed from the amino acid sequence of positions 287-302 of EGFR exposed in tumor cells. The nucleotide sequences of VL and VH genes were obtained from the sequences SEQ ID NO: 14 and SEQ ID NO: 13 as shown in patent application 201210094008.x and linked in the order of VL7B3-linker-VH7B3.

[0143] Nucleotide sequence 717 base airs SEQ ID NO: 2 of single chain antibody 7B3:

TABLE-US-00001 GATATTCAGATGACCCAGAGCCCGAGCAGC CTGAGCGCGAGCGTGGGCGACCGTGTGACC ATTACCTGCCATGCGAGCCAGGATATTAAC AGCAACATTGGCTGGCTGCAGCAGAAACCG GGCAAAGCGTTTAAAGGCCTGATTTATCAT GGCAAAAACCTGGAAGATGGCGTGCCGAGC CGTTTTAGCGGCAGCGGCAGCGGCACCGAT TTTACCCTGACCATTAGCAGCCTGCAGCCG GAAGATTTTGCGACCTATTATTGCGTTCAG TACGCCCAGTTCCCATATACATTTGGCCAG GGCACCAAAGTGGAAATTAAACGTGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGT GGCGGATCGGATGTGCAGCTGGTGGAAAGC GGCGGCGGCCTGGTGCAGCCGGGCGGCAGC CTGCGTCTGAGCTGCGCGGTGAGCGGCTAT AGCATTACCAGCGATTATGCGTGGAACTGG ATTCGTCAGGCGCCGGGCAAAGGCCTGGAA TGGCTGGGCTATATTAGCTATCGTGGCCGC ACCAGCTATAACCCGAGCCTGAAAAGCCGT ATTAGCATTACCCGTGATAACAGCAAAAAC ACCTTTTTCCTGCAGCTGAACAGCCTGCGT GCGGAAGATACCGCGGTGTATTATTGCGCG CGCCTGGGACGCGGCTTCCGCTACTGGGGC CAGGGCACCCTGGTGACCGTGAGCAGC

[0144] The amino acid sequence of the single chain antibody 7B3 (239 amino acids, SEQ ID NO: 3; underlined area was 7B3 VL CDR1, CDR2, CDR3, 7B3 VH CDR1, CDR2, CDR3, respectively):

TABLE-US-00002 DIQMTQSPSSLSASVGDRVTITCHASQDINSNIGWLQQKP GKAFKGLIYHGKNLEDGVPSRFSGSGSGTDFTLTISSLQP EDFATYYCVQYAQFPYTFGQGTKVEIKRGGGGSGGGGSGG GGSDVQLVESGGGLVQPGGSLRLSCAVSGYSITSDYAWNW IRQAPGKGLEWLGYISYRGRTSYNPSLKSRISITRDNSKN TFFLQLNSLRAEDTAVYYCARLGRGFRYWGQGTLVTVSS

[0145] For enhancing the ability of 7B3 single-chain antibody to bind EGFR, some amino acids in CDR3 of light chain and CDR3 of heavy chain were randomly mutated and corresponding mature libraries were constructed.

[0146] 1. Construction of 7B3 Light Chain CDR3 Affinity Mature Library

[0147] By sequence alignment and analysis of 7B3 single-chain antibody, part of the amino acids in the third CDR region of 7B3 light chain were selected and randomized mutations were introduced by primers to construct a light-chain affinity mature library.

[0148] To prepare a DNA fragment encoding the 7B3 mutant library, two DNA fragments were respectively obtained by PCR using plasmid pCantab 5E-7B3 (inserting 7B3 into sfiI/NotI site of pCantab 5E-7B3) as a template, followed by splicing through bypass PCR method. Specifically, the following procedure was used: for synthesizing genes, PCR reactions were performed in a volume of 50 .mu.l each using plasmid pCantab 5E-7B3 as a template with a final concentration of 0.2 .mu.M for each primer and 5 .mu.l of 10.times.KOD Plus buffer, 4 .mu.l dNTPs (dATP, dCTP, dGTP and dTTP, 2 mM each), 2 .mu.l 25 mM MgSO.sub.4 and 1 U KOD Plus (from Takara) were added and the PCR procedure was started in a thermal cycler after making up the volume with water. The reaction was firstly heated to 94.degree. C. for 5 minutes and then incubated for 25 cycles of 94.degree. C. for 30 seconds, 56.degree. C. for 30 seconds and 68.degree. C. for 30 seconds, and finally, at 68.degree. C. for 10 minutes. The first fragment was amplified using primers pC7B3fw (SEQ ID NO: 4, ATAACAGGCCCAGCCGGCCATGGATATTCAGATGACCCAGAG) and LR3re (SEQ ID NO: 5, CACTTTGGTGCCCTGGCCAAATGTMNNTGGGNNMNNMNNMNNCTGMNNGCAATA ATAGGTCGCAAAATC) and the second fragment was amplified using primer LR3f2fw (SEQ ID NO: 6, ACATTTGGCCAGGGCACCAAAG) and pC7B3re (SEQ ID NO: 7, ATAAATGCGGCC GCGCTGCTCACGGTCAC).

[0149] Expected PCR products were identified by analytical agarose gel electrophoresis and purified from samples by Wizard SV Gel and PCR Clean-up Kit (available from Promega). The two fragments were added in equimolar ratio to a second round of bridge PCR as a template and the reaction system still used KOD Plus system mentioned above. The reaction was firstly heated to 94.degree. C. for 5 minutes and then incubated for 10 cycles, each cycling reaction conditions were 94.degree. C. for 30 seconds, 60.degree. C. for 30 seconds and 68.degree. C. for 30 seconds, and finally, at 68.degree. C. for 10 minutes. Subsequently, primers pC7B3fw and pC7B3re were directly added to the reaction system at a final concentration of 0.2 .mu.M, and the PCR program was started. The reaction was firstly heated to 94.degree. C. for 5 minutes and then incubated for 25 cycles of 94.degree. C. for 30 seconds, 56.degree. C. for 30 seconds and 68.degree. C. for 30 seconds, and finally, at 68.degree. C. for 10 minutes. The expected PCR products were separated by preparative agarose gel electrophoresis and purified by Wizard SV Gel and PCR Clean-up kits according to the manufacturer's instructions.

[0150] In the library, complete DNA fragments contained sfiI and Notl restriction enzyme recognition sites at each end, and was digested by restriction endonuclease sfiI/NotI (purchased from New England Biolabs) for restriction digestion and inserted into phagemid vector pCANTAB 5E digested by the same two enzymes. Ligation products were isolated and desalted using Wizard SV Gel and PCR Clean-up Kit for electrotransformation. For electrotransformation, a home-made competent E. coli ER2738 (available from New England Biolabs) was used with electroporation cuvette and electroporation instrument Gene Pulser II (from Bio-Rad). A library containing 1.9.times.10.sup.9 mutants was finally confirmed.

[0151] 2. Construction of 7B3 Heavy Chain CDR3 Affinity Mature Library

[0152] By sequence alignment and analysis of 7B3 single-chain antibody, part of the amino acids in the third CDR region of 7B3 heavy chain were selected and randomized mutations were introduced by primers to construct a heavy-chain affinity mature library.

[0153] To prepare a DNA fragment encoding the 7B3 mutant library, two DNA fragments were respectively obtained by PCR using plasmid pCantab 5E-7B3 as a template, followed by splicing through bypass PCR method. Specifically, the following procedure was used: for synthesizing genes, PCR reactions were performed in a volume of 50 .mu.l each using plasmid pCantab 5E-7B3 as a template with a final concentration of 0.2 .mu.M for each primer and 5 .mu.l of 10.times.KOD Plus buffer, 4 .mu.l dNTPs (dATP, dCTP, dGTP and dTTP, 2 mM each), 2 .mu.l 25 mM MgSO.sub.4 and 1 U KOD Plus were added and the PCR procedure was started in a thermal cycler after making up the volume with water. The reaction was firstly heated to 94.degree. C. for 5 minutes and then incubated for 25 cycles of 94.degree. C. for 30 seconds, 56.degree. C. for 30 seconds and 68.degree. C. for 30 seconds, and finally, at 68.degree. C. for 10 minutes. The first fragment was amplified using primers HR3f1fw (SEQ ID NO: 8, TCGCAATTCCTTTAGTTGTTCC) and HR3f1re (SEQ ID NO: 9, CAGGGTGCCCTGGCCCCAGTAANNMNNMNNMNNMNNMNNGCGCGCGCAATAATAC AC) and the second fragment was amplified using primer HR3f2fw (SEQ ID NO: 10, TACTGGGGCCAGGGCACCCTG) HR3f2re (SEQ ID NO: 11, GGAATAGGTGTATCACCGTACTCAG).

[0154] Expected PCR products were identified by analytical agarose gel electrophoresis and purified from samples by Wizard SV Gel and PCR Clean-up Kit. The two fragments were added in equimolar ratio to a second round of bridge PCR as a template and the reaction system still used KOD Plus system mentioned above. The reaction was firstly heated to 94.degree. C. for 5 minutes and then incubated for 10 cycles, each cycling reaction conditions were 94.degree. C. for 30 seconds, 60.degree. C. for 30 seconds and 68.degree. C. for 30 seconds, and finally, at 68.degree. C. for 10 minutes. Subsequently, primers HR3f1fw and HR3f2re were directly added to the reaction system at a final concentration of 0.2 .mu.M, and the PCR program was started. The reaction was firstly heated to 94.degree. C. for 5 minutes and then incubated for 25 cycles of 94.degree. C. for 30 seconds, 56.degree. C. for 30 seconds and 68.degree. C. for 30 seconds, and finally, at 68.degree. C. for 10 minutes. The expected PCR products were separated by preparative agarose gel electrophoresis and purified by Wizard SV Gel and PCR Clean-up kits according to the manufacturer's instructions.

[0155] In the library, complete DNA fragments contained sfiI and Notl restriction enzyme recognition sites at each end, and was digested by restriction endonuclease sfiI/NotI for restriction digestion and inserted into phagemid vector pCANTAB 5E digested by the same two enzymes. Ligation products were isolated and desalted using Wizard SV Gel and PCR Clean-up Kit for electrotransformation. For electrotransformation, a home-made competent E. coli ER2738 was used with electroporation cuvette and electroporation instrument Gene Pulser II. A library containing 6.0.times.10.sup.9 mutants was finally confirmed.

Example 2. Screening Against EGFRvIII by Using 7B3 Affinity Maturation Library

[0156] To obtain 7B3 mutants with higher affinity, four rounds of screening were performed using light chain and heavy chain mutant libraries, respectively, as follows: a corresponding phage library was obtained from the above library through infection of helper phage M13KO7. The phage library was incubated with the biotin-labeled antigen EGFRvIII (purchased from Shanghai raygene biotechnology Co., LTD) for 2 hours at room temperature and then incubated with 2% (w/v) BSA (bovine serum albumin, purchased from Shanghai Bioengineering)-blocked streptavidin magnetic beads MyOne Cl (from Invitrogen) at room temperature for 30 minutes. The beads were then washed with PBST (containing 0.1% Tween-20) buffer to remove phage not specifically bound or with weaker binding capacity. Strongly binding phages were eluted from magnetic beads with glycine-HCl (pH 2.2), neutralized with Tris neutralizing solution (pH 9.1), and then used to infect E. coli ER2738 in the mid-logarithmic growth phase for the next round of screening.

[0157] In the above described four rounds of screening, the amounts of magnetic beads were 50 .mu.l, 25 .mu.l, 10 .mu.l and 10 .mu.l, the concentrations of biotin-labeled antigen EGFRvIII were 10 nM, 1 nM, 0.5 nM and 0.1 nM, respectively, and PBST was used for washing for 10, 10, 15 and 20 times. From the second round of screening, 50-, 500-, and 1000-fold excess of unlabeled antigen EGFRvIII, respectively, was added as a competitor prior to elution to remove mutants with weaker binding capacity.

[0158] For the production of phage displaying 7B3 single chain antibody mutants on the surface, the strain in glycerol obtained in Example 1 was inoculated into 400 ml of 2YT/ampicillin medium to bring the cell density to OD.sub.600=0.1, and at 37.degree. C. and 200 rpm, cultured with shaking until the cell density reached OD.sub.600=0.5. 10.sup.12 pfu of M13KO7 helper phage was used in infection and incubated at 30.degree. C. and 50 rpm for 30 minutes. After adding 50 mg/l kanamycin and shaking at 37.degree. C. and 200 rpm for 30 minutes, the pellet was separated by centrifugation (15 minutes, 1600.times.g, 4.degree. C.) and resuspended in 400 ml 2YT/ampicillin/Kanamycin medium and cultured for 16 hours at 37.degree. C. with shaking at 200 rpm. Finally, the pellet was separated by centrifugation (5000 rpm, 4.degree. C. for 20 minutes) and discarded. The supernatant was filtered through a 0.45 .mu.m filter and 1/4 volume of 20% (w/v) PEG 8000, 2.5 M NaCl solution was added and incubated in an ice bath for 1 hour for precipitating phage pellets. The pellet was then centrifuged (20 min, 8000.times.g, 4.degree. C.) and the supernatant was discarded. The phage was resuspended in 25 ml of prechilled PBS (137 mM NaCl, 2.7 mM KCl, 8 mM Na.sub.2HPO.sub.4, 2 mM KH.sub.2PO.sub.4) and centrifuged (5 minutes, 20000.times.g, 4.degree. C.). 1/4 volume of 20% (w/v) PEG 8000, 2.5 M NaCl solution was added to the supernatant and incubated in an ice bath for 30 minutes for precipitating the phage particles again. The pellet was obtained by centrifugation (30 min at 20000.times.g at 4.degree. C.), resuspended in 2 ml of prechilled PBS again, kept on ice for 30 min and centrifuged (30 min, 17000.times.g, 4.degree. C.). The supernatant was mixed with 4% (w/v) BSA in PBS at 1:1, placed on a rotary mixer and incubated for 30 minutes at room temperature, and then used directly in screening.

Example 3. Identification of 7B3 Mutants Specifically Binding to EGFRvIII

[0159] After four rounds of screening against EGFRvIII antigen, 96 clones were randomly selected from the clones obtained in the fourth round of screening and analyzed for their combination with antigens EGFRvIII and N1N2-806 (purchased from Shanghai raygene biotechnology Co., LTD) using single phage ELISA (enzyme-linked immunosorbent assay), where N1N2-806 is a fusion protein of N1N2 domain of M13 phage PIII protein and amino acids at positions 287-302 of EGFR. For this purpose, each single colony was inoculated into 300 .mu.l of 2YT/ampicillin medium (containing 2% glucose) in a 96-well deep-well plate and cultured with shaking at 37.degree. C. and 250 rpm for 16 hours. 20 .mu.l of culture was innoculated into 500 .mu.l of 2YT/ampicillin medium (containing 0.1% glucose) and shaken at 37.degree. C. and 250 rpm for 1.5 hours. To prepare the helper phage solution, 75 .mu.l of M13KO7 (titer of 3.times.10.sup.12 pfu/ml) was taken and mixed into 15 ml of 2YT medium and added into a plate at 50 .mu.l/well. Incubation was performed at 37.degree. C. and 150 rpm for 30 minutes, and then 50 .mu.l/well of prepared kanamycin solution (180 .mu.l of 50 mg/ml kanamycin taken and added into 15 ml of 2YT medium) was added and cultured at 37.degree. C. and 250 rpm for 16 hours with shaking. Finally, the cells were precipitated by centrifugation (30 minutes at 5000.times.g, 4.degree. C.) and the supernatant was transferred to a new 96-well deep-well plate.

[0160] To perform single-phage ELISA, 100 ng/well of antigen EGFRvIII, N1N2-806 and negative control proteins BSA and N1N2 (purchased from Shanghai raygene biotechnology Co., LTD) were used on 96-well MediSorp ELISA plate (purchased from Nunc) at 50 .mu.l/well, and coated overnight at 4.degree. C. Each well was blocked with PBST containing 2% BSA (w/v). The wells were then washed with PBST for three times. Then, each phage solution prepared above was added to each well of the plate at 100 .mu.l/well. After incubation for 2 hours at 37.degree. C., it was washed for three times with PBST. To detect bound phage, anti-M13 antibody superoxide dismutase conjugate (purchased from GE Healthcare) was diluted at 1:5000 in PBST and 100 .mu.l was added to each well. After incubating at 37.degree. C. for 1 hour, the wells were rinsed for three times with PBST and then rinsed for three times with PBS. Finally, 50 .mu.l of TMB substrate was added into the wells and developed for 10 minutes at room temperature, followed by addition of 50 .mu.l of 2M H.sub.2SO.sub.4 per well to stop the color reaction. Extinction values were measured at 450 nm with an enzyme-linked immunosorbent (Bio-Rad).

[0161] Clones with stronger signal of binding antigen instead of BSA in ELISA were selected and used in subsequent evaluation and sequencing analysis. The antibodies obtained from the light chain affinity maturation library were then further combined with the antibodies obtained from Example 2 in the heavy chain affinity maturation library on light chain variable region sequence and heavy chain variable region sequence and the resulting antibodies are also capable of specifically binding antigens EGFRvIII and N1N2-806, instead of the control proteins BSA and N1N2.

[0162] From the crystal structure of the antibody and antigenic determinant, the binding of combined antibodies obtained from 7B3 light and heavy chain mutations and EGFR287-302 was structurally analyzed, and finally, some amino acid positions were selected for further mutation for higher affinity and stability. All of the altered amino acid positions include S31 in the light chain CDR1 region, V89, A92, Q93, F94 and Y96 in the light chain CDR3 region, S182 in the heavy chain CDR2 region, L222, R224, G225, F226 and R227 in the heavy chain CDR3 region. Based on the sequences of combined antibodies after mutagenesis of the light and heavy chains, the mutation sites were further introduced to obtain the antibody Y022. Compared with the parental antibody 7B3, Y022 contains 12 amino acid mutation sites (S31V, V89N, A92E, Q93N, F941, Y96L, S182Q, L222M, R224K, G225N, F226W, and R227D). As shown in FIG. 1, in a single phage ELISA assay, Y022 was able to specifically bind to antigens EGFRvIII and N1N2-806 without binding to control proteins BSA and N1N2.

[0163] Nucleotide sequence of single chain antibody Y022 (717 bases; SEQ ID NO: 12):

TABLE-US-00003 GATATTCAGATGACCCAGAGCCCGAGCAGC CTGAGCGCGAGCGTGGGCGACCGTGTGACC ATTACCTGCCATGCGAGCCAGGATATTAAC GTGAACATTGGCTGGCTGCAGCAGAAACCG GGCAAAGCGTTTAAAGGCCTGATTTATCAT GGCAAAAACCTGGAAGATGGCGTGCCGAGC CGTTTTAGCGGCAGCGGCAGCGGCACCGAT TTTACCCTGACCATTAGCAGCCTGCAGCCG GAAGATTTTGCGACCTATTATTGCAATCAG TATGAAAATATCCCACTGACATTTGGCCAG GGCACCAAAGTGGAAATTAAACGTGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGT GGCGGATCGGATGTGCAGCTGGTGGAAAGC GGCGGCGGCCTGGTGCAGCCGGGCGGCAGC CTGCGTCTGAGCTGCGCGGTGAGCGGCTAT AGCATTACCAGCGATTATGCGTGGAACTGG ATTCGTCAGGCGCCGGGCAAAGGCCTGGAA TGGCTGGGCTATATTAGCTATCGTGGCCGC ACCCAGTATAACCCGAGCCTGAAAAGCCGT ATTAGCATTACCCGTGATAACAGCAAAAAC ACCTTTTTCCTGCAGCTGAACAGCCTGCGT GCGGAAGATACCGCGGTGTATTATTGCGCG CGCATGGGTAAGAATTGGGATTACTGGGGC CAGGGCACCCTGGTGACCGTGAGCAGC

[0164] Amino acid sequence of single chain antibody Y022 (239 amino acids; SEQ ID NO: 13):

TABLE-US-00004 DIQMTQSPSSLSASVGDRVTITCHASQDIN VNIGWLQQKPGKAFKGLIYHGKNLEDGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCNQ YENIPLTFGQGTKVEIKRGGGGSGGGGSGG GGSDVQLVESGGGLVQPGGSLRLSCAVSGY SITSDYAWNWIRQAPGKGLEWLGYISYRGR TQYNPSLKSRISITRDNSKNTFFLQLNSLR AEDTAVYYCARMGKNWDYWGQGTLVTVSS

[0165] Wherein the light chain is in positions 1-108 and the light chain CDR1 sequence: HASQDINVNIG (SEQ ID NO: 41), CDR2 sequence: HGKNLED (SEQ ID NO: 42), CDR3 sequence: NQYENIPLT (SEQ ID NO: 43).

[0166] Wherein the heavy chain is in positions 124-239 and the heavy chain CDR1 sequence: GYSITSDYAWN (SEQ ID NO: 44), CDR2 sequence: YISYRGRTQYNPSLKS (SEQ ID NO: 45), CDR3 sequence: MGKNWDY (SEQ ID NO: 46).

[0167] Since it was screened in the mutant library constructed previously and subjected to site-directed mutagenesis, the nucleotide sequence of Y022 was contained in pCantab 5E, named as pCantab 5E-Y022 plasmid.

[0168] The inventors also obtained 10 additional antibody clones with significantly improved affinity and stability using the same method as for the production of antibody Y022, namely M14, M15, M25, M26, S7, S8, S17, S22, S23 and S29. Compared with the parent antibody 7B3, all single-chain antibodies contained amino acid mutation sites as shown in Table 1.

