Variant Nucleic Acid Libraries For Coronavirus

Abstract

Provided herein are methods and compositions relating to libraries of optimized antibodies having nucleic acids encoding for an antibody comprising modified sequences. Libraries described herein comprise nucleic acids encoding SARS-CoV-2 or ACE2 antibodies. Further described herein are protein libraries generated when the nucleic acid libraries are translated. Further described herein are cell libraries expressing variegated nucleic acid libraries described herein.

Description

CROSS-REFERENCE

[0001] This application claims the benefit of U.S. Provisional Patent Application No. 63/115,568 filed on Nov. 18, 2020, U.S. Provisional Patent Application No. 63/104,465 filed on Oct. 22, 2020, U.S. Provisional Patent Application No. 63/073,362 filed on Sep. 1, 2020, U.S. Provisional Patent Application No. 63/069,665 filed on Aug. 24, 2020, U.S. Provisional Patent Application No. 63/034,896 filed on Jun. 4, 2020, U.S. Provisional Patent Application No. 63/016,254 filed on Apr. 27, 2020, each of which is incorporated by reference in its entirety.

BACKGROUND

[0002] Coronaviruses like severe acute respiratory coronavirus 2 (SARS-CoV-2) can cause severe respiratory problems. Therapies are needed for treating and preventing viral infection caused by coronaviruses like SARS-CoV-2. Antibodies possess the capability to bind with high specificity and affinity to biological targets. However, the design of therapeutic antibodies is challenging due to balancing of immunological effects with efficacy. Thus, there is a need to develop compositions and methods for the optimization of antibody properties in order to develop effective therapies for treating coronavirus infections.

INCORPORATION BY REFERENCE

[0003] All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication, patent, or patent application was specifically and individually indicated to be incorporated by reference.

BRIEF SUMMARY

[0004] Provided herein are nucleic acid libraries comprising: a plurality of sequences that when translated encode for antibodies or antibody fragments that bind to SARS-CoV-2 or ACE2 protein, wherein each of the sequences comprises a predetermined number of variants within a CDR relative to an input sequence that encodes an antibody, and wherein the library comprises at least 50,000 variant sequences. Further provided herein are nucleic acid libraries, wherein the antibodies or antibody fragments bind to a spike glycoprotein, a membrane protein, an envelope protein, a nucleocapsid protein, or combinations thereof of the SARS-CoV-2. Further provided herein are nucleic acid libraries, wherein the antibodies or antibody fragments bind to a spike glycoprotein. Further provided herein are nucleic acid libraries, wherein the antibodies or antibody fragment bind to a receptor binding domain of the spike glycoprotein. Further provided herein are nucleic acid libraries, wherein the library comprises at least 100,000 variant sequences. Further provided herein are nucleic acid libraries, wherein at least some of the sequences encode for an antibody light chain. Further provided herein are nucleic acid libraries, wherein at least some of the sequences encode for an antibody heavy chain. Further provided herein are nucleic acid libraries, wherein each sequence of the plurality of sequences comprises at least one variant in the CDR of a heavy chain or light chain relative to the input sequence. Further provided herein are nucleic acid libraries, wherein each sequence of the plurality of sequences comprises at least two variants in the CDR of a heavy chain or light chain relative to the input sequence. Further provided herein are nucleic acid libraries, wherein at least one of the variants is present in at least two individuals. Further provided herein are nucleic acid libraries, wherein at least one of the variants is present in at least three individuals. Further provided herein are nucleic acid libraries, wherein at least one sequence when translated encodes for an antibody or antibody fragment having at least 5.times. higher binding affinity than a binding affinity of the input sequence. Further provided herein are nucleic acid libraries, wherein at least one sequence when translated encodes for an antibody or antibody fragment having at least 25.times. higher binding affinity than a binding affinity of the input sequence. Further provided herein are nucleic acid libraries, wherein at least one sequence when translated encodes for an antibody or antibody fragment having at least 50.times. higher binding affinity than a binding affinity of the input sequence. Further provided herein are nucleic acid libraries, wherein each sequence of the plurality of sequences comprises at least one variant in the CDR of a heavy chain or light chain relative to a germline sequence of the input sequence. Further provided herein are nucleic acid libraries, wherein the CDR is a CDR1, CDR2, and CDR3 on a heavy chain. Further provided herein are nucleic acid libraries, wherein the CDR is a CDR1, CDR2, and CDR3 on a light chain. Further provided herein are nucleic acid libraries, wherein the at least one sequence that when translated encodes for an antibody or antibody fragment having at least 70.times. higher binding affinity than the input sequence. Further provided herein are nucleic acid libraries, wherein the at least one sequence that when translated encodes for an antibody or antibody fragment having a K.sub.D of less than 50 nM. Further provided herein are nucleic acid libraries, wherein the at least one sequence that when translated encodes for an antibody or antibody fragment having a K.sub.D of less than 25 nM. Further provided herein are nucleic acid libraries, wherein the at least one sequence that when translated encodes for an antibody or antibody fragment having a K.sub.D of less than 10 nM. Further provided herein are nucleic acid libraries, wherein the at least one sequence that when translated encodes for an antibody or antibody fragment having a K.sub.D of less than 5 nM. Further provided herein are nucleic acid libraries, wherein the library encodes a CDR sequence of any one of SEQ ID NOs: 1-591.

[0005] Provided herein are nucleic acid libraries comprising: a plurality of sequences that when translated encode for antibodies or antibody fragments that bind to a coronavirus or a receptor of the coronavirus, wherein each of the sequences comprises a predetermined number of variants within a CDR relative to an input sequence that encodes an antibody, and wherein the library comprises at least 50,000 variant sequences. Further provided herein are nucleic acid libraries, wherein the coronavirus is SARS-CoV, MERS-CoV, CoV-229E, HCoV-NL63, HCoV-OC43, or HCoV-HKU1. Further provided herein are nucleic acid libraries, wherein the receptor of the coronavirus is ACE2 or dipeptidyl peptidase 4 (DPP4). Further provided herein are nucleic acid libraries, wherein the library comprises at least 100,000 variant sequences. Further provided herein are nucleic acid libraries, wherein at least some of the sequences encode for an antibody light chain. Further provided herein are nucleic acid libraries, wherein at least some of the sequences encode for an antibody heavy chain. Further provided herein are nucleic acid libraries, wherein each sequence of the plurality of sequences comprises at least one variant in the CDR of a heavy chain or light chain relative to the input sequence. Further provided herein are nucleic acid libraries, wherein each sequence of the plurality of sequences comprises at least two variants in the CDR of a heavy chain or light chain relative to the input sequence. Further provided herein are nucleic acid libraries, wherein at least one of the variants is present in at least two individuals. Further provided herein are nucleic acid libraries, wherein at least one of the variants is present in at least three individuals. Further provided herein are nucleic acid libraries, wherein at least one sequence when translated encodes for an antibody or antibody fragment having at least 5.times. higher binding affinity than a binding affinity of the input sequence. Further provided herein are nucleic acid libraries, wherein at least one sequence when translated encodes for an antibody or antibody fragment having at least 25.times. higher binding affinity than a binding affinity of the input sequence. Further provided herein are nucleic acid libraries, wherein at least one sequence when translated encodes for an antibody or antibody fragment having at least 50.times. higher binding affinity than a binding affinity of the input sequence. Further provided herein are nucleic acid libraries, wherein each sequence of the plurality of sequences comprises at least one variant in the CDR of a heavy chain or light chain relative to a germline sequence of the input sequence. Further provided herein are nucleic acid libraries, wherein the CDR is a CDR1, CDR2, and CDR3 on a heavy chain. Further provided herein are nucleic acid libraries, wherein the CDR is a CDR1, CDR2, and CDR3 on a light chain. Further provided herein are nucleic acid libraries, wherein the at least one sequence that when translated encodes for an antibody or antibody fragment having at least 70.times. higher binding affinity than the input sequence. Further provided herein are nucleic acid libraries, wherein the at least one sequence that when translated encodes for an antibody or antibody fragment having a K.sub.D of less than 50 nM. Further provided herein are nucleic acid libraries, wherein the at least one sequence that when translated encodes for an antibody or antibody fragment having a K.sub.D of less than 25 nM. Further provided herein are nucleic acid libraries, wherein the at least one sequence that when translated encodes for an antibody or antibody fragment having a K.sub.D of less than 10 nM. Further provided herein are nucleic acid libraries, wherein the at least one sequence that when translated encodes for an antibody or antibody fragment having a K.sub.D of less than 5 nM.

[0006] Provided herein are antibodies, wherein the antibody comprises a sequence comprising at least 90% sequence identity to any one of SEQ ID NOs: 1-716.

[0007] Provided herein are antibodies, wherein the antibody comprises a sequence comprising at least 90% sequence identity to SEQ ID NOs: 1-716; and wherein the antibody is a monoclonal antibody, a polyclonal antibody, a bi-specific antibody, a multispecific antibody, a grafted antibody, a human antibody, a humanized antibody, a synthetic antibody, a chimeric antibody, a camelized antibody, a single-chain Fvs (scFv), a single chain antibody, a Fab fragment, a F(ab')2 fragment, a Fd fragment, a Fv fragment, a single-domain antibody, an isolated complementarity determining region (CDR), a diabody, a fragment comprised of only a single monomeric variable domain, disulfide-linked Fvs (sdFv), an intrabody, an anti-idiotypic (anti-Id) antibody, or ab antigen-binding fragments thereof.

[0008] Provided herein are methods of treating a SARS-CoV-2 infection, comprising administering the antibody as described herein. Further provided herein are methods, wherein the antibody is administered prior to exposure to SARS-CoV-2. Further provided herein are methods, wherein the antibody is administered at least about 1 week prior to exposure to SARS-CoV-2. Further provided herein are methods, wherein the antibody is administered at least about 1 month prior to exposure to SARS-CoV-2. Further provided herein are methods, wherein the antibody is administered at least about 5 months prior to exposure to SARS-CoV-2. Further provided herein are methods, wherein the antibody is administered after exposure to SARS-CoV-2. Further provided herein are methods, wherein the antibody is administered at most about 24 hours after exposure to SARS-CoV-2. Further provided herein are methods, wherein the antibody is administered at most about 1 week after exposure to SARS-CoV-2. Further provided herein are methods, wherein the antibody is administered at most about 1 month after exposure to SARS-CoV-2.

[0009] Provided herein are methods of treating an individual with a SARS-CoV-2 infection with the antibody as described herein comprising: (a) obtaining or having obtained a sample from the individual; (b) performing or having performed an expression level assay on the sample to determine expression levels of SARS-CoV-2 antibodies; and (c) if the sample has an expression level of the SARS-CoV-2 antibodies then administering to the individual the antibody as described herein, thereby treating the SARS-CoV-2 infection.

[0010] Provided herein are methods for optimizing an antibody comprising: (a) providing a plurality of polynucleotide sequences encoding for an antibody or antibody fragment, wherein the antibody or antibody fragment is derived from a subject having SARS-CoV-2; (b) generating a nucleic acid library comprising the plurality of sequences that when translated encode for antibodies or antibody fragments that bind SARS-CoV-2 or ACE2 protein, wherein each of the sequences comprises a predetermined number of variants within a CDR relative to an input sequence that encodes an antibody; wherein the library comprises at least 50,000 variant sequences; and (c) synthesizing the at least 50,000 variant sequences. Further provided herein are methods, wherein the antibody library comprises at least 100,000 sequences. Further provided herein are methods, wherein the method further comprises enriching a subset of the variant sequences. Further provided herein are methods, wherein the method further comprises expressing the antibody or antibody fragments corresponding to the variant sequences. Further provided herein are methods, wherein the polynucleotide sequence is a murine, human, or chimeric antibody sequence. Further provided herein are methods, wherein each sequence of the plurality of variant sequences comprises at least one variant in each CDR of a heavy chain or light chain, relative to the input sequence. Further provided herein are methods, wherein each sequence of the plurality of variant sequences comprises at least two variants in each CDR of a heavy chain or light chain relative to the input sequence. Further provided herein are methods, wherein at least one sequence when translated encodes for an antibody or antibody fragment having at least 5.times. higher binding affinity than a binding affinity of the input sequence. Further provided herein are methods, wherein at least one sequence when translated encodes for an antibody or antibody fragment having at least 25.times. higher binding affinity than a binding affinity of the input sequence. Further provided herein are methods, wherein at least one sequence when translated encodes for an antibody or antibody fragment having at least 50.times. higher binding affinity than a binding affinity of the input sequence. Further provided herein are methods, wherein each sequence comprises at least one variant in each CDR of a heavy chain or light chain relative to a germline sequence of the input sequence. Further provided herein are methods, wherein the nucleic acid library has a theoretical diversity of at least 10.sup.10 sequences. Further provided herein are methods, wherein the nucleic acid library has a theoretical diversity of at least 10.sup.12 sequences.

[0011] Provided herein are antibodies or antibody fragments comprising a variable domain, heavy chain region (VH) and a variable domain, light chain region (VL), wherein VH comprises complementarity determining regions CDRH1, CDRH2, and CDRH3, wherein VL comprises complementarity determining regions CDRL1, CDRL2, and CDRL3, and wherein (a) an amino acid sequence of CDRH1 is as set forth in any one of SEQ ID NOs: 1-36 or 217-282; (b) an amino acid sequence of CDRH2 is as set forth in any one of SEQ ID NOs: 37-72 or 283-348; (c) an amino acid sequence of CDRH3 is as set forth in any one of SEQ ID NOs: 73-108 or 349-414; (d) an amino acid sequence of CDRL1 is as set forth in any one of SEQ ID NOs: 109-144 or 415-473; (e) an amino acid sequence of CDRL2 is as set forth in any one of SEQ ID NOs: 145-180 or 415-473; and (f) an amino acid sequence of CDRL3 is as set forth in any one of SEQ ID NOs: 181-216 or 533-591. Further provided herein are antibodies or antibody fragments, wherein (a) an amino acid sequence of CDRH1 is as set forth in SEQ ID NO: 30; (b) an amino acid sequence of CDRH2 is as set forth in SEQ ID NO: 66; (c) an amino acid sequence of CDRH3 is as set forth in SEQ ID NO: 102; (d) an amino acid sequence of CDRL1 is as set forth in SEQ ID NO: 138; (e) an amino acid sequence of CDRL2 is as set forth in SEQ ID NO: 174; and (f) an amino acid sequence of CDRL3 is as set forth in SEQ ID NO: 210. Further provided herein are antibodies or antibody fragments, wherein (a) an amino acid sequence of CDRH1 is as set forth in SEQ ID NO: 35; (b) an amino acid sequence of CDRH2 is as set forth in SEQ ID NO: 71; (c) an amino acid sequence of CDRH3 is as set forth in SEQ ID NO: 107; (d) an amino acid sequence of CDRL1 is as set forth in SEQ ID NO: 143; (e) an amino acid sequence of CDRL2 is as set forth in SEQ ID NO: 179; and (f) an amino acid sequence of CDRL3 is as set forth in SEQ ID NO: 215. Further provided herein are antibodies or antibody fragments, wherein (a) an amino acid sequence of CDRH1 is as set forth in SEQ ID NO: 12; (b) an amino acid sequence of CDRH2 is as set forth in SEQ ID NO: 48; (c) an amino acid sequence of CDRH3 is as set forth in SEQ ID NO: 84; (d) an amino acid sequence of CDRL1 is as set forth in SEQ ID NO: 120; (e) an amino acid sequence of CDRL2 is as set forth in SEQ ID NO: 156; and (f) an amino acid sequence of CDRL3 is as set forth in SEQ ID NO: 192. Further provided herein are antibodies or antibody fragments, wherein (a) an amino acid sequence of CDRH1 is as set forth in SEQ ID NO: 31; (b) an amino acid sequence of CDRH2 is as set forth in SEQ ID NO: 67; (c) an amino acid sequence of CDRH3 is as set forth in SEQ ID NO: 103; (d) an amino acid sequence of CDRL1 is as set forth in SEQ ID NO: 139; (e) an amino acid sequence of CDRL2 is as set forth in SEQ ID NO: 175; and (f) an amino acid sequence of CDRL3 is as set forth in SEQ ID NO: 211. Further provided herein are antibodies or antibody fragments, wherein (a) an amino acid sequence of CDRH1 is as set forth in SEQ ID NO: 240; (b) an amino acid sequence of CDRH2 is as set forth in SEQ ID NO: 306; (c) an amino acid sequence of CDRH3 is as set forth in SEQ ID NO: 372; (d) an amino acid sequence of CDRL1 is as set forth in SEQ ID NO: 437; (e) an amino acid sequence of CDRL2 is as set forth in SEQ ID NO: 496; and (f) an amino acid sequence of CDRL3 is as set forth in SEQ ID NO: 555. Further provided herein are antibodies or antibody fragments, wherein (a) an amino acid sequence of CDRH1 is as set forth in SEQ ID NO: 244; (b) an amino acid sequence of CDRH2 is as set forth in SEQ ID NO: 310; (c) an amino acid sequence of CDRH3 is as set forth in SEQ ID NO: 376; (d) an amino acid sequence of CDRL1 is as set forth in SEQ ID NO: 437; (e) an amino acid sequence of CDRL2 is as set forth in SEQ ID NO: 496; and (f) an amino acid sequence of CDRL3 is as set forth in SEQ ID NO: 555. Further provided herein are antibodies or antibody fragments, wherein (a) an amino acid sequence of CDRH1 is as set forth in SEQ ID NO: 270; (b) an amino acid sequence of CDRH2 is as set forth in SEQ ID NO: 336; (c) an amino acid sequence of CDRH3 is as set forth in SEQ ID NO: 402; (d) an amino acid sequence of CDRL1 is as set forth in SEQ ID NO: 461; (e) an amino acid sequence of CDRL2 is as set forth in SEQ ID NO: 520; and (f) an amino acid sequence of CDRL3 is as set forth in SEQ ID NO: 579. Further provided herein are antibodies or antibody fragments, wherein the antibody or antibody fragment binds to a spike glycoprotein. Further provided herein are antibodies or antibody fragments, wherein the antibody or antibody fragment binds to a receptor binding domain of the spike glycoprotein. Further provided herein are antibodies or antibody fragments, wherein the antibody or antibody fragment comprises a K.sub.D of less than 50 nM. Further provided herein are antibodies or antibody fragments, wherein the antibody or antibody fragment comprises a K.sub.D of less than 25 nM. Further provided herein are antibodies or antibody fragments, wherein the antibody or antibody fragment comprises a K.sub.D of less than 10 nM. Further provided herein are antibodies or antibody fragments, wherein the antibody or antibody fragment comprises a K.sub.D of less than 5 nM.