TABLE-US-00005 TABLE 1 Antibody amino acid mutation site Y022 S31V, V89N, A92E, Q93N, F94I, Y96L, S182Q, L222M, R224K, G225N, F226W, R227D M14 V89N, A92E, Q93N, F94N, Y96I, S182N M15 S31V, V89N, A92E, Q93N, F94N, Y96I M25 S31V, V89N, A92E, Q93N, F94I, Y96L, S182R M26 S31V, V89N, A92E, Q93N, F94I, Y96L, S182Q S7 S31V, K53T, V89N, A92E, Q93N, F94N, Y96I S8 S31V, A44S, V89N, A92E, Q93N, F94N, Y96I S17 S31T, V89N, A92E, Q93N, F94N, Y96L, S182Q S22 S31V, K53T, V89N, A92E, Q93N, F94N, Y96L, S182R S23 S31V, A44S, V89N, A92E, Q93N, F94N, Y96L, S182R S29 S31V, V89N, A92E, Q93N, Y96L, S182R

[0169] Nucleotide sequence of single chain antibody M14 (717 bases; SEQ ID NO: 58):

TABLE-US-00006 GATATTCAGATGACCCAGAGCCCGAGCAGC CTGAGCGCGAGCGTGGGCGACCGTGTGACC ATTACCTGCCATGCGAGCCAGGATATTAAC AGCAACATTGGCTGGCTGCAGCAGAAACCG GGCAAAGCGTTTAAAGGCCTGATTTATCAT GGCAAAAACCTGGAAGATGGCGTGCCGAGC CGTTTTAGCGGCAGCGGCAGCGGCACCGAT TTTACCCTGACCATTAGCAGCCTGCAGCCG GAAGATTTTGCGACCTATTATTGCAATCAG TATGAAAATAACCCAATTACATTTGGCCAG GGCACCAAAGTGGAAATTAAACGTGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGT GGCGGATCGGATGTGCAGCTGGTGGAAAGC GGCGGCGGCCTGGTGCAGCCGGGCGGCAGC CTGCGTCTGAGCTGCGCGGTGAGCGGCTAT AGCATTACCAGCGATTATGCGTGGAACTGG ATTCGTCAGGCGCCGGGCAAAGGCCTGGAA TGGCTGGGCTATATTAGCTATCGTGGCCGC ACCAACTATAACCCGAGCCTGAAAAGCCGT ATTAGCATTACCCGTGATAACAGCAAAAAC ACCTTTTTCCTGCAGCTGAACAGCCTGCGT GCGGAAGATACCGCGGTGTATTATTGCGCG CGCCTGGGACGCGGCTTCCGCTACTGGGGC CAGGGCACCCTGGTGACCGTGAGCAGC

[0170] Amino acid sequence of single chain antibody M14 (239 amino acids; SEQ ID NO: 59):

TABLE-US-00007 DIQMTQSPSSLSASVGDRVTITCHASQDIN SNIGWLQQKPGKAFKGLIYHGKNLEDGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCNQ YENNPITFGQGTKVEIKRGGGGSGGGGSGG GGSDVQLVESGGGLVQPGGSLRLSCAVSGY SITSDYAWNWIRQAPGKGLEWLGYISYRGR TNYNPSLKSRISITRDNSKNTFFLQLNSLR AEDTAVYYCARLGRGFRYWGQGTLVTVSS

[0171] Amino acid sequences of M14 light chain CDR1(HASQDINSNIG), CDR2(HGKNLED), CDR3(NQYENNPIT) and heavy chain CDR1 (GYSITSDYAWN), CDR2 (YISYRGRTNYNPSLKS), CDR3 (LGRGFRY) are SEQ ID NO: 47, 42, 48, 44, 49, 50, respectively.

[0172] Nucleotide sequence of single chain antibody M15 (717 bases; SEQ ID NO: 60):

TABLE-US-00008 GATATTCAGATGACCCAGAGCCCGAGCAGC CTGAGCGCGAGCGTGGGCGACCGTGTGACC ATTACCTGCCATGCGAGCCAGGATATTAAC GTGAACATTGGCTGGCTGCAGCAGAAACCG GGCAAAGCGTTTAAAGGCCTGATTTATCAT GGCAAAAACCTGGAAGATGGCGTGCCGAGC CGTTTTAGCGGCAGCGGCAGCGGCACCGAT TTTACCCTGACCATTAGCAGCCTGCAGCCG GAAGATTTTGCGACCTATTATTGCAATCAG TATGAAAATAACCCAATTACATTTGGCCAG GGCACCAAAGTGGAAATTAAACGTGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGT GGCGGATCGGATGTGCAGCTGGTGGAAAGC GGCGGCGGCCTGGTGCAGCCGGGCGGCAGC CTGCGTCTGAGCTGCGCGGTGAGCGGCTAT AGCATTACCAGCGATTATGCGTGGAACTGG ATTCGTCAGGCGCCGGGCAAAGGCCTGGAA TGGCTGGGCTATATTAGCTATCGTGGCCGC ACCAGCTATAACCCGAGCCTGAAAAGCCGT ATTAGCATTACCCGTGATAACAGCAAAAAC ACCTTTTTCCTGCAGCTGAACAGCCTGCGT GCGGAAGATACCGCGGTGTATTATTGCGCG CGCCTGGGACGCGGCTTCCGCTACTGGGGC CAGGGCACCCTGGTGACCGTGAGCAGC

[0173] Amino acid sequence of single chain antibody M15 (239 amino acids; SEQ ID NO: 61):

TABLE-US-00009 DIQMTQSPSSLSASVGDRVTITCHASQDIN VNIGWLQQKPGKAFKGLIYHGKNLEDGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCNQ YENNPITFGQGTKVEIKRGGGGSGGGGSGG GGSDVQLVESGGGLVQPGGSLRLSCAVSGY SITSDYAWNWIRQAPGKGLEWLGYISYRGR TSYNPSLKSRISITRDNSKNTFFLQLNSLR AEDTAVYYCARLGRGFRYWGQGTLVTVSS

[0174] Amino acid sequences of M15 light chain CDR1 (HASQDINVNIG), CDR2 (HGKNLED), CDR3 (NQYENNPIT) and heavy chain CDR1 (GYSITSDYAWN), CDR2 (YISYRGRTSYNPSLKS), CDR3 (LGRGFRY) are SEQ ID NO: 41, 42, 48, 44, 51, 50, respectively.

[0175] Nucleotide sequence of single chain antibody M25 (717 bases; SEQ ID NO: 62):

TABLE-US-00010 GATATTCAGATGACCCAGAGCCCGAGCAGC CTGAGCGCGAGCGTGGGCGACCGTGTGACC ATTACCTGCCATGCGAGCCAGGATATTAAC GTGAACATTGGCTGGCTGCAGCAGAAACCG GGCAAAGCGTTTAAAGGCCTGATTTATCAT GGCAAAAACCTGGAAGATGGCGTGCCGAGC CGTTTTAGCGGCAGCGGCAGCGGCACCGAT TTTACCCTGACCATTAGCAGCCTGCAGCCG GAAGATTTTGCGACCTATTATTGCAATCAG TATGAAAATATCCCACTGACATTTGGCCAG GGCACCAAAGTGGAAATTAAACGTGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGT GGCGGATCGGATGTGCAGCTGGTGGAAAGC GGCGGCGGCCTGGTGCAGCCGGGCGGCAGC CTGCGTCTGAGCTGCGCGGTGAGCGGCTAT AGCATTACCAGCGATTATGCGTGGAACTGG ATTCGTCAGGCGCCGGGCAAAGGCCTGGAA TGGCTGGGCTATATTAGCTATCGTGGCCGC ACCCGCTATAACCCGAGCCTGAAAAGCCGT ATTAGCATTACCCGTGATAACAGCAAAAAC ACCTTTTTCCTGCAGCTGAACAGCCTGCGT GCGGAAGATACCGCGGTGTATTATTGCGCG CGCCTGGGACGCGGCTTCCGCTACTGGGGC CAGGGCACCCTGGTGACCGTGAGCAGC

[0176] Amino acid sequence of single chain antibody M25 (239 amino acids: SEQ ID NO: 63):

TABLE-US-00011 DIQMTQSPSSLSASVGDRVTITCHASQDIN VNIGWLQQKPGKAFKGLIYHGKNLEDGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCNQ YENIPLTFGQGTKVEIKRGGGGSGGGGSGG GGSDVQLVESGGGLVQPGGSLRLSCAVSGY SITSDYAWNWIRQAPGKGLEWLGYISYRGR TRYNPSLKSRISITRDNSKNTFFLQLNSLR AEDTAVYYCARLGRGFRYWGQGTLVTVSS

[0177] Amino acid sequences of M25 light chain CDR1 (HASQDINVNIG), CDR2 (HGKNLED), CDR3 (NQYENIPLT) and heavy chain CDR1 (GYSITSDYAWN), CDR2 (YISYRGRTRYNPSLKS), CDR3 (LGRGFRY) are SEQ ID NO: 41, 42, 43, 44, 52, 50, respectively.

[0178] Nucleotide sequence of single chain antibody M26 (717 bases; SEQ ID NO: 64):

TABLE-US-00012 GATATTCAGATGACCCAGAGCCCGAGCAGC CTGAGCGCGAGCGTGGGCGACCGTGTGACC ATTACCTGCCATGCGAGCCAGGATATTAAC GTGAACATTGGCTGGCTGCAGCAGAAACCG GGCAAAGCGTTTAAAGGCCTGATTTATCAT GGCAAAAACCTGGAAGATGGCGTGCCGAGC CGTTTTAGCGGCAGCGGCAGCGGCACCGAT TTTACCCTGACCATTAGCAGCCTGCAGCCG GAAGATTTTGCGACCTATTATTGCAATCAG TATGAAAATATCCCACTGACATTTGGCCAG GGCACCAAAGTGGAAATTAAACGTGGTGGA GGCGGTTCAGGCGGAGGTGGCTCTGGCGGT GGCGGATCGGATGTGCAGCTGGTGGAAAGC GGCGGCGGCCTGGTGCAGCCGGGCGGCAGC CTGCGTCTGAGCTGCGCGGTGAGCGGCTAT AGCATTACCAGCGATTATGCGTGGAACTGG ATTCGTCAGGCGCCGGGCAAAGGCCTGGAA TGGCTGGGCTATATTAGCTATCGTGGCCGC ACCCAGTATAACCCGAGCCTGAAAAGCCGT ATTAGCATTACCCGTGATAACAGCAAAAAC ACCTTTTTCCTGCAGCTGAACAGCCTGCGT GCGGAAGATACCGCGGTGTATTATTGCGCG CGCCTGGGACGCGGCTTCCGCTACTGGGGC CAGGGCACCCTGGTGACCGTGAGCAGC

[0179] Amino acid sequence of single chain antibody M26 (239 amino acids; SEQ ID NO: 65):

TABLE-US-00013 DIQMTQSPSSLSASVGDRVTITCHASQDIN VNIGWLQQKPGKAFKGLIYHGKNLEDGVPS RFSGSGSGTDFTLTISSLQPEDFATYYCNQ YENIPLTFGQGTKVEIKRGGGGSGGGGSGG GGSDVQLVESGGGLVQPGGSLRLSCAVSGY SITSDYAWNWIRQAPGKGLEWLGYISYRGR TQYNPSLKSRISITRDNSKNTFFLQLNSLR AEDTAVYYCARLGRGFRYWGQGTLVTVSS

[0180] Amino acid sequences of M26 light chain CDR1 (HASQDINVNIG), CDR2 (HGKNLED), CDR3 (NQYENIPLT) and heavy chain CDR1 (GYSITSDYAWN), CDR2 (YISYRGRTQYNPSLKS), CDR3 (LGRGFRY) are SEQ ID NO: 41, 42, 43, 44, 45, 50, respectively.

[0181] Nucleotide sequence of single chain antibody S7 (717 bases; SEQ ID NO: 66):

TABLE-US-00014 GATATTCAGATGACCCAGAGCCCGAGCAGCCTGAGCGCGAGCGTGGGCG ACCGTGTGACCATTACCTGCCATGCGAGCCAGGATATTAACGTGAACAT TGGCTGGCTGCAGCAGAAACCGGGCAAAGCGTTTAAAGGCCTGATTTAT CATGGCACCAACCTGGAAGATGGCGTGCCGAGCCGTTTTAGCGGCAGCG GCAGCGGCACCGATTTTACCCTGACCATTAGCAGCCTGCAGCCGGAAGA TTTTGCGACCTATTATTGCAATCAGTATGAAAATAACCCAATTACATTT GGCCAGGGCACCAAAGTGGAAATTAAACGTGGTGGAGGCGGTTCAGGCG GAGGTGGCTCTGGCGGTGGCGGATCGGATGTGCAGCTGGTGGAAAGCGG CGGCGGCCTGGTGCAGCCGGGCGGCAGCCTGCGTCTGAGCTGCGCGGTG AGCGGCTATAGCATTACCAGCGATTATGCGTGGAACTGGATTCGTCAGG CGCCGGGCAAAGGCCTGGAATGGCTGGGCTATATTAGCTATCGTGGCCG CACCAGCTATAACCCGAGCCTGAAAAGCCGTATTAGCATTACCCGTGAT AACAGCAAAAACACCTTTTTCCTGCAGCTGAACAGCCTGCGTGCGGAAG ATACCGCGGTGTATTATTGCGCGCGCCTGGGACGCGGCTTCCGCTACTG GGGCCAGGGCACCCTGGTGACCGTGAGCAGC

[0182] Amino acid sequence of single chain antibody S7 (239 amino acids; SEQ ID NO: 67):

TABLE-US-00015 DIQMTQSPSSLSASVGDRVTITCHASQDINVNIGWLQQKPGKAFKGLIY HGTNLEDGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCNQYENNPITF GQGTKVEIKRGGGGSGGGGSGGGGSDVQLVESGGGLVQPGGSLRLSCAV SGYSITSDYAWNWIRQAPGKGLEWLGYISYRGRTSYNPSLKSRISITRD NSKNTFFLQLNSLRAEDTAVYYCARLGRGFRYWGQGTLVTVSS

[0183] Amino acid sequences of S7 light chain CDR1 (HASQDINVNIG), CDR2 (HGTNLED), CDR3 (NQYENNPIT) and heavy chain CDR1 (GYSITSDYAWN), CDR2 (YISYRGRTSYNPSLKS), CDR3 (LGRGFRY) are SEQ ID NO: 41, 53, 54, 44, 51, 50, respectively.

[0184] Nucleotide sequence of single chain antibody S8 (717 bases; SEQ ID NO: 68):

TABLE-US-00016 GATATTCAGATGACCCAGAGCCCGAGCAGCCTGAGCGCGAGCGTGGGCG ACCGTGTGACCATTACCTGCCATGCGAGCCAGGATATTAACGTGAACAT TGGCTGGCTGCAGCAGAAACCGGGCAAAAGCTTTAAAGGCCTGATTTAT CATGGCAAAAACCTGGAAGATGGCGTGCCGAGCCGTTTTAGCGGCAGCG GCAGCGGCACCGATTTTACCCTGACCATTAGCAGCCTGCAGCCGGAAGA TTTTGCGACCTATTATTGCAATCAGTATGAAAATAACCCAATTACATTT GGCCAGGGCACCAAAGTGGAAATTAAACGTGGTGGAGGCGGTTCAGGCG GAGGTGGCTCTGGCGGTGGCGGATCGGATGTGCAGCTGGTGGAAAGCGG CGGCGGCCTGGTGCAGCCGGGCGGCAGCCTGCGTCTGAGCTGCGCGGTG AGCGGCTATAGCATTACCAGCGATTATGCGTGGAACTGGATTCGTCAGG CGCCGGGCAAAGGCCTGGAATGGCTGGGCTATATTAGCTATCGTGGCCG CACCAGCTATAACCCGAGCCTGAAAAGCCGTATTAGCATTACCCGTGAT AACAGCAAAAACACCTTTTTCCTGCAGCTGAACAGCCTGCGTGCGGAAG ATACCGCGGTGTATTATTGCGCGCGCCTGGGACGCGGCTTCCGCTACTG GGGCCAGGGCACCCTGGTGACCGTGAGCAGC

[0185] Amino acid sequence of single chain antibody S8 (239 amino acids; SEQ ID NO: 69):

TABLE-US-00017 DIQMTQSPSSLSASVGDRVTITCHASQDINVNIGWLQQKPGKSFKGLIYH GKNLEDGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCNQYENNPITFGQ GTKVEIKRGGGGSGGGGSGGGGSDVQLVESGGGLVQPGGSLRLSCAVSGY SITSDYAWNWIRQAPGKGLEWLGYISYRGRTSYNPSLKSRISITRDNSKN TFFLQLNSLRAEDTAVYYCARLGRGFRYWGQGTLVTVSS

[0186] Amino acid sequences of S8 light chain CDR1 (HASQDINVNIG), CDR2 (HGKNLED), CDR3 (NQYENNPIT) and heavy chain CDR1 (GYSITSDYAWN), CDR2 (YISYRGRTSYNPSLKS), CDR3 (LGRGFRY) are SEQ ID NO: 41, 42, 54, 44, 51, 50, respectively.

[0187] Nucleotide sequence of single chain antibody S17 (717 bases; SEQ ID NO: 70):

TABLE-US-00018 GATATTCAGATGACCCAGAGCCCGAGCAGCCTGAGCGCGAGCGTGGGCGA CCGTGTGACCATTACCTGCCATGCGAGCCAGGATATTAACACCAACATTG GCTGGCTGCAGCAGAAACCGGGCAAAGCGTTTAAAGGCCTGATTTATCAT GGCAAAAACCTGGAAGATGGCGTGCCGAGCCGTTTTAGCGGCAGCGGCAG CGGCACCGATTTTACCCTGACCATTAGCAGCCTGCAGCCGGAAGATTTTG CGACCTATTATTGCAATCAGTATGAAAATAACCCACTGACATTTGGCCAG GGCACCAAAGTGGAAATTAAACGTGGTGGAGGCGGTTCAGGCGGAGGTGG CTCTGGCGGTGGCGGATCGGATGTGCAGCTGGTGGAAAGCGGCGGCGGCC TGGTGCAGCCGGGCGGCAGCCTGCGTCTGAGCTGCGCGGTGAGCGGCTAT AGCATTACCAGCGATTATGCGTGGAACTGGATTCGTCAGGCGCCGGGCAA AGGCCTGGAATGGCTGGGCTATATTAGCTATCGTGGCCGCACCCAGTATA ACCCGAGCCTGAAAAGCCGTATTAGCATTACCCGTGATAACAGCAAAAAC ACCTTTTTCCTGCAGCTGAACAGCCTGCGTGCGGAAGATACCGCGGTGTA TTATTGCGCGCGCCTGGGACGCGGCTTCCGCTACTGGGGCCAGGGCACCC TGGTGACCGTGAGCAGC

[0188] Amino acid sequence of single chain antibody S17 (239 amino acids; SEQ ID NO: 71):

TABLE-US-00019 DIQMTQSPSSLSASVGDRVTITCHASQDINTNIGWLQQKPGKAFKGLIYH GKNLEDGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCNQYENNPLTFGQ GTKVEIKRGGGGSGGGGSGGGGSDVQLVESGGGLVQPGGSLRLSCAVSGY SITSDYAWNWIRQAPGKGLEWLGYISYRGRTQYNPSLKSRISITRDNSKN TFFLQLNSLRAEDTAVYYCARLGRGFRYWGQGTLVTVSS

[0189] Amino acid sequences of S17 light chain CDR1 (HASQDINTNIG), CDR2 (HGKNLED), CDR3 (NQYENNPLT) and heavy chain CDR1 (GYSITSDYAWN), CDR2 (YISYRGRTQYNPSLKS), CDR3 (LGRGFRY) are SEQ ID NO: 55, 42, 56, 44, 45, 50, respectively.

[0190] Nucleotide sequence of single chain antibody S22 (717 bases; SEQ ID NO: 72):

TABLE-US-00020 GATATTCAGATGACCCAGAGCCCGAGCAGCCTGAGCGCGAGCGTGGGCGA CCGTGTGACCATTACCTGCCATGCGAGCCAGGATATTAACGTGAACATTG GCTGGCTGCAGCAGAAACCGGGCAAAGCGTTTAAAGGCCTGATTTATCAT GGCACCAACCTGGAAGATGGCGTGCCGAGCCGTTTTAGCGGCAGCGGCAG CGGCACCGATTTTACCCTGACCATTAGCAGCCTGCAGCCGGAAGATTTTG CGACCTATTATTGCAATCAGTATGAAAATAACCCACTGACATTTGGCCAG GGCACCAAAGTGGAAATTAAACGTGGTGGAGGCGGTTCAGGCGGAGGTGG CTCTGGCGGTGGCGGATCGGATGTGCAGCTGGTGGAAAGCGGCGGCGGCC TGGTGCAGCCGGGCGGCAGCCTGCGTCTGAGCTGCGCGGTGAGCGGCTAT AGCATTACCAGCGATTATGCGTGGAACTGGATTCGTCAGGCGCCGGGCAA AGGCCTGGAATGGCTGGGCTATATTAGCTATCGTGGCCGCACCCGCTATA ACCCGAGCCTGAAAAGCCGTATTAGCATTACCCGTGATAACAGCAAAAAC ACCTTTTTCCTGCAGCTGAACAGCCTGCGTGCGGAAGATACCGCGGTGTA TTATTGCGCGCGCCTGGGACGCGGCTTCCGCTACTGGGGCCAGGGCACCC TGGTGACCGTGAGCAGC

[0191] Amino acid sequence of single chain antibody S22 (239 amino acids; SEQ ID NO: 73):

TABLE-US-00021 DIQMTQSPSSLSASVGDRVTITCHASQDINVNIGWLQQKPGKAFKGLIYH GTNLEDGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCNQYENNPLTFGQ GTKVEIKRGGGGSGGGGSGGGGSDVQLVESGGGLVQPGGSLRLSCAVSGY SITSDYAWNWIRQAPGKGLEWLGYISYRGRTRYNPSLKSRISITRDNSKN TFFLQLNSLRAEDTAVYYCARLGRGFRYWGQGTLVTVSS

[0192] Amino acid sequences of S22 light chain CDR1 (HASQDINVNIG), CDR2 (HGTNLED), CDR3 (NQYENNPLT) and heavy chain CDR1 (GYSITSDYAWN), CDR2 (YISYRGRTRYNPSLKS), CDR3(LGRGFRY) are SEQ ID NO: 41, 53, 56, 44, 52, 50, respectively.

[0193] Nucleotide sequence of single chain antibody S23 (717 bases; SEQ ID NO: 74):

TABLE-US-00022 GATATTCAGATGACCCAGAGCCCGAGCAGCCTGAGCGCGAGCGTGGGCGA CCGTGTGACCATTACCTGCCATGCGAGCCAGGATATTAACGTGAACATTG GCTGGCTGCAGCAGAAACCGGGCAAAAGCTTTAAAGGCCTGATTTATCAT GGCAAAAACCTGGAAGATGGCGTGCCGAGCCGTTTTAGCGGCAGCGGCAG CGGCACCGATTTTACCCTGACCATTAGCAGCCTGCAGCCGGAAGATTTTG CGACCTATTATTGCAATCAGTATGAAAATAACCCACTGACATTTGGCCAG GGCACCAAAGTGGAAATTAAACGTGGTGGAGGCGGTTCAGGCGGAGGTGG CTCTGGCGGTGGCGGATCGGATGTGCAGCTGGTGGAAAGCGGCGGCGGCC TGGTGCAGCCGGGCGGCAGCCTGCGTCTGAGCTGCGCGGTGAGCGGCTAT AGCATTACCAGCGATTATGCGTGGAACTGGATTCGTCAGGCGCCGGGCAA AGGCCTGGAATGGCTGGGCTATATTAGCTATCGTGGCCGCACCCGCTATA ACCCGAGCCTGAAAAGCCGTATTAGCATTACCCGTGATAACAGCAAAAAC ACCTTTTTCCTGCAGCTGAACAGCCTGCGTGCGGAAGATACCGCGGTGTA TTATTGCGCGCGCCTGGGACGCGGCTTCCGCTACTGGGGCCAGGGCACCC TGGTGACCGTGAGCAGC

[0194] Amino acid sequence of single chain antibody S23 (239 amino acids; SEQ ID NO: 75):

TABLE-US-00023 DIQMTQSPSSLSASVGDRVTITCHASQDINVNIGWLQQKPGKSFKGLIY HGKNLEDGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCNQYENNPLTF GQGTKVEIKRGGGGSGGGGSGGGGSDVQLVESGGGLVQPGGSLRLSCAV SGYSITSDYAWNWIRQAPGKGLEWLGYISYRGRTRYNPSLKSRISITRD NSKNTFFLQLNSLRAEDTAVYYCARLGRGFRYWGQGTLVTVSS

[0195] Amino acid sequences of S23 light chain CDR1 (HASQDINVNIG), CDR2 (HGKNLEDG), CDR3 (NQYENNPLT) and heavy chain CDR1 (GYSITSDYAWN), CDR2 (YISYRGRTRYNPSLKS), CDR3 (LGRGFRY) are SEQ ID NO: 41, 42, 56, 44, 52, 50, respectively.

[0196] Nucleotide sequence of single chain antibody S29717 bases; SEQ ID NO: 76):

TABLE-US-00024 GATATTCAGATGACCCAGAGCCCGAGCAGCCTGAGCGCGAGCGTGGGCG ACCGTGTGACCATTACCTGCCATGCGAGCCAGGATATTAACGTGAACAT TGGCTGGCTGCAGCAGAAACCGGGCAAAGCGTTTAAAGGCCTGATTTAT CATGGCAAAAACCTGGAAGATGGCGTGCCGAGCCGTTTTAGCGGCAGCG GCAGCGGCACCGATTTTACCCTGACCATTAGCAGCCTGCAGCCGGAAGA TTTTGCGACCTATTATTGCAATCAGTATGAAAATTTCCCACTGACATTT GGCCAGGGCACCAAAGTGGAAATTAAACGTGGTGGAGGCGGTTCAGGCG GAGGTGGCTCTGGCGGTGGCGGATCGGATGTGCAGCTGGTGGAAAGCGG CGGCGGCCTGGTGCAGCCGGGCGGCAGCCTGCGTCTGAGCTGCGCGGTG AGCGGCTATAGCATTACCAGCGATTATGCGTGGAACTGGATTCGTCAGG CGCCGGGCAAAGGCCTGGAATGGCTGGGCTATATTAGCTATCGTGGCCG CACCCGCTATAACCCGAGCCTGAAAAGCCGTATTAGCATTACCCGTGAT AACAGCAAAAACACCTTTTTCCTGCAGCTGAACAGCCTGCGTGCGGAAG ATACCGCGGTGTATTATTGCGCGCGCCTGGGACGCGGCTTCCGCTACTG GGGCCAGGGCACCCTGGTGACCGTGAGCAGC

[0197] Amino acid sequence of single chain antibody S29 (239 amino acids; SEQ ID NO: 77):

TABLE-US-00025 DIQMTQSPSSLSASVGDRVTITCHASQDINVNIGWLQQKPGKAFKGLIY HGKNLEDGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCNQYENFPLTF GQGTKVEIKRGGGGSGGGGSGGGGSDVQLVESGGGLVQPGGSLRLSCAV SGYSITSDYAWNWIRQAPGKGLEWLGYISYRGRTRYNPSLKSRISITRD NSKNTFFLQLNSLRAEDTAVYYCARLGRGFRYWGQGTLVTVSS

[0198] Amino acid sequences of S23 light chain CDR1 (HASQDINVNIG), CDR2 (HGKNLED), CDR3 (NQYENFPLT) and heavy chain CDR1 (GYSITSDYAWN), CDR2 (YISYRGRTRYNPSLKS), CDR3 (LGRGFRY) are SEQ ID NO: 41, 42, 57, 44, 52, 50, respectively.

Example 4. Expression and Purification of Antibody

[0199] Genes of each antibody were inserted into NdeI/XhoI site of the expression vector pET22B(+), antibody proteins were recombinantly produced in E. coli BL21 (DE3) and purified by nickel columns using polypeptides with carboxy-terminal fused 6.times.histidine. In particular, to prepare the antibody protein, each single colony was inoculated into 5 ml of 2.times.YT/ampicillin medium and cultured with shaking at 37.degree. C. and 220 rpm for 16 hours. 1 ml of this preculture was used to inoculate 100 ml of 2.times. YT/ampicillin medium and cultured with shaking at 37.degree. C. and 220 rpm until the cell density reached OD.sub.600=0.5. After induction of foreign gene expression by 1 mM .alpha.-D-isopropylthiogalactoside (IPTG), the culture was shaken for 6 hours at 30.degree. C. and 220 rpm. The cells were then precipitated by centrifugation (15 minutes at 3500.times.g, 4.degree. C.) and resuspended in 35 ml breaking buffer (50 mM PB, 300 mM NaCl, 2 M urea, 0.5% Triton X-100, pH 8.0). After sonication, the sample was shaken at room temperature for 30 minutes to completely lyse cell debris. Inclusion body pellets were then collected by centrifugation (15 minutes, 10,000.times.g, 4.degree. C.) and 20 ml denaturing buffer (50 mM PB, 300 mM NaCl, 8 M urea, 10 mM imidazole, pH 8.0) was added and shaken for one hour at room temperature. The pellets were removed by centrifugation (15 min, 10,000.times.g, 4.degree. C.), the lysate was collected and the protein was purified with 5 ml HisTrap HP purification column (commercially available from GE Healthcare). The purity of the purified antibody protein was analyzed by SDS polyacrylamide gel electrophoresis and the protein concentration was determined by the BCA method.

Example 5. Binding Activity Assay of Antibody

[0200] Binding activity of an antibody to antigen EGFRvIII was determined by concentration gradient ELISA assay. For this purpose, the antigen EGFRvIII was diluted with 0.1 M NaHCO.sub.3 (pH 9.6) coating solution and each well was coated with 200 ng at 50 .mu.l/well overnight at 4.degree. C. and blocked with PBST containing 2% (w/v) BSA for 2 hours at room temperature. The plate was then rinsed for three times with PBST. Subsequently, 100 .mu.l of each antibody protein solution in PBST containing a series of concentrations (initial concentration of 50 ng/well, 18 nM diluted until to 1:81) was added to each well plate and each sample was assayed using parallel three-well analysis. After incubation for 2 hours at 37.degree. C., plate was rinsed for three times with PBST followed by adding 100 .mu.l/well of a 1:2000 dilution of mouse anti-His-tag antibody (available from Santa cruz) for 1 hour at 37.degree. C. To test the bound antibody, HRP-labeled goat anti-mouse antibody (purchased from Santa Cruz) was diluted in PBST at a 1:15,000 dilution and 100 .mu.l per well was added and incubated at 37.degree. C. for 1 hour. For detection, wells were rinsed for three times with PBST followed by rinsing for three times with PBS and finally TMB was added for development for 15 mins. The chromogenic reaction was stopped with 50 .mu.l of 2 M H.sub.2SO.sub.4 per well and extinction value was measured at 450 nm using enzyme-linked immunoassay (Bio-Rad). The absorbance values obtained were evaluated using Sigma Plot software and the binding strength of an antibody was calculated. For this purpose, the extinction value measured in each case was plotted against the corresponding antibody concentration and the resulting curve was fitted using the following non-linear regression.

y = a * x ( b + x ) ##EQU00001##

[0201] Wherein the binding/dissociation equilibrium identified between the immobilized antigen and the antibody protein is:

[0202] x=concentration of antibody protein;

[0203] y=concentration of antigen/antibody complex (indirectly measured by absorbance after color reaction);

[0204] a=total concentration of immobilized antigen;

[0205] b=dissociation constant (K.sub.D).

[0206] The binding curve obtained for antibody 7B3 in concentration-gradient ELISA assay is exemplarily shown in FIG. 2 with K.sub.D of about 22.4 nM; the binding curve of antibody Y022 to EGFRvIII is shown in FIG. 3 with apparent K.sub.D of about 2.7 nM.

Example 6. Activity Analysis on Binding of Y022 to Cell Surface EGFR

[0207] 1. Expression and Purification of scFv-Y022-Fc, scFv-806-Fc and scFv-C225-Fc Fusion Antibody

[0208] According to a standard scheme, scFv-Y022 fragment was amplified from the resulting clones using the primer pair V5-Y022-F (SEQ ID NO: 14, ACAGTGCTAGCAGATATTCAGATGACCCAG) and V5-Y022-R (SEQ ID NO: 15, AAGAATGCGGCCGCGCTGCTCACGGTCACCAG); ScFv-806 was amplified using the primer pair V5-806-F (SEQ ID NO: 16, ACAGTGCTAGCAGACATCCTGATGACCCAAT) and V5-806-R (SEQ ID NO: 17, AAGAATGCGGCCGCTGCAGAGACAGTGACCAG) and pH-806/CD3 (see 201210094008.X) as the template; scFv-C225 fragment was cloned using the primer pairs V5-C225-F (SEQ ID NO: 18, ACAGTGCTAGCAGACATCTTGCTGACTCAG) and V5-C225-R (SEQ ID NO: 19, AAGAATGCGGCCGCTGCAGAGACAGTGACCAG) and C225 (VL-linker-VH) DNA fragment (sequence thereof was determined according to SEQ ID NO: 10 and SEQ ID NO: 12 in US20090099339A1 and obtained through whole-genome synthesis by Shanghai raygene biotechnology Co., LTD) as the template; and the amplified product was digested by NheI/NotI (purchased from NEB), linked with NheI/NotI-digested vector plasmid pCMV-V5-Fc (in the vector, the Fc fragment of human IgG1 was fused downstream to the multiple cloning site, abbreviated as V5-Fc, purchased from Shanghai raygene biotechnology Co., LTD) with T4 DNA ligase (purchased from NEB) and transformed into host strain TOP10. Clones were selected and the positive clones were identified by PCR and confirmed by sequencing, so as to obtain V5-scFv-Y022-Fc, V5-scFv-806-Fc and V5-scFv-C225-Fc eukaryotic expression plasmids, respectively.

[0209] The above expression plasmids were respectively transfected into well-growing HEK-293F cells, cultured at 37.degree. C., 5% CO.sub.2, 125 rpm shaker for 7 days, and centrifuged at 4000 rpm for 10 min. The precipitate was removed, the supernatant was collected and filtered with 0.45 .mu.m membrane. The sample was affinity-purified with protein A (from GE) affinity column to finally obtain the purified antibody-Fc fusion proteins scFv-Y022-Fc, scFv-806-Fc and scFv-C225-Fc. Results are shown in FIG. 4.

[0210] 2. Detection of Binding Ability of Single-Chain scFv-Y022-Fc, scFv-806-Fc and scFv-C225-Fc to Cell-Surface EGFR by FACS

[0211] The binding capacities of each of single-chain antibodies scFv-Y022-Fc, scFv-806-Fc and scFv-C225-Fc to the following cell lines were analyzed by fluorescence activated cell sorter (FACS) (BD, FACS Calibur).

[0212] Specific methods are as follows:

[0213] 1) tumor cells in logarithmic growth phase as listed in Table 2 were inoculated into a 6 cm dish with a inoculation cell density of about 90%, and incubated at 37.degree. C. incubator overnight.

[0214] 2) Cells were digested with 10 mM EDTA and cells were collected by centrifugation at 200 g for 5 min. Cells were resuspended in 1% phosphate buffered saline (NBS PBS) containing calf serum at a concentration of 1.times.10.sup.6 to 1.times.10.sup.7/mL, and added in a flow tube in an amount of 100 .mu.l/tube.

[0215] 3) Cells were centrifuged at 200 g.times.5 min, and the supernatant was discarded.

[0216] 4) Antibodies to be tested, scFv-Y022-Fc, scFv-806-Fc and scFv-C225-Fc, were added respectively. And PBS was used as a negative control. The final concentration of antibody was 20 .mu.g/ml, 100 .mu.l was added to each tube and placed in an ice bath for 45 minutes.

[0217] 5) 2 ml of 1% NBS PBS was added to each tube and centrifuged at 200 g.times.5 min for two times.

[0218] 6) Supernatant was discarded and FITC fluorescent-labeled goat anti-human antibody (from Shanghai Kangcheng Bio-engineering Company) at a dilution of 1:50 was added, and 100 ul was added to each tube and placed in an ice bath for 45 minutes.

[0219] 7) 2 ml of 1% NBS PBS was added to each tube and centrifuged at 200 g.times.5 min for two times.

[0220] 8) Supernatant was discarded, resuspended in 300 ul of 1% NBS PBS and detected by flow cytometry.

[0221] 9) Data was analyzed by using flow cytometry data analysis software WinMDI 2.9.

TABLE-US-00026 TABLE 2 Name of Expression tumor cell Source Properties of cell of EGFR U87 ATCC Glioma cell line Low-expressed EGFR U87-EGFR Shanghai Cancer EGFR-transfected U87 cell over-expressed Institute line EGFR U87-EGFRvIII Shanghai Cancer EGFRvIII-transfected over-expressed Institute U87 cell line EGFRvIII A431 ATCC Vaginal epithelial cancer over-expressed EGFR CAL 27 ATCC Tongue cancer cell line over-expressed EGFR MDA-MB-468 ATCC Breast cancer cell line over-expressed EGFR RWPE-1 ATCC Prostate normal normally-expressed epithelial cells EGFR K2 Shanghai Cancer Human primary keratinocytes normallyr-expressed Institute EGFR

[0222] Results are shown in FIG. 5, single chain antibody Y022 of the present invention can, with different degrees, bind to U87-EGFR exogenously overexpressing EGFR (Construction method can be found in Wang H., et al., Identification of an Exon 4-Deletion Variant of Epidermal Growth Factor Receptor with Increased Metastasis-Promoting Capacity. Neoplasia, 2011, 13, 461-471) and U87-EGFRvIII overexpressing EGFRvIII (construction method can be found in WO/2011/035465), A431, CAL27, MDA-MB-468 endogenously overexpressing EGFR, and especially strongly bind to U87-EGFRvIII and A431 cells, but its binding ability was not as high as that of single-chain antibody 806. Binding ability of the single-chain antibody C225 to these cells is very strong. These single-chain antibodies have little binding to U87 cells.

[0223] In addition, both Y022 and 806 single-chain antibodies almost did not bind to glioma cell line U87 cells. Especially, single chain antibody Y022 also does not bind to Normal prostate epithelial cells RWPE-1 and human primary keratinocyte K2, whereas single-chain antibody 806 binds to both of these normal cells with different degrees.

[0224] These results indicate that the single chain antibody Y022 specifically binds to tumor cells overexpressing EGFR as well as EGFRvIII, while little binding to normal EGFR-expressing cells.

Example 7. Construction of Expression Vector Containing Nucleotide Sequence Encoding Y022/CD3 Single Chain Bifunctional Antibodies

[0225] PCR amplification was performed using the pCantab 5E-Y022 plasmid obtained in Example 3 as a template and a primer pair, the forward primer pH7B3f2_fw (SEQ ID NO: 20, GATATTCAGATGACCCAGAGCCCGAGCAG) and the reverse primer pH7B3f2_re (SEQ ID NO: 21, AATAGGATCCACCACCTCCGCTGCTCACGGTCAC) to obtain DNA fragment of Y022 scFv. Another DNA fragment containing the pH vector signal peptide sequence was obtained by PCR using pH-7B3/CD3 plasmid (see 201210094008.X Example 3 and FIG. 2) as a template and the forward primer pH7B3f1_fw (SEQ ID NO: 22 CCATTGACGCAAATGGGCGGTAGG) and reverse primer pH7B3f1_re (SEQ ID NO: 23, CTGCTCGGGCTCTGGGTCATCTGAATATC). The two fragments were mixed in equimolar ratio for fragment splicing and PCR. The splicing conditions were: denaturation: 94.degree. C. for 4 min; denaturation: 94.degree. C. for 40 s; annealing: 60.degree. C. for 40 s; extension: 68.degree. C. for 140 s for 5 cycles, and then the total extension of 68.degree. C., 10 min. And then DNA polymerase and forward primer pH7B3f1_fw and reverse primer pH7B3f2_re were supplemented, 30 cycles of amplification were performed, and amplification conditions were: 94.degree. C., 4 min; denaturation: 94.degree. C., 40 s; annealing: 60.degree. C., 40 s; 68.degree. C. for 140 s for 30 cycles and then total extension 68.degree. C. for 10 min.

[0226] The amplified sequence was digested with the restriction endonuclease NheI/BamHI and double-digested according to the reaction conditions recommended by the enzyme supplier (New England Biolabs, NEB). The expression vector pH (see 201210094008.X Example 3 and FIG. 2) was also similarly digested with the restriction enzyme NheI/BamHI. The double-digested Y022 scFv fragment and pH vector fragment were then ligated with T4 DNA ligase following the reaction conditions recommended by the enzyme supplier (NEB). The nucleotide sequence encoding for Y022 single chain antibody polypeptide thus obtained was cloned into a vector, and was transcribed together with the nucleotide sequence already contained in the vector encoding CD3 single-chain antibody polypeptide into an mRNA, which finally translated into Y022/CD3 single-chain bifunctional antibody polypeptide. The new plasmid was named as pH-Y022/CD3, and the detailed structure was shown in FIG. 6.

Example 8. Expression and Purification of Single Chain Bifunctional Antibody Y022/CD3, pH-806/CD3 and pH-C225/CD3

[0227] The expression vectors pH-Y022/CD3, pH-806/CD3 and pH-C225/CD3 (see 201210094008.X) were transfected into Chinese hamster ovary (CHO) cells according to the procedure of FreeStyle MAX Reagent Transfection Reagent (from Invitrogen). And then the stable clones were screened according to OptiCHO.TM. protein expression kit (from Invitrogen). Stable clones of CHO cells transfected with each of the above expression vectors were cultured in shake flasks at 37.degree. C. for 7 days at 130 rpm, and the used medium was CD OptiCHO (from Gibco). The culture supernatant was obtained by centrifugation and then stored at -20.degree. C.

[0228] Protein purification was performed using a histidine affinity column (His Trap HP column, available from GE Healthcare) according to the manufacturer's method steps. Specifically, the column was equilibrated with buffer A (20 mM sodium phosphate pH 7.4, 0.4 M NaCl) and then the cell culture supernatant (500 mL of the supernatant) was added to the column (1 mL) with a flow rate of 3 ml/min after dialysis against PBS. The column was then washed with 5 volumes of buffer A and 10 volumes of buffer A containing 50 mM imidazole to remove the impurity protein. The bound protein of interest was eluted with the same buffer A supplemented with 250 mM imidazole. All purification steps were performed at 4.degree. C.

[0229] Purified single-chain bifunctional antibodies were detected by reducing SDS-PAGE. As shown in FIG. 7, the molecular weights of these antibody molecules were all around 60 kD, which corresponded to the molecular weight of the single-chain bifunctional antibody calculated from the amino acid sequences.

Example 9. Analysis of Antigen Binding Specificity of Single Chain Bifunctional Antibody Such as Y022/CD3

[0230] The binding capacities of single chain bifunctional antibody Y022/CD3 to EGFR were analyzed by fluorescence activated cell sorter (FACS) (BD, FACS Calibur).

[0231] Specific methods are as follows:

[0232] 1. Tumor cells in logarithmic growth phase as listed in Table 2 were inoculated into a 6 cm dish with inoculation cell density of about 90%, and incubated at 37.degree. C. incubator overnight.

[0233] 2. Cells were digested with 10 mM EDTA and cells were collected by centrifugation at 200 g for 5 min. Cells were resuspended in 1% phosphate buffered saline (NBS PBS) containing calf serum at a concentration of 1.times.10.sup.6 to 1.times.10.sup.7/mL, and added in a flow tube in an amount of 100 .mu.l/tube.

[0234] 3. Cells were centrifuged at 200 g.times.5 min, and the supernatant was discarded.

[0235] 4. Antibody Y022/CD3 to be tested was added. And irrelevant antibody NGR/CD3 was used as a negative control. The final concentration of antibody was 5 .mu.g/ml, 100 .mu.l was added to each tube and placed in an ice bath for 45 minutes.

[0236] 5. 2 ml of 1% NBS PBS was added to each tube and centrifuged at 200 g.times.5 min for two times.

[0237] 6. Supernatant was discarded and mouse anti-his tag antibody (from Shanghai Genomics Technology Co., Ltd.) at a dilution of 1:50 was added, and 100 ul was added to each tube and placed in an ice bath for 45 minutes.

[0238] 7. 2 ml of 1% NBS PBS was added to each tube and centrifuged at 200 g.times.5 min for two times.

[0239] 8. Supernatant was discarded and FITC fluorescent-labeled goat anti-mouse antibody (from Shanghai Kangcheng Bio-engineering Company) at a dilution of 1:50 was added, and 100 ul was added to each tube and placed in an ice bath for 45 minutes.

[0240] 9. 2 ml of 1% NBS PBS was added to each tube and centrifuged at 200 g.times.5 min for two times.

[0241] 10. Supernatant was discarded, resuspended in 300 ul of 1% NBS PBS and detected by flow cytometry.

[0242] 11. Data was analyzed by using flow cytom6etry data analysis software WinMDI 2.9.

[0243] Results are shown in FIG. 8, the bifunctional antibody Y022/CD3 of the present invention can bind to U87-EGFR, U87-EGFRvIII and A431 cells, however, hardly bind to U87 and human keratinous epithelial cells. These results indicate that Y022/CD3 can specifically bind to tumor cells expressing mutant human EGFR and overexpressing EGFR, but not to tissues that normally express EGFR.

[0244] In addition, Y022/CD3 can also bind to human peripheral blood mononuclear cells (PBMCs) or Jurkat cells (human peripheral blood leukemia T cells, CD3 positive) as shown in the figure, suggesting that the bifunctional antibody of the present invention can specifically bind to CD3 antigen of T cell surface.

[0245] The expression plasmids were constructed according to the methods mentioned in Examples 7 and 8, respectively (Y022 in Examples 7 and 8 were replaced with other mutated forms of antibodies), and M14/CD3, M15/CD3, M25/CD3, M26/CD3, S7/CD3, S8/CD3, S17/CD3, S22/CD3, S23/CD3, S29/CD3 were expressed and purified. According to the method of this example, the binding abilities of these antibodies to U87-EGFRvIII overexpressing EGFRvIII and to CAL27 cells endogenously overexpressing EGFR were determined respectively. The above antibodies were able to bind both of these cells, and their mean fluorescence intensity (MFI) values are shown in Table 13.

TABLE-US-00027 TABLE 13 Antibody U87MG-EGFRvIII CAL 27 PBS 1 3.11 M14 36.52 28.39 M15 37.86 29.43 M25 36.52 24.14 M26 41.42 24.58 S7 42.17 27.88 S8 38.54 29.96 S17 31.62 25.03 S22 31.34 24.58 S23 32.2 29.69 S29 34.6 25.71

Example 10. Biological Activity Analysis of Single-Chain Bifunctional Antibody, Such as Y022/CD3--Cytotoxicity to Various Tumor Cells

[0246] Peripheral blood mononuclear cells (PBMCs) were isolated from healthy human-donated blood following standard procedures using Ficoll (from Biochrom) density gradient centrifugation. After centrifugation, the cells were washed with phosphate buffered saline (PBS) at a concentration of 0.1 M and then resuspended in RPMI 1640 complete medium (Gibco) and the cell concentration was adjusted to 5.times.10.sup.5/mL. PBMCs served as effector cells in cytotoxicity experiments. Different tumor cells act as target cells. The target cell concentration was adjusted to 5.times.10.sup.4/mL with RPMI 1640 complete medium. The same volume of target cells and effector cells were mixed such that the effector cell: target cell (E:T) ratio was 10:1.