[0012] Provided herein are antibodies or antibody fragments comprising a variable domain, heavy chain region (VH) and a variable domain, light chain region (VL), wherein the VH comprises an amino acid sequence at least about 90% identical to a sequence as set forth in any one of SEQ ID NOs: 592-657, and wherein the VL comprises an amino acid sequence at least about 90% identical to a sequence as set forth in any one of SEQ ID NOs: 658-716. Further provided herein are antibodies or antibody fragments, wherein the VH comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 594, and wherein the VL comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 660. Further provided herein are antibodies or antibody fragments, wherein the VH comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 595, and wherein the VL comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 661. Further provided herein are antibodies or antibody fragments, wherein the VH comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 598, and wherein the VL comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 664. Further provided herein are antibodies or antibody fragments, wherein the VH comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 603, and wherein the VL comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 669. Further provided herein are antibodies or antibody fragments, wherein the VH comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 615, and wherein the VL comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 680. Further provided herein are antibodies or antibody fragments, wherein the VH comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 631, and wherein the VL comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 691. Further provided herein are antibodies or antibody fragments, wherein the VH comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 645, and wherein the VL comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 704. Further provided herein are antibodies, wherein the antibody comprises a sequence comprising at least 90% sequence identity to any one of SEQ ID NOs: 1-716; and wherein the antibody is a monoclonal antibody, a polyclonal antibody, a bi-specific antibody, a multispecific antibody, a grafted antibody, a human antibody, a humanized antibody, a synthetic antibody, a chimeric antibody, a camelized antibody, a single-chain Fvs (scFv), a single chain antibody, a Fab fragment, a F(ab')2 fragment, a Fd fragment, a Fv fragment, a single-domain antibody, an isolated complementarity determining region (CDR), a diabody, a fragment comprised of only a single monomeric variable domain, disulfide-linked Fvs (sdFv), an intrabody, an anti-idiotypic (anti-Id) antibody, or ab antigen-binding fragments thereof.

[0013] Provided herein are nucleic acid compositions comprising: a) a first nucleic acid encoding a variable domain, heavy chain region (VH) comprising an amino acid sequence at least about 90% identical to a sequence as set forth in any one of SEQ ID NOs: 592-657; b) a second nucleic acid encoding a variable domain, light chain region (VL) comprising at least about 90% identical to a sequence as set forth in any one of SEQ ID NOs: 658-716; and an excipient.

[0014] Provided herein are methods of treating a SARS-CoV-2 infection, comprising administering the antibody or antibody fragment described herein. Further provided herein are methods, wherein the antibody is administered prior to exposure to SARS-CoV-2. Further provided herein are methods, wherein the antibody is administered at least about 1 week prior to exposure to SARS-CoV-2. Further provided herein are methods, wherein the antibody is administered at least about 1 month prior to exposure to SARS-CoV-2. Further provided herein are methods, wherein the antibody is administered at least about 5 months prior to exposure to SARS-CoV-2. Further provided herein are methods, wherein the antibody is administered after exposure to SARS-CoV-2. Further provided herein are methods, wherein the antibody is administered at most about 24 hours after exposure to SARS-CoV-2. Further provided herein are methods, wherein the antibody is administered at most about 1 week after exposure to SARS-CoV-2. Further provided herein are methods, wherein the antibody is administered at most about 1 month after exposure to SARS-CoV-2.

[0015] Provided herein are methods of treating an individual with a SARS-CoV-2 infection with the antibody or antibody fragment described herein comprising: a) obtaining or having obtained a sample from the individual; b) performing or having performed an expression level assay on the sample to determine expression levels of SARS-CoV-2 antibodies; and if the sample has an expression level of the SARS-CoV-2 antibodies then administering to the individual the antibody or antibody fragment described herein, thereby treating the SARS-CoV-2 infection.

[0016] Provided herein are methods for optimizing an antibody comprising: a) providing a plurality of polynucleotide sequences encoding for an antibody or antibody fragment, wherein the antibody or antibody fragment is derived from a subject having SARS-CoV-2; b) generating a nucleic acid library comprising the plurality of sequences that when translated encode for antibodies or antibody fragments that bind SARS-CoV-2 or ACE2 protein, wherein each of the sequences comprises a predetermined number of variants within a CDR relative to an input sequence that encodes an antibody; wherein the library comprises at least 50,000 variant sequences; and c) synthesizing the at least 50,000 variant sequences. Further provided herein are methods, wherein the antibody library comprises at least 100,000 sequences. Further provided herein are methods, wherein the method further comprises enriching a subset of the variant sequences. Further provided herein are methods, wherein the method further comprises expressing the antibody or antibody fragments corresponding to the variant sequences. Further provided herein are methods, wherein the polynucleotide sequence is a murine, human, or chimeric antibody sequence. Further provided herein are methods, wherein each sequence of the plurality of variant sequences comprises at least one variant in each CDR of a heavy chain or light chain, relative to the input sequence. Further provided herein are methods, wherein each sequence of the plurality of variant sequences comprises at least two variants in each CDR of a heavy chain or light chain relative to the input sequence. Further provided herein are methods, wherein at least one sequence when translated encodes for an antibody or antibody fragment having at least 5.times. higher binding affinity than a binding affinity of the input sequence. Further provided herein are methods, wherein at least one sequence when translated encodes for an antibody or antibody fragment having at least 25.times. higher binding affinity than a binding affinity of the input sequence. Further provided herein are methods, wherein at least one sequence when translated encodes for an antibody or antibody fragment having at least 50.times. higher binding affinity than a binding affinity of the input sequence. Further provided herein are methods, wherein each sequence comprises at least one variant in each CDR of a heavy chain or light chain relative to a germline sequence of the input sequence. Further provided herein are methods, wherein the nucleic acid library has a theoretical diversity of at least 10.sup.10 sequences. Further provided herein are methods, wherein the nucleic acid library has a theoretical diversity of at least 10.sup.12 sequences.

BRIEF DESCRIPTION OF THE DRAWINGS

[0017] FIG. 1 depicts a workflow for antibody optimization.

[0018] FIG. 2 presents a diagram of steps demonstrating an exemplary process workflow for gene synthesis as disclosed herein.

[0019] FIG. 3 illustrates an example of a computer system.

[0020] FIG. 4 is a block diagram illustrating an architecture of a computer system.

[0021] FIG. 5 is a diagram demonstrating a network configured to incorporate a plurality of computer systems, a plurality of cell phones and personal data assistants, and Network Attached Storage (NAS).

[0022] FIG. 6 is a block diagram of a multiprocessor computer system using a shared virtual address memory space.

[0023] FIG. 7 is a schema of a panning workflow.

[0024] FIGS. 8A-8B are graphs of panning data from round 4 for antibody 1.

[0025] FIGS. 8C-8D are graphs of panning data from round 4 for antibody 2.

[0026] FIGS. 9A-9B are graphs of panning data from round 4 for antibody 3.

[0027] FIGS. 9C-9D are graphs of panning data from round 4 for antibody 4.

[0028] FIG. 10 shows graphs of ACE2 binding to SARS-CoV-2 variant antibodies.

[0029] FIGS. 11A-11B are graphs of affinity data for SARS-CoV-2 variant antibodies.

[0030] FIG. 12 is a graph of binding of SARS-CoV-2 variant antibodies to 51 protein.

[0031] FIG. 13A is a graph of SARS-CoV-2 and ACE2 competition ELISAs from a first set.

[0032] FIG. 13B is a graph of SARS-CoV-2 and ACE2 competition ELISAs from a first set showing SARS-CoV-2 variant antibodies.

[0033] FIGS. 14A-14B are graphs from a first set (FIG. 14A) and second set (FIG. 14B) showing ACE2 variant antibodies.

[0034] FIGS. 14C-14D are graphs of SARS-CoV-2 variant antibodies in neutralization assays.

[0035] FIG. 15 is a graph of SARS-CoV-2 and ACE2 inhibition.

[0036] FIGS. 16A-16B are graphs of SARS-CoV-2 variant antibodies on VERO E6 inhibition measured by FACS.

[0037] FIG. 17A is a graph of SARS-CoV-2 variant antibodies on VERO E6 inhibition measured by FACS as compared to CR3022.

[0038] FIGS. 17B-17C are graphs of affinity of SARS-CoV-2 variant antibodies determined by coating ELISA plates with SARS-CoV-2 Spike Glycoprotein 51 (FIG. 17B) or S protein trimer (FIG. 17C).

[0039] FIG. 17D is a graph of mean fluorescent intensity (MFI) plotted for each SARS-CoV-2 variant antibody dilution.

[0040] FIGS. 18A-18C are graphs of mean fluorescent intensity (MFI) plotted for each SARS-CoV-2 variant antibody dilution.

[0041] FIGS. 19A-19B are graphs of antibody kinetics for variants 2-5, 2-2, and 2-6 (FIG. 19A) and variants 1-12, 1-42, 1-20, and 1-19 (FIG. 19B).

[0042] FIG. 19C is a graph of percent neutralization for variants 1-12, 1-42 and 1-20.

[0043] FIG. 19D is a graph of percent neutralization for variants 1-12, 1-42 and 1-20 using live virus.

[0044] FIGS. 20A-20D are graphs of variant antibodies neutralizing live virus.

[0045] FIG. 20E is a graph of variant antibodies neutralizing live virus FRNT.

[0046] FIG. 20E-20I show data of variant antibodies neutralizing live virus PRNT.

[0047] FIG. 21A shows a graph of percent weight change (y-axis) versus day post injection (PI, x-axis) for positive control convalescent plasma and negative control Mab c7d11.

[0048] FIG. 21B shows a graph of percent weight change (y-axis) versus day post injection (PI, x-axis) for variant antibody 6-63.

[0049] FIG. 21C shows a graph of percent weight change (y-axis) versus day post injection (PI, x-axis) for variant antibody 6-3.

[0050] FIG. 21D shows a graph of percent weight change (y-axis) versus day post injection (PI, x-axis) for variant antibody 6-36.

[0051] FIG. 21E shows graphs of percent weight change (y-axis) versus day post injection (PI, x-axis) based on dose.

[0052] FIG. 21F shows graphs of percent weight change (y-axis) versus day post injection (PI, x-axis) based on dose for variant antibodies 2-3, 2-63, and 1-20.

[0053] FIG. 21G shows a graph of data from a plaque assay to detect infectious virus in Day 9 lungs. The indicated antibodies were administered Day -1. Lungs were collected on Day 9, the right lobe was homogenized, clarified and supernatants were quantified by plaque titration. Individual hamster values are shown as symbols. White symbols indicate no infectious virus detected. The geometric mean PFU/gram is shown as bars. Limit of assay shown as dotted line.

[0054] FIG. 21H shows a graph of data from in situ hybridization (ISH) to detect infected cells in Day 9 lungs. The indicated antibodies were administered Day -1. Three animals per group were analyzed. Individual hamster values are shown as symbols. Median ISH scores are shown as bars.

[0055] FIG. 21I shows a graph of data from cumulative inflammation and edema scores for Day 9 lungs. The indicated antibodies were administered Day -1. Three animals per group were analyzed. Individual hamster cumulative pathology scores are shown as symbols. Median scores are shown as bars.

[0056] FIG. 22A shows a graph of the positive control pAb in a neutralization assay.

[0057] FIG. 22B shows a graph of neutralization of antibodies 6-63, 6-3, and 1-12 in VSV-SARS B.135 strain.

[0058] FIG. 23A shows a graph of the positive control in a neutralization assay.

[0059] FIGS. 23B-23C show graphs of neutralization by antibodies described herein.

[0060] FIG. 24A shows graphs weight change. Animals were immunosuppressed and then exposed to SARS-CoV-2 virus, WA1 strain, on Day 0. Top graph indicates data from the control group that received the cocktail on Day -1 (D-1, Group A). A group was immunosuppressed but not exposed to virus (CYP Control, Group I). Negative control is an IgG monoclonal (Group H). The cocktail was administered on the indicated day post-exposure (Groups B-G; middle and bottom graphs). Arrows indicate day of antibody administration. Symbols are mean.+-.SEM. Statistical differences in the area under the curve (AOC) are shown to the right of each line. * indicates p value <0.05, ns=not significant.

[0061] FIG. 24B shows a graph of data from FIG. 24A plotted on one graph.

[0062] FIG. 24C shows a graph of infectious virus in lungs on Day 14. Plaque assays were run on Day 14 lung homogenates. Plaque forming units (PFU) per gram of tissue were calculated and plotted. The limit of the assay is shown as a dotted line. Bars are the geometric means for each group. Group ID are in parentheses. White symbols indicated no infectious virus was detected. CYP=cyclophosphamide; Neg=Negative; Cont=control.

[0063] FIG. 24D shows a graph infectious virus in lungs of untreated control hamsters. CYP-treated animals were exposed to 1,000 pfu of virus by intranasal route on Day 0. Groups of four animals were euthanized and lungs were collected on the indicated days. Lung homogenates were assayed for infectious virus by plaque assay. Plaque forming units (PFU) per gram lung tissue are plotted. Geometric mean titers and SD are shown.

DETAILED DESCRIPTION

[0064] The present disclosure employs, unless otherwise indicated, conventional molecular biology techniques, which are within the skill of the art. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as is commonly understood by one of ordinary skill in the art.

Definitions

[0065] Throughout this disclosure, various embodiments are presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of any embodiments. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range to the tenth of the unit of the lower limit unless the context clearly dictates otherwise. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual values within that range, for example, 1.1, 2, 2.3, 5, and 5.9. This applies regardless of the breadth of the range. The upper and lower limits of these intervening ranges may independently be included in the smaller ranges, and are also encompassed within the disclosure, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the disclosure, unless the context clearly dictates otherwise.

[0066] The terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting of any embodiment. As used herein, the singular forms "a," "an" and "the" are intended to include the plural forms as well, unless the context clearly indicates otherwise. It will be further understood that the terms "comprises" and/or "comprising," when used in this specification, specify the presence of stated features, integers, steps, operations, elements, and/or components, but do not preclude the presence or addition of one or more other features, integers, steps, operations, elements, components, and/or groups thereof. As used herein, the term "and/or" includes any and all combinations of one or more of the associated listed items.

[0067] Unless specifically stated or obvious from context, as used herein, the term "about" in reference to a number or range of numbers is understood to mean the stated number and numbers +/-10% thereof, or 10% below the lower listed limit and 10% above the higher listed limit for the values listed for a range.

[0068] Unless specifically stated, as used herein, the term "nucleic acid" encompasses double- or triple-stranded nucleic acids, as well as single-stranded molecules. In double- or triple-stranded nucleic acids, the nucleic acid strands need not be coextensive (i.e., a double-stranded nucleic acid need not be double-stranded along the entire length of both strands). Nucleic acid sequences, when provided, are listed in the 5' to 3' direction, unless stated otherwise. Methods described herein provide for the generation of isolated nucleic acids. Methods described herein additionally provide for the generation of isolated and purified nucleic acids. A "nucleic acid" as referred to herein can comprise at least 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, or more bases in length. Moreover, provided herein are methods for the synthesis of any number of polypeptide-segments encoding nucleotide sequences, including sequences encoding non-ribosomal peptides (NRPs), sequences encoding non-ribosomal peptide-synthetase (NRPS) modules and synthetic variants, polypeptide segments of other modular proteins, such as antibodies, polypeptide segments from other protein families, including non-coding DNA or RNA, such as regulatory sequences e.g. promoters, transcription factors, enhancers, siRNA, shRNA, RNAi, miRNA, small nucleolar RNA derived from microRNA, or any functional or structural DNA or RNA unit of interest. The following are non-limiting examples of polynucleotides: coding or non-coding regions of a gene or gene fragment, intergenic DNA, loci (locus) defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, short interfering RNA (siRNA), short-hairpin RNA (shRNA), micro-RNA (miRNA), small nucleolar RNA, ribozymes, complementary DNA (cDNA), which is a DNA representation of mRNA, usually obtained by reverse transcription of messenger RNA (mRNA) or by amplification; DNA molecules produced synthetically or by amplification, genomic DNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers. cDNA encoding for a gene or gene fragment referred herein may comprise at least one region encoding for exon sequences without an intervening intron sequence in the genomic equivalent sequence. cDNA described herein may be generated by de novo synthesis.

[0069] Antibody Optimization Library for Coronavirus

[0070] Provided herein are methods, compositions, and systems for the optimization of antibodies for coronavirus. In some embodiments, the antibodies are optimized for SARS-CoV, MERS-CoV, CoV-229E, HCoV-NL63, HCoV-OC43, or HCoV-HKU1. In some embodiments, the antibodies are optimized for SARS-CoV-2. In some embodiments, the antibodies are optimized for a receptor that binds to the coronavirus. In some embodiments, the receptor of the coronavirus is ACE2 or dipeptidyl peptidase 4 (DPP4). In some embodiments, the antibodies are optimized based on interactions between the coronavirus and the receptor that binds the coronavirus. In some embodiments, the antibodies are optimized for angiotensin-converting enzyme 2 (ACE2). In some embodiments, the antibodies are optimized based on interactions between SARS-CoV-2 and ACE2.

[0071] Antibodies are in some instances optimized by the design of in-silico libraries comprising variant sequences of an input antibody sequence (FIG. 1). Input sequences 100 are in some instances modified in-silico 102 with one or more mutations or variants to generate libraries of optimized sequences 103. In some instances, such libraries are synthesized, cloned into expression vectors, and translation products (antibodies) evaluated for activity. In some instances, fragments of sequences are synthesized and subsequently assembled. In some instances, expression vectors are used to display and enrich desired antibodies, such as phage display. Selection pressures used during enrichment in some instances includes, but is not limited to, binding affinity, toxicity, immunological tolerance, stability, receptor-ligand competition, or developability. Such expression vectors allow antibodies with specific properties to be selected ("panning"), and subsequent propagation or amplification of such sequences enriches the library with these sequences Panning rounds can be repeated any number of times, such as 1, 2, 3, 4, 5, 6, 7, or more than 7 rounds. Sequencing at one or more rounds is in some instances used to identify which sequences 105 have been enriched in the library.

[0072] Described herein are methods and systems of in-silico library design. For example, an antibody or antibody fragment sequence is used as input. In some instances, the antibody sequence used as input is an antibody or antibody fragment sequence that binds SARS-CoV-2. In some instances, the input is an antibody or antibody fragment sequence that binds a protein of SARS-CoV-2. In some instances, the protein is a spike glycoprotein, a membrane protein, an envelope protein, a nucleocapsid protein, or combinations thereof. In some instances, the protein is a spike glycoprotein of SARS-CoV-2. In some instances, the protein is a receptor binding domain of SARS-CoV-2. In some instances, the input sequence is an antibody or antibody fragment sequence that binds angiotensin-converting enzyme 2 (ACE2). In some instances, the input sequence is an antibody or antibody fragment sequence that binds an extracellular domain of the angiotensin-converting enzyme 2 (ACE2).

[0073] A database 102 comprising known mutations or variants of one or more viruses is queried 101, and a library 103 of sequences comprising combinations of these mutations or variants are generated. In some instances, the database comprises known mutations or variants of SARS-CoV-like coronaviruses, SARS-CoV-2, SARS-CoV, or combinations thereof. In some instances, the database comprises known mutations or variants of the spike protein of SARS-CoV-like coronaviruses, SARS-CoV-2, SARS-CoV, or combinations thereof. In some instances, the database comprises known mutations or variants of the receptor binding domain of SARS-CoV-like coronaviruses, SARS-CoV-2, SARS-CoV, or combinations thereof. In some instances, the database comprises mutations or variants of a protein of SARS-CoV-like coronaviruses, SARS-CoV-2, SARS-CoV, or combinations thereof that binds to ACE2.

[0074] In some instances, the input sequence is a heavy chain sequence of an antibody or antibody fragment that binds SARS-CoV-like coronaviruses, SARS-CoV-2, SARS-CoV, or combinations thereof. In some instances, the input sequence is a light chain sequence of an antibody or antibody fragment that binds SARS-CoV-like coronaviruses, SARS-CoV-2, SARS-CoV, or combinations thereof. In some instances, the heavy chain sequence comprises varied CDR regions. In some instances, the light chain sequence comprises varied CDR regions. In some instances, known mutations or variants from CDRs are used to build the sequence library. Filters 104, or exclusion criteria, are in some instances used to select specific types of variants for members of the sequence library. For example, sequences having a mutation or variant are added if a minimum number of organisms in the database have the mutation or variant. In some instances, additional CDRs are specified for inclusion in the database. In some instances, specific mutations or variants or combinations of mutations or variants are excluded from the library (e.g., known immunogenic sites, structure sites, etc.). In some instances, specific sites in the input sequence are systematically replaced with histidine, aspartic acid, glutamic acid, or combinations thereof. In some instances, the maximum or minimum number of mutations or variants allowed for each region of an antibody are specified. Mutations or variants in some instances are described relative to the input sequence or the input sequence's corresponding germline sequence. For example, sequences generated by the optimization comprise at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or more than 16 mutations or variants from the input sequence. In some instances, sequences generated by the optimization comprise no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or no more than 18 mutations or variants from the input sequence. In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or about 18 mutations or variants relative to the input sequence. In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, or 7 mutations or variants from the input sequence in a first CDR region. In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, or 7 mutations or variants from the input sequence in a second CDR region. In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, or 7 mutations or variants from the input sequence in a third CDR region. In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, or 7 mutations or variants from the input sequence in a first CDR region of a heavy chain. In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, or 7 mutations or variants from the input sequence in a second CDR region of a heavy chain. In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, or 7 mutations or variants from the input sequence in a third CDR region of a heavy chain. In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, or 7 mutations or variants from the input sequence in a first CDR region of a light chain. In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, or 7 mutations or variants from the input sequence in a second CDR region of a light chain. In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, or 7 mutations or variants from the input sequence in a third CDR region of a light chain. In some instances, a first CDR region is CDR1. In some instances, a second CDR region is CDR2. In some instances, a third CDR region is CDR3. In-silico antibodies libraries are in some instances synthesized, assembled, and enriched for desired sequences.

[0075] The germline sequences corresponding to an input sequence may also be modified to generate sequences in a library. For example, sequences generated by the optimization methods described herein comprise at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or more than 16 mutations or variants from the germline sequence. In some instances, sequences generated by the optimization comprise no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or no more than 18 mutations or variants from the germline sequence. In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or about 18 mutations or variants relative to the germline sequence.

[0076] Provided herein are methods, systems, and compositions for antibody optimization, wherein the input sequence comprises mutations or variants in an antibody region. Exemplary regions of the antibody include, but are not limited to, a complementarity-determining region (CDR), a variable domain, or a constant domain. In some instances, the CDR is CDR1, CDR2, or CDR3. In some instances, the CDR is a heavy domain including, but not limited to, CDRH1, CDRH2, and CDRH3. In some instances, the CDR is a light domain including, but not limited to, CDRL1, CDRL2, and CDRL3. In some instances, the variable domain is variable domain, light chain (VL) or variable domain, heavy chain (VH). In some instances, the VL domain comprises kappa or lambda chains. In some instances, the constant domain is constant domain, light chain (CL) or constant domain, heavy chain (CH). In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, or 7 mutations or variants from the germline sequence in a first CDR region. In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, or 7 mutations or variants from the germline sequence in a second CDR region. In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, or 7 mutations or variants from the germline sequence in a third CDR region. In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, or 7 mutations or variants from the germline sequence in a first CDR region of a heavy chain. In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, or 7 mutations or variants from the germline sequence in a second CDR region of a heavy chain. In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, or 7 mutations or variants from the germline sequence in a third CDR region of a heavy chain. In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, or 7 mutations or variants from the germline sequence in a first CDR region of a light chain. In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, or 7 mutations or variants from the germline sequence in a second CDR region of a light chain. In some instances, sequences generated by the optimization comprise about 1, 2, 3, 4, 5, 6, or 7 mutations or variants from the germline sequence in a third CDR region of a light chain. In some instances, a first CDR region is CDR1. In some instances, a second CDR region is CDR2. In some instances, a third CDR region is CDR3.

[0077] VHH Libraries

[0078] Provided herein are methods, compositions, and systems for generation of antibodies or antibody fragments. In some instances, the antibodies or antibody fragments are single domain antibodies. Methods, compositions, and systems described herein for the optimization of antibodies comprise a ratio-variant approach that mirror the natural diversity of antibody sequences. In some instances, libraries of optimized antibodies comprise variant antibody sequences. In some instances, the variant antibody sequences are designed comprising variant CDR regions. In some instances, the variant antibody sequences comprising variant CDR regions are generated by shuffling the natural CDR sequences in a llama, humanized, or chimeric framework. In some instances, such libraries are synthesized, cloned into expression vectors, and translation products (antibodies) evaluated for activity. In some instances, fragments of sequences are synthesized and subsequently assembled. In some instances, expression vectors are used to display and enrich desired antibodies, such as phage display. In some instances, the phage vector is a Fab phagemid vector. Selection pressures used during enrichment in some instances includes, but is not limited to, binding affinity, toxicity, immunological tolerance, stability, receptor-ligand competition, or developability. Such expression vectors allow antibodies with specific properties to be selected ("panning"), and subsequent propagation or amplification of such sequences enriches the library with these sequences. Panning rounds can be repeated any number of times, such as 1, 2, 3, 4, 5, 6, 7, or more than 7 rounds. In some instances, each round of panning involves a number of washes. In some instances, each round of panning involves at least or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or more than 16 washes.

[0079] Described herein are methods and systems of in-silico library design. Libraries as described herein, in some instances, are designed based on a database comprising a variety of antibody sequences. In some instances, the database comprises a plurality of variant antibody sequences against various targets. In some instances, the database comprises at least 100, 500, 1000, 1500, 2000, 2500, 3000, 3500, 4000, 4500, 5000, or more than 5000 antibody sequences. An exemplary database is an iCAN database. In some instances, the database comprises naive and memory B-cell receptor sequences. In some instances, the naive and memory B-cell receptor sequences are human, mouse, or primate sequences. In some instances, the naive and memory B-cell receptor sequences are human sequences. In some instances, the database is analyzed for position specific variation. In some instances, antibodies described herein comprise position specific variations in CDR regions. In some instances, the CDR regions comprise multiple sites for variation.

[0080] Described herein are libraries comprising variation in a CDR region. In some instances, the CDR is CDR1, CDR2, or CDR3 of a variable heavy chain. In some instances, the CDR is CDR1, CDR2, or CDR3 of a variable light chain. In some instances, the libraries comprise multiple variants encoding for CDR1, CDR2, or CDR3. In some instances, the libraries as described herein encode for at least 50, 100, 200, 300, 400, 500, 1000, 1200, 1500, 1700, 2000, 2500, 3000, 3500, 4000, 4500, 5000, or more than 5000 CDR1 sequences. In some instances, the libraries as described herein encode for at least 50, 100, 200, 300, 400, 500, 1000, 1200, 1500, 1700, 2000, 2500, 3000, 3500, 4000, 4500, 5000, or more than 5000 CDR2 sequences. In some instances, the libraries as described herein encode for at least 50, 100, 200, 300, 400, 500, 1000, 1200, 1500, 1700, 2000, 2500, 3000, 3500, 4000, 4500, 5000, or more than 5000 CDR3 sequences. In-silico antibodies libraries are in some instances synthesized, assembled, and enriched for desired sequences.

[0081] Following synthesis of CDR1 variants, CDR2 variants, and CDR3 variants, in some instances, the CDR1 variants, the CDR2 variants, and the CDR3 variants are shuffled to generate a diverse library. In some instances, the diversity of the libraries generated by methods described herein have a theoretical diversity of at least or about 10.sup.7, 10.sup.8, 10.sup.9, 10.sup.10, 10.sup.11, 10.sup.12, 10.sup.13, 10.sup.14, 10.sup.15, 10.sup.16, 10.sup.17, 10.sup.18, or more than 10.sup.18 sequences. In some instances, the library has a final library diversity of at least or about 10.sup.7, 10.sup.8, 10.sup.9, 10.sup.10, 10.sup.11, 10.sup.12, 10.sup.13, 10.sup.14, 10.sup.15, 10.sup.16, 10.sup.17, 10.sup.18, or more than 10.sup.18 sequences.

[0082] The germline sequences corresponding to a variant sequence may also be modified to generate sequences in a library. For example, sequences generated by methods described herein comprise at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or more than 16 mutations or variants from the germline sequence. In some instances, sequences generated comprise no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or no more than 18 mutations or variants from the germline sequence. In some instances, sequences generated comprise about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, or about 18 mutations or variants relative to the germline sequence.

[0083] Coronavirus Antibody Libraries

[0084] Provided herein are libraries generated from antibody optimization methods described herein. Antibodies described herein result in improved functional activity, structural stability, expression, specificity, or a combination thereof.

[0085] Provided herein are methods and compositions relating to SARS-CoV-2 binding libraries comprising nucleic acids encoding for a SARS-CoV-2 antibody. Further provided herein are methods and compositions relating to ACE2 binding libraries comprising nucleic acids encoding for an ACE2 antibody. Such methods and compositions in some instances are generated by the antibody optimization methods and systems described herein. Libraries as described herein may be further variegated to provide for variant libraries comprising nucleic acids each encoding for a predetermined variant of at least one predetermined reference nucleic acid sequence. Further described herein are protein libraries that may be generated when the nucleic acid libraries are translated. In some instances, nucleic acid libraries as described herein are transferred into cells to generate a cell library. Also provided herein are downstream applications for the libraries synthesized using methods described herein. Downstream applications include identification of variant nucleic acids or protein sequences with enhanced biologically relevant functions, e.g., improved stability, affinity, binding, functional activity, and for the treatment or prevention of an infection caused by a coronavirus such as SARS-CoV-2.

[0086] In some instances, an antibody or antibody fragment described herein comprises a sequence of any one of SEQ ID NOs: 1-716. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 80% identical to a sequence of any one of SEQ ID NOs: 1-716. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 85% identical to a sequence of any one of SEQ ID NOs: 1-716. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 90% identical to a sequence of any one of SEQ ID NOs: 1-716. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 95% identical to a sequence of any one of SEQ ID NOs: 1-716.

[0087] In some instances, an antibody or antibody fragment described herein comprises a CDRH1 sequence of any one of SEQ ID NOs: 1-36 or 217-282. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 80% identical to a CDRH1 sequence of any one of SEQ ID NOs: 1-36 or 217-282. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 85% identical to a CDRH1 sequence of any one of SEQ ID NOs: 1-36 or 217-282. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 90% identical to a CDRH1 sequence of any one of SEQ ID NOs: 1-36 or 217-282. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 95% identical to a CDRH1 sequence of any one of SEQ ID NOs: 1-36 or 217-282. In some instances, an antibody or antibody fragment described herein comprises a CDRH2 sequence of any one of SEQ ID NOs: 37-72 or 283-348. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 80% identical to a CDRH2 sequence of any one of SEQ ID NOs: 37-72 or 283-348. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 85% identical to a CDRH2 sequence of any one of SEQ ID NOs: 37-72 or 283-348. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 90% identical to a CDRH2 sequence of any one of SEQ ID NOs: 37-72 or 283-348. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 95% identical to a CDRH2 sequence of any one of SEQ ID NOs: 37-72 or 283-348. In some instances, an antibody or antibody fragment described herein comprises a CDRH3 sequence of any one of SEQ ID NOs: 73-108 or 349-414. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 80% identical to a CDRH3 sequence of any one of SEQ ID NOs: 73-108 or 349-414. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 85% identical to a CDRH3 sequence of any one of SEQ ID NOs: 73-108 or 349-414. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 90% identical to a CDRH3 sequence of any one of SEQ ID NOs: 73-108 or 349-414. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 95% identical to a CDRH3 sequence of any one of SEQ ID NOs: 73-108 or 349-414.