[0247] The mixed cell suspension was added to a 96-well plate in a volume of 75 .mu.L/well. Then 25 .mu.L of the following reagent serially diluted ten times from 1000 ng/mL to 0.1 ng/mL was added to each well:

[0248] (1) Y022/CD3 Single chain bifunctional antibody (BiTe);

[0249] (2) RPMI 1640 complete medium (background);

[0250] (3) NGR/CD3 Single chain bifunctional antibody (negative control, NGR was a neovascular targeting peptide that has no cross-binding site with EGFR, and prepared according to a conventional method)

[0251] After incubation for 40 hours in a 37.degree. C., 5% CO.sub.2 incubator, the cytotoxicity of the antibody was tested using CytoTox 96R Non-Radioactive Cytotoxicity Assay kit (from Promega) according to the manufacturer's instructions.

[0252] The CytoTox 96@ Non-Radioactive Cytotoxicity Assay is a colorimetric based assay that can replace 51Cr release assay. CytoTox 96@ Assay measures lactate dehydrogenase (LDH) quantitatively. LDH is a stable cytosolic enzyme that is released upon lysis of cells and is released in the same way as radioactive 51Cr is released. The supernatant with released LDH medium can be detected by a 30-minute coupled enzyme reaction in which LDH converts a tetrazolium salt (INT) to a red formazan. The amount of red product produced is proportional to the number of lysed cells.

[0253] Five EGFR-associated tumor cells as listed in Table 3 below were used to analyze T cell tumors killing ability mediated by the bifunctional antibody Y022/CD3 of the present invention and the NGR/CD3 single-chain bifunctional antibody that is not associated with EGFR as a control, respectively.

[0254] Tumor cell killing rate (i.e., cytotoxicity %) was calculated based on the following formula provided in the manual of CytoTox 96@ non-radioactive cytotoxicity assay G1780:

cytotoxicity %=[(experiment-effector cell spontaneously-target cell spontaneously)/(target cell maxium-target cell spontaneously)].times.100

[0255] wherein:

[0256] "Experiment" refers to LDH release produced in the experimental wells, in which the antibody/effector/target cells were added,

[0257] "effector cell spontaneously" refers to LDH release produced by effector cells spontaneously,

[0258] "target cell spontaneously" refers to LDH release produced by cells that are not treated by other factors,

[0259] "target cell maxium" refers to LDH release resulting from complete lysis of target cells after treatment with 0.8% Triton X-100,

[0260] "target cell maxium-target cell spontaneously" refers to LDH release resulting from complete lysis of cells after external treatment.

TABLE-US-00028 TABLE 3 1000 ng/ml 1000 ng/ml Tumor Cytotoxicity Cytotoxicity cell line % of Y022/CD3 % of NGR/CD3 U87 2.0 3.4 U87-EGFR 32.1 3.7 U87-EGFRvIII 66.2 6.3 A431 48.7 5.2 K2 5.1 4.5

[0261] The results of Table 3 above show that all of the tumor cells expressing mutant EGFR and/or overexpressing EGFR, such as U87-EGFRvIII, U87-EGFR and A431, will be specifically killed by T-cells directed by the bifunctional antibody Y022/CD3.

[0262] Specifically, in the above tumor cell group treated with Y022/CD3, the minimum specific cytotoxicity was 32.1% and the maximum was 66.2%. While the cytotoxicity of Y022/CD3 to cells expressing low levels of EGFR, U87, and human primary keratinocytes was very low at 3.4% and 4.5%, respectively, which were significantly lower than those to the above-mentioned mutant cells expressing EGFR and/or overexpressing EGFR.

[0263] More specifically, cytotoxicity % of Y022/CD3 and control antibody NGR/CD3 at various concentrations to each tumor is shown in Tables 4-8 below.

TABLE-US-00029 TABLE 4 U87 ng/ml NGR/CD3 Y022/CD3 1000 3.4 .+-. 1.2 2.0 .+-. 1.3 100 4.8 .+-. 1.1 1.6 .+-. 3.2 10 4.3 .+-. 1.5 2.5 .+-. 2.3 1 5.2 .+-. 2.1 0.5 .+-. 1.2 0.1 5.4 .+-. 2.2 0.2 .+-. 1.7

TABLE-US-00030 TABLE 5 U87-EGFR ng/ml NGR/CD3 Y022/CD3 1000 3.7 .+-. 2.6 32.1 .+-. 3.1 100 4.9 .+-. 1.7 21.7 .+-. 4.4 10 4.3 .+-. 2.7 12.6 .+-. 3.2 1 3.3 .+-. 1.9 6.3 .+-. 2.6 0.1 0.7 .+-. 1.2 5.1 .+-. 2.0

TABLE-US-00031 TABLE 6 U87-EGFRvIII ng/ml NGR/CD3 Y022/CD3 1000 6.3 .+-. 1.3 66.2 .+-. 5.8 100 7.4 .+-. 2.4 52.5 .+-. 4.5 10 6.5 .+-. 0.8 33.6 .+-. 3.2 1 4.7 .+-. 2.1 25.3 .+-. 2.9 0.1 2.6 .+-. 1.4 6.7 .+-. 2.3

TABLE-US-00032 TABLE 7 A431 ng/ml NGR/CD3 Y022/CD3 1000 5.2 .+-. 2.9 48.7 .+-. 4.3 100 5.6 .+-. 2.7 35.3 .+-. 5.1 10 3.7 .+-. 2.4 22.7 .+-. 3.3 1 1.3 .+-. 0.6 10.8 .+-. 4.4 0.1 1.5 .+-. 1.1 4.3 .+-. 2.1

TABLE-US-00033 TABLE 8 K2 ng/ml NGR/CD3 Y022/CD3 1000 4.5 .+-. 2.2 5.1 .+-. 1.1 100 4.1 .+-. 2.8 3.2 .+-. 1.2 10 3.5 .+-. 2.4 1.7 .+-. 1.0 1 2.1 .+-. 1.8 2.7 .+-. 1.2 0.1 4.3 .+-. 2.9 2.1 .+-. 1.3

[0264] In addition, in vitro toxicity analysis was performed by the same method on the following expressed and purified BiTe: M14/CD3, M15/CD3, M25/CD3, M26/CD3, S7/CD3, S8/CD3, S17/CD3, S22/S29/CD3, and the results are shown in FIG. 9.

[0265] As can be seen in FIG. 9, tumor cells expressing mutated EGFR and/or overexpressing EGFR, such as U87-EGFRvIII, U87-EGFR, and CAL27, can be killed by T cells directed by the bifunctional specific antibodies M14/CD3, M15/CD3, M25/M26/CD3, S7/CD3, S8/CD3, S17/CD3, S22/CD3, S23/CD3, S29/CD3 to different degrees. While for U87, a cell that expresses low levels of EGFR, there is little killing effect.

Example 11. Construction of Lentiviral Plasmid Expressing the Chimeric Antigen Receptor Protein Encoded by the Nucleic Acid of the Present Invention and Virus Packaging

[0266] Construction of the chimeric antigen receptor, and the connection order of chimeric antigen receptor exemplified in the present invention, is shown in Table 9 and FIG. 10.

TABLE-US-00034 TABLE 9 Extracellular binding region - transmembrane region - intracellular signal region 1 - chimeric antigen intracellular signal region 2 and receptor the like Description Y022-.delta.Z scFv(EGFR)-CD8-CD3.delta.zeta Negative control Y022-Z scFv(EGFR)-CD8-CD3 zeta 1.sup.st generation Y022-BBZ scFv(EGFR)-CD8-CD137-CD3 zeta 2.sup.nd generation Y022-28Z scFv(EGFR)-CD28a-CD28b-CD3 zeta 2.sup.nd generation Y022-28BBZ scFv(EGFR)-CD28a-CD28b-CD137- 3.sup.rd CD3 zeta generation Note: CD28a represents the transmembrane region of CD28 molecule and CD28b represents the intracellular signaling region of CD28 molecule.

[0267] 1. Amplification of Nucleic Acid Fragments

[0268] (1) Amplification of scFv Sequences

[0269] Y022 scFv was obtained by PCR using pCantab 5E-Y022 plasmid as a template with a forward primer (SEQ ID NO: 24, comprising part of the sequence of CD8 signal peptide) and a reverse primer (SEQ ID NO: 25, comprising part of the sequence of CD8 hinge).

TABLE-US-00035 SEQ ID NO: 24 (TGCTCCACGCCGCCAGGCCGGATATTCAGATGACCCAG) SEQ ID NO: 25 (CGCGGCGCTGGCGTCGTGGTGCTGCTCACGGTCAC)

[0270] (2) Nucleic Acid Sequences of Other Parts of the Chimeric Antigen Receptor

[0271] The nucleic acid sequences of other parts of the anti-EGFRvIII chimeric antigen receptor protein except for Y022 scFv were respectively obtained by PCR using the sequences SEQ ID NO: 26, 27, 28, 29 and 30 disclosed in Patent Application No. 201310164725.X as templates. Specifically, the eGFP-F2A-CD8sp sequence was obtained by PCR amplification using SEQ ID NO: 27 plasmid contained in Patent Application No. 201310164725.X as a template and primer pairs (SEQ ID NOs: 26 and 27). CD8-CD36 zeta (6Z) was obtained by PCR amplification using SEQ ID NO: 26 plasmid in the patent application CN201310164725.X as a template and primer pairs (SEQ ID NOs: 28 and 29). The CD8-CD3 zeta (Z), CD8-CD137-CD3 zeta (BBZ), CD28.alpha.-CD28b-CD3 zeta (28Z) and CD28a-CD28b-CD137-CD3 zeta (28BBZ) were obtained by PCR amplification respectively using SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29 and SEQ ID NO: 30 in the patent application CN201310164725.X as templates and primer pairs (SEQ ID NO: 28, 30).

TABLE-US-00036 SEQ ID NO: 26 (TGCAGTAGTCGCCGTGAAC) SEQ ID NO: 27 (CGGCCTGGCGGCGTGGAGCA) SEQ ID NO: 28 (ACCACGACGCCAGCGCCGCGACCAC) SEQ ID NO: 29 (GAGGTCGACCTACGCGGGGGCGTCTGCGCTCCTGCTGAACTTCACTCT) SEQ ID NO: 30 (GAGGTCGACCTAGCGAGGGGGCAGGGCCTGCATGTGAAG)

[0272] 2. Splicing of Nucleic Acid Fragments

[0273] eGFP-F2A-CD8sp nucleic acid fragment obtained as described above and equimolar Y022 scFv nucleic acid fragment and equimolar CD8-CD36 zeta (6Z) or CD8-CD3 zeta (Z) or CD8-CD137-CD3 zeta (BBZ) or CD28a-CD28b-CD3 zeta (28Z) or CD28a-CD28b-CD137-CD3 zeta (28BBZ) nucleic acid fragments were subjected to three-segment splicing and PCR as shown in FIG. 9 under the following conditions: Pre-denaturation: 94.degree. C. for 4 min; denaturation: 94.degree. C. for 40 s; annealing: 60.degree. C. for 40 s; extension: 68.degree. C. for 140 s for 5 cycles and then total extension 68.degree. C. for 10 min. DNA polymerase and forward primer (SEQ ID NO: 24) and reverse primer (reverse primer corresponding to CD8-CD36 zeta was SEQ ID NO: 29, and other is SEQ ID NO: 30) were supplemented, and then PCR was performed for 30 cycles with the amplification conditions: Pre-denaturation: 94.degree. C. for 4 min; denaturation: 94.degree. C. for 40 s; annealing: 60.degree. C. for 40 s; extension: 68.degree. C. for 140 s for 30 cycles and then total extension 68.degree. C. for 10 min. The amplified fragments were referred to as (Table 2):

[0274] eGFP-F2A-Y022 scFv-6Z (SEQ ID NO: 31),

[0275] eGFP-F2A-Y022 scFv-Z (SEQ ID NO: 32),

[0276] eGFP-F2A-Y022 scFv-BBZ (SEQ ID NO: 33),

[0277] eGFP-F2A-Y022 scFv-28Z (SEQ ID NO: 34),

[0278] eGFP-F2A-Y022 scFv-28BBZ (SEQ ID NO: 35).

[0279] 3. Construction of Lentiviral Plasmid Vector

[0280] By way of example, the vector system used for the lentiviral plasmid vectors constructed below belongs to self-inactivating lentiviral vector system of the third generation, which has three plasmids, namely, packaging plasmid psPAX2 encoding protein Gag/Pol, encoding Rev protein (from addgene); envelope plasmid PMD2.G encoding VSV-G protein (from addgene); and the recombinant expression vector encoding the gene of interest CAR based on empty vector pWPT-eGFP (from addgene).

[0281] In the empty vector pWPT-eGFP, the expression of enhanced green fluorescent protein (eGFP) is regulated by elongation factor-1.alpha. (EF-1.alpha.) promoter. After inserting the constructs constructed as described in this example into an empty vector, a recombinant expression vector encoding CAR of the target gene was formed, wherein co-expression of eGFP and target gene CAR is achieved ribosomal skipping sequence from food and mouth disease virus (FMDV, F2A). F2A is a core sequence of 2A (or "self-cleaving polypeptide 2A") from foot-and-mouth disease virus possessing the "self-shearing" function of 2A that enables upstream and downstream gene co-expression. 2A provides an effective and viable strategy for constructing polycistronic vectors for gene therapy due to its high shearing efficiency, high upstream and downstream gene expression balance and short sequence itself. Especially in immunotherapy based on chimeric antigen receptor gene modified T lymphocytes, this sequence is frequently used to achieve the co-expression of the target gene with GFP or eGFP. The expression of CAR can be indirectly detected by detecting GFP or eGFP.

[0282] In this example, a lentiviral expression vector co-expressing eGFP and specific CAR linked by F2A was constructed, collectively referred to as pWPT-eGFP-F2A-CAR. The target gene eGFP-F2A-CAR (see 2 in Example 7, the component after F2A is abbreviated as CAR) obtained in the above step 2 was double-digested by MluI and SalI restriction enzymes and ligated into the same double digested pWPT vector to construct a lentiviral vector expressing each chimeric antigen receptor. The constructed vector was identified by MluI and SalI digestion and sequenced correctly, which was ready for lentivirus packaging. As mentioned above, eGFP-F2A-CAR was transcribed into one mRNA but eventually translated into two peptide chains of eGFP and anti-EGFRvIII chimeric antigen receptors, where the anti-EGFRvIII chimeric antigen receptor will be localized under the guidance of CD8a signal peptide on the cell membrane.

[0283] The vectors containing the desired CARs are as follows (the components following F2A may be abbreviated as CAR):

[0284] pWPT-eGFP-F2A-Y022 scFv-6Z;

[0285] pWPT-eGFP-F2A-Y022 scFv-Z;

[0286] pWPT-eGFP-F2A-Y022 scFv-BBZ;

[0287] pWPT-eGFP-F2A-Y022 scFv-28Z;

[0288] pWPT-eGFP-F2A-Y022 scFv-28BBZ.

[0289] 5 eGFP-F2A-CAR polypeptide sequences were respectively obtained through the above construction, which are named as:

[0290] eGFP-F2A-Y022 scFv-6Z (SEQ ID NO: 36);

[0291] eGFP-F2A-Y022 scFv-Z (SEQ ID NO: 37);

[0292] eGFP-F2A-Y022 scFv-BBZ (SEQ ID NO: 38);

[0293] eGFP-F2A-Y022 scFv-28Z (SEQ ID NO: 39);

[0294] eGFP-F2A-Y022 scFv-28BBZ (SEQ ID NO: 40).

[0295] 4. Plasmid-Transfected 293T Packaging Lentivirus

[0296] HEK-293T cells (ATCC: CRL-11268) cultured at passage 6 to passage 10 were seeded at a density of 6.times.10.sup.6 in 10 cm dishes and cultured overnight at 37.degree. C. in 5% CO.sub.2 for transfection. The medium was DMEM (available from PAA) containing 10% fetal bovine serum (purchased from PAA).

[0297] Transfection steps are as follows:

[0298] 4.1 Preparation of liquid A: dissolving 10 .mu.g of mock control or 10 .mu.g of each of the desired gene plasmids pWPT-eGFP-F2A-CAR with 7.5 .mu.g of packaging plasmid PAX2: and 3 .mu.g of envelope plasmid pMD2.G into 800 .mu.L of serum-free DMEM medium and mixing well.

[0299] 4.2 Preparation of liquid B: dissolving 60 .mu.g PEI (polyethylenimine, purchased from Polysciences) in 800 .mu.L serum-free DMEM medium, mixing gently and incubating at room temperature for 5 min.

[0300] 4.3 Formation of transfection complex: adding liquid A into liquid B and gently mixing, vortexing or gently mixing immediately after addition, incubating at room temperature for 20 min.

[0301] 4.4 Adding 1.6 ml of the transfection complex into HEK-293T cells dropwise, and after 4-5 h, changing to DMEM with 2% FBS for transfected 293T cells.

[0302] In the next day after transfection, the transfection efficiency (that is, the proportion of green fluorescent cells) was observed: .about. 80% of the positive transfection efficiency represents the successful transfection experiments. After 72 h of transfection, the virus was collected by filtration using a 0.45 .mu.m filter (available from Millipore Corporation) and centrifuged at 28,000 rpm using a Beckman Optima L-100XP ultracentrifuge for 2 hours at 4.degree. C. The supernatant was discarded and the resulting pellet was centrifuged at 1/10.about. 1/50 stock solution of AIM-V (purchased from Invitrogen) and resuspend at 100 .mu.L/tube in -80.degree. C. for virus titration or infection of T lymphocytes.

[0303] 5. Determination of Lentiviral Titers Packaged with Mock or eGFP-F2A-CAR

[0304] On the first day, 293T cells were inoculated at 1.times.10.sup.5/mL in 96-well culture plates, 100 .mu.L/well, and cultured at 37.degree. C., 5% CO.sub.2, and the culture medium was DMEM containing 10% fetal bovine serum. On the next day, 50 .mu.L/well of culture supernatant was discarded, 50 .mu.L/well of fresh medium was supplemented, and polybrene at final concentration of 6 .mu.g/mL was contained. The culture was incubated for 30 min at 37.degree. C. with 5% CO.sub.2. 10 .mu.L/well of virus stock or 1 .mu.L/well of virus concentrate was added (3-fold diluted, 6 gradients, two replicate wells) and incubated at 37.degree. C. in 5% CO.sub.2. 48 h after infection, eGFP was detected by flow cytometry, cells with 5 to 20% of the positive rate are appropriate to calculate the titer (U/mL)=positive rate.times.dilution times.times.100.times.10.sup.4. The titers of virus comprising the above-mentioned mock empty vector control and each eGFP-F2A-CAR packaged in the PEI transfection method were both about 0.5 to 1.times.10.sup.7U/mL, and the detected virus titer after concentration was about 0.5.about. 1.times.10.sup.8U/mL.

Example 12. T Cells Infected by Recombinant Lentivirus

[0305] Human peripheral blood mononuclear cells were obtained from healthy human peripheral blood by density gradient centrifugation (supplied by Shanghai Blood Center) and added in AIM-V lymphocyte medium (purchased from Invitrogen) at a density of about 2.times.10.sup.6/mL and added. The magnetic beads coated with anti-CD3 and CD28 antibodies (Invitrogen) were added in a 1:1 ratio of cells to magnetic beads, and recombinant human IL-2 (purchased from Shanghai Huaxin Biotechnology Co., Ltd.) at a final concentration of 300 U/mL was added for stimulation and culture for 48 h. And then T cells were infected with the above recombinant lentivirus (MOI.apprxeq.15). Infected T cells were detected by flow cytometry on day 8 of culture for the expression of different chimeric antigen receptors. Since eGFP was co-expressed with CAR, the detected eGFP-positive cells were positive cells expressing chimeric antigen receptors. Using uninfected T lymphocytes as a negative control, the positive rates of virus-infected T cells expressing different chimeric antigen receptors are shown in Table 10. The positive rate results show that a certain positive rate of CAR T cells can be obtained by lentivirus infection.

TABLE-US-00037 TABLE 10 T cells transfected eGFP positive rate by following CARs of CAR T cells Y022-.delta.Z(Mock) 66% Y022-Z 58% Y022-BBZ 53% Y022-28Z 54% Y022-28BBZ 52%

[0306] T cells were infected with viruses that had different chimeric antigen receptors packaged, respectively, and then subcultured at a cell density of 5.times.10.sup.5/ml quaque die alterna, counted, and supplemented with IL-2 (final concentration of 300 U/ml). On the 11th day of culture, about 100.about.1000 times of amplification was obtained, indicating that the T cells expressing different chimeric antigen receptors can be expanded in a certain amount in vitro, which ensures subsequent in vitro toxicity tests and in vivo experiments.

Example 13. In Vitro Antitumor Activity of CAR-Y022

[0307] In vitro toxicity experiments used the following materials:

[0308] The target cells were U87, U87-EGFR, U87-EGFRvIII, A431, CAL 27, MDA-MB-468, RWPE-1 cells and human primary keratinocyte K2 as shown in Table 5, respectively. Effector cells were T lymphocytes (CAR T cells) cultured for 12 days in vitro, which were detected chimeric antigen receptor positive by FACS.

[0309] Effective target ratios were 3:1, 1:1 and 1:3, respectively. The number of target cells was 10000/well, and each group had 5 replicate wells. Detection time was 18 h.

[0310] Each experimental group and each control group are listed as follows:

[0311] Each experimental group: each target cell+CAR T lymphocytes expressing different chimeric antigen receptors;

[0312] Control group 1: target cells with maxium LDH release;

[0313] Control group 2: target cells with spontaneous LDH release;

[0314] Control group 3: effector cells with spontaneous LDH release.

[0315] Detection method: CytoTox 96.RTM. Non-Radioactive Cytotoxicity Assay (Promega) is used, which is a colorimetric based assay that can replace 51Cr release assay. CytoTox 96.RTM. Assay measures lactate dehydrogenase (LDH) quantitatively. LDH is a stable cytosolic enzyme that is released upon lysis of cells and is released in the same way as radioactive 51Cr is released. The supernatant with released LDH medium can be detected by a 30-minute coupled enzyme reaction in which LDH converts a tetrazolium salt (INT) to a red formazan. The amount of red product produced is proportional to the number of lysed cells. Details can be found in instructions of CytoTox 96 non-radioactive cytotoxicity detection kit.

[0316] Cytotoxicity is calculated as:

Cytotoxicity %=[(experiment group-control group 2-control group 3)/(control group 1-control group 2)].times.100

[0317] Specifically, as shown in Table 11 and Table 12, compared with 806-CAR T, Y022-28Z CAR T and Y022-28BBZ CAR T expressing chimeric antigen receptors of the present invention at different effector target ratios showed a significantly killing effects on cells highly expressing EGFR and EGFRvIII and a effector target ratio gradient dependency, that is, the higher the effector target ratio, the stronger the cytotoxic effects. Effector-target-ratio-dependency data further demonstrate the specific cytotoxic effects of CAR T cells expressing chimeric antigen receptors of the invention on cells that highly express EGFR and its variants.

[0318] It is noteworthy that Y022-CAR T has almost no killing effect on RWPE-1 cells that normally express EGFR and human primary keratinocytes K2. At the effector target ratio of 3:1, Cytotoxicity of the chimeric antigen receptor Y022-28BBZ CAR T-lymphocyte to RWPE-1 cells and human primary keratinocytes K2 was 12% and 2%, respectively. Cytotoxicity of Y022-28Z CAR T lymphocytes to RWPE-1 cells and human primary keratinocytes K2 was 8% and 3%. In contrast, 806-CAR T had different degrees of cytotoxicity on both of these cells. The cytotoxicity of 806-28BBZ CAR T lymphocytes to RWPE-1 cells and human primary keratinocytes K2 were 25% and 22%, respectively, and the cytotoxicity of 806-28Z CAR T lymphocytes to RWPE-1 cells and human primary keratinocytes K2 was 15% and 13%, respectively.