[0088] In some instances, an antibody or antibody fragment described herein comprises a CDRL1 sequence of any one of SEQ ID NOs: 109-144 or 415-473. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 80% identical to a CDRL1 sequence of any one of SEQ ID NOs: 109-144 or 415-473. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 85% identical to a CDRL1 sequence of any one of SEQ ID NOs: 109-144 or 415-473. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 90% identical to a CDRL1 sequence of any one of SEQ ID NOs: 109-144 or 415-473. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 95% identical to a CDRL1 sequence of any one of SEQ ID NOs: 109-144 or 415-473. In some instances, an antibody or antibody fragment described herein comprises a CDRL2 sequence of any one of SEQ ID NOs: 145-180 or 415-473. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 80% identical to a CDRL2 sequence of any one of SEQ ID NOs: 145-180 or 415-473. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 85% identical to a CDRL2 sequence of any one of SEQ ID NOs: 145-180 or 415-473. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 90% identical to a CDRL2 sequence of any one of SEQ ID NOs: 145-180 or 415-473. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 95% identical to a CDRL2 sequence of any one of SEQ ID NOs: 145-180 or 415-473. In some instances, an antibody or antibody fragment described herein comprises a CDRL3 sequence of any one of SEQ ID NOs: 181-216, 442-456, or 532-546. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 80% identical to a CDRL3 sequence of any one of SEQ ID NOs: 181-216 or 533-591. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 85% identical to a CDRL3 sequence of any one of SEQ ID NOs: 181-216 or 533-591. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 90% identical to a CDRL3 sequence of any one of SEQ ID NOs: 181-216 or 533-591. In some instances, an antibody or antibody fragment described herein comprises a sequence that is at least 95% identical to a CDRL3 sequence of any one of SEQ ID NOs: 181-216 or 533-591.

[0089] In some embodiments, the antibody or antibody fragment comprising a variable domain, heavy chain region (VH) and a variable domain, light chain region (VL), wherein VH comprises complementarity determining regions CDRH1, CDRH2, and CDRH3, wherein VL comprises complementarity determining regions CDRL1, CDRL2, and CDRL3, and wherein (a) an amino acid sequence of CDRH1 is as set forth in any one of SEQ ID NOs: 1-36 or 217-282; (b) an amino acid sequence of CDRH2 is as set forth in any one of SEQ ID NOs: 37-72 or 283-348; (c) an amino acid sequence of CDRH3 is as set forth in any one of SEQ ID NOs: 73-108 or 349-414; (d) an amino acid sequence of CDRL1 is as set forth in any one of SEQ ID NOs: 109-144 or 415-473; (e) an amino acid sequence of CDRL2 is as set forth in any one of SEQ ID NOs: 145-180 or 415-473; and (f) an amino acid sequence of CDRL3 is as set forth in any one of SEQ ID NOs: 181-216 or 533-591. In some embodiments, the antibody or antibody fragment comprising a variable domain, heavy chain region (VH) and a variable domain, light chain region (VL), wherein VH comprises complementarity determining regions CDRH1, CDRH2, and CDRH3, wherein VL comprises complementarity determining regions CDRL1, CDRL2, and CDRL3, and wherein (a) an amino acid sequence of CDRH1 is at least or about 80%, 85%, 90%, or 95% identical to any one of SEQ ID NOs: 1-36 or 217-282; (b) an amino acid sequence of CDRH2 is at least or about 80%, 85%, 90%, or 95% identical to any one of SEQ ID NOs: 37-72 or 283-348; (c) an amino acid sequence of CDRH3 is at least or about 80%, 85%, 90%, or 95% identical to any one of SEQ ID NOs: 73-108 or 349-414; (d) an amino acid sequence of CDRL1 is at least or about 80%, 85%, 90%, or 95% identical to any one of SEQ ID NOs: 109-144 or 415-473; (e) an amino acid sequence of CDRL2 is at least or about 80%, 85%, 90%, or 95% identical to any one of SEQ ID NOs: 145-180 or 415-473; and (f) an amino acid sequence of CDRL3 is at least or about 80%, 85%, 90%, or 95% identical to any one of SEQ ID NOs: 181-216 or 533-591.

[0090] Described herein, in some embodiments, are antibodies or antibody fragments comprising a variable domain, heavy chain region (VH) and a variable domain, light chain region (VL), wherein the VH comprises an amino acid sequence at least about 90% identical to a sequence as set forth in any one of SEQ ID NOs: 592-657, and wherein the VL comprises an amino acid sequence at least about 90% identical to a sequence as set forth in any one of SEQ ID NOs: 658-716. In some instances, the antibodies or antibody fragments comprise VH comprising at least or about 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to any one of SEQ ID NOs: 592-657, and VL comprising at least or about 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to any one of SEQ ID NOs: 658-716.

[0091] The term "sequence identity" means that two polynucleotide sequences are identical (i.e., on a nucleotide-by-nucleotide basis) over the window of comparison. The term "percentage of sequence identity" is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, U, or I) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity.

[0092] The term "homology" or "similarity" between two proteins is determined by comparing the amino acid sequence and its conserved amino acid substitutes of one protein sequence to the second protein sequence. Similarity may be determined by procedures which are well-known in the art, for example, a BLAST program (Basic Local Alignment Search Tool at the National Center for Biological Information).

[0093] Provided herein are libraries comprising nucleic acids encoding for SARS-CoV-2 antibodies. Antibodies described herein allow for improved stability for a range of SARS-CoV-2 or ACE2 binding domain encoding sequences. In some instances, the binding domain encoding sequences are determined by interactions between SARS-CoV-2 and ACE2.

[0094] Sequences of binding domains based on surface interactions between SARS-CoV-2 and ACE2 are analyzed using various methods. For example, multispecies computational analysis is performed. In some instances, a structure analysis is performed. In some instances, a sequence analysis is performed. Sequence analysis can be performed using a database known in the art. Non-limiting examples of databases include, but are not limited to, NCBI BLAST (blast.ncbi.nlm.nih.gov/Blast.cgi), UCSC Genome Browser (genome.ucsc.edu/), UniProt (www.uniprot.org/), and IUPHAR/BPS Guide to PHARMACOLOGY (guidetopharmacology.org/).

[0095] Described herein are SARS-CoV-2 or ACE2 binding domains designed based on sequence analysis among various organisms. For example, sequence analysis is performed to identify homologous sequences in different organisms. Exemplary organisms include, but are not limited to, mouse, rat, equine, sheep, cow, primate (e.g., chimpanzee, baboon, gorilla, orangutan, monkey), dog, cat, pig, donkey, rabbit, fish, fly, and human. In some instances, homologous sequences are identified in the same organism, across individuals.

[0096] Following identification of SARS-CoV-2 or ACE2 binding domains, libraries comprising nucleic acids encoding for the SARS-CoV-2 or ACE2 binding domains may be generated. In some instances, libraries of SARS-CoV-2 or ACE2 binding domains comprise sequences of SARS-CoV-2 or ACE2 binding domains designed based on conformational ligand interactions, peptide ligand interactions, small molecule ligand interactions, extracellular domains of SARS-CoV-2 or ACE2, or antibodies that target SARS-CoV-2 or ACE2. Libraries of SARS-CoV-2 or ACE2 binding domains may be translated to generate protein libraries. In some instances, libraries of SARS-CoV-2 or ACE2 binding domains are translated to generate peptide libraries, immunoglobulin libraries, derivatives thereof, or combinations thereof. In some instances, libraries of SARS-CoV-2 or ACE2 binding domains are translated to generate protein libraries that are further modified to generate peptidomimetic libraries. In some instances, libraries of SARS-CoV-2 or ACE2 binding domains are translated to generate protein libraries that are used to generate small molecules.

[0097] Methods described herein provide for synthesis of libraries of SARS-CoV-2 or ACE2 binding domains comprising nucleic acids each encoding for a predetermined variant of at least one predetermined reference nucleic acid sequence. In some cases, the predetermined reference sequence is a nucleic acid sequence encoding for a protein, and the variant library comprises sequences encoding for variation of at least a single codon such that a plurality of different variants of a single residue in the subsequent protein encoded by the synthesized nucleic acid are generated by standard translation processes. In some instances, the libraries of SARS-CoV-2 or ACE2 binding domains comprise varied nucleic acids collectively encoding variations at multiple positions. In some instances, the variant library comprises sequences encoding for variation of at least a single codon in a SARS-CoV-2 or ACE2 binding domain. In some instances, the variant library comprises sequences encoding for variation of multiple codons in a SARS-CoV-2 or ACE2 binding domain. An exemplary number of codons for variation include, but are not limited to, at least or about 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 225, 250, 275, 300, or more than 300 codons.

[0098] Methods described herein provide for synthesis of libraries comprising nucleic acids encoding for the SARS-CoV-2 or ACE2 binding domains, wherein the libraries comprise sequences encoding for variation of length of the SARS-CoV-2 or ACE2 binding domains. In some instances, the library comprises sequences encoding for variation of length of at least or about 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 225, 250, 275, 300, or more than 300 codons less as compared to a predetermined reference sequence. In some instances, the library comprises sequences encoding for variation of length of at least or about 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 200, 225, 250, 275, 300, or more than 300 codons more as compared to a predetermined reference sequence.

[0099] Following identification of SARS-CoV-2 or ACE2 binding domains, antibodies may be designed and synthesized to comprise the SARS-CoV-2 or ACE2 binding domains. Antibodies comprising SARS-CoV-2 or ACE2 binding domains may be designed based on binding, specificity, stability, expression, folding, or downstream activity. In some instances, the antibodies comprising SARS-CoV-2 or ACE2 binding domains enable contact with the SARS-CoV-2 or ACE2. In some instances, the antibodies comprising SARS-CoV-2 or ACE2 binding domains enables high affinity binding with the SARS-CoV-2 or ACE2. Exemplary amino acid sequences of SARS-CoV-2 or ACE2 binding domains comprise any one of SEQ ID NOs: 1-716.

[0100] In some instances, the SARS-CoV-2 antibody comprises a binding affinity (e.g., K.sub.D) to SARS-CoV-2 of less than 1 nM, less than 1.2 nM, less than 2 nM, less than 5 nM, less than 10 nM, less than 11 nm, less than 13.5 nM, less than 15 nM, less than 20 nM, less than 25 nM, or less than 30 nM. In some instances, the SARS-CoV-2 antibody comprises a K.sub.D of less than 1 nM. In some instances, the SARS-CoV-2 antibody comprises a K.sub.D of less than 1.2 nM. In some instances, the SARS-CoV-2 antibody comprises a K.sub.D of less than 2 nM. In some instances, the SARS-CoV-2 antibody comprises a K.sub.D of less than 5 nM. In some instances, the SARS-CoV-2 antibody comprises a K.sub.D of less than 10 nM. In some instances, the SARS-CoV-2 antibody comprises a K.sub.D of less than 13.5 nM. In some instances, the SARS-CoV-2 antibody comprises a K.sub.D of less than 15 nM. In some instances, the SARS-CoV-2 antibody comprises a K.sub.D of less than 20 nM. In some instances, the SARS-CoV-2 antibody comprises a K.sub.D of less than 25 nM. In some instances, the SARS-CoV-2 antibody comprises a K.sub.D of less than 30 nM.

[0101] In some instances, the ACE2 antibody comprises a binding affinity (e.g., K.sub.D) to ACE2 of less than 1 nM, less than 1.2 nM, less than 2 nM, less than 5 nM, less than 10 nM, less than 11 nm, less than 13.5 nM, less than 15 nM, less than 20 nM, less than 25 nM, or less than 30 nM. In some instances, the ACE2 antibody comprises a K.sub.D of less than 1 nM. In some instances, the ACE2 antibody comprises a K.sub.D of less than 1.2 nM. In some instances, the ACE2 antibody comprises a K.sub.D of less than 2 nM. In some instances, the ACE2 antibody comprises a K.sub.D of less than 5 nM. In some instances, the ACE2 antibody comprises a K.sub.D of less than 10 nM. In some instances, the ACE2 antibody comprises a K.sub.D of less than 13.5 nM. In some instances, the ACE2 antibody comprises a K.sub.D of less than 15 nM. In some instances, the ACE2 antibody comprises a K.sub.D of less than 20 nM. In some instances, the ACE2 antibody comprises a K.sub.D of less than 25 nM. In some instances, the ACE2 antibody comprises a K.sub.D of less than 30 nM.

[0102] In some instances, the SARS-CoV-2 or ACE2 immunoglobulin is an agonist. In some instances, the SARS-CoV-2 or ACE2 immunoglobulin is an antagonist. In some instances, the SARS-CoV-2 or ACE2 immunoglobulin is an allosteric modulator. In some instances, the allosteric modulator is a negative allosteric modulator. In some instances, the allosteric modulator is a positive allosteric modulator. In some instances, the SARS-CoV-2 or ACE2 immunoglobulin results in agonistic, antagonistic, or allosteric effects at a concentration of at least or about 1 nM, 2 nM, 4 nM, 6 nM, 8 nM, 10 nM, 20 nM, 30 nM, 40 nM, 50 nM, 60 nM, 70 nM, 80 nM, 90 nM, 100 nM, 120 nM, 140 nM, 160 nM, 180 nM, 200 nM, 300 nM, 400 nM, 500 nM, 600 nM, 700 nM, 800 nM, 900 nM, 1000 nM, or more than 1000 nM. In some instances, the SARS-CoV-2 or ACE2 immunoglobulin is a negative allosteric modulator. In some instances, the SARS-CoV-2 or ACE2 immunoglobulin is a negative allosteric modulator at a concentration of at least or about 0.001, 0.005, 0.01, 0.05, 0.1, 0.5, 1 nM, 2 nM, 4 nM, 6 nM, 8 nM, 10 nM, 20 nM, 30 nM, 40 nM, 50 nM, 60 nM, 70 nM, 80 nM, 90 nM, 100 nM, or more than 100 nM. In some instances, the SARS-CoV-2 or ACE2 immunoglobulin is a negative allosteric modulator at a concentration in a range of about 0.001 to about 100, 0.01 to about 90, about 0.1 to about 80, 1 to about 50, about 10 to about 40 nM, or about 1 to about 10 nM. In some instances, the SARS-CoV-2 or ACE2 immunoglobulin comprises an EC50 or IC50 of at least or about 0.001, 0.0025, 0.005, 0.01, 0.025, 0.05, 0.06, 0.07, 0.08, 0.9, 0.1, 0.5, 1, 2, 3, 4, 5, 6, or more than 6 nM. In some instances, the SARS-CoV-2 or ACE2 immunoglobulin comprises an EC50 or IC50 of at least or about 1 nM, 2 nM, 4 nM, 6 nM, 8 nM, 10 nM, 20 nM, 30 nM, 40 nM, 50 nM, 60 nM, 70 nM, 80 nM, 90 nM, 100 nM, or more than 100 nM.

[0103] In some instances, the affinity of the SARS-CoV-2 or ACE2 antibody generated by methods as described herein is at least or about 1.5.times., 2.0.times., 5.times., 10.times., 20.times., 30.times., 40.times., 50.times., 60.times., 70.times., 80.times., 90.times., 100.times., 200.times., or more than 200.times. improved binding affinity as compared to a comparator antibody. In some instances, the SARS-CoV-2 or ACE2 antibody generated by methods as described herein is at least or about 1.5.times., 2.0.times., 5.times., 10.times., 20.times., 30.times., 40.times., 50.times., 60.times., 70.times., 80.times., 90.times., 100.times., 200.times., or more than 200.times. improved function as compared to a comparator antibody. In some instances, the comparator antibody is an antibody with similar structure, sequence, or antigen target.

[0104] Provided herein are SARS-CoV-2 or ACE2 binding libraries comprising nucleic acids encoding for antibodies comprising SARS-CoV-2 or ACE2 binding domains comprise variation in domain type, domain length, or residue variation. In some instances, the domain is a region in the antibody comprising the SARS-CoV-2 or ACE2 binding domains. For example, the region is the VH, CDRH3, or VL domain. In some instances, the domain is the SARS-CoV-2 or ACE2 binding domain.