[0319] In addition, CAR T, as a negative control, transfected with a virus containing the mock plasmid (carrying scFv-Y022-6Z) showed very low cytotoxic effects on the above cell lines.

[0320] The above results indicate that the chimeric antigen receptor Y022-CAR T, which is constructed from a single chain antibody against EGFR and its variants, can selectively kill tumor cells that highly express EGFR and its variant (EGFRvIII), while hardly kill cells normally expressing EGFR. In addition, from the cytotoxicity data, CAR T of the third generation (Y022-28BBZ) was more cytotoxic to target cells than the second generation (Y022-28Z) CART.

TABLE-US-00038 TABLE 11 Y022-28BBZ Y022-28Z mock Different effector Different effector Different effector target ratio target ratio target ratio Cytotoxicity % 3:1 1:1 1:3 3:1 1:1 1:3 3:1 1:1 1:3 U87 2 4 5 4 3 1 -4 -3 2 U87-EGFR 35 17 6 25 16 7 -1 5 1 U87-EGFRvIII 73 42 19 65 31 9 3 0.3 1 A431 67 37 12 45 24 5 9 7 4 CAL27 70 49 15 50 23 8 7 5 5 MDA-MB-468 57 45 14 41 23 1 6 8 7 RWPE-1 12 7 3 8 6 4 3 2 0.2 K2 11 2 0.3 3 0.6 2 -3 -1 2

TABLE-US-00039 TABLE 12 806-28BBZ 806-28Z mock Different effector Different effector Different effector target ratio target ratio target ratio Cytotoxicity % 3:1 1:1 1:3 3:1 1:1 1:3 3:1 1:1 1:3 U87 3 4 2 5 0.6 2 1 3 -3 U87-EGFR 68 49 18 55 36 12 3 7 4 U87-EGFRvIII 83 51 23 75 42 15 6 5 2 A431 75 48 16 56 35 12 7 7 5 CAL27 81 57 25 65 33 18 3 6 2 MDA-MB-468 62 49 32 51 32 16 6 9 7 RWPE-1 29 17 10 15 10 7 -2 -3 2 K2 27 15 2 13 9 4 0.2 1 3

[0321] All references mentioned in the present application are incorporated herein by reference, as if each reference was individually incorporated by reference. In addition, it should be understood that after reading the above teachings of the present invention, those skilled in the art can make various modifications or changes to the present invention, and such equivalent forms also fall within the scope of the appended claims of the present application.

Sequence CWU 1

1

77116PRTHomo Sapiens 1Cys Gly Ala Asp Ser Tyr Glu Met Glu Glu Asp Gly Val Arg Lys Cys1 5 10 152717DNAArtificial sequenceencoding sequence of single chain antibody 7B3 2gatattcaga tgacccagag cccgagcagc ctgagcgcga gcgtgggcga ccgtgtgacc 60attacctgcc atgcgagcca ggatattaac agcaacattg gctggctgca gcagaaaccg 120ggcaaagcgt ttaaaggcct gatttatcat ggcaaaaacc tggaagatgg cgtgccgagc 180cgttttagcg gcagcggcag cggcaccgat tttaccctga ccattagcag cctgcagccg 240gaagattttg cgacctatta ttgcgttcag tacgcccagt tcccatatac atttggccag 300ggcaccaaag tggaaattaa acgtggtgga ggcggttcag gcggaggtgg ctctggcggt 360ggcggatcgg atgtgcagct ggtggaaagc ggcggcggcc tggtgcagcc gggcggcagc 420ctgcgtctga gctgcgcggt gagcggctat agcattacca gcgattatgc gtggaactgg 480attcgtcagg cgccgggcaa aggcctggaa tggctgggct atattagcta tcgtggccgc 540accagctata acccgagcct gaaaagccgt attagcatta cccgtgataa cagcaaaaac 600acctttttcc tgcagctgaa cagcctgcgt gcggaagata ccgcggtgta ttattgcgcg 660cgcctgggac gcggcttccg ctactggggc cagggcaccc tggtgaccgt gagcagc 7173239PRTArtificial sequenceamino acid sequence of single chain antibody 7B3 3Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys His Ala Ser Gln Asp Ile Asn Ser Asn 20 25 30Ile Gly Trp Leu Gln Gln Lys Pro Gly Lys Ala Phe Lys Gly Leu Ile 35 40 45Tyr His Gly Lys Asn Leu Glu Asp Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Val Gln Tyr Ala Gln Phe Pro Tyr 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Gly Gly Gly Gly 100 105 110Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu Val 115 120 125Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser 130 135 140Cys Ala Val Ser Gly Tyr Ser Ile Thr Ser Asp Tyr Ala Trp Asn Trp145 150 155 160Ile Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu Gly Tyr Ile Ser 165 170 175Tyr Arg Gly Arg Thr Ser Tyr Asn Pro Ser Leu Lys Ser Arg Ile Ser 180 185 190Ile Thr Arg Asp Asn Ser Lys Asn Thr Phe Phe Leu Gln Leu Asn Ser 195 200 205Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Leu Gly Arg 210 215 220Gly Phe Arg Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser225 230 235442DNAArtificial sequencePrimer 4ataacaggcc cagccggcca tggatattca gatgacccag ag 42569DNAArtificial sequencePrimer(26)..(27)n is a, c, g, or t(32)..(33)n is a, c, g, or t(35)..(36)n is a, c, g, or t(38)..(39)n is a, c, g, or t(41)..(42)n is a, c, g, or t(47)..(48)n is a, c, g, or t 5cactttggtg ccctggccaa atgtmnntgg gnnmnnmnnm nnctgmnngc aataataggt 60cgcaaaatc 69622DNAArtificial sequencePrimer 6acatttggcc agggcaccaa ag 22729DNAArtificial sequencePrimer 7ataaatgcgg ccgcgctgct cacggtcac 29822DNAArtificial sequencePrimer 8tcgcaattcc tttagttgtt cc 22957DNAArtificial sequencePrimer(23)..(24)n is a, c, g, or t(26)..(27)n is a, c, g, or t(29)..(30)n is a, c, g, or t(32)..(33)n is a, c, g, or t(35)..(36)n is a, c, g, or t(38)..(39)n is a, c, g, or t 9cagggtgccc tggccccagt aannmnnmnn mnnmnnmnng cgcgcgcaat aatacac 571021DNAArtificial sequencePrimer 10tactggggcc agggcaccct g 211125DNAArtificial sequencePrimer 11ggaataggtg tatcaccgta ctcag 2512717DNAArtificial sequencenucelotide sequence of single chain antibody Y022 12gatattcaga tgacccagag cccgagcagc ctgagcgcga gcgtgggcga ccgtgtgacc 60attacctgcc atgcgagcca ggatattaac gtgaacattg gctggctgca gcagaaaccg 120ggcaaagcgt ttaaaggcct gatttatcat ggcaaaaacc tggaagatgg cgtgccgagc 180cgttttagcg gcagcggcag cggcaccgat tttaccctga ccattagcag cctgcagccg 240gaagattttg cgacctatta ttgcaatcag tatgaaaata tcccactgac atttggccag 300ggcaccaaag tggaaattaa acgtggtgga ggcggttcag gcggaggtgg ctctggcggt 360ggcggatcgg atgtgcagct ggtggaaagc ggcggcggcc tggtgcagcc gggcggcagc 420ctgcgtctga gctgcgcggt gagcggctat agcattacca gcgattatgc gtggaactgg 480attcgtcagg cgccgggcaa aggcctggaa tggctgggct atattagcta tcgtggccgc 540acccagtata acccgagcct gaaaagccgt attagcatta cccgtgataa cagcaaaaac 600acctttttcc tgcagctgaa cagcctgcgt gcggaagata ccgcggtgta ttattgcgcg 660cgcatgggta agaattggga ttactggggc cagggcaccc tggtgaccgt gagcagc 71713239PRTArtificial sequenceamino acid sequence of single chain antibody Y022 13Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys His Ala Ser Gln Asp Ile Asn Val Asn 20 25 30Ile Gly Trp Leu Gln Gln Lys Pro Gly Lys Ala Phe Lys Gly Leu Ile 35 40 45Tyr His Gly Lys Asn Leu Glu Asp Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Asn Gln Tyr Glu Asn Ile Pro Leu 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Gly Gly Gly Gly 100 105 110Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu Val 115 120 125Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser 130 135 140Cys Ala Val Ser Gly Tyr Ser Ile Thr Ser Asp Tyr Ala Trp Asn Trp145 150 155 160Ile Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu Gly Tyr Ile Ser 165 170 175Tyr Arg Gly Arg Thr Gln Tyr Asn Pro Ser Leu Lys Ser Arg Ile Ser 180 185 190Ile Thr Arg Asp Asn Ser Lys Asn Thr Phe Phe Leu Gln Leu Asn Ser 195 200 205Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Met Gly Lys 210 215 220Asn Trp Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser225 230 2351430DNAArtificial sequencePrimer 14acagtgctag cagatattca gatgacccag 301532DNAArtificial sequencePrimer 15aagaatgcgg ccgcgctgct cacggtcacc ag 321631DNAArtificial sequencePrimer 16acagtgctag cagacatcct gatgacccaa t 311732DNAArtificial sequencePrimer 17aagaatgcgg ccgctgcaga gacagtgacc ag 321830DNAArtificial sequencePrimer 18acagtgctag cagacatctt gctgactcag 301932DNAArtificial sequencePrimer 19aagaatgcgg ccgctgcaga gacagtgacc ag 322029DNAArtificial sequencePrimer 20gatattcaga tgacccagag cccgagcag 292134DNAArtificial sequencePrimer 21aataggatcc accacctccg ctgctcacgg tcac 342224DNAArtificial sequencePrimer 22ccattgacgc aaatgggcgg tagg 242329DNAArtificial sequencePrimer 23ctgctcgggc tctgggtcat ctgaatatc 292438DNAArtificial sequencePrimer 24tgctccacgc cgccaggccg gatattcaga tgacccag 382535DNAArtificial sequencePrimer 25cgcggcgctg gcgtcgtggt gctgctcacg gtcac 352619DNAArtificial sequencePrimer 26tgcagtagtc gccgtgaac 192720DNAArtificial sequencePrimer 27cggcctggcg gcgtggagca 202825DNAArtificial sequencePrimer 28accacgacgc cagcgccgcg accac 252948DNAArtificial sequencePrimer 29gaggtcgacc tacgcggggg cgtctgcgct cctgctgaac ttcactct 483039DNAArtificial sequencePrimer 30gaggtcgacc tagcgagggg gcagggcctg catgtgaag 39311928DNAArtificial sequenceeGFP-F2A-Y022 scFv-Z nucleotide sequence 31tgcagtagtc gccgtgaacg ttctttttcg caacgggttt gccgccagaa cacaggtgtc 60gtgacgcgga tccaggccta agcttacgcg tcctagcgct accggtcgcc accatggtga 120gcaagggcga ggagctgttc accggggtgg tgcccatcct ggtcgagctg gacggcgacg 180taaacggcca caagttcagc gtgtccggcg agggcgaggg cgatgccacc tacggcaagc 240tgaccctgaa gttcatctgc accaccggca agctgcccgt gccctggccc accctcgtga 300ccaccctgac ctacggcgtg cagtgcttca gccgctaccc cgaccacatg aagcagcacg 360acttcttcaa gtccgccatg cccgaaggct acgtccagga gcgcaccatc ttcttcaagg 420acgacggcaa ctacaagacc cgcgccgagg tgaagttcga gggcgacacc ctggtgaacc 480gcatcgagct gaagggcatc gacttcaagg aggacggcaa catcctgggg cacaagctgg 540agtacaacta caacagccac aacgtctata tcatggccga caagcagaag aacggcatca 600aggtgaactt caagatccgc cacaacatcg aggacggcag cgtgcagctc gccgaccact 660accagcagaa cacccccatc ggcgacggcc ccgtgctgct gcccgacaac cactacctga 720gcacccagtc cgccctgagc aaagacccca acgagaagcg cgatcacatg gtcctgctgg 780agttcgtgac cgccgccggg atcactctcg gcatggacga gctgtacaag tccggagtga 840aacagacttt gaattttgac cttctgaagt tggcaggaga cgttgagtcc aaccctgggc 900ccatggcctt accagtgacc gccttgctcc tgccgctggc cttgctgctc cacgccgcca 960ggccggatat tcagatgacc cagagcccga gcagcctgag cgcgagcgtg ggcgaccgtg 1020tgaccattac ctgccatgcg agccaggata ttaacgtgaa cattggctgg ctgcagcaga 1080aaccgggcaa agcgtttaaa ggcctgattt atcatggcaa aaacctggaa gatggcgtgc 1140cgagccgttt tagcggcagc ggcagcggca ccgattttac cctgaccatt agcagcctgc 1200agccggaaga ttttgcgacc tattattgca atcagtatga aaatatccca ctgacatttg 1260gccagggcac caaagtggaa attaaacgtg gtggaggcgg ttcaggcgga ggtggctctg 1320gcggtggcgg atcggatgtg cagctggtgg aaagcggcgg cggcctggtg cagccgggcg 1380gcagcctgcg tctgagctgc gcggtgagcg gctatagcat taccagcgat tatgcgtgga 1440actggattcg tcaggcgccg ggcaaaggcc tggaatggct gggctatatt agctatcgtg 1500gccgcaccca gtataacccg agcctgaaaa gccgtattag cattacccgt gataacagca 1560aaaacacctt tttcctgcag ctgaacagcc tgcgtgcgga agataccgcg gtgtattatt 1620gcgcgcgcat gggtaagaat tgggattact ggggccaggg caccctggtg accgtgagca 1680gcaccacgac gccagcgccg cgaccaccaa caccggcgcc caccatcgcg tcgcagcccc 1740tgtccctgcg cccagaggcg tgccggccag cggcgggggg cgcagtgcac acgagggggc 1800tggacttcgc ctgtgatatc tacatctggg cgcccttggc cgggacttgt ggggtccttc 1860tcctgtcact ggttatcacc agagtgaagt tcagcaggag cgcagacgcc cccgcgtagg 1920tcgacctc 1928322231DNAArtificial sequenceeGFP-F2A-Y022 scFv-Z nucleotide sequence 32tgcagtagtc gccgtgaacg ttctttttcg caacgggttt gccgccagaa cacaggtgtc 60gtgacgcgga tccaggccta agcttacgcg tcctagcgct accggtcgcc accatggtga 120gcaagggcga ggagctgttc accggggtgg tgcccatcct ggtcgagctg gacggcgacg 180taaacggcca caagttcagc gtgtccggcg agggcgaggg cgatgccacc tacggcaagc 240tgaccctgaa gttcatctgc accaccggca agctgcccgt gccctggccc accctcgtga 300ccaccctgac ctacggcgtg cagtgcttca gccgctaccc cgaccacatg aagcagcacg 360acttcttcaa gtccgccatg cccgaaggct acgtccagga gcgcaccatc ttcttcaagg 420acgacggcaa ctacaagacc cgcgccgagg tgaagttcga gggcgacacc ctggtgaacc 480gcatcgagct gaagggcatc gacttcaagg aggacggcaa catcctgggg cacaagctgg 540agtacaacta caacagccac aacgtctata tcatggccga caagcagaag aacggcatca 600aggtgaactt caagatccgc cacaacatcg aggacggcag cgtgcagctc gccgaccact 660accagcagaa cacccccatc ggcgacggcc ccgtgctgct gcccgacaac cactacctga 720gcacccagtc cgccctgagc aaagacccca acgagaagcg cgatcacatg gtcctgctgg 780agttcgtgac cgccgccggg atcactctcg gcatggacga gctgtacaag tccggagtga 840aacagacttt gaattttgac cttctgaagt tggcaggaga cgttgagtcc aaccctgggc 900ccatggcctt accagtgacc gccttgctcc tgccgctggc cttgctgctc cacgccgcca 960ggccggatat tcagatgacc cagagcccga gcagcctgag cgcgagcgtg ggcgaccgtg 1020tgaccattac ctgccatgcg agccaggata ttaacgtgaa cattggctgg ctgcagcaga 1080aaccgggcaa agcgtttaaa ggcctgattt atcatggcaa aaacctggaa gatggcgtgc 1140cgagccgttt tagcggcagc ggcagcggca ccgattttac cctgaccatt agcagcctgc 1200agccggaaga ttttgcgacc tattattgca atcagtatga aaatatccca ctgacatttg 1260gccagggcac caaagtggaa attaaacgtg gtggaggcgg ttcaggcgga ggtggctctg 1320gcggtggcgg atcggatgtg cagctggtgg aaagcggcgg cggcctggtg cagccgggcg 1380gcagcctgcg tctgagctgc gcggtgagcg gctatagcat taccagcgat tatgcgtgga 1440actggattcg tcaggcgccg ggcaaaggcc tggaatggct gggctatatt agctatcgtg 1500gccgcaccca gtataacccg agcctgaaaa gccgtattag cattacccgt gataacagca 1560aaaacacctt tttcctgcag ctgaacagcc tgcgtgcgga agataccgcg gtgtattatt 1620gcgcgcgcat gggtaagaat tgggattact ggggccaggg caccctggtg accgtgagca 1680gcaccacgac gccagcgccg cgaccaccaa caccggcgcc caccatcgcg tcgcagcccc 1740tgtccctgcg cccagaggcg tgccggccag cggcgggggg cgcagtgcac acgagggggc 1800tggacttcgc ctgtgatatc tacatctggg cgcccttggc cgggacttgt ggggtccttc 1860tcctgtcact ggttatcacc agagtgaagt tcagcaggag cgcagacgcc cccgcgtacc 1920agcagggcca gaaccagctc tataacgagc tcaatctagg acgaagagag gagtacgatg 1980ttttggacaa gagacgtggc cgggaccctg agatgggggg aaagccgcag agaaggaaga 2040accctcagga aggcctgtac aatgaactgc agaaagataa gatggcggag gcctacagtg 2100agattgggat gaaaggcgag cgccggaggg gcaaggggca cgatggcctt taccagggtc 2160tcagtacagc caccaaggac acctacgacg cccttcacat gcaggccctg ccccctcgct 2220aggtcgacct c 2231332357DNAArtificial sequenceeGFP-F2A-Y022 scFv-BBZ nucleotide sequence 33tgcagtagtc gccgtgaacg ttctttttcg caacgggttt gccgccagaa cacaggtgtc 60gtgacgcgga tccaggccta agcttacgcg tcctagcgct accggtcgcc accatggtga 120gcaagggcga ggagctgttc accggggtgg tgcccatcct ggtcgagctg gacggcgacg 180taaacggcca caagttcagc gtgtccggcg agggcgaggg cgatgccacc tacggcaagc 240tgaccctgaa gttcatctgc accaccggca agctgcccgt gccctggccc accctcgtga 300ccaccctgac ctacggcgtg cagtgcttca gccgctaccc cgaccacatg aagcagcacg 360acttcttcaa gtccgccatg cccgaaggct acgtccagga gcgcaccatc ttcttcaagg 420acgacggcaa ctacaagacc cgcgccgagg tgaagttcga gggcgacacc ctggtgaacc 480gcatcgagct gaagggcatc gacttcaagg aggacggcaa catcctgggg cacaagctgg 540agtacaacta caacagccac aacgtctata tcatggccga caagcagaag aacggcatca 600aggtgaactt caagatccgc cacaacatcg aggacggcag cgtgcagctc gccgaccact 660accagcagaa cacccccatc ggcgacggcc ccgtgctgct gcccgacaac cactacctga 720gcacccagtc cgccctgagc aaagacccca acgagaagcg cgatcacatg gtcctgctgg 780agttcgtgac cgccgccggg atcactctcg gcatggacga gctgtacaag tccggagtga 840aacagacttt gaattttgac cttctgaagt tggcaggaga cgttgagtcc aaccctgggc 900ccatggcctt accagtgacc gccttgctcc tgccgctggc cttgctgctc cacgccgcca 960ggccggatat tcagatgacc cagagcccga gcagcctgag cgcgagcgtg ggcgaccgtg 1020tgaccattac ctgccatgcg agccaggata ttaacgtgaa cattggctgg ctgcagcaga 1080aaccgggcaa agcgtttaaa ggcctgattt atcatggcaa aaacctggaa gatggcgtgc 1140cgagccgttt tagcggcagc ggcagcggca ccgattttac cctgaccatt agcagcctgc 1200agccggaaga ttttgcgacc tattattgca atcagtatga aaatatccca ctgacatttg 1260gccagggcac caaagtggaa attaaacgtg gtggaggcgg ttcaggcgga ggtggctctg 1320gcggtggcgg atcggatgtg cagctggtgg aaagcggcgg cggcctggtg cagccgggcg 1380gcagcctgcg tctgagctgc gcggtgagcg gctatagcat taccagcgat tatgcgtgga 1440actggattcg tcaggcgccg ggcaaaggcc tggaatggct gggctatatt agctatcgtg 1500gccgcaccca gtataacccg agcctgaaaa gccgtattag cattacccgt gataacagca 1560aaaacacctt tttcctgcag ctgaacagcc tgcgtgcgga agataccgcg gtgtattatt 1620gcgcgcgcat gggtaagaat tgggattact ggggccaggg caccctggtg accgtgagca 1680gcaccacgac gccagcgccg cgaccaccaa caccggcgcc caccatcgcg tcgcagcccc 1740tgtccctgcg cccagaggcg tgccggccag cggcgggggg cgcagtgcac acgagggggc 1800tggacttcgc ctgtgatatc tacatctggg cgcccttggc cgggacttgt ggggtccttc 1860tcctgtcact ggttatcacc aaacggggca gaaagaaact cctgtatata ttcaaacaac 1920catttatgag accagtacaa actactcaag aggaagatgg ctgtagctgc cgatttccag 1980aagaagaaga aggaggatgt gaactgagag tgaagttcag caggagcgca gacgcccccg 2040cgtaccagca gggccagaac cagctctata acgagctcaa tctaggacga agagaggagt 2100acgatgtttt ggacaagaga cgtggccggg accctgagat ggggggaaag ccgcagagaa 2160ggaagaaccc tcaggaaggc ctgtacaatg aactgcagaa agataagatg gcggaggcct 2220acagtgagat tgggatgaaa ggcgagcgcc ggaggggcaa ggggcacgat ggcctttacc 2280agggtctcag tacagccacc aaggacacct acgacgccct tcacatgcag gccctgcccc 2340ctcgctaggt cgacctc 2357342372DNAArtificial sequenceeGFP-F2A-Y022 scFv-28Z nucleotide sequence 34tgcagtagtc gccgtgaacg ttctttttcg caacgggttt gccgccagaa cacaggtgtc 60gtgacgcgga tccaggccta agcttacgcg tcctagcgct accggtcgcc accatggtga 120gcaagggcga ggagctgttc accggggtgg tgcccatcct ggtcgagctg gacggcgacg 180taaacggcca caagttcagc gtgtccggcg agggcgaggg cgatgccacc tacggcaagc 240tgaccctgaa gttcatctgc accaccggca agctgcccgt gccctggccc accctcgtga 300ccaccctgac ctacggcgtg cagtgcttca gccgctaccc cgaccacatg aagcagcacg 360acttcttcaa gtccgccatg cccgaaggct acgtccagga gcgcaccatc ttcttcaagg 420acgacggcaa ctacaagacc cgcgccgagg tgaagttcga gggcgacacc ctggtgaacc 480gcatcgagct gaagggcatc gacttcaagg aggacggcaa catcctgggg cacaagctgg 540agtacaacta caacagccac aacgtctata tcatggccga caagcagaag aacggcatca 600aggtgaactt caagatccgc cacaacatcg aggacggcag cgtgcagctc gccgaccact 660accagcagaa cacccccatc ggcgacggcc ccgtgctgct gcccgacaac cactacctga 720gcacccagtc cgccctgagc aaagacccca acgagaagcg cgatcacatg gtcctgctgg 780agttcgtgac cgccgccggg atcactctcg gcatggacga gctgtacaag

tccggagtga 840aacagacttt gaattttgac cttctgaagt tggcaggaga cgttgagtcc aaccctgggc 900ccatggcctt accagtgacc gccttgctcc tgccgctggc cttgctgctc cacgccgcca 960ggccggatat tcagatgacc cagagcccga gcagcctgag cgcgagcgtg ggcgaccgtg 1020tgaccattac ctgccatgcg agccaggata ttaacgtgaa cattggctgg ctgcagcaga 1080aaccgggcaa agcgtttaaa ggcctgattt atcatggcaa aaacctggaa gatggcgtgc 1140cgagccgttt tagcggcagc ggcagcggca ccgattttac cctgaccatt agcagcctgc 1200agccggaaga ttttgcgacc tattattgca atcagtatga aaatatccca ctgacatttg 1260gccagggcac caaagtggaa attaaacgtg gtggaggcgg ttcaggcgga ggtggctctg 1320gcggtggcgg atcggatgtg cagctggtgg aaagcggcgg cggcctggtg cagccgggcg 1380gcagcctgcg tctgagctgc gcggtgagcg gctatagcat taccagcgat tatgcgtgga 1440actggattcg tcaggcgccg ggcaaaggcc tggaatggct gggctatatt agctatcgtg 1500gccgcaccca gtataacccg agcctgaaaa gccgtattag cattacccgt gataacagca 1560aaaacacctt tttcctgcag ctgaacagcc tgcgtgcgga agataccgcg gtgtattatt 1620gcgcgcgcat gggtaagaat tgggattact ggggccaggg caccctggtg accgtgagca 1680gcaccacgac gccagcgccg cgaccaccaa caccggcgcc caccatcgcg tcgcagcccc 1740tgtccctgcg cccagaggcg tgccggccag cggcgggggg cgcagtgcac acgagggggc 1800tggacttcgc ctgtgatttt tgggtgctgg tggtggttgg tggagtcctg gcttgctata 1860gcttgctagt aacagtggcc tttattattt tctgggtgag gagtaagagg agcaggctcc 1920tgcacagtga ctacatgaac atgactcccc gccgccccgg gccaacccgc aagcattacc 1980agccctatgc cccaccacgc gacttcgcag cctatcgctc cagagtgaag ttcagcagga 2040gcgcagacgc ccccgcgtac cagcagggcc agaaccagct ctataacgag ctcaatctag 2100gacgaagaga ggagtacgat gttttggaca agagacgtgg ccgggaccct gagatggggg 2160gaaagccgca gagaaggaag aaccctcagg aaggcctgta caatgaactg cagaaagata 2220agatggcgga ggcctacagt gagattggga tgaaaggcga gcgccggagg ggcaaggggc 2280acgatggcct ttaccagggt ctcagtacag ccaccaagga cacctacgac gcccttcaca 2340tgcaggccct gccccctcgc taggtcgacc tc 2372352498DNAArtificial sequenceeGFP-F2A-Y022 scFv-28BBZ nucleotide sequence 35tgcagtagtc gccgtgaacg ttctttttcg caacgggttt gccgccagaa cacaggtgtc 60gtgacgcgga tccaggccta agcttacgcg tcctagcgct accggtcgcc accatggtga 120gcaagggcga ggagctgttc accggggtgg tgcccatcct ggtcgagctg gacggcgacg 180taaacggcca caagttcagc gtgtccggcg agggcgaggg cgatgccacc tacggcaagc 240tgaccctgaa gttcatctgc accaccggca agctgcccgt gccctggccc accctcgtga 300ccaccctgac ctacggcgtg cagtgcttca gccgctaccc cgaccacatg aagcagcacg 360acttcttcaa gtccgccatg cccgaaggct acgtccagga gcgcaccatc ttcttcaagg 420acgacggcaa ctacaagacc cgcgccgagg tgaagttcga gggcgacacc ctggtgaacc 480gcatcgagct gaagggcatc gacttcaagg aggacggcaa catcctgggg cacaagctgg 540agtacaacta caacagccac aacgtctata tcatggccga caagcagaag aacggcatca 600aggtgaactt caagatccgc cacaacatcg aggacggcag cgtgcagctc gccgaccact 660accagcagaa cacccccatc ggcgacggcc ccgtgctgct gcccgacaac cactacctga 720gcacccagtc cgccctgagc aaagacccca acgagaagcg cgatcacatg gtcctgctgg 780agttcgtgac cgccgccggg atcactctcg gcatggacga gctgtacaag tccggagtga 840aacagacttt gaattttgac cttctgaagt tggcaggaga cgttgagtcc aaccctgggc 900ccatggcctt accagtgacc gccttgctcc tgccgctggc cttgctgctc cacgccgcca 960ggccggatat tcagatgacc cagagcccga gcagcctgag cgcgagcgtg ggcgaccgtg 1020tgaccattac ctgccatgcg agccaggata ttaacgtgaa cattggctgg ctgcagcaga 1080aaccgggcaa agcgtttaaa ggcctgattt atcatggcaa aaacctggaa gatggcgtgc 1140cgagccgttt tagcggcagc ggcagcggca ccgattttac cctgaccatt agcagcctgc 1200agccggaaga ttttgcgacc tattattgca atcagtatga aaatatccca ctgacatttg 1260gccagggcac caaagtggaa attaaacgtg gtggaggcgg ttcaggcgga ggtggctctg 1320gcggtggcgg atcggatgtg cagctggtgg aaagcggcgg cggcctggtg cagccgggcg 1380gcagcctgcg tctgagctgc gcggtgagcg gctatagcat taccagcgat tatgcgtgga 1440actggattcg tcaggcgccg ggcaaaggcc tggaatggct gggctatatt agctatcgtg 1500gccgcaccca gtataacccg agcctgaaaa gccgtattag cattacccgt gataacagca 1560aaaacacctt tttcctgcag ctgaacagcc tgcgtgcgga agataccgcg gtgtattatt 1620gcgcgcgcat gggtaagaat tgggattact ggggccaggg caccctggtg accgtgagca 1680gcaccacgac gccagcgccg cgaccaccaa caccggcgcc caccatcgcg tcgcagcccc 1740tgtccctgcg cccagaggcg tgccggccag cggcgggggg cgcagtgcac acgagggggc 1800tggacttcgc ctgtgatttt tgggtgctgg tggtggttgg tggagtcctg gcttgctata 1860gcttgctagt aacagtggcc tttattattt tctgggtgag gagtaagagg agcaggctcc 1920tgcacagtga ctacatgaac atgactcccc gccgccccgg gccaacccgc aagcattacc 1980agccctatgc cccaccacgc gacttcgcag cctatcgctc caaacggggc agaaagaaac 2040tcctgtatat attcaaacaa ccatttatga gaccagtaca aactactcaa gaggaagatg 2100gctgtagctg ccgatttcca gaagaagaag aaggaggatg tgaactgaga gtgaagttca 2160gcaggagcgc agacgccccc gcgtaccagc agggccagaa ccagctctat aacgagctca 2220atctaggacg aagagaggag tacgatgttt tggacaagag acgtggccgg gaccctgaga 2280tggggggaaa gccgcagaga aggaagaacc ctcaggaagg cctgtacaat gaactgcaga 2340aagataagat ggcggaggcc tacagtgaga ttgggatgaa aggcgagcgc cggaggggca 2400aggggcacga tggcctttac cagggtctca gtacagccac caaggacacc tacgacgccc 2460ttcacatgca ggccctgccc cctcgctagg tcgacctc 249836601PRTArtificial sequenceeGFP-F2A-Y022 scFv-Z amino acid sequence 36Met Val Ser Lys Gly Glu Glu Leu Phe Thr Gly Val Val Pro Ile Leu1 5 10 15Val Glu Leu Asp Gly Asp Val Asn Gly His Lys Phe Ser Val Ser Gly 20 25 30Glu Gly Glu Gly Asp Ala Thr Tyr Gly Lys Leu Thr Leu Lys Phe Ile 35 40 45Cys Thr Thr Gly Lys Leu Pro Val Pro Trp Pro Thr Leu Val Thr Thr 50 55 60Leu Thr Tyr Gly Val Gln Cys Phe Ser Arg Tyr Pro Asp His Met Lys65 70 75 80Gln His Asp Phe Phe Lys Ser Ala Met Pro Glu Gly Tyr Val Gln Glu 85 90 95Arg Thr Ile Phe Phe Lys Asp Asp Gly Asn Tyr Lys Thr Arg Ala Glu 100 105 110Val Lys Phe Glu Gly Asp Thr Leu Val Asn Arg Ile Glu Leu Lys Gly 115 120 125Ile Asp Phe Lys Glu Asp Gly Asn Ile Leu Gly His Lys Leu Glu Tyr 130 135 140Asn Tyr Asn Ser His Asn Val Tyr Ile Met Ala Asp Lys Gln Lys Asn145 150 155 160Gly Ile Lys Val Asn Phe Lys Ile Arg His Asn Ile Glu Asp Gly Ser 165 170 175Val Gln Leu Ala Asp His Tyr Gln Gln Asn Thr Pro Ile Gly Asp Gly 180 185 190Pro Val Leu Leu Pro Asp Asn His Tyr Leu Ser Thr Gln Ser Ala Leu 195 200 205Ser Lys Asp Pro Asn Glu Lys Arg Asp His Met Val Leu Leu Glu Phe 210 215 220Val Thr Ala Ala Gly Ile Thr Leu Gly Met Asp Glu Leu Tyr Lys Ser225 230 235 240Gly Val Lys Gln Thr Leu Asn Phe Asp Leu Leu Lys Leu Ala Gly Asp 245 250 255Val Glu Ser Asn Pro Gly Pro Met Ala Leu Pro Val Thr Ala Leu Leu 260 265 270Leu Pro Leu Ala Leu Leu Leu His Ala Ala Arg Pro Asp Ile Gln Met 275 280 285Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr 290 295 300Ile Thr Cys His Ala Ser Gln Asp Ile Asn Val Asn Ile Gly Trp Leu305 310 315 320Gln Gln Lys Pro Gly Lys Ala Phe Lys Gly Leu Ile Tyr His Gly Lys 325 330 335Asn Leu Glu Asp Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly 340 345 350Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala 355 360 365Thr Tyr Tyr Cys Asn Gln Tyr Glu Asn Ile Pro Leu Thr Phe Gly Gln 370 375 380Gly Thr Lys Val Glu Ile Lys Arg Gly Gly Gly Gly Ser Gly Gly Gly385 390 395 400Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu Val Glu Ser Gly Gly 405 410 415Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Val Ser 420 425 430Gly Tyr Ser Ile Thr Ser Asp Tyr Ala Trp Asn Trp Ile Arg Gln Ala 435 440 445Pro Gly Lys Gly Leu Glu Trp Leu Gly Tyr Ile Ser Tyr Arg Gly Arg 450 455 460Thr Gln Tyr Asn Pro Ser Leu Lys Ser Arg Ile Ser Ile Thr Arg Asp465 470 475 480Asn Ser Lys Asn Thr Phe Phe Leu Gln Leu Asn Ser Leu Arg Ala Glu 485 490 495Asp Thr Ala Val Tyr Tyr Cys Ala Arg Met Gly Lys Asn Trp Asp Tyr 500 505 510Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Thr Thr Thr Pro Ala 515 520 525Pro Arg Pro Pro Thr Pro Ala Pro Thr Ile Ala Ser Gln Pro Leu Ser 530 535 540Leu Arg Pro Glu Ala Cys Arg Pro Ala Ala Gly Gly Ala Val His Thr545 550 555 560Arg Gly Leu Asp Phe Ala Cys Asp Ile Tyr Ile Trp Ala Pro Leu Ala 565 570 575Gly Thr Cys Gly Val Leu Leu Leu Ser Leu Val Ile Thr Arg Val Lys 580 585 590Phe Ser Arg Ser Ala Asp Ala Pro Ala 595 60037702PRTArtificial sequenceeGFP-F2A-Y022 scFv-Z amino acid sequence 37Met Val Ser Lys Gly Glu Glu Leu Phe Thr Gly Val Val Pro Ile Leu1 5 10 15Val Glu Leu Asp Gly Asp Val Asn Gly His Lys Phe Ser Val Ser Gly 20 25 30Glu Gly Glu Gly Asp Ala Thr Tyr Gly Lys Leu Thr Leu Lys Phe Ile 35 40 45Cys Thr Thr Gly Lys Leu Pro Val Pro Trp Pro Thr Leu Val Thr Thr 50 55 60Leu Thr Tyr Gly Val Gln Cys Phe Ser Arg Tyr Pro Asp His Met Lys65 70 75 80Gln His Asp Phe Phe Lys Ser Ala Met Pro Glu Gly Tyr Val Gln Glu 85 90 95Arg Thr Ile Phe Phe Lys Asp Asp Gly Asn Tyr Lys Thr Arg Ala Glu 100 105 110Val Lys Phe Glu Gly Asp Thr Leu Val Asn Arg Ile Glu Leu Lys Gly 115 120 125Ile Asp Phe Lys Glu Asp Gly Asn Ile Leu Gly His Lys Leu Glu Tyr 130 135 140Asn Tyr Asn Ser His Asn Val Tyr Ile Met Ala Asp Lys Gln Lys Asn145 150 155 160Gly Ile Lys Val Asn Phe Lys Ile Arg His Asn Ile Glu Asp Gly Ser 165 170 175Val Gln Leu Ala Asp His Tyr Gln Gln Asn Thr Pro Ile Gly Asp Gly 180 185 190Pro Val Leu Leu Pro Asp Asn His Tyr Leu Ser Thr Gln Ser Ala Leu 195 200 205Ser Lys Asp Pro Asn Glu Lys Arg Asp His Met Val Leu Leu Glu Phe 210 215 220Val Thr Ala Ala Gly Ile Thr Leu Gly Met Asp Glu Leu Tyr Lys Ser225 230 235 240Gly Val Lys Gln Thr Leu Asn Phe Asp Leu Leu Lys Leu Ala Gly Asp 245 250 255Val Glu Ser Asn Pro Gly Pro Met Ala Leu Pro Val Thr Ala Leu Leu 260 265 270Leu Pro Leu Ala Leu Leu Leu His Ala Ala Arg Pro Asp Ile Gln Met 275 280 285Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr 290 295 300Ile Thr Cys His Ala Ser Gln Asp Ile Asn Val Asn Ile Gly Trp Leu305 310 315 320Gln Gln Lys Pro Gly Lys Ala Phe Lys Gly Leu Ile Tyr His Gly Lys 325 330 335Asn Leu Glu Asp Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly 340 345 350Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala 355 360 365Thr Tyr Tyr Cys Asn Gln Tyr Glu Asn Ile Pro Leu Thr Phe Gly Gln 370 375 380Gly Thr Lys Val Glu Ile Lys Arg Gly Gly Gly Gly Ser Gly Gly Gly385 390 395 400Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu Val Glu Ser Gly Gly 405 410 415Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Val Ser 420 425 430Gly Tyr Ser Ile Thr Ser Asp Tyr Ala Trp Asn Trp Ile Arg Gln Ala 435 440 445Pro Gly Lys Gly Leu Glu Trp Leu Gly Tyr Ile Ser Tyr Arg Gly Arg 450 455 460Thr Gln Tyr Asn Pro Ser Leu Lys Ser Arg Ile Ser Ile Thr Arg Asp465 470 475 480Asn Ser Lys Asn Thr Phe Phe Leu Gln Leu Asn Ser Leu Arg Ala Glu 485 490 495Asp Thr Ala Val Tyr Tyr Cys Ala Arg Met Gly Lys Asn Trp Asp Tyr 500 505 510Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Thr Thr Thr Pro Ala 515 520 525Pro Arg Pro Pro Thr Pro Ala Pro Thr Ile Ala Ser Gln Pro Leu Ser 530 535 540Leu Arg Pro Glu Ala Cys Arg Pro Ala Ala Gly Gly Ala Val His Thr545 550 555 560Arg Gly Leu Asp Phe Ala Cys Asp Ile Tyr Ile Trp Ala Pro Leu Ala 565 570 575Gly Thr Cys Gly Val Leu Leu Leu Ser Leu Val Ile Thr Arg Val Lys 580 585 590Phe Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln Gly Gln Asn Gln 595 600 605Leu Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr Asp Val Leu 610 615 620Asp Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys Pro Gln Arg625 630 635 640Arg Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln Lys Asp Lys 645 650 655Met Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu Arg Arg Arg 660 665 670Gly Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr Ala Thr Lys 675 680 685Asp Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro Arg 690 695 70038744PRTArtificial sequenceeGFP-F2A-Y022 scFv-BBZ amino acid sequence 38Met Val Ser Lys Gly Glu Glu Leu Phe Thr Gly Val Val Pro Ile Leu1 5 10 15Val Glu Leu Asp Gly Asp Val Asn Gly His Lys Phe Ser Val Ser Gly 20 25 30Glu Gly Glu Gly Asp Ala Thr Tyr Gly Lys Leu Thr Leu Lys Phe Ile 35 40 45Cys Thr Thr Gly Lys Leu Pro Val Pro Trp Pro Thr Leu Val Thr Thr 50 55 60Leu Thr Tyr Gly Val Gln Cys Phe Ser Arg Tyr Pro Asp His Met Lys65 70 75 80Gln His Asp Phe Phe Lys Ser Ala Met Pro Glu Gly Tyr Val Gln Glu 85 90 95Arg Thr Ile Phe Phe Lys Asp Asp Gly Asn Tyr Lys Thr Arg Ala Glu 100 105 110Val Lys Phe Glu Gly Asp Thr Leu Val Asn Arg Ile Glu Leu Lys Gly 115 120 125Ile Asp Phe Lys Glu Asp Gly Asn Ile Leu Gly His Lys Leu Glu Tyr 130 135 140Asn Tyr Asn Ser His Asn Val Tyr Ile Met Ala Asp Lys Gln Lys Asn145 150 155 160Gly Ile Lys Val Asn Phe Lys Ile Arg His Asn Ile Glu Asp Gly Ser 165 170 175Val Gln Leu Ala Asp His Tyr Gln Gln Asn Thr Pro Ile Gly Asp Gly 180 185 190Pro Val Leu Leu Pro Asp Asn His Tyr Leu Ser Thr Gln Ser Ala Leu 195 200 205Ser Lys Asp Pro Asn Glu Lys Arg Asp His Met Val Leu Leu Glu Phe 210 215 220Val Thr Ala Ala Gly Ile Thr Leu Gly Met Asp Glu Leu Tyr Lys Ser225 230 235 240Gly Val Lys Gln Thr Leu Asn Phe Asp Leu Leu Lys Leu Ala Gly Asp 245 250 255Val Glu Ser Asn Pro Gly Pro Met Ala Leu Pro Val Thr Ala Leu Leu 260 265 270Leu Pro Leu Ala Leu Leu Leu His Ala Ala Arg Pro Asp Ile Gln Met 275 280 285Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr 290 295 300Ile Thr Cys His Ala Ser Gln Asp Ile Asn Val Asn Ile Gly Trp Leu305 310 315 320Gln Gln Lys Pro Gly Lys Ala Phe Lys Gly Leu Ile Tyr His Gly Lys 325 330 335Asn Leu Glu Asp Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly 340 345 350Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala 355 360 365Thr Tyr Tyr Cys Asn Gln Tyr Glu Asn Ile Pro Leu Thr Phe Gly Gln 370 375 380Gly Thr Lys Val Glu Ile Lys Arg Gly Gly Gly Gly Ser Gly Gly Gly385 390 395 400Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu Val Glu Ser Gly Gly 405 410 415Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Val Ser 420 425 430Gly Tyr Ser Ile Thr Ser Asp Tyr Ala Trp Asn Trp Ile Arg Gln Ala 435 440 445Pro Gly Lys Gly Leu Glu Trp Leu Gly Tyr Ile Ser Tyr Arg Gly Arg 450 455