[0105] Methods described herein provide for synthesis of a SARS-CoV-2 or ACE21 binding library of nucleic acids each encoding for a predetermined variant of at least one predetermined reference nucleic acid sequence. In some cases, the predetermined reference sequence is a nucleic acid sequence encoding for a protein, and the variant library comprises sequences encoding for variation of at least a single codon such that a plurality of different variants of a single residue in the subsequent protein encoded by the synthesized nucleic acid are generated by standard translation processes. In some instances, the SARS-CoV-2 or ACE2 binding library comprises varied nucleic acids collectively encoding variations at multiple positions. In some instances, the variant library comprises sequences encoding for variation of at least a single codon of a VH or VL domain. In some instances, the variant library comprises sequences encoding for variation of at least a single codon in a SARS-CoV-2 or ACE2 binding domain. For example, at least one single codon of a SARS-CoV-2 or ACE2 binding domain is varied. In some instances, the variant library comprises sequences encoding for variation of multiple codons of a VH or VL domain. In some instances, the variant library comprises sequences encoding for variation of multiple codons in a SARS-CoV-2 or ACE2 binding domain. An exemplary number of codons for variation include, but are not limited to, at least or about 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 225, 250, 275, 300, or more than 300 codons.

[0106] Methods described herein provide for synthesis of a SARS-CoV-2 or ACE2 binding library of nucleic acids each encoding for a predetermined variant of at least one predetermined reference nucleic acid sequence, wherein the SARS-CoV-2 or ACE2 binding library comprises sequences encoding for variation of length of a domain. In some instances, the domain is VH or VL domain. In some instances, the domain is the SARS-CoV-2 or ACE2binding domain. In some instances, the library comprises sequences encoding for variation of length of at least or about 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 225, 250, 275, 300, or more than 300 codons less as compared to a predetermined reference sequence. In some instances, the library comprises sequences encoding for variation of length of at least or about 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 200, 225, 250, 275, 300, or more than 300 codons more as compared to a predetermined reference sequence.

[0107] Provided herein are SARS-CoV-2 or ACE2 binding libraries comprising nucleic acids encoding for antibodies comprising SARS-CoV-2 or ACE2 binding domains, wherein the SARS-CoV-2 or ACE2 binding libraries are synthesized with various numbers of fragments. In some instances, the fragments comprise the VH or VL domain. In some instances, the SARS-CoV-2 or ACE2 binding libraries are synthesized with at least or about 2 fragments, 3 fragments, 4 fragments, 5 fragments, or more than 5 fragments. The length of each of the nucleic acid fragments or average length of the nucleic acids synthesized may be at least or about 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 525, 550, 575, 600, or more than 600 base pairs. In some instances, the length is about 50 to 600, 75 to 575, 100 to 550, 125 to 525, 150 to 500, 175 to 475, 200 to 450, 225 to 425, 250 to 400, 275 to 375, or 300 to 350 base pairs.

[0108] SARS-CoV-2 or ACE2 binding libraries comprising nucleic acids encoding for antibodies comprising SARS-CoV-2 or ACE2 binding domains as described herein comprise various lengths of amino acids when translated. In some instances, the length of each of the amino acid fragments or average length of the amino acid synthesized may be at least or about 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, or more than 150 amino acids. In some instances, the length of the amino acid is about 15 to 150, 20 to 145, 25 to 140, 30 to 135, 35 to 130, 40 to 125, 45 to 120, 50 to 115, 55 to 110, 60 to 110, 65 to 105, 70 to 100, or 75 to 95 amino acids. In some instances, the length of the amino acid is about 22 to about 75 amino acids.

[0109] SARS-CoV-2 or ACE2 binding libraries comprising de novo synthesized variant sequences encoding for antibodies comprising SARS-CoV-2 or ACE2 binding domains comprise a number of variant sequences. In some instances, a number of variant sequences is de novo synthesized for a CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, CDRL3, VL, VH, or a combination thereof. In some instances, a number of variant sequences is de novo synthesized for framework element 1 (FW1), framework element 2 (FW2), framework element 3 (FW3), or framework element 4 (FW4). In some instances, a number of variant sequences are de novo synthesized for a SARS-CoV-2 or ACE2 binding domain. The number of variant sequences may be at least or about 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, or more than 500 sequences. In some instances, the number of variant sequences is about 10 to 300, 25 to 275, 50 to 250, 75 to 225, 100 to 200, or 125 to 150 sequences.

[0110] SARS-CoV-2 or ACE2 binding libraries comprising de novo synthesized variant sequences encoding for antibodies comprising SARS-CoV-2 or ACE2 binding domains comprise improved diversity. In some instances, variants include affinity maturation variants. Alternatively or in combination, variants include variants in other regions of the antibody including, but not limited to, CDRH1, CDRH2, CDRL1, CDRL2, and CDRL3. In some instances, the number of variants of the SARS-CoV-2 or ACE2 binding libraries is least or about 10.sup.4, 10.sup.5, 10.sup.6, 10.sup.7, 10.sup.8, 10.sup.9, 10.sup.10, 10.sup.11, 10.sup.12, 10.sup.13, 10.sup.14 or more than 10.sup.14 non-identical sequences.

[0111] Following synthesis of SARS-CoV-2 or ACE2 binding libraries comprising nucleic acids encoding antibodies comprising SARS-CoV-2 or ACE2 binding domains, libraries may be used for screening and analysis. For example, libraries are assayed for library displayability and panning. In some instances, displayability is assayed using a selectable tag. Exemplary tags include, but are not limited to, a radioactive label, a fluorescent label, an enzyme, a chemiluminescent tag, a colorimetric tag, an affinity tag or other labels or tags that are known in the art. In some instances, the tag is histidine, polyhistidine, myc, hemagglutinin (HA), or FLAG. For example, SARS-CoV-2 or ACE2 binding libraries comprise nucleic acids encoding antibodies comprising SARS-CoV-2 or ACE2 binding domains with multiple tags such as GFP, FLAG, and Lucy as well as a DNA barcode. In some instances, libraries are assayed by sequencing using various methods including, but not limited to, single-molecule real-time (SMRT) sequencing, Polony sequencing, sequencing by ligation, reversible terminator sequencing, proton detection sequencing, ion semiconductor sequencing, nanopore sequencing, electronic sequencing, pyrosequencing, Maxam-Gilbert sequencing, chain termination (e.g., Sanger) sequencing, +S sequencing, or sequencing by synthesis.

[0112] As used herein, the term antibody will be understood to include proteins having the characteristic two-armed, Y-shape of a typical antibody molecule as well as one or more fragments of an antibody that retain the ability to specifically bind to an antigen. Exemplary antibodies include, but are not limited to, a monoclonal antibody, a polyclonal antibody, a bi-specific antibody, a multispecific antibody, a grafted antibody, a human antibody, a humanized antibody, a synthetic antibody, a chimeric antibody, a camelized antibody, a single-chain Fvs (scFv) (including fragments in which the VL and VH are joined using recombinant methods by a synthetic or natural linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules, including single chain Fab and scFab), a single chain antibody, a Fab fragment (including monovalent fragments comprising the VL, VH, CL, and CH1 domains), a F(ab')2 fragment (including bivalent fragments comprising two Fab fragments linked by a disulfide bridge at the hinge region), a Fd fragment (including fragments comprising the VH and CH1 fragment), a Fv fragment (including fragments comprising the VL and VH domains of a single arm of an antibody), a single-domain antibody (dAb or sdAb) (including fragments comprising a VH domain), an isolated complementarity determining region (CDR), a diabody (including fragments comprising bivalent dimers such as two VL and VH domains bound to each other and recognizing two different antigens), a fragment comprised of only a single monomeric variable domain, disulfide-linked Fvs (sdFv), an intrabody, an anti-idiotypic (anti-Id) antibody, or ab antigen-binding fragments thereof. In some instances, the libraries disclosed herein comprise nucleic acids encoding for an antibody, wherein the antibody is a Fv antibody, including Fv antibodies comprised of the minimum antibody fragment which contains a complete antigen-recognition and antigen-binding site. In some embodiments, the Fv antibody consists of a dimer of one heavy chain and one light chain variable domain in tight, non-covalent association, and the three hypervariable regions of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer. In some embodiments, the six hypervariable regions confer antigen-binding specificity to the antibody. In some embodiments, a single variable domain (or half of an Fv comprising only three hypervariable regions specific for an antigen, including single domain antibodies isolated from camelid animals comprising one heavy chain variable domain such as VHH antibodies or nanobodies) has the ability to recognize and bind antigen. In some instances, the libraries disclosed herein comprise nucleic acids encoding for an antibody, wherein the antibody is a single-chain Fv or scFv, including antibody fragments comprising a VH, a VL, or both a VH and VL domain, wherein both domains are present in a single polypeptide chain. In some embodiments, the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains allowing the scFv to form the desired structure for antigen binding. In some instances, a scFv is linked to the Fc fragment or a VHH is linked to the Fc fragment (including minibodies). In some instances, the antibody comprises immunoglobulin molecules and immunologically active fragments of immunoglobulin molecules, e.g., molecules that contain an antigen binding site. Immunoglobulin molecules are of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG 1, IgG 2, IgG 3, IgG 4, IgA 1 and IgA 2) or subclass.

[0113] In some embodiments, the antibody is a multivalent antibody. In some embodiments, the antibody is a monovalent, bivalent, or multivalent antibody. In some instances, the antibody is monospecific, bispecific, or multispecific. In some embodiments, the antibody is monovalent monospecific, monovalent bispecific, monovalent multispecific, bivalent monospecific, bivalent bispecific, bivalent multispecific, multivalent monospecific, multivalent bispecific, multivalent multispecific. In some instances, the antibody is homodimeric, heterodimeric, or heterotrimeric.

[0114] In some embodiments, libraries comprise immunoglobulins that are adapted to the species of an intended therapeutic target. Generally, these methods include "mammalization" and comprises methods for transferring donor antigen-binding information to a less immunogenic mammal antibody acceptor to generate useful therapeutic treatments. In some instances, the mammal is mouse, rat, equine, sheep, cow, primate (e.g., chimpanzee, baboon, gorilla, orangutan, monkey), dog, cat, pig, donkey, rabbit, and human. In some instances, provided herein are libraries and methods for felinization and caninization of antibodies.

[0115] "Humanized" forms of non-human antibodies can be chimeric antibodies that contain minimal sequence derived from the non-human antibody. A humanized antibody is generally a human antibody (recipient antibody) in which residues from one or more CDRs are replaced by residues from one or more CDRs of a non-human antibody (donor antibody). The donor antibody can be any suitable non-human antibody, such as a mouse, rat, rabbit, chicken, or non-human primate antibody having a desired specificity, affinity, or biological effect. In some instances, selected framework region residues of the recipient antibody are replaced by the corresponding framework region residues from the donor antibody Humanized antibodies may also comprise residues that are not found in either the recipient antibody or the donor antibody. In some instances, these modifications are made to further refine antibody performance.

[0116] "Caninization" can comprise a method for transferring non-canine antigen-binding information from a donor antibody to a less immunogenic canine antibody acceptor to generate treatments useful as therapeutics in dogs. In some instances, caninized forms of non-canine antibodies provided herein are chimeric antibodies that contain minimal sequence derived from non-canine antibodies. In some instances, caninized antibodies are canine antibody sequences ("acceptor" or "recipient" antibody) in which hypervariable region residues of the recipient are replaced by hypervariable region residues from a non-canine species ("donor" antibody) such as mouse, rat, rabbit, cat, dogs, goat, chicken, bovine, horse, llama, camel, dromedaries, sharks, non-human primates, human, humanized, recombinant sequence, or an engineered sequence having the desired properties. In some instances, framework region (FR) residues of the canine antibody are replaced by corresponding non-canine FR residues. In some instances, caninized antibodies include residues that are not found in the recipient antibody or in the donor antibody. In some instances, these modifications are made to further refine antibody performance. The caninized antibody may also comprise at least a portion of an immunoglobulin constant region (Fc) of a canine antibody.

[0117] "Felinization" can comprise a method for transferring non-feline antigen-binding information from a donor antibody to a less immunogenic feline antibody acceptor to generate treatments useful as therapeutics in cats. In some instances, felinized forms of non-feline antibodies provided herein are chimeric antibodies that contain minimal sequence derived from non-feline antibodies. In some instances, felinized antibodies are feline antibody sequences ("acceptor" or "recipient" antibody) in which hypervariable region residues of the recipient are replaced by hypervariable region residues from a non-feline species ("donor" antibody) such as mouse, rat, rabbit, cat, dogs, goat, chicken, bovine, horse, llama, camel, dromedaries, sharks, non-human primates, human, humanized, recombinant sequence, or an engineered sequence having the desired properties. In some instances, framework region (FR) residues of the feline antibody are replaced by corresponding non-feline FR residues. In some instances, felinized antibodies include residues that are not found in the recipient antibody or in the donor antibody. In some instances, these modifications are made to further refine antibody performance. The felinized antibody may also comprise at least a portion of an immunoglobulin constant region (Fc) of a felinize antibody.

[0118] Methods as described herein may be used for optimization of libraries encoding a non-immunoglobulin. In some instances, the libraries comprise antibody mimetics. Exemplary antibody mimetics include, but are not limited to, anticalins, affilins, affibody molecules, affimers, affitins, alphabodies, avimers, atrimers, DARPins, fynomers, Kunitz domain-based proteins, monobodies, anticalins, knottins, armadillo repeat protein-based proteins, and bicyclic peptides.

[0119] Libraries described herein comprising nucleic acids encoding for an antibody comprise variations in at least one region of the antibody. Exemplary regions of the antibody for variation include, but are not limited to, a complementarity-determining region (CDR), a variable domain, or a constant domain. In some instances, the CDR is CDR1, CDR2, or CDR3. In some instances, the CDR is a heavy domain including, but not limited to, CDRH1, CDRH2, and CDRH3. In some instances, the CDR is a light domain including, but not limited to, CDRL1, CDRL2, and CDRL3. In some instances, the variable domain is variable domain, light chain (VL) or variable domain, heavy chain (VH). In some instances, the VL domain comprises kappa or lambda chains. In some instances, the constant domain is constant domain, light chain (CL) or constant domain, heavy chain (CH).

[0120] Methods described herein provide for synthesis of libraries comprising nucleic acids encoding an antibody, wherein each nucleic acid encodes for a predetermined variant of at least one predetermined reference nucleic acid sequence. In some cases, the predetermined reference sequence is a nucleic acid sequence encoding for a protein, and the variant library comprises sequences encoding for variation of at least a single codon such that a plurality of different variants of a single residue in the subsequent protein encoded by the synthesized nucleic acid are generated by standard translation processes. In some instances, the antibody library comprises varied nucleic acids collectively encoding variations at multiple positions. In some instances, the variant library comprises sequences encoding for variation of at least a single codon of a CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, CDRL3, VL, or VH domain. In some instances, the variant library comprises sequences encoding for variation of multiple codons of a CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, CDRL3, VL, or VH domain. In some instances, the variant library comprises sequences encoding for variation of multiple codons of framework element 1 (FW1), framework element 2 (FW2), framework element 3 (FW3), or framework element 4 (FW4). An exemplary number of codons for variation include, but are not limited to, at least or about 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 225, 250, 275, 300, or more than 300 codons.

[0121] In some instances, the at least one region of the antibody for variation is from heavy chain V-gene family, heavy chain D-gene family, heavy chain J-gene family, light chain V-gene family, or light chain J-gene family. In some instances, the light chain V-gene family comprises immunoglobulin kappa (IGK) gene or immunoglobulin lambda (IGL). Exemplary regions of the antibody for variation include, but are not limited to, IGHV1-18, IGHV1-69, IGHV1-8, IGHV3-21, IGHV3-23, IGHV3-30/33rn, IGHV3-28, IGHV1-69, IGHV3-74, IGHV4-39, IGHV4-59/61, IGKV1-39, IGKV1-9, IGKV2-28, IGKV3-11, IGKV3-15, IGKV3-20, IGKV4-1, IGLV1-51, IGLV2-14, IGLV1-40, and IGLV3-1. In some instances, the gene is IGHV1-69, IGHV3-30, IGHV3-23, IGHV3, IGHV1-46, IGHV3-7, IGHV1, or IGHV1-8. In some instances, the gene is IGHV1-69 and IGHV3-30. In some instances, the region of the antibody for variation is IGHJ3, IGHJ6, IGHJ, IGHJ4, IGHJ5, IGHJ2, or IGH1. In some instances, the region of the antibody for variation is IGHJ3, IGHJ6, IGHJ, or IGHJ4. In some instances, the at least one region of the antibody for variation is IGHV1-69, IGHV3-23, IGKV3-20, IGKV1-39, or combinations thereof. In some instances, the at least one region of the antibody for variation is IGHV1-69 and IGKV3-20, In some instances, the at least one region of the antibody for variation is IGHV1-69 and IGKV1-39. In some instances, the at least one region of the antibody for variation is IGHV3-23 and IGKV3-20. In some instances, the at least one region of the antibody for variation is IGHV3-23 and IGKV1-39.