460Thr Gln Tyr Asn Pro Ser Leu Lys Ser Arg Ile Ser Ile Thr Arg Asp465 470 475 480Asn Ser Lys Asn Thr Phe Phe Leu Gln Leu Asn Ser Leu Arg Ala Glu 485 490 495Asp Thr Ala Val Tyr Tyr Cys Ala Arg Met Gly Lys Asn Trp Asp Tyr 500 505 510Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Thr Thr Thr Pro Ala 515 520 525Pro Arg Pro Pro Thr Pro Ala Pro Thr Ile Ala Ser Gln Pro Leu Ser 530 535 540Leu Arg Pro Glu Ala Cys Arg Pro Ala Ala Gly Gly Ala Val His Thr545 550 555 560Arg Gly Leu Asp Phe Ala Cys Asp Ile Tyr Ile Trp Ala Pro Leu Ala 565 570 575Gly Thr Cys Gly Val Leu Leu Leu Ser Leu Val Ile Thr Lys Arg Gly 580 585 590Arg Lys Lys Leu Leu Tyr Ile Phe Lys Gln Pro Phe Met Arg Pro Val 595 600 605Gln Thr Thr Gln Glu Glu Asp Gly Cys Ser Cys Arg Phe Pro Glu Glu 610 615 620Glu Glu Gly Gly Cys Glu Leu Arg Val Lys Phe Ser Arg Ser Ala Asp625 630 635 640Ala Pro Ala Tyr Gln Gln Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn 645 650 655Leu Gly Arg Arg Glu Glu Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg 660 665 670Asp Pro Glu Met Gly Gly Lys Pro Gln Arg Arg Lys Asn Pro Gln Glu 675 680 685Gly Leu Tyr Asn Glu Leu Gln Lys Asp Lys Met Ala Glu Ala Tyr Ser 690 695 700Glu Ile Gly Met Lys Gly Glu Arg Arg Arg Gly Lys Gly His Asp Gly705 710 715 720Leu Tyr Gln Gly Leu Ser Thr Ala Thr Lys Asp Thr Tyr Asp Ala Leu 725 730 735His Met Gln Ala Leu Pro Pro Arg 74039749PRTArtificial sequenceeGFP-F2A-Y022 scFv-28Z amino acid sequence 39Met Val Ser Lys Gly Glu Glu Leu Phe Thr Gly Val Val Pro Ile Leu1 5 10 15Val Glu Leu Asp Gly Asp Val Asn Gly His Lys Phe Ser Val Ser Gly 20 25 30Glu Gly Glu Gly Asp Ala Thr Tyr Gly Lys Leu Thr Leu Lys Phe Ile 35 40 45Cys Thr Thr Gly Lys Leu Pro Val Pro Trp Pro Thr Leu Val Thr Thr 50 55 60Leu Thr Tyr Gly Val Gln Cys Phe Ser Arg Tyr Pro Asp His Met Lys65 70 75 80Gln His Asp Phe Phe Lys Ser Ala Met Pro Glu Gly Tyr Val Gln Glu 85 90 95Arg Thr Ile Phe Phe Lys Asp Asp Gly Asn Tyr Lys Thr Arg Ala Glu 100 105 110Val Lys Phe Glu Gly Asp Thr Leu Val Asn Arg Ile Glu Leu Lys Gly 115 120 125Ile Asp Phe Lys Glu Asp Gly Asn Ile Leu Gly His Lys Leu Glu Tyr 130 135 140Asn Tyr Asn Ser His Asn Val Tyr Ile Met Ala Asp Lys Gln Lys Asn145 150 155 160Gly Ile Lys Val Asn Phe Lys Ile Arg His Asn Ile Glu Asp Gly Ser 165 170 175Val Gln Leu Ala Asp His Tyr Gln Gln Asn Thr Pro Ile Gly Asp Gly 180 185 190Pro Val Leu Leu Pro Asp Asn His Tyr Leu Ser Thr Gln Ser Ala Leu 195 200 205Ser Lys Asp Pro Asn Glu Lys Arg Asp His Met Val Leu Leu Glu Phe 210 215 220Val Thr Ala Ala Gly Ile Thr Leu Gly Met Asp Glu Leu Tyr Lys Ser225 230 235 240Gly Val Lys Gln Thr Leu Asn Phe Asp Leu Leu Lys Leu Ala Gly Asp 245 250 255Val Glu Ser Asn Pro Gly Pro Met Ala Leu Pro Val Thr Ala Leu Leu 260 265 270Leu Pro Leu Ala Leu Leu Leu His Ala Ala Arg Pro Asp Ile Gln Met 275 280 285Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr 290 295 300Ile Thr Cys His Ala Ser Gln Asp Ile Asn Val Asn Ile Gly Trp Leu305 310 315 320Gln Gln Lys Pro Gly Lys Ala Phe Lys Gly Leu Ile Tyr His Gly Lys 325 330 335Asn Leu Glu Asp Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly 340 345 350Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala 355 360 365Thr Tyr Tyr Cys Asn Gln Tyr Glu Asn Ile Pro Leu Thr Phe Gly Gln 370 375 380Gly Thr Lys Val Glu Ile Lys Arg Gly Gly Gly Gly Ser Gly Gly Gly385 390 395 400Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu Val Glu Ser Gly Gly 405 410 415Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Val Ser 420 425 430Gly Tyr Ser Ile Thr Ser Asp Tyr Ala Trp Asn Trp Ile Arg Gln Ala 435 440 445Pro Gly Lys Gly Leu Glu Trp Leu Gly Tyr Ile Ser Tyr Arg Gly Arg 450 455 460Thr Gln Tyr Asn Pro Ser Leu Lys Ser Arg Ile Ser Ile Thr Arg Asp465 470 475 480Asn Ser Lys Asn Thr Phe Phe Leu Gln Leu Asn Ser Leu Arg Ala Glu 485 490 495Asp Thr Ala Val Tyr Tyr Cys Ala Arg Met Gly Lys Asn Trp Asp Tyr 500 505 510Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Thr Thr Thr Pro Ala 515 520 525Pro Arg Pro Pro Thr Pro Ala Pro Thr Ile Ala Ser Gln Pro Leu Ser 530 535 540Leu Arg Pro Glu Ala Cys Arg Pro Ala Ala Gly Gly Ala Val His Thr545 550 555 560Arg Gly Leu Asp Phe Ala Cys Asp Phe Trp Val Leu Val Val Val Gly 565 570 575Gly Val Leu Ala Cys Tyr Ser Leu Leu Val Thr Val Ala Phe Ile Ile 580 585 590Phe Trp Val Arg Ser Lys Arg Ser Arg Leu Leu His Ser Asp Tyr Met 595 600 605Asn Met Thr Pro Arg Arg Pro Gly Pro Thr Arg Lys His Tyr Gln Pro 610 615 620Tyr Ala Pro Pro Arg Asp Phe Ala Ala Tyr Arg Ser Arg Val Lys Phe625 630 635 640Ser Arg Ser Ala Asp Ala Pro Ala Tyr Gln Gln Gly Gln Asn Gln Leu 645 650 655Tyr Asn Glu Leu Asn Leu Gly Arg Arg Glu Glu Tyr Asp Val Leu Asp 660 665 670Lys Arg Arg Gly Arg Asp Pro Glu Met Gly Gly Lys Pro Gln Arg Arg 675 680 685Lys Asn Pro Gln Glu Gly Leu Tyr Asn Glu Leu Gln Lys Asp Lys Met 690 695 700Ala Glu Ala Tyr Ser Glu Ile Gly Met Lys Gly Glu Arg Arg Arg Gly705 710 715 720Lys Gly His Asp Gly Leu Tyr Gln Gly Leu Ser Thr Ala Thr Lys Asp 725 730 735Thr Tyr Asp Ala Leu His Met Gln Ala Leu Pro Pro Arg 740 74540791PRTArtificial sequenceeGFP-F2A-Y022 scFv-28BBZ amino acid sequence 40Met Val Ser Lys Gly Glu Glu Leu Phe Thr Gly Val Val Pro Ile Leu1 5 10 15Val Glu Leu Asp Gly Asp Val Asn Gly His Lys Phe Ser Val Ser Gly 20 25 30Glu Gly Glu Gly Asp Ala Thr Tyr Gly Lys Leu Thr Leu Lys Phe Ile 35 40 45Cys Thr Thr Gly Lys Leu Pro Val Pro Trp Pro Thr Leu Val Thr Thr 50 55 60Leu Thr Tyr Gly Val Gln Cys Phe Ser Arg Tyr Pro Asp His Met Lys65 70 75 80Gln His Asp Phe Phe Lys Ser Ala Met Pro Glu Gly Tyr Val Gln Glu 85 90 95Arg Thr Ile Phe Phe Lys Asp Asp Gly Asn Tyr Lys Thr Arg Ala Glu 100 105 110Val Lys Phe Glu Gly Asp Thr Leu Val Asn Arg Ile Glu Leu Lys Gly 115 120 125Ile Asp Phe Lys Glu Asp Gly Asn Ile Leu Gly His Lys Leu Glu Tyr 130 135 140Asn Tyr Asn Ser His Asn Val Tyr Ile Met Ala Asp Lys Gln Lys Asn145 150 155 160Gly Ile Lys Val Asn Phe Lys Ile Arg His Asn Ile Glu Asp Gly Ser 165 170 175Val Gln Leu Ala Asp His Tyr Gln Gln Asn Thr Pro Ile Gly Asp Gly 180 185 190Pro Val Leu Leu Pro Asp Asn His Tyr Leu Ser Thr Gln Ser Ala Leu 195 200 205Ser Lys Asp Pro Asn Glu Lys Arg Asp His Met Val Leu Leu Glu Phe 210 215 220Val Thr Ala Ala Gly Ile Thr Leu Gly Met Asp Glu Leu Tyr Lys Ser225 230 235 240Gly Val Lys Gln Thr Leu Asn Phe Asp Leu Leu Lys Leu Ala Gly Asp 245 250 255Val Glu Ser Asn Pro Gly Pro Met Ala Leu Pro Val Thr Ala Leu Leu 260 265 270Leu Pro Leu Ala Leu Leu Leu His Ala Ala Arg Pro Asp Ile Gln Met 275 280 285Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly Asp Arg Val Thr 290 295 300Ile Thr Cys His Ala Ser Gln Asp Ile Asn Val Asn Ile Gly Trp Leu305 310 315 320Gln Gln Lys Pro Gly Lys Ala Phe Lys Gly Leu Ile Tyr His Gly Lys 325 330 335Asn Leu Glu Asp Gly Val Pro Ser Arg Phe Ser Gly Ser Gly Ser Gly 340 345 350Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro Glu Asp Phe Ala 355 360 365Thr Tyr Tyr Cys Asn Gln Tyr Glu Asn Ile Pro Leu Thr Phe Gly Gln 370 375 380Gly Thr Lys Val Glu Ile Lys Arg Gly Gly Gly Gly Ser Gly Gly Gly385 390 395 400Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu Val Glu Ser Gly Gly 405 410 415Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser Cys Ala Val Ser 420 425 430Gly Tyr Ser Ile Thr Ser Asp Tyr Ala Trp Asn Trp Ile Arg Gln Ala 435 440 445Pro Gly Lys Gly Leu Glu Trp Leu Gly Tyr Ile Ser Tyr Arg Gly Arg 450 455 460Thr Gln Tyr Asn Pro Ser Leu Lys Ser Arg Ile Ser Ile Thr Arg Asp465 470 475 480Asn Ser Lys Asn Thr Phe Phe Leu Gln Leu Asn Ser Leu Arg Ala Glu 485 490 495Asp Thr Ala Val Tyr Tyr Cys Ala Arg Met Gly Lys Asn Trp Asp Tyr 500 505 510Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Thr Thr Thr Pro Ala 515 520 525Pro Arg Pro Pro Thr Pro Ala Pro Thr Ile Ala Ser Gln Pro Leu Ser 530 535 540Leu Arg Pro Glu Ala Cys Arg Pro Ala Ala Gly Gly Ala Val His Thr545 550 555 560Arg Gly Leu Asp Phe Ala Cys Asp Phe Trp Val Leu Val Val Val Gly 565 570 575Gly Val Leu Ala Cys Tyr Ser Leu Leu Val Thr Val Ala Phe Ile Ile 580 585 590Phe Trp Val Arg Ser Lys Arg Ser Arg Leu Leu His Ser Asp Tyr Met 595 600 605Asn Met Thr Pro Arg Arg Pro Gly Pro Thr Arg Lys His Tyr Gln Pro 610 615 620Tyr Ala Pro Pro Arg Asp Phe Ala Ala Tyr Arg Ser Lys Arg Gly Arg625 630 635 640Lys Lys Leu Leu Tyr Ile Phe Lys Gln Pro Phe Met Arg Pro Val Gln 645 650 655Thr Thr Gln Glu Glu Asp Gly Cys Ser Cys Arg Phe Pro Glu Glu Glu 660 665 670Glu Gly Gly Cys Glu Leu Arg Val Lys Phe Ser Arg Ser Ala Asp Ala 675 680 685Pro Ala Tyr Gln Gln Gly Gln Asn Gln Leu Tyr Asn Glu Leu Asn Leu 690 695 700Gly Arg Arg Glu Glu Tyr Asp Val Leu Asp Lys Arg Arg Gly Arg Asp705 710 715 720Pro Glu Met Gly Gly Lys Pro Gln Arg Arg Lys Asn Pro Gln Glu Gly 725 730 735Leu Tyr Asn Glu Leu Gln Lys Asp Lys Met Ala Glu Ala Tyr Ser Glu 740 745 750Ile Gly Met Lys Gly Glu Arg Arg Arg Gly Lys Gly His Asp Gly Leu 755 760 765Tyr Gln Gly Leu Ser Thr Ala Thr Lys Asp Thr Tyr Asp Ala Leu His 770 775 780Met Gln Ala Leu Pro Pro Arg785 7904111PRTArtificial sequenceY022 light chain CDR1 41His Ala Ser Gln Asp Ile Asn Val Asn Ile Gly1 5 10427PRTArtificial sequenceY022 light chainCDR2 42His Gly Lys Asn Leu Glu Asp1 5439PRTArtificial sequenceY022 light chain CDR3 43Asn Gln Tyr Glu Asn Ile Pro Leu Thr1 54411PRTArtificial sequenceY022 heavy chain CDR1 44Gly Tyr Ser Ile Thr Ser Asp Tyr Ala Trp Asn1 5 104516PRTArtificial sequenceY022 heavy chain CDR2 45Tyr Ile Ser Tyr Arg Gly Arg Thr Gln Tyr Asn Pro Ser Leu Lys Ser1 5 10 15467PRTArtificial sequenceY022 heavy chain CDR3 46Met Gly Lys Asn Trp Asp Tyr1 54711PRTArtificial sequenceM14 light chain CDR1 amino acid sequence 47His Ala Ser Gln Asp Ile Asn Ser Asn Ile Gly1 5 10489PRTArtificial sequenceM14 light chain CDR3 amino acid sequence 48Asn Gln Tyr Glu Asn Asn Pro Ile Thr1 54916PRTArtificial sequenceM14 heavy chain CDR2 49Tyr Ile Ser Tyr Arg Gly Arg Thr Asn Tyr Asn Pro Ser Leu Lys Ser1 5 10 15507PRTArtificial sequenceM14 heavy chain CDR3 50Leu Gly Arg Gly Phe Arg Tyr1 55116PRTArtificial sequenceM15 heavy chain CDR2 51Tyr Ile Ser Tyr Arg Gly Arg Thr Ser Tyr Asn Pro Ser Leu Lys Ser1 5 10 155216PRTArtificial sequenceM25 heavy chain CDR2 52Tyr Ile Ser Tyr Arg Gly Arg Thr Arg Tyr Asn Pro Ser Leu Lys Ser1 5 10 15537PRTArtificial sequenceS7 light chain CDR2 53His Gly Thr Asn Leu Glu Asp1 5549PRTArtificial sequenceS7 light chain CDR3 54Asn Gln Tyr Glu Asn Asn Pro Ile Thr1 55511PRTArtificial sequenceS17 light chain CDR1 55His Ala Ser Gln Asp Ile Asn Thr Asn Ile Gly1 5 10569PRTArtificial sequenceS17 light chain CDR3 56Asn Gln Tyr Glu Asn Asn Pro Leu Thr1 5579PRTArtificial sequenceS23 light chain CDR3 57Asn Gln Tyr Glu Asn Phe Pro Leu Thr1 558717DNAArtificial sequencenucleotide sequence of single chain antibody M14 58gatattcaga tgacccagag cccgagcagc ctgagcgcga gcgtgggcga ccgtgtgacc 60attacctgcc atgcgagcca ggatattaac agcaacattg gctggctgca gcagaaaccg 120ggcaaagcgt ttaaaggcct gatttatcat ggcaaaaacc tggaagatgg cgtgccgagc 180cgttttagcg gcagcggcag cggcaccgat tttaccctga ccattagcag cctgcagccg 240gaagattttg cgacctatta ttgcaatcag tatgaaaata acccaattac atttggccag 300ggcaccaaag tggaaattaa acgtggtgga ggcggttcag gcggaggtgg ctctggcggt 360ggcggatcgg atgtgcagct ggtggaaagc ggcggcggcc tggtgcagcc gggcggcagc 420ctgcgtctga gctgcgcggt gagcggctat agcattacca gcgattatgc gtggaactgg 480attcgtcagg cgccgggcaa aggcctggaa tggctgggct atattagcta tcgtggccgc 540accaactata acccgagcct gaaaagccgt attagcatta cccgtgataa cagcaaaaac 600acctttttcc tgcagctgaa cagcctgcgt gcggaagata ccgcggtgta ttattgcgcg 660cgcctgggac gcggcttccg ctactggggc cagggcaccc tggtgaccgt gagcagc 71759239PRTArtificial sequenceamino acid sequence of single chain antibody M14 59Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys His Ala Ser Gln Asp Ile Asn Ser Asn 20 25 30Ile Gly Trp Leu Gln Gln Lys Pro Gly Lys Ala Phe Lys Gly Leu Ile 35 40 45Tyr His Gly Lys Asn Leu Glu Asp Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Asn Gln Tyr Glu Asn Asn Pro Ile 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Gly Gly Gly Gly 100 105 110Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu Val 115 120 125Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser 130 135 140Cys Ala Val Ser Gly Tyr Ser Ile Thr Ser Asp Tyr Ala Trp Asn Trp145 150 155 160Ile Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu Gly Tyr Ile Ser 165 170 175Tyr Arg Gly Arg Thr Asn Tyr Asn Pro Ser Leu Lys Ser Arg Ile Ser 180 185 190Ile Thr Arg Asp Asn Ser

Lys Asn Thr Phe Phe Leu Gln Leu Asn Ser 195 200 205Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Leu Gly Arg 210 215 220Gly Phe Arg Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser225 230 23560717DNAArtificial sequencenucleotide sequence of single chain antibody M15 60gatattcaga tgacccagag cccgagcagc ctgagcgcga gcgtgggcga ccgtgtgacc 60attacctgcc atgcgagcca ggatattaac gtgaacattg gctggctgca gcagaaaccg 120ggcaaagcgt ttaaaggcct gatttatcat ggcaaaaacc tggaagatgg cgtgccgagc 180cgttttagcg gcagcggcag cggcaccgat tttaccctga ccattagcag cctgcagccg 240gaagattttg cgacctatta ttgcaatcag tatgaaaata acccaattac atttggccag 300ggcaccaaag tggaaattaa acgtggtgga ggcggttcag gcggaggtgg ctctggcggt 360ggcggatcgg atgtgcagct ggtggaaagc ggcggcggcc tggtgcagcc gggcggcagc 420ctgcgtctga gctgcgcggt gagcggctat agcattacca gcgattatgc gtggaactgg 480attcgtcagg cgccgggcaa aggcctggaa tggctgggct atattagcta tcgtggccgc 540accagctata acccgagcct gaaaagccgt attagcatta cccgtgataa cagcaaaaac 600acctttttcc tgcagctgaa cagcctgcgt gcggaagata ccgcggtgta ttattgcgcg 660cgcctgggac gcggcttccg ctactggggc cagggcaccc tggtgaccgt gagcagc 71761239PRTArtificial sequenceamino acid sequence of single chain antibody M15 61Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys His Ala Ser Gln Asp Ile Asn Val Asn 20 25 30Ile Gly Trp Leu Gln Gln Lys Pro Gly Lys Ala Phe Lys Gly Leu Ile 35 40 45Tyr His Gly Lys Asn Leu Glu Asp Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Asn Gln Tyr Glu Asn Asn Pro Ile 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Gly Gly Gly Gly 100 105 110Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu Val 115 120 125Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser 130 135 140Cys Ala Val Ser Gly Tyr Ser Ile Thr Ser Asp Tyr Ala Trp Asn Trp145 150 155 160Ile Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu Gly Tyr Ile Ser 165 170 175Tyr Arg Gly Arg Thr Ser Tyr Asn Pro Ser Leu Lys Ser Arg Ile Ser 180 185 190Ile Thr Arg Asp Asn Ser Lys Asn Thr Phe Phe Leu Gln Leu Asn Ser 195 200 205Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Leu Gly Arg 210 215 220Gly Phe Arg Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser225 230 23562717DNAArtificial sequencenucleotide sequence of single chain antibody M25 62gatattcaga tgacccagag cccgagcagc ctgagcgcga gcgtgggcga ccgtgtgacc 60attacctgcc atgcgagcca ggatattaac gtgaacattg gctggctgca gcagaaaccg 120ggcaaagcgt ttaaaggcct gatttatcat ggcaaaaacc tggaagatgg cgtgccgagc 180cgttttagcg gcagcggcag cggcaccgat tttaccctga ccattagcag cctgcagccg 240gaagattttg cgacctatta ttgcaatcag tatgaaaata tcccactgac atttggccag 300ggcaccaaag tggaaattaa acgtggtgga ggcggttcag gcggaggtgg ctctggcggt 360ggcggatcgg atgtgcagct ggtggaaagc ggcggcggcc tggtgcagcc gggcggcagc 420ctgcgtctga gctgcgcggt gagcggctat agcattacca gcgattatgc gtggaactgg 480attcgtcagg cgccgggcaa aggcctggaa tggctgggct atattagcta tcgtggccgc 540acccgctata acccgagcct gaaaagccgt attagcatta cccgtgataa cagcaaaaac 600acctttttcc tgcagctgaa cagcctgcgt gcggaagata ccgcggtgta ttattgcgcg 660cgcctgggac gcggcttccg ctactggggc cagggcaccc tggtgaccgt gagcagc 71763239PRTArtificial sequenceamino acid sequence of single chain antibody M25 63Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys His Ala Ser Gln Asp Ile Asn Val Asn 20 25 30Ile Gly Trp Leu Gln Gln Lys Pro Gly Lys Ala Phe Lys Gly Leu Ile 35 40 45Tyr His Gly Lys Asn Leu Glu Asp Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Asn Gln Tyr Glu Asn Ile Pro Leu 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Gly Gly Gly Gly 100 105 110Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu Val 115 120 125Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser 130 135 140Cys Ala Val Ser Gly Tyr Ser Ile Thr Ser Asp Tyr Ala Trp Asn Trp145 150 155 160Ile Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu Gly Tyr Ile Ser 165 170 175Tyr Arg Gly Arg Thr Arg Tyr Asn Pro Ser Leu Lys Ser Arg Ile Ser 180 185 190Ile Thr Arg Asp Asn Ser Lys Asn Thr Phe Phe Leu Gln Leu Asn Ser 195 200 205Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Leu Gly Arg 210 215 220Gly Phe Arg Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser225 230 23564717DNAArtificial sequencenucleotide sequence of single chain antibody M26 64gatattcaga tgacccagag cccgagcagc ctgagcgcga gcgtgggcga ccgtgtgacc 60attacctgcc atgcgagcca ggatattaac gtgaacattg gctggctgca gcagaaaccg 120ggcaaagcgt ttaaaggcct gatttatcat ggcaaaaacc tggaagatgg cgtgccgagc 180cgttttagcg gcagcggcag cggcaccgat tttaccctga ccattagcag cctgcagccg 240gaagattttg cgacctatta ttgcaatcag tatgaaaata tcccactgac atttggccag 300ggcaccaaag tggaaattaa acgtggtgga ggcggttcag gcggaggtgg ctctggcggt 360ggcggatcgg atgtgcagct ggtggaaagc ggcggcggcc tggtgcagcc gggcggcagc 420ctgcgtctga gctgcgcggt gagcggctat agcattacca gcgattatgc gtggaactgg 480attcgtcagg cgccgggcaa aggcctggaa tggctgggct atattagcta tcgtggccgc 540acccagtata acccgagcct gaaaagccgt attagcatta cccgtgataa cagcaaaaac 600acctttttcc tgcagctgaa cagcctgcgt gcggaagata ccgcggtgta ttattgcgcg 660cgcctgggac gcggcttccg ctactggggc cagggcaccc tggtgaccgt gagcagc 71765239PRTArtificial sequenceamino acid sequence of single chain antibody M26 65Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys His Ala Ser Gln Asp Ile Asn Val Asn 20 25 30Ile Gly Trp Leu Gln Gln Lys Pro Gly Lys Ala Phe Lys Gly Leu Ile 35 40 45Tyr His Gly Lys Asn Leu Glu Asp Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Asn Gln Tyr Glu Asn Ile Pro Leu 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Gly Gly Gly Gly 100 105 110Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu Val 115 120 125Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser 130 135 140Cys Ala Val Ser Gly Tyr Ser Ile Thr Ser Asp Tyr Ala Trp Asn Trp145 150 155 160Ile Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu Gly Tyr Ile Ser 165 170 175Tyr Arg Gly Arg Thr Gln Tyr Asn Pro Ser Leu Lys Ser Arg Ile Ser 180 185 190Ile Thr Arg Asp Asn Ser Lys Asn Thr Phe Phe Leu Gln Leu Asn Ser 195 200 205Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Leu Gly Arg 210 215 220Gly Phe Arg Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser225 230 23566717DNAArtificial sequencenucleotide sequence of single chain antibody S7 66gatattcaga tgacccagag cccgagcagc ctgagcgcga gcgtgggcga ccgtgtgacc 60attacctgcc atgcgagcca ggatattaac gtgaacattg gctggctgca gcagaaaccg 120ggcaaagcgt ttaaaggcct gatttatcat ggcaccaacc tggaagatgg cgtgccgagc 180cgttttagcg gcagcggcag cggcaccgat tttaccctga ccattagcag cctgcagccg 240gaagattttg cgacctatta ttgcaatcag tatgaaaata acccaattac atttggccag 300ggcaccaaag tggaaattaa acgtggtgga ggcggttcag gcggaggtgg ctctggcggt 360ggcggatcgg atgtgcagct ggtggaaagc ggcggcggcc tggtgcagcc gggcggcagc 420ctgcgtctga gctgcgcggt gagcggctat agcattacca gcgattatgc gtggaactgg 480attcgtcagg cgccgggcaa aggcctggaa tggctgggct atattagcta tcgtggccgc 540accagctata acccgagcct gaaaagccgt attagcatta cccgtgataa cagcaaaaac 600acctttttcc tgcagctgaa cagcctgcgt gcggaagata ccgcggtgta ttattgcgcg 660cgcctgggac gcggcttccg ctactggggc cagggcaccc tggtgaccgt gagcagc 71767239PRTArtificial sequenceamino acid sequence of single chain antibody S7 67Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys His Ala Ser Gln Asp Ile Asn Val Asn 20 25 30Ile Gly Trp Leu Gln Gln Lys Pro Gly Lys Ala Phe Lys Gly Leu Ile 35 40 45Tyr His Gly Thr Asn Leu Glu Asp Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Asn Gln Tyr Glu Asn Asn Pro Ile 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Gly Gly Gly Gly 100 105 110Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu Val 115 120 125Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser 130 135 140Cys Ala Val Ser Gly Tyr Ser Ile Thr Ser Asp Tyr Ala Trp Asn Trp145 150 155 160Ile Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu Gly Tyr Ile Ser 165 170 175Tyr Arg Gly Arg Thr Ser Tyr Asn Pro Ser Leu Lys Ser Arg Ile Ser 180 185 190Ile Thr Arg Asp Asn Ser Lys Asn Thr Phe Phe Leu Gln Leu Asn Ser 195 200 205Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Leu Gly Arg 210 215 220Gly Phe Arg Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser225 230 23568717DNAArtificial sequencenucleotide sequence of single chain antibody S8 68gatattcaga tgacccagag cccgagcagc ctgagcgcga gcgtgggcga ccgtgtgacc 60attacctgcc atgcgagcca ggatattaac gtgaacattg gctggctgca gcagaaaccg 120ggcaaaagct ttaaaggcct gatttatcat ggcaaaaacc tggaagatgg cgtgccgagc 180cgttttagcg gcagcggcag cggcaccgat tttaccctga ccattagcag cctgcagccg 240gaagattttg cgacctatta ttgcaatcag tatgaaaata acccaattac atttggccag 300ggcaccaaag tggaaattaa acgtggtgga ggcggttcag gcggaggtgg ctctggcggt 360ggcggatcgg atgtgcagct ggtggaaagc ggcggcggcc tggtgcagcc gggcggcagc 420ctgcgtctga gctgcgcggt gagcggctat agcattacca gcgattatgc gtggaactgg 480attcgtcagg cgccgggcaa aggcctggaa tggctgggct atattagcta tcgtggccgc 540accagctata acccgagcct gaaaagccgt attagcatta cccgtgataa cagcaaaaac 600acctttttcc tgcagctgaa cagcctgcgt gcggaagata ccgcggtgta ttattgcgcg 660cgcctgggac gcggcttccg ctactggggc cagggcaccc tggtgaccgt gagcagc 71769239PRTArtificial sequenceamino acid sequence of single chain antibody S8 69Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys His Ala Ser Gln Asp Ile Asn Val Asn 20 25 30Ile Gly Trp Leu Gln Gln Lys Pro Gly Lys Ser Phe Lys Gly Leu Ile 35 40 45Tyr His Gly Lys Asn Leu Glu Asp Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Asn Gln Tyr Glu Asn Asn Pro Ile 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Gly Gly Gly Gly 100 105 110Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu Val 115 120 125Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser 130 135 140Cys Ala Val Ser Gly Tyr Ser Ile Thr Ser Asp Tyr Ala Trp Asn Trp145 150 155 160Ile Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu Gly Tyr Ile Ser 165 170 175Tyr Arg Gly Arg Thr Ser Tyr Asn Pro Ser Leu Lys Ser Arg Ile Ser 180 185 190Ile Thr Arg Asp Asn Ser Lys Asn Thr Phe Phe Leu Gln Leu Asn Ser 195 200 205Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Leu Gly Arg 210 215 220Gly Phe Arg Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser225 230 23570717DNAArtificial sequencenucleotide sequence of single chain antibody S17 70gatattcaga tgacccagag cccgagcagc ctgagcgcga gcgtgggcga ccgtgtgacc 60attacctgcc atgcgagcca ggatattaac accaacattg gctggctgca gcagaaaccg 120ggcaaagcgt ttaaaggcct gatttatcat ggcaaaaacc tggaagatgg cgtgccgagc 180cgttttagcg gcagcggcag cggcaccgat tttaccctga ccattagcag cctgcagccg 240gaagattttg cgacctatta ttgcaatcag tatgaaaata acccactgac atttggccag 300ggcaccaaag tggaaattaa acgtggtgga ggcggttcag gcggaggtgg ctctggcggt 360ggcggatcgg atgtgcagct ggtggaaagc ggcggcggcc tggtgcagcc gggcggcagc 420ctgcgtctga gctgcgcggt gagcggctat agcattacca gcgattatgc gtggaactgg 480attcgtcagg cgccgggcaa aggcctggaa tggctgggct atattagcta tcgtggccgc 540acccagtata acccgagcct gaaaagccgt attagcatta cccgtgataa cagcaaaaac 600acctttttcc tgcagctgaa cagcctgcgt gcggaagata ccgcggtgta ttattgcgcg 660cgcctgggac gcggcttccg ctactggggc cagggcaccc tggtgaccgt gagcagc 71771239PRTArtificial sequenceamino acid sequence of single chain antibody S17 71Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys His Ala Ser Gln Asp Ile Asn Thr Asn 20 25 30Ile Gly Trp Leu Gln Gln Lys Pro Gly Lys Ala Phe Lys Gly Leu Ile 35 40 45Tyr His Gly Lys Asn Leu Glu Asp Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Asn Gln Tyr Glu Asn Asn Pro Leu 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Gly Gly Gly Gly 100 105 110Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu Val 115 120 125Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser 130 135 140Cys Ala Val Ser Gly Tyr Ser Ile Thr Ser Asp Tyr Ala Trp Asn Trp145 150 155 160Ile Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu Gly Tyr Ile Ser 165 170 175Tyr Arg Gly Arg Thr Gln Tyr Asn Pro Ser Leu Lys Ser Arg Ile Ser 180 185 190Ile Thr Arg Asp Asn Ser Lys Asn Thr Phe Phe Leu Gln Leu Asn Ser 195 200 205Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Leu Gly Arg 210 215 220Gly Phe Arg Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser225 230 23572717DNAArtificial sequencenucleotide sequence of single chain antibody S22 72gatattcaga tgacccagag cccgagcagc ctgagcgcga gcgtgggcga ccgtgtgacc 60attacctgcc atgcgagcca ggatattaac gtgaacattg gctggctgca gcagaaaccg 120ggcaaagcgt ttaaaggcct gatttatcat ggcaccaacc tggaagatgg cgtgccgagc 180cgttttagcg gcagcggcag cggcaccgat tttaccctga ccattagcag cctgcagccg 240gaagattttg cgacctatta ttgcaatcag tatgaaaata acccactgac atttggccag 300ggcaccaaag tggaaattaa acgtggtgga ggcggttcag gcggaggtgg ctctggcggt 360ggcggatcgg atgtgcagct ggtggaaagc ggcggcggcc tggtgcagcc gggcggcagc 420ctgcgtctga gctgcgcggt gagcggctat agcattacca gcgattatgc gtggaactgg 480attcgtcagg cgccgggcaa aggcctggaa tggctgggct atattagcta tcgtggccgc 540acccgctata acccgagcct gaaaagccgt attagcatta cccgtgataa cagcaaaaac 600acctttttcc tgcagctgaa cagcctgcgt gcggaagata ccgcggtgta ttattgcgcg 660cgcctgggac gcggcttccg ctactggggc cagggcaccc tggtgaccgt gagcagc 71773239PRTArtificial sequenceamino acid sequence of single chain antibody S22 73Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys His Ala Ser Gln Asp Ile

Asn Val Asn 20 25 30Ile Gly Trp Leu Gln Gln Lys Pro Gly Lys Ala Phe Lys Gly Leu Ile 35 40 45Tyr His Gly Thr Asn Leu Glu Asp Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Asn Gln Tyr Glu Asn Asn Pro Leu 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Gly Gly Gly Gly 100 105 110Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu Val 115 120 125Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser 130 135 140Cys Ala Val Ser Gly Tyr Ser Ile Thr Ser Asp Tyr Ala Trp Asn Trp145 150 155 160Ile Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu Gly Tyr Ile Ser 165 170 175Tyr Arg Gly Arg Thr Arg Tyr Asn Pro Ser Leu Lys Ser Arg Ile Ser 180 185 190Ile Thr Arg Asp Asn Ser Lys Asn Thr Phe Phe Leu Gln Leu Asn Ser 195 200 205Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Leu Gly Arg 210 215 220Gly Phe Arg Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser225 230 23574717DNAArtificial sequencenucleotide sequence of single chain antibody S23 74gatattcaga tgacccagag cccgagcagc ctgagcgcga gcgtgggcga ccgtgtgacc 60attacctgcc atgcgagcca ggatattaac gtgaacattg gctggctgca gcagaaaccg 120ggcaaaagct ttaaaggcct gatttatcat ggcaaaaacc tggaagatgg cgtgccgagc 180cgttttagcg gcagcggcag cggcaccgat tttaccctga ccattagcag cctgcagccg 240gaagattttg cgacctatta ttgcaatcag tatgaaaata acccactgac atttggccag 300ggcaccaaag tggaaattaa acgtggtgga ggcggttcag gcggaggtgg ctctggcggt 360ggcggatcgg atgtgcagct ggtggaaagc ggcggcggcc tggtgcagcc gggcggcagc 420ctgcgtctga gctgcgcggt gagcggctat agcattacca gcgattatgc gtggaactgg 480attcgtcagg cgccgggcaa aggcctggaa tggctgggct atattagcta tcgtggccgc 540acccgctata acccgagcct gaaaagccgt attagcatta cccgtgataa cagcaaaaac 600acctttttcc tgcagctgaa cagcctgcgt gcggaagata ccgcggtgta ttattgcgcg 660cgcctgggac gcggcttccg ctactggggc cagggcaccc tggtgaccgt gagcagc 71775239PRTArtificial sequenceamino acid sequence of single chain antibody S23 75Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys His Ala Ser Gln Asp Ile Asn Val Asn 20 25 30Ile Gly Trp Leu Gln Gln Lys Pro Gly Lys Ser Phe Lys Gly Leu Ile 35 40 45Tyr His Gly Lys Asn Leu Glu Asp Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Asn Gln Tyr Glu Asn Asn Pro Leu 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Gly Gly Gly Gly 100 105 110Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu Val 115 120 125Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser 130 135 140Cys Ala Val Ser Gly Tyr Ser Ile Thr Ser Asp Tyr Ala Trp Asn Trp145 150 155 160Ile Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu Gly Tyr Ile Ser 165 170 175Tyr Arg Gly Arg Thr Arg Tyr Asn Pro Ser Leu Lys Ser Arg Ile Ser 180 185 190Ile Thr Arg Asp Asn Ser Lys Asn Thr Phe Phe Leu Gln Leu Asn Ser 195 200 205Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Leu Gly Arg 210 215 220Gly Phe Arg Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser225 230 23576717DNAArtificial sequencenucleotide sequence of single chain antibody S29 76gatattcaga tgacccagag cccgagcagc ctgagcgcga gcgtgggcga ccgtgtgacc 60attacctgcc atgcgagcca ggatattaac gtgaacattg gctggctgca gcagaaaccg 120ggcaaagcgt ttaaaggcct gatttatcat ggcaaaaacc tggaagatgg cgtgccgagc 180cgttttagcg gcagcggcag cggcaccgat tttaccctga ccattagcag cctgcagccg 240gaagattttg cgacctatta ttgcaatcag tatgaaaatt tcccactgac atttggccag 300ggcaccaaag tggaaattaa acgtggtgga ggcggttcag gcggaggtgg ctctggcggt 360ggcggatcgg atgtgcagct ggtggaaagc ggcggcggcc tggtgcagcc gggcggcagc 420ctgcgtctga gctgcgcggt gagcggctat agcattacca gcgattatgc gtggaactgg 480attcgtcagg cgccgggcaa aggcctggaa tggctgggct atattagcta tcgtggccgc 540acccgctata acccgagcct gaaaagccgt attagcatta cccgtgataa cagcaaaaac 600acctttttcc tgcagctgaa cagcctgcgt gcggaagata ccgcggtgta ttattgcgcg 660cgcctgggac gcggcttccg ctactggggc cagggcaccc tggtgaccgt gagcagc 71777239PRTArtificial sequenceamino acid sequence of single chain antibody S29 77Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15Asp Arg Val Thr Ile Thr Cys His Ala Ser Gln Asp Ile Asn Val Asn 20 25 30Ile Gly Trp Leu Gln Gln Lys Pro Gly Lys Ala Phe Lys Gly Leu Ile 35 40 45Tyr His Gly Lys Asn Leu Glu Asp Gly Val Pro Ser Arg Phe Ser Gly 50 55 60Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Asn Gln Tyr Glu Asn Phe Pro Leu 85 90 95Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Gly Gly Gly Gly 100 105 110Ser Gly Gly Gly Gly Ser Gly Gly Gly Gly Ser Asp Val Gln Leu Val 115 120 125Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly Ser Leu Arg Leu Ser 130 135 140Cys Ala Val Ser Gly Tyr Ser Ile Thr Ser Asp Tyr Ala Trp Asn Trp145 150 155 160Ile Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Leu Gly Tyr Ile Ser 165 170 175Tyr Arg Gly Arg Thr Arg Tyr Asn Pro Ser Leu Lys Ser Arg Ile Ser 180 185 190Ile Thr Arg Asp Asn Ser Lys Asn Thr Phe Phe Leu Gln Leu Asn Ser 195 200 205Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ala Arg Leu Gly Arg 210 215 220Gly Phe Arg Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser225 230 235

Claims

1-36. (canceled)

37. A multi-functional immunoconjugate, comprising: an antibody; and a functional molecule linked thereto; and the functional molecule is selected from a group consisting of a molecule that targets a tumor surface marker, a tumor-suppressing molecule, a molecule that targets a surface marker of an immune cell, a detectable label; wherein the antibody specifically recognizing EGFRvIII expressed or EGFR overexpressed by tumor cells, wherein the antibody comprises a light chain variable region and a heavy chain variable region, and CDR1 of the light chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 41, SEQ ID NO: 47, SEQ ID NO: 55; CDR2 of the light chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 42, SEQ ID NO: 53; CDR3 of the light chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 43, SEQ ID NO: 48, SEQ ID NO: 54, SEQ ID NO: 56, SEQ ID NO: 57; CDR1 of the heavy chain variable region has the amino acid sequence of SEQ ID NO: 44; CDR2 of the heavy chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 45, SEQ ID NO: 49, SEQ ID NO: 51, SEQ ID NO: 52; CDR3 of the heavy chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 46, SEQ ID NO: 50.

38. The multi-functional immunoconjugate of claim 37, wherein the molecule that targets the tumor surface marker is an antibody or ligand that binds to a tumor surface marker; or the tumor-suppressing molecule is an anti-tumor cytokine or an anti-tumor toxin; preferably, the cytokines include but are not limited to: IL-12, IL-15, IFN-beta, TNF-alpha.

39. The multi-functional immunoconjugate of claim 37, wherein the detectable label includes a fluorescent label and a chromogenic label.

40. The multi-functional immunoconjugate of claim 37, wherein the molecule targeting the surface marker of the immune cell is an antibody or ligand that binds to an immune cell surface marker; preferably, the immune cell surface markers include: CD3, CD16, CD28.

41. The multi-functional immunoconjugate of claim 40, wherein the molecule that targets the surface marker of the immune cell is an antibody that binds to a T cell surface marker, which forms a T-cell-engaging bifunctional antibody with the following antibody: an antibody specifically recognizing EGFRvIII expressed or EGFR overexpressed by tumor cells, wherein the antibody comprises a light chain variable region and a heavy chain variable region, and CDR1 of the light chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 41, SEQ ID NO: 47, SEQ ID NO: 55; CDR2 of the light chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 42, SEQ ID NO: 53; CDR3 of the light chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 43, SEQ ID NO: 48, SEQ ID NO: 54, SEQ ID NO: 56, SEQ ID NO: 57; CDR1 of the heavy chain variable region has the amino acid sequence of SEQ ID NO: 44; CDR2 of the heavy chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 45, SEQ ID NO: 49, SEQ ID NO: 51, SEQ ID NO: 52; CDR3 of the heavy chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 46, SEQ ID NO: 50.

42. The multi-functional immunoconjugate of claim 41, wherein the antibody that binds to the immune cell surface marker is an anti-CD3 antibody.

43. The multi-functional immunoconjugate of claim 37, wherein the multi-functional immunoconjugate is a fusion polypeptide, and further comprises a linker peptide between the following antibody and the functional molecule linked thereto: an antibody specifically recognizing EGFRvIII expressed or EGFR overexpressed by tumor cells, wherein the antibody comprises a light chain variable region and a heavy chain variable region, and CDR1 of the light chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 41, SEQ ID NO: 47, SEQ ID NO: 55; CDR2 of the light chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 42, SEQ ID NO: 53; CDR3 of the light chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 43, SEQ ID NO: 48, SEQ ID NO: 54, SEQ ID NO: 56, SEQ ID NO: 57; CDR1 of the heavy chain variable region has the amino acid sequence of SEQ ID NO: 44; CDR2 of the heavy chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 45, SEQ ID NO: 49, SEQ ID NO: 51, SEQ ID NO: 52; CDR3 of the heavy chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 46, SEQ ID NO: 50.

44. A chimeric antigen receptor expressed on the surface of an immune cell comprising an antibody, wherein the chimeric antigen receptor comprises: the antibody, a transmembrane region and an intracellular signal region, which are sequentially linked; wherein the antibody specifically recognizing EGFRvIII expressed or EGFR overexpressed by tumor cells, wherein the antibody comprises a light chain variable region and a heavy chain variable region, and CDR1 of the light chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 41, SEQ ID NO: 47, SEQ ID NO: 55; CDR2 of the light chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 42, SEQ ID NO: 53; CDR3 of the light chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 43, SEQ ID NO: 48, SEQ ID NO: 54, SEQ ID NO: 56, SEQ ID NO: 57; CDR1 of the heavy chain variable region has the amino acid sequence of SEQ ID NO: 44; CDR2 of the heavy chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 45, SEQ ID NO: 49, SEQ ID NO: 51, SEQ ID NO: 52; CDR3 of the heavy chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 46, SEQ ID NO: 50.

45. The chimeric antigen receptor of claim 44, wherein the intracellular signal region is selected from a group consisting of intracellular signal region sequences of CD3.zeta., Fc.epsilon.RI.gamma., CD27, CD28, CD137 and CD134, or a combination thereof.

46. The chimeric antigen receptor of claim 45, wherein the transmembrane region comprises a transmembrane region of CD8 or CD28.

47. The chimeric antigen receptor of claim 45, wherein the immune cells include T lymphocyte, NK cell or NKT cell.

48. The chimeric antigen receptor of claim 45, wherein the chimeric antigen receptor comprises an antibody, transmembrane region and intracellular signal region which are sequentially linked as follows: Antibody, CD8 and CD3.zeta.; Antibody, CD8, CD137 and CD3.zeta.; Antibody, a transmembrane region of a CD28 molecule, an intracellular signal region of a CD28 molecule, and CD3.zeta.; or Antibody, a transmembrane region of a CD28 molecule, an intracellular signal region of a CD28 molecule, CD137 and CD3.zeta.; Wherein the antibody is an antibody specifically recognizing EGFRvIII expressed or EGFR overexpressed by tumor cells, wherein the antibody comprises a light chain variable region and a heavy chain variable region, and CDR1 of the light chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 41, SEQ ID NO: 47, SEQ ID NO: 55; CDR2 of the light chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 42, SEQ ID NO: 53; CDR3 of the light chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 43, SEQ ID NO: 48, SEQ ID NO: 54, SEQ ID NO: 56, SEQ ID NO: 57; CDR1 of the heavy chain variable region has the amino acid sequence of SEQ ID NO: 44; CDR2 of the heavy chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 45, SEQ ID NO: 49, SEQ ID NO: 51, SEQ ID NO: 52; CDR3 of the heavy chain variable region has an amino acid sequence selected from a group consisting of SEQ ID NO: 46, SEQ ID NO: 50.

49. The chimeric antigen receptor of claim 45, wherein the antibody is a single chain antibody or a domain antibody.

50. The chimeric antigen receptor of claim 45, wherein the chimeric antigen receptor comprises: SEQ ID NO: 36 or the amino acid sequence shown in positions 285-601; or SEQ ID NO: 37 or the amino acid sequence shown in positions 285-702; or SEQ ID NO: 38 or the amino acid sequence shown in positions 285-744; or SEQ ID NO: 39 or the amino acid sequence shown in positions 285-749; or SEQ ID NO: 40 or the amino acid sequence shown in positions 285-791.

51. A genetically modified immune cell, wherein it is transduced with a nucleic acid encoding the chimeric antigen receptor of claim 44, or an expression vector comprising the nucleic acid or a virus comprising the vector; or it expresses the chimeric antigen receptor of claim 8 at its surface.

52. The immune cell of claim 51, wherein it further carries an exogenous encoding sequence for cytokine; preferably, the cytokine includes: IL-12, IL-15 or IL-21

53. The immune cell of claim 51, wherein it further expresses another chimeric antigen receptor that does not contain CD3.zeta., but contains the intracellular signaling domain of CD28, the intracellular signaling domain of CD137, or a combination of both.

54. The immune cell of claim 51, wherein it further expresses a chemokine receptor; preferably, the chemokine receptor includes CCR2.

55. The immune cell of claim 51, wherein it further expresses siRNA that can reduce PD-1 expression or a protein that can block PD-L1.

56. The immune cell of claim 51, wherein it further expresses a safety switch; preferably, the safety switch includes iCaspase-9, Truancated EGFR or RQR8.