[0122] Provided herein are libraries comprising nucleic acids encoding for antibodies, wherein the libraries are synthesized with various numbers of fragments. In some instances, the fragments comprise the CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, CDRL3, VL, or VH domain. In some instances, the fragments comprise framework element 1 (FW1), framework element 2 (FW2), framework element 3 (FW3), or framework element 4 (FW4). In some instances, the antibody libraries are synthesized with at least or about 2 fragments, 3 fragments, 4 fragments, 5 fragments, or more than 5 fragments. The length of each of the nucleic acid fragments or average length of the nucleic acids synthesized may be at least or about 50, 75, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 525, 550, 575, 600, or more than 600 base pairs. In some instances, the length is about 50 to 600, 75 to 575, 100 to 550, 125 to 525, 150 to 500, 175 to 475, 200 to 450, 225 to 425, 250 to 400, 275 to 375, or 300 to 350 base pairs.

[0123] Libraries comprising nucleic acids encoding for antibodies as described herein comprise various lengths of amino acids when translated. In some instances, the length of each of the amino acid fragments or average length of the amino acid synthesized may be at least or about 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, or more than 150 amino acids. In some instances, the length of the amino acid is about 15 to 150, 20 to 145, 25 to 140, 30 to 135, 35 to 130, 40 to 125, 45 to 120, 50 to 115, 55 to 110, 60 to 110, 65 to 105, 70 to 100, or 75 to 95 amino acids. In some instances, the length of the amino acid is about 22 amino acids to about 75 amino acids. In some instances, the antibodies comprise at least or about 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000, or more than 5000 amino acids.

[0124] A number of variant sequences for the at least one region of the antibody for variation are de novo synthesized using methods as described herein. In some instances, a number of variant sequences is de novo synthesized for CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, CDRL3, VL, VH, or combinations thereof. In some instances, a number of variant sequences is de novo synthesized for framework element 1 (FW1), framework element 2 (FW2), framework element 3 (FW3), or framework element 4 (FW4). The number of variant sequences may be at least or about 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, or more than 500 sequences. In some instances, the number of variant sequences is at least or about 500, 600, 700, 800, 900, 1000, 2000, 3000, 4000, 5000, 6000, 7000, 8000, or more than 8000 sequences. In some instances, the number of variant sequences is about 10 to 500, 25 to 475, 50 to 450, 75 to 425, 100 to 400, 125 to 375, 150 to 350, 175 to 325, 200 to 300, 225 to 375, 250 to 350, or 275 to 325 sequences.

[0125] Variant sequences for the at least one region of the antibody, in some instances, vary in length or sequence. In some instances, the at least one region that is de novo synthesized is for CDRH1, CDRH2, CDRH3, CDRL1, CDRL2, CDRL3, VL, VH, or combinations thereof. In some instances, the at least one region that is de novo synthesized is for framework element 1 (FW1), framework element 2 (FW2), framework element 3 (FW3), or framework element 4 (FW4). In some instances, the variant sequence comprises at least or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, or more than 50 variant nucleotides or amino acids as compared to wild-type. In some instances, the variant sequence comprises at least or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, or 50 additional nucleotides or amino acids as compared to wild-type. In some instances, the variant sequence comprises at least or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, or 50 less nucleotides or amino acids as compared to wild-type. In some instances, the libraries comprise at least or about 10.sup.1, 10.sup.2, 10.sup.3, 10.sup.4, 10.sup.5, 10.sup.6, 10.sup.7, 10.sup.8, 10.sup.9, 10.sup.10, or more than 10.sup.10 variants.

[0126] Following synthesis of antibody libraries, antibody libraries may be used for screening and analysis. For example, antibody libraries are assayed for library displayability and panning. In some instances, displayability is assayed using a selectable tag. Exemplary tags include, but are not limited to, a radioactive label, a fluorescent label, an enzyme, a chemiluminescent tag, a colorimetric tag, an affinity tag or other labels or tags that are known in the art. In some instances, the tag is histidine, polyhistidine, myc, hemagglutinin (HA), or FLAG. In some instances, antibody libraries are assayed by sequencing using various methods including, but not limited to, single-molecule real-time (SMRT) sequencing, Polony sequencing, sequencing by ligation, reversible terminator sequencing, proton detection sequencing, ion semiconductor sequencing, nanopore sequencing, electronic sequencing, pyrosequencing, Maxam-Gilbert sequencing, chain termination (e.g., Sanger) sequencing, +S sequencing, or sequencing by synthesis. In some instances, antibody libraries are displayed on the surface of a cell or phage. In some instances, antibody libraries are enriched for sequences with a desired activity using phage display.

[0127] In some instances, the antibody libraries are assayed for functional activity, structural stability (e.g., thermal stable or pH stable), expression, specificity, or a combination thereof. In some instances, the antibody libraries are assayed for antibody capable of folding. In some instances, a region of the antibody is assayed for functional activity, structural stability, expression, specificity, folding, or a combination thereof. For example, a VH region or VL region is assayed for functional activity, structural stability, expression, specificity, folding, or a combination thereof.

[0128] In some instances, the affinity of antibodies or IgGs generated by methods as described herein is at least or about 1.5.times., 2.0.times., 5.times., 10.times., 20.times., 30.times., 40.times., 50.times., 60.times., 70.times., 80.times., 90.times., 100.times., 200.times., or more than 200.times. improved binding affinity as compared to a comparator antibody. In some instances, the affinity of antibodies or IgGs generated by methods as described herein is at least or about 1.5.times., 2.0.times., 5.times., 10.times., 20.times., 30.times., 40.times., 50.times., 60.times., 70.times., 80.times., 90.times., 100.times., 200.times., or more than 200.times. improved function as compared to a comparator antibody. In some instances, the comparator antibody is an antibody with similar structure, sequence, or antigen target.

[0129] Expression Systems

[0130] Provided herein are libraries comprising nucleic acids encoding for antibody comprising binding domains, wherein the libraries have improved specificity, stability, expression, folding, or downstream activity. In some instances, libraries described herein are used for screening and analysis.

[0131] Provided herein are libraries comprising nucleic acids encoding for antibody comprising binding domains, wherein the nucleic acid libraries are used for screening and analysis. In some instances, screening and analysis comprises in vitro, in vivo, or ex vivo assays. Cells for screening include primary cells taken from living subjects or cell lines. Cells may be from prokaryotes (e.g., bacteria and fungi) or eukaryotes (e.g., animals and plants). Exemplary animal cells include, without limitation, those from a mouse, rabbit, primate, and insect. In some instances, cells for screening include a cell line including, but not limited to, Chinese Hamster Ovary (CHO) cell line, human embryonic kidney (HEK) cell line, or baby hamster kidney (BHK) cell line. In some instances, nucleic acid libraries described herein may also be delivered to a multicellular organism. Exemplary multicellular organisms include, without limitation, a plant, a mouse, rabbit, primate, and insect.

[0132] Nucleic acid libraries described herein may be screened for various pharmacological or pharmacokinetic properties. In some instances, the libraries are screened using in vitro assays, in vivo assays, or ex vivo assays. For example, in vitro pharmacological or pharmacokinetic properties that are screened include, but are not limited to, binding affinity, binding specificity, and binding avidity. Exemplary in vivo pharmacological or pharmacokinetic properties of libraries described herein that are screened include, but are not limited to, therapeutic efficacy, activity, preclinical toxicity properties, clinical efficacy properties, clinical toxicity properties, immunogenicity, potency, and clinical safety properties.

[0133] Provided herein are nucleic acid libraries, wherein the nucleic acid libraries may be expressed in a vector. Expression vectors for inserting nucleic acid libraries disclosed herein may comprise eukaryotic or prokaryotic expression vectors. Exemplary expression vectors include, without limitation, mammalian expression vectors: pSF-CMV-NEO-NH2-PPT-3XFLAG, pSF-CMV-NEO-COOH-3XFLAG, pSF-CMV-PURO-NH2-GST-TEV, pSF-OXB20-COOH-TEV-FLAG(R)-6His, pCEP4 pDEST27, pSF-CMV-Ub-KrYFP, pSF-CMV-FMDV-daGFP, pEF1a-mCherry-N1 Vector, pEF1a-tdTomato Vector, pSF-CMV-FMDV-Hygro, pSF-CMV-PGK-Puro, pMCP-tag(m), and pSF-CMV-PURO-NH2-CMYC; bacterial expression vectors: pSF-OXB20-BetaGal,pSF-OXB20-Fluc, pSF-OXB20, and pSF-Tac; plant expression vectors: pRI 101-AN DNA and pCambia2301; and yeast expression vectors: pTYB21 and pKLAC2, and insect vectors: pAc5.1/V5-His A and pDEST8. In some instances, the vector is pcDNA3 or pcDNA3.1.

[0134] Described herein are nucleic acid libraries that are expressed in a vector to generate a construct comprising an antibody. In some instances, a size of the construct varies. In some instances, the construct comprises at least or about 500, 600, 700, 800, 900, 1000, 1100, 1300, 1400, 1500, 1600, 1700, 1800, 2000, 2400, 2600, 2800, 3000, 3200, 3400, 3600, 3800, 4000, 4200, 4400, 4600, 4800, 5000, 6000, 7000, 8000, 9000, 10000, or more than 10000 bases. In some instances, a the construct comprises a range of about 300 to 1,000, 300 to 2,000, 300 to 3,000, 300 to 4,000, 300 to 5,000, 300 to 6,000, 300 to 7,000, 300 to 8,000, 300 to 9,000, 300 to 10,000, 1,000 to 2,000, 1,000 to 3,000, 1,000 to 4,000, 1,000 to 5,000, 1,000 to 6,000, 1,000 to 7,000, 1,000 to 8,000, 1,000 to 9,000, 1,000 to 10,000, 2,000 to 3,000, 2,000 to 4,000, 2,000 to 5,000, 2,000 to 6,000, 2,000 to 7,000, 2,000 to 8,000, 2,000 to 9,000, 2,000 to 10,000, 3,000 to 4,000, 3,000 to 5,000, 3,000 to 6,000, 3,000 to 7,000, 3,000 to 8,000, 3,000 to 9,000, 3,000 to 10,000, 4,000 to 5,000, 4,000 to 6,000, 4,000 to 7,000, 4,000 to 8,000, 4,000 to 9,000, 4,000 to 10,000, 5,000 to 6,000, 5,000 to 7,000, 5,000 to 8,000, 5,000 to 9,000, 5,000 to 10,000, 6,000 to 7,000, 6,000 to 8,000, 6,000 to 9,000, 6,000 to 10,000, 7,000 to 8,000, 7,000 to 9,000, 7,000 to 10,000, 8,000 to 9,000, 8,000 to 10,000, or 9,000 to 10,000 bases.

[0135] Provided herein are libraries comprising nucleic acids encoding for antibodies, wherein the nucleic acid libraries are expressed in a cell. In some instances, the libraries are synthesized to express a reporter gene. Exemplary reporter genes include, but are not limited to, acetohydroxyacid synthase (AHAS), alkaline phosphatase (AP), beta galactosidase (LacZ), beta glucuronidase (GUS), chloramphenicol acetyltransferase (CAT), green fluorescent protein (GFP), red fluorescent protein (RFP), yellow fluorescent protein (YFP), cyan fluorescent protein (CFP), cerulean fluorescent protein, citrine fluorescent protein, orange fluorescent protein, cherry fluorescent protein, turquoise fluorescent protein, blue fluorescent protein, horseradish peroxidase (HRP), luciferase (Luc), nopaline synthase (NOS), octopine synthase (OCS), luciferase, and derivatives thereof. Methods to determine modulation of a reporter gene are well known in the art, and include, but are not limited to, fluorometric methods (e.g. fluorescence spectroscopy, Fluorescence Activated Cell Sorting (FACS), fluorescence microscopy), and antibiotic resistance determination.

[0136] Diseases and Disorders

[0137] Provided herein are SARS-CoV-2 or ACE2 binding libraries comprising nucleic acids encoding for antibodies comprising SARS-CoV-2 or ACE2 binding domains may have therapeutic effects. In some instances, the SARS-CoV-2 or ACE2 binding libraries result in protein when translated that is used to treat a disease or disorder. In some instances, the protein is an immunoglobulin. In some instances, the protein is a peptidomimetic. In some instances, the disease or disorder is a viral infection caused by SARS-CoV-2. In some instances, the disease or disorder is a respiratory disease or disorder caused by SARS-CoV-2.

[0138] SARS-CoV-2 or ACE2 variant antibody libraries as described herein may be used to treat SARS-CoV-2. In some embodiments, the SARS-CoV-2 or ACE2 variant antibody libraries are used to treat or prevent symptoms of SARS-CoV-2. These symptoms include, but are not limited to, fever, chills, cough, fatigue, headaches, loss of taste, loss of smell, nausea, vomiting, muscle weakness, sleep difficulties, anxiety, and depression. In some embodiments, the SARS-CoV-2 or ACE2 variant antibody libraries are used to treat a subject who has symptoms for an extended period of time. In some embodiments, the subject has symptoms for an extended period of time after testing negative for SARS-CoV-2. In some embodiments, the subject has symptoms for an extended period of time including at least 1 week, 2 weeks, 3 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 1 year, or more than 1 year.

[0139] In some instances, the subject is a mammal. In some instances, the subject is a mouse, rabbit, dog, or human. Subjects treated by methods described herein may be infants, adults, or children. Pharmaceutical compositions comprising antibodies or antibody fragments as described herein may be administered intravenously or subcutaneously. In some instances, a pharmaceutical composition comprises an antibody or antibody fragment described herein comprising a CDRH1 sequence of any one of SEQ ID NOs: 217-266, 1495-1635, or 2059-2238. In some instances, a pharmaceutical composition comprises an antibody or antibody fragment described herein comprising a CDRH2 sequence of any one of SEQ ID NOs: 267-316, 1636-1776, or 2239-2418 In some instances, a pharmaceutical composition comprises an antibody or antibody fragment described herein comprising a CDRH3 sequence of any one of SEQ ID NOs: 317-366, 1777-1917, or 2419-2598. In some instances, a pharmaceutical composition comprises an antibody or antibody fragment described herein comprising a variable domain, heavy chain region (VH) and a variable domain, light chain region (VL), wherein VH comprises complementarity determining regions CDRH1, CDRH2, and CDRH3, wherein VL comprises complementarity determining regions CDRL1, CDRL2, and CDRL3, and wherein (a) an amino acid sequence of CDRH1 is as set forth in any one of SEQ ID NOs: 1-36 or 217-282; (b) an amino acid sequence of CDRH2 is as set forth in any one of SEQ ID NOs: 37-72 or 283-348; (c) an amino acid sequence of CDRH3 is as set forth in any one of SEQ ID NOs: 73-108 or 349-414; (d) an amino acid sequence of CDRL1 is as set forth in any one of SEQ ID NOs: 109-144 or 415-473; (e) an amino acid sequence of CDRL2 is as set forth in any one of SEQ ID NOs: 145-180 or 415-473; and (f) an amino acid sequence of CDRL3 is as set forth in any one of SEQ ID NOs: 181-216 or 533-591. In some instances, a pharmaceutical composition comprises an antibody or antibody fragment described herein comprising a VH comprising at least or about 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to any one of SEQ ID NOs: 592-657, and VL comprising at least or about 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to any one of SEQ ID NOs: 658-716. In some instances, a pharmaceutical composition comprises an antibody or antibody fragment described herein comprising a heavy chain variable domain comprising at least or about 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to any one of SEQ ID NOs: 1918-2058, 2599-2778, and 3095-3173.

[0140] SARS-CoV-2 or ACE2 antibodies as described herein may confer immunity after exposure to SARS-CoV-2 or ACE2 antibodies. In some embodiments, the SARS-CoV-2 or ACE2 antibodies described herein are used for passive immunization of a subject. In some instances, the subject is actively immunized after exposure to SARS-CoV-2 or ACE2 antibodies followed by exposure to SARS-CoV-2. In some embodiments, SARS-CoV-2 or ACE2 antibodies are derived from a subject who has recovered from SARS-CoV-2.

[0141] In some embodiments, the immunity occurs at least about 30 minutes, 1 hour, 5 hours, 10 hours, 16 hours, 20 hours, 24 hours, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, or more than 2 weeks after exposure to SARS-CoV-2 or ACE2 antibodies. In some instances, the immunity lasts for at least about 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 1 year, 2 years, 3 years, 4 years, 5 years, or more than 5 years after exposure to SARS-CoV-2 or ACE2 antibodies.

[0142] In some embodiments, the subject receives the SARS-CoV-2 or ACE2 antibodies prior to exposure to SARS-CoV-2. In some embodiments, the subject receives the SARS-CoV-2 or ACE2 antibodies at least about 30 minutes, 1 hour, 4 hours, 8 hours, 12 hours, 16 hours, 20 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 1 year, 2 years, 3 years, 4 years, 5 years, or more than 5 years prior to exposure to SARS-CoV-2. In some embodiments, the subject receives the SARS-CoV-2 or ACE2 antibodies after exposure to SARS-CoV-2. In some embodiments, the subject receives the SARS-CoV-2 or ACE2 antibodies at least about 30 minutes, 1 hour, 4 hours, 8 hours, 12 hours, 16 hours, 20 hours, 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 1 year, 2 years, 3 years, 4 years, 5 years, or more than 5 years after exposure to SARS-CoV-2.

[0143] SARS-CoV-2 or ACE2 antibodies described herein may be administered through various routes. The administration may, depending on the composition being administered, for example, be oral, pulmonary, intravenous, intraperitoneal, intramuscular, intracavity, subcutaneous, or transdermal.

[0144] Described herein are compositions or pharmaceutical compositions comprising SARS-CoV-2 or ACE2 antibodies or antibody fragment thereof that comprise various dosages of the antibodies or antibody fragment. In some instances, the dosage is ranging from about 1 to 25 mg/kg, from about 1 to 50 mg/kg, from about 1 to 80 mg/kg, from about 1 to about 100 mg/kg, from about 5 to about 100 mg/kg, from about 5 to about 80 mg/kg, from about 5 to about 60 mg/kg, from about 5 to about 50 mg/kg or from about 5 to about 500 mg/kg which can be administered in single or multiple doses. In some instances, the dosage is administered in an amount of about 0.01 mg/kg, about 0.05 mg/kg, about 0.10 mg/kg, about 0.25 mg/kg, about 0.5 mg/kg, about 1 mg/kg, about 5 mg/kg, about 10 mg/kg, about 15 mg/kg, about 20 mg/kg, about 25 mg/kg, about 30 mg/kg, about 35 mg/kg, about 40 mg/kg, about 45 mg/kg, about 50 mg/kg, about 55 mg/kg, about 60 mg/kg, about 65 mg/kg, about 70 mg/kg, about 75 mg/kg, about 80 mg/kg, about 85 mg/kg, about 90 mg/kg, about 95 mg/kg, about 100 mg/kg, about 105 mg/kg, about 110 mg/kg, about 115 mg/kg, about 120, about 125, about 130, about 135, about 140, about 145, about 150, about 155, about 160, about 165, about 170, about 175, about 180, about 185, about 190, about 195, about 200, about 205, about 210, about 215, about 220, about 225, about 230, about 240, about 250, about 260, about 270, about 275, about 280, about 290, about 300, about 310, about 320, about 330, about 340, about 350, about 360 mg/kg, about 370 mg/kg, about 380 mg/kg, about 390 mg/kg, about 400 mg/kg, 410 mg/kg, about 420 mg/kg, about 430 mg/kg, about 440 mg/kg, about 450 mg/kg, about 460 mg/kg, about 470 mg/kg, about 480 mg/kg, about 490 mg/kg, or about 500 mg/kg.

[0145] SARS-CoV-2 or ACE2 antibodies or antibody fragment thereof described herein, in some embodiments, improve disease severity. In some embodiments, the SARS-CoV-2 or ACE2 antibodies or antibody fragment thereof improve disease severity at a dose level of about 0.01 mg/kg, about 0.05 mg/kg, about 0.10 mg/kg, about 0.25 mg/kg, about 0.5 mg/kg, about 1 mg/kg, about 5 mg/kg, about 10 mg/kg, about 15 mg/kg, or about 20 mg/kg. In some embodiments, the SARS-CoV-2 or ACE2 antibodies or antibody fragment thereof improve disease severity at a dose level of about 1 mg/kg, about 5 mg/kg, or about 10 mg/kg. In some embodiments, disease severity is determined by percent weight loss. In some embodiments, the SARS-CoV-2 or ACE2 antibodies or antibody fragment thereof protects against weight loss at a dose level of about 0.01 mg/kg, about 0.05 mg/kg, about 0.10 mg/kg, about 0.25 mg/kg, about 0.5 mg/kg, about 1 mg/kg, about 5 mg/kg, about 10 mg/kg, about 15 mg/kg, or about 20 mg/kg. In some embodiments, the SARS-CoV-2 or ACE2 antibodies or antibody fragment thereof protects against weight loss at a dose level of about 1 mg/kg, about 5 mg/kg, or about 10 mg/kg. In some embodiments, SARS-CoV-2 or ACE2 antibodies or antibody fragment thereof

[0146] Variant Libraries

[0147] Codon Variation

[0148] Variant nucleic acid libraries described herein may comprise a plurality of nucleic acids, wherein each nucleic acid encodes for a variant codon sequence compared to a reference nucleic acid sequence. In some instances, each nucleic acid of a first nucleic acid population contains a variant at a single variant site. In some instances, the first nucleic acid population contains a plurality of variants at a single variant site such that the first nucleic acid population contains more than one variant at the same variant site. The first nucleic acid population may comprise nucleic acids collectively encoding multiple codon variants at the same variant site. The first nucleic acid population may comprise nucleic acids collectively encoding up to 19 or more codons at the same position. The first nucleic acid population may comprise nucleic acids collectively encoding up to 60 variant triplets at the same position, or the first nucleic acid population may comprise nucleic acids collectively encoding up to 61 different triplets of codons at the same position. Each variant may encode for a codon that results in a different amino acid during translation. Table 1 provides a listing of each codon possible (and the representative amino acid) for a variant site.

TABLE-US-00001 TABLE 1 List of codons and amino acids One Three letter letter Amino Acids code code Codons Alanine A Ala GCA GCC GCG GCT Cysteine C Cys TGC TGT Aspartic D Asp GAC GAT acid Glutamic E Glu GAA GAG acid Phenylalanine F Phe TTC TTT Glycine G Gly GGA GGC GGG GGT Histidine H His CAC CAT Isoleucine I Iso ATA ATC ATT Lysine K Lys AAA AAG Leucine L Leu TTA TTG CTA CTC CTG CTT Methionine M Met ATG Asparagine N Asn AAC AAT Proline P Pro CCA CCC CCG CCT Glutamine Q Gln CAA CAG Arginine R Arg AGA AGG CGA CGC CGG CGT Serine S Ser AGC AGT TCA TCC TCG TCT Threonine T Thr ACA ACC ACG ACT Valine V Val GTA GTC GTG GTT Tryptophan W Trp TGG Tyrosine Y Tyr TAC TAT

[0149] A nucleic acid population may comprise varied nucleic acids collectively encoding up to 20 codon variations at multiple positions. In such cases, each nucleic acid in the population comprises variation for codons at more than one position in the same nucleic acid. In some instances, each nucleic acid in the population comprises variation for codons at 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more codons in a single nucleic acid. In some instances, each variant long nucleic acid comprises variation for codons at 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more codons in a single long nucleic acid. In some instances, the variant nucleic acid population comprises variation for codons at 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more codons in a single nucleic acid. In some instances, the variant nucleic acid population comprises variation for codons in at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100 or more codons in a single long nucleic acid.

[0150] Highly Parallel Nucleic Acid Synthesis

[0151] Provided herein is a platform approach utilizing miniaturization, parallelization, and vertical integration of the end-to-end process from polynucleotide synthesis to gene assembly within nanowells on silicon to create a revolutionary synthesis platform. Devices described herein provide, with the same footprint as a 96-well plate, a silicon synthesis platform is capable of increasing throughput by a factor of up to 1,000 or more compared to traditional synthesis methods, with production of up to approximately 1,000,000 or more polynucleotides, or 10,000 or more genes in a single highly-parallelized run.

[0152] With the advent of next-generation sequencing, high resolution genomic data has become an important factor for studies that delve into the biological roles of various genes in both normal biology and disease pathogenesis. At the core of this research is the central dogma of molecular biology and the concept of "residue-by-residue transfer of sequential information." Genomic information encoded in the DNA is transcribed into a message that is then translated into the protein that is the active product within a given biological pathway.

[0153] Another exciting area of study is on the discovery, development and manufacturing of therapeutic molecules focused on a highly-specific cellular target. High diversity DNA sequence libraries are at the core of development pipelines for targeted therapeutics. Gene variants are used to express proteins in a design, build, and test protein engineering cycle that ideally culminates in an optimized gene for high expression of a protein with high affinity for its therapeutic target. As an example, consider the binding pocket of a receptor. The ability to test all sequence permutations of all residues within the binding pocket simultaneously will allow for a thorough exploration, increasing chances of success. Saturation mutagenesis, in which a researcher attempts to generate all possible mutations or variants at a specific site within the receptor, represents one approach to this development challenge. Though costly and time and labor-intensive, it enables each variant to be introduced into each position. In contrast, combinatorial mutagenesis, where a few selected positions or short stretch of DNA may be modified extensively, generates an incomplete repertoire of variants with biased representation.

[0154] To accelerate the drug development pipeline, a library with the desired variants available at the intended frequency in the right position available for testing--in other words, a precision library, enables reduced costs as well as turnaround time for screening. Provided herein are methods for synthesizing nucleic acid synthetic variant libraries which provide for precise introduction of each intended variant at the desired frequency. To the end user, this translates to the ability to not only thoroughly sample sequence space but also be able to query these hypotheses in an efficient manner, reducing cost and screening time. Genome-wide editing can elucidate important pathways, libraries where each variant and sequence permutation can be tested for optimal functionality, and thousands of genes can be used to reconstruct entire pathways and genomes to re-engineer biological systems for drug discovery.

[0155] In a first example, a drug itself can be optimized using methods described herein. For example, to improve a specified function of an antibody, a variant polynucleotide library encoding for a portion of the antibody is designed and synthesized. A variant nucleic acid library for the antibody can then be generated by processes described herein (e.g., PCR mutagenesis followed by insertion into a vector). The antibody is then expressed in a production cell line and screened for enhanced activity. Example screens include examining modulation in binding affinity to an antigen, stability, or effector function (e.g., ADCC, complement, or apoptosis). Exemplary regions to optimize the antibody include, without limitation, the Fc region, Fab region, variable region of the Fab region, constant region of the Fab region, variable domain of the heavy chain or light chain (V.sub.H or V.sub.L), and specific complementarity-determining regions (CDRs) of V.sub.H or V.sub.L.

[0156] Nucleic acid libraries synthesized by methods described herein may be expressed in various cells associated with a disease state. Cells associated with a disease state include cell lines, tissue samples, primary cells from a subject, cultured cells expanded from a subject, or cells in a model system. Exemplary model systems include, without limitation, plant and animal models of a disease state.

[0157] To identify a variant molecule associated with prevention, reduction or treatment of a disease state, a variant nucleic acid library described herein is expressed in a cell associated with a disease state, or one in which a cell a disease state can be induced. In some instances, an agent is used to induce a disease state in cells. Exemplary tools for disease state induction include, without limitation, a Cre/Lox recombination system, LPS inflammation induction, and streptozotocin to induce hypoglycemia. The cells associated with a disease state may be cells from a model system or cultured cells, as well as cells from a subject having a particular disease condition. Exemplary disease conditions include a bacterial, fungal, viral, autoimmune, or proliferative disorder (e.g., cancer). In some instances, the variant nucleic acid library is expressed in the model system, cell line, or primary cells derived from a subject, and screened for changes in at least one cellular activity. Exemplary cellular activities include, without limitation, proliferation, cycle progression, cell death, adhesion, migration, reproduction, cell signaling, energy production, oxygen utilization, metabolic activity, and aging, response to free radical damage, or any combination thereof

[0158] Substrates

[0159] Devices used as a surface for polynucleotide synthesis may be in the form of substrates which include, without limitation, homogenous array surfaces, patterned array surfaces, channels, beads, gels, and the like. Provided herein are substrates comprising a plurality of clusters, wherein each cluster comprises a plurality of loci that support the attachment and synthesis of polynucleotides. In some instances, substrates comprise a homogenous array surface. For example, the homogenous array surface is a homogenous plate. The term "locus" as used herein refers to a discrete region on a structure which provides support for polynucleotides encoding for a single predetermined sequence to extend from the surface. In some instances, a locus is on a two dimensional surface, e.g., a substantially planar surface. In some instances, a locus is on a three-dimensional surface, e.g., a well, microwell, channel, or post. In some instances, a surface of a locus comprises a material that is actively functionalized to attach to at least one nucleotide for polynucleotide synthesis, or preferably, a population of identical nucleotides for synthesis of a population of polynucleotides. In some instances, polynucleotide refers to a population of polynucleotides encoding for the same nucleic acid sequence. In some cases, a surface of a substrate is inclusive of one or a plurality of surfaces of a substrate. The average error rates for polynucleotides synthesized within a library described here using the systems and methods provided are often less than 1 in 1000, less than about 1 in 2000, less than about 1 in 3000 or less often without error correction.

[0160] Provided herein are surfaces that support the parallel synthesis of a plurality of polynucleotides having different predetermined sequences at addressable locations on a common support. In some instances, a substrate provides support for the synthesis of more than 50, 100, 200, 400, 600, 800, 1000, 1200, 1400, 1600, 1800, 2,000; 5,000; 10,000; 20,000; 50,000; 100,000; 200,000; 300,000; 400,000; 500,000; 600,000; 700,000; 800,000; 900,000; 1,000,000; 1,200,000; 1,400,000; 1,600,000; 1,800,000; 2,000,000; 2,500,000; 3,000,000; 3,500,000; 4,000,000; 4,500,000; 5,000,000; 10,000,000 or more non-identical polynucleotides. In some cases, the surfaces provide support for the synthesis of more than 50, 100, 200, 400, 600, 800, 1000, 1200, 1400, 1600, 1800, 2,000; 5,000; 10,000; 20,000; 50,000; 100,000; 200,000; 300,000; 400,000; 500,000; 600,000; 700,000; 800,000; 900,000; 1,000,000; 1,200,000; 1,400,000; 1,600,000; 1,800,000; 2,000,000; 2,500,000; 3,000,000; 3,500,000; 4,000,000; 4,500,000; 5,000,000; 10,000,000 or more polynucleotides encoding for distinct sequences. In some instances, at least a portion of the polynucleotides have an identical sequence or are configured to be synthesized with an identical sequence. In some instances, the substrate provides a surface environment for the growth of polynucleotides having at least 80, 90, 100, 120, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500 bases or more.

[0161] Provided herein are methods for polynucleotide synthesis on distinct loci of a substrate, wherein each locus supports the synthesis of a population of polynucleotides. In some cases, each locus supports the synthesis of a population of polynucleotides having a different sequence than a population of polynucleotides grown on another locus. In some instances, each polynucleotide sequence is synthesized with 1, 2, 3, 4, 5, 6, 7, 8, 9 or more redundancy across different loci within the same cluster of loci on a surface for polynucleotide synthesis. In some instances, the loci of a substrate are located within a plurality of clusters. In some instances, a substrate comprises at least 10, 500, 1000, 2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000, 10000, 11000, 12000, 13000, 14000, 15000, 20000, 30000, 40000, 50000 or more clusters. In some instances, a substrate comprises more than 2,000; 5,000; 10,000; 100,000; 200,000; 300,000; 400,000; 500,000; 600,000; 700,000; 800,000; 900,000; 1,000,000; 1,100,000; 1,200,000; 1,300,000; 1,400,000; 1,500,000; 1,600,000; 1,700,000; 1,800,000; 1,900,000; 2,000,000; 300,000; 400,000; 500,000; 600,000; 700,000; 800,000; 900,000; 1,000,000; 1,200,000; 1,400,000; 1,600,000; 1,800,000; 2,000,000; 2,500,000; 3,000,000; 3,500,000; 4,000,000; 4,500,000; 5,000,000; or 10,000,000 or more distinct loci. In some instances, a substrate comprises about 10,000 distinct loci. The amount of loci within a single cluster is varied in different instances. In some cases, each cluster includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 120, 130, 150, 200, 300, 400, 500 or more loci. In some instances, each cluster includes about 50-500 loci. In some instances, each cluster includes about 100-200 loci. In some instances, each cluster includes about 100-150 loci. In some instances, each cluster includes about 109, 121, 130 or 137 loci. In some instances, each cluster includes about 19, 20, 61, 64 or more loci. Alternatively or in combination, polynucleotide synthesis occurs on a homogenous array surface.

[0162] In some instances, the number of distinct polynucleotides synthesized on a substrate is dependent on the number of distinct loci available in the substrate. In some instances, the density of loci within a cluster or surface of a substrate is at least or about 1, 10, 25, 50, 65, 75, 100, 130, 150, 175, 200, 300, 400, 500, 1,000 or more loci per mm.sup.2. In some cases, a substrate comprises 10-500, 25-400, 50-500, 100-500, 150-500, 10-250, 50-250, 10-200, or 50-200 mm.sup.2. In some instances, the distance between the centers of two adjacent loci within a cluster or surface is from about 10-500, from about 10-200, or from about 10-100 um. In some instances, the distance between two centers of adjacent loci is greater than about 10, 20, 30, 40, 50, 60, 70, 80, 90 or 100 um. In some instances, the distance between the centers of two adjacent loci is less than about 200, 150, 100, 80, 70, 60, 50, 40, 30, 20 or 10 um. In some instances, each locus has a width of about 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90 or 100 um. In some cases, each locus has a width of about 0.5-100, 0.5-50, 10-75, or 0.5-50 um.

[0163] In some instances, the density of clusters within a substrate is at least or about 1 cluster per 100 mm.sup.2, 1 cluster per 10 mm.sup.2, 1 cluster per 5 mm.sup.2, 1 cluster per 4 mm.sup.2, 1 cluster per 3 mm.sup.2, 1 cluster per 2 mm.sup.2, 1 cluster per 1 mm.sup.2, 2 clusters per 1 mm.sup.2, 3 clusters per 1 mm.sup.2, 4 clusters per 1 mm.sup.2, 5 clusters per 1 mm.sup.2, 10 clusters per 1 mm.sup.2, 50 clusters per 1 mm.sup.2 or more. In some instances, a substrate comprises from about 1 cluster per 10 mm.sup.2 to about 10 clusters per 1 mm.sup.2. In some instances, the distance between the centers of two adjacent clusters is at least or about 50, 100, 200, 500, 1000, 2000, or 5000 um. In some cases, the distance between the centers of two adjacent clusters is between about 50-100, 50-200, 50-300, 50-500, and 100-2000 um. In some cases, the distance between the centers of two adjacent clusters is between about 0.05-50, 0.05-10, 0.05-5, 0.05-4, 0.05-3, 0.05-2, 0.1-10, 0.2-10, 0.3-10, 0.4-10, 0.5-10, 0.5-5, or 0.5-2 mm. In some cases, each cluster has a cross section of about 0.5 to about 2, about 0.5 to about 1, or about 1 to about 2 mm. In some cases, each cluster has a cross section of about 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9 or 2 mm. In some cases, each cluster has an interior cross section of about 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.1, 1.15, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9 or 2 mm.

[0164] In some instances, a substrate is about the size of a standard 96 well plate, for example between about 100 and about 200 mm by between about 50 and about 150 mm. In some instances, a substrate has a diameter less than or equal to about 1000, 500, 450, 400, 300, 250, 200, 150, 100 or 50 mm. In some instances, the diameter of a substrate is between about 25-1000, 25-800, 25-600, 25-500, 25-400, 25-300, or 25-200 mm. In some instances, a substrate has a planar surface area of at least about 100; 200; 500; 1,000; 2,000; 5,000; 10,000; 12,000; 15,000; 20,000; 30,000; 40,000; 50,000 mm.sup.2 or more. In some instances, the thickness of a substrate is between about 50-2000, 50-1000, 100-1000, 200-1000, or 250-1000 mm.

[0165] Surface Materials

[0166] Substrates, devices, and reactors provided herein are fabricated from any variety of materials suitable for the methods, compositions, and systems described herein. In certain instances, substrate materials are fabricated to exhibit a low level of nucleotide binding. In some instances, substrate materials are modified to generate distinct surfaces that exhibit a high level of nucleotide binding. In some instances, substrate materials are transparent to visible and/or UV light. In some instances, substrate materials are sufficiently conductive, e.g., are able to form uniform electric fields across all or a portion of a substrate. In some instances, conductive materials are connected to an electric ground. In some instances, the substrate is heat conductive or insulated. In some instances, the materials are chemical resistant and heat resistant to support chemical or biochemical reactions, for example polynucleotide synthesis reaction processes. In some instances, a substrate comprises flexible materials. For flexible materials, materials can include, without limitation: nylon, both modified and unmodified, nitrocellulose, polypropylene, and the like. In some instances, a substrate comprises rigid materials. For rigid materials, materials can include, without limitation: glass; fuse silica; silicon, plastics (for example polytetrafluoroethylene, polypropylene, polystyrene, polycarbonate, and blends thereof, and the like); metals (for example, gold, platinum, and the like). The substrate, solid support or reactors can be fabricated from a material selected from the group consisting of silicon, polystyrene, agarose, dextran, cellulosic polymers, polyacrylamides, polydimethylsiloxane (PDMS), and glass. The substrates/solid supports or the microstructures, reactors therein may be manufactured with a combination of materials listed herein or any other suitable material known in the art.

[0167] Surface Architecture

[0168] Provided herein are substrates for the methods, compositions, and systems described herein, wherein the substrates have a surface architecture suitable for the methods, compositions, and systems described herein. In some instances, a substrate comprises raised and/or lowered features. One benefit of having such features is an increase in surface area to support polynucleotide synthesis. In some instances, a substrate having raised and/or lowered features is referred to as a three-dimensional substrate. In some cases, a three-dimensional substrate comprises one or more channels. In some cases, one or more loci comprise a channel. In some cases, the channels are accessible to reagent deposition via a deposition device such as a material deposition device. In some cases, reagents and/or fluids collect in a larger well in fluid communication one or more channels. For example, a substrate comprises a plurality of channels corresponding to a plurality of loci with a cluster, and the plurality of channels are in fluid communication with one well of the cluster. In some methods, a library of polynucleotides is synthesized in a plurality of loci of a cluster.

[0169] Provided herein are substrates for the methods, compositions, and systems described herein, wherein the substrates are configured for polynucleotide synthesis. In some instances, the structure is configured to allow for controlled flow and mass transfer paths for polynucleotide synthesis on a surface. In some instances, the configuration of a substrate allows for the controlled and even distribution of mass transfer paths, chemical exposure times, and/or wash efficacy during polynucleotide synthesis. In some instances, the configuration of a substrate allows for increased sweep efficiency, for example by providing sufficient volume for a growing polynucleotide such that the excluded volume by the growing polynucleotide does not take up more than 50, 45, 40, 35, 30, 25, 20, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1%, or less of the initially available volume that is available or suitable for growing the polynucleotide. In some instances, a three-dimensional structure allows for managed flow of fluid to allow for the rapid exchange of chemical exposure.

[0170] Provided herein are substrates for the methods, compositions, and systems described herein, wherein the substrates comprise structures suitable for the methods, compositions, and systems described herein. In some instances, segregation is achieved by physical structure. In some instances, segregation is achieved by differential functionalization of the surface generating active and passive regions for polynucleotide synthesis. In some instances, differential functionalization is achieved by alternating the hydrophobicity across the substrate surface, thereby creating water contact angle effects that cause beading or wetting of the deposited reagents. Employing larger structures can decrease splashing and cross-contamination of distinct polynucleotide synthesis locations with reagents of the neighboring spots. In some cases, a device, such as a material deposition device, is used to deposit reagents to distinct polynucleotide synthesis locations. Substrates having three-dimensional features are configured in a manner that allows for the synthesis of a large number of polynucleotides (e.g., more than about 10,000) with a low error rate (e.g., less than about 1:500, 1:1000, 1:1500, 1:2,000, 1:3,000, 1:5,000, or 1:10,000). In some cases, a substrate comprises features with a density of about or greater than about 1, 5, 10, 20, 30, 40, 50, 60, 70, 80, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 300, 400 or 500 features per mm.sup.2.

[0171] A well of a substrate may have the same or different width, height, and/or volume as another well of the substrate. A channel of a substrate may have the same or different width, height, and/or volume as another channel of the substrate. In some instances, the diameter of a cluster or the diameter of a well comprising a cluster, or both, is between about 0.05-50, 0.05-10, 0.05-5, 0.05-4, 0.05-3, 0.05-2, 0.05-1, 0.05-0.5, 0.05-0.1, 0.1-10, 0.2-10, 0.3-10, 0.4-10, 0.5-10, 0.5-5, or 0.5-2 mm. In some instances, the diameter of a cluster or well or both is less than or about 5, 4, 3, 2, 1, 0.5, 0.1, 0.09, 0.08, 0.07, 0.06, or 0.05 mm. In some instances, the diameter of a cluster or well or both is between about 1.0 and 1.3 mm. In some instances, the diameter of a cluster or well, or both is about 1.150 mm. In some instances, the diameter of a cluster or well, or both is about 0.08 mm. The diameter of a cluster refers to clusters within a two-dimensional or three-dimensional substrate.

[0172] In some instances, the height of a well is from about 20-1000, 50-1000, 100-1000, 200-1000, 300-1000, 400-1000, or 500-1000 um. In some cases, the height of a well is less than about 1000, 900, 800, 700, or 600 um.

[0173] In some instances, a substrate comprises a plurality of channels corresponding to a plurality of loci within a cluster, wherein the height or depth of a channel is 5-500, 5-400, 5-300, 5-200, 5-100, 5-50, or 10-50 um. In some cases, the height of a channel is less than 100, 80, 60, 40, or 20 um.

[0174] In some instances, the diameter of a channel, locus (e.g., in a substantially planar substrate) or both channel and locus (e.g., in a three-dimensional substrate wherein a locus corresponds to a channel) is from about 1-1000, 1-500, 1-200, 1-100, 5-100, or 10-100 um, for example, about 90, 80, 70, 60, 50, 40, 30, 20 or 10 um. In some instances, the diameter of a channel, locus, or both channel and locus is less than about 100, 90, 80, 70, 60, 50, 40, 30, 20 or 10 um. In some instances, the distance between the center of two adjacent channels, loci, or channels and loci is from about 1-500, 1-200, 1-100, 5-200, 5-100, 5-50, or 5-30, for example, about 20 um.

[0175] Surface Modifications

[0176] Provided herein are methods for polynucleotide synthesis on a surface, wherein the surface comprises various surface modifications. In some instances, the surface modifications are employed for the chemical and/or physical alteration of a surface by an additive or subtractive process to change one or more chemical and/or physical properties of a substrate surface or a selected site or region of a substrate surface. For example, surface modifications include, without limitation, (1) changing the wetting properties of a surface, (2) functionalizing a surface, i.e., providing, modifying or substituting surface functional groups, (3) defunctionalizing a surface, i.e., removing surface functional groups, (4) otherwise altering the chemical composition of a surface, e.g., through etching, (5) increasing or decreasing surface roughness, (6) providing a coating on a surface, e.g., a coating that exhibits wetting properties that are different from the wetting properties of the surface, and/or (7) depositing particulates on a surface.

[0177] In some cases, the addition of a chemical layer on top of a surface (referred to as adhesion promoter) facilitates structured patterning of loci on a surface of a substrate. Exemplary surfaces for application of adhesion promotion include, without limitation, glass, silicon, silicon dioxide and silicon nitride. In some cases, the adhesion promoter is a chemical with a high surface energy. In some instances, a second chemical layer is deposited on a surface of a substrate. In some cases, the second chemical layer has a low surface energy. In some cases, surface energy of a chemical layer coated on a surface supports localization of droplets on the surface. Depending on the patterning arrangement selected, the proximity of loci and/or area of fluid contact at the loci are alterable.

[0178] In some instances, a substrate surface, or resolved loci, onto which nucleic acids or other moieties are deposited, e.g., for polynucleotide synthesis, are smooth or substantially planar (e.g., two-dimensional) or have irregularities, such as raised or lowered features (e.g., three-dimensional features). In some instances, a substrate surface is modified with one or more different layers of compounds. Such modification layers of interest include, without limitation, inorganic and organic layers such as metals, metal oxides, polymers, small organic molecules and the like.

[0179] In some instances, resolved loci of a substrate are functionalized with one or more moieties that increase and/or decrease surface energy. In some cases, a moiety is chemically inert. In some cases, a moiety is configured to support a desired chemical reaction, for example, one or more processes in a polynucleotide synthesis reaction. The surface energy, or hydrophobicity, of a surface is a factor for determining the affinity of a nucleotide to attach onto the surface. In some instances, a method for substrate functionalization comprises: (a) providing a substrate having a surface that comprises silicon dioxide; and (b) silanizing the surface using, a suitable silanizing agent described herein or otherwise known in the art, for example, an organofunctional alkoxysilane molecule. Methods and functionalizing agents are described in U.S. Pat. No. 5,474,796, which is herein incorporated by reference in its entirety.

[0180] In some instances, a substrate surface is functionalized by contact with a derivatizing composition that contains a mixture of silanes, under reaction conditions effective to couple the silanes to the substrate surface, typically via reactive hydrophilic moieties present on the substrate surface. Silanization generally covers a surface through self-assembly with organofunctional alkoxysilane molecules. A variety of siloxane functionalizing reagents can further be used as currently known in the art, e.g., for lowering or increasing surface energy. The organofunctional alkoxysilanes are classified according to their organic functions.

[0181] Polynucleotide Synthesis

[0182] Methods of the current disclosure for polynucleotide synthesis may include processes involving phosphoramidite chemistry. In some instances, polynucleotide synthesis comprises coupling a base with phosphoramidite. Polynucleotide synthesis may comprise coupling a base by deposition of phosphoramidite under coupling conditions, wherein the same base is optionally deposited with phosphoramidite more than once, i.e., double coupling. Polynucleotide synthesis may comprise capping of unreacted sites. In some instances, capping is optional. Polynucleotide synthesis may also comprise oxidation or an oxidation step or oxidation steps. Polynucleotide synthesis may comprise deblocking, detritylation, and sulfurization. In some instances, polynucleotide synthesis comprises either oxidation or sulfurization. In some instances, between one or each step during a polynucleotide synthesis reaction, the device is washed, for example, using tetrazole or acetonitrile. Time frames for any one step in a phosphoramidite synthesis method may be less than about 2 min, 1 min, 50 sec, 40 sec, 30 sec, 20 sec and 10 sec.

[0183] Polynucleotide synthesis using a phosphoramidite method may comprise a subsequent addition of a phosphoramidite building block (e.g., nucleoside phosphoramidite) to a growing polynucleotide chain for the formation of a phosphite triester linkage. Phosphoramidite polynucleotide synthesis proceeds in the 3' to 5' direction. Phosphoramidite polynucleotide synthesis allows for the controlled addition of one nucleotide to a growing nucleic acid chain per synthesis cycle. In some instances, each synthesis cycle comprises a coupling step. Phosphoramidite coupling involves the formation of a phosphite triester linkage between an activated nucleoside phosphoramidite and a nucleoside bound to the substrate, for example, via a linker. In some instances, the nucleoside phosphoramidite is provided to the device activated. In some instances, the nucleoside phosphoramidite is provided to the device with an activator. In some instances, nucleoside phosphoramidites are provided to the device in a 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100-fold excess or more over the substrate-bound nucleosides. In some instances, the addition of nucleoside phosphoramidite is performed in an anhydrous environment, for example, in anhydrous acetonitrile. Following addition of a nucleoside phosphoramidite, the device is optionally washed. In some instances, the coupling step is repeated one or more additional times, optionally with a wash step between nucleoside phosphoramidite additions to the substrate. In some instances, a polynucleotide synthesis method used herein comprises 1, 2, 3 or more sequential coupling steps. Prior to coupling, in many cases, the nucleoside bound to the device is de-protected by removal of a protecting group, where the protecting group functions to prevent polymerization. A common protecting group is 4,4'-dimethoxytrityl (DMT).

[0184] Following coupling, phosphoramidite polynucleotide synthesis methods optionally comprise a capping step. In a capping step, the growing polynucleotide is treated with a capping agent. A capping step is useful to block unreacted substrate-bound 5'-OH groups after coupling from further chain elongation, preventing the formation of polynucleotides with internal base deletions. Further, phosphoramidites activated with 1H-tetrazole may react, to a small extent, with the O6 position of guanosine. Without being bound by theory, upon oxidation with I.sub.2/water, this side product, possibly via O6-N7 migration, may undergo depurination. The apurinic sites may end up being cleaved in the course of the final deprotection of the polynucleotide thus reducing the yield of the full-length product. The O6 modifications may be removed by treatment with the capping reagent prior to oxidation with I.sub.2/water. In some instances, inclusion of a capping step during polynucleotide synthesis decreases the error rate as compared to synthesis without capping. As an example, the capping step comprises treating the substrate-bound polynucleotide with a mixture of acetic anhydride and 1-methylimidazole. Following a capping step, the device is optionally washed.

[0185] In some instances, following addition of a nucleoside phosphoramidite, and optionally after capping and one or more wash steps, the device bound growing nucleic acid is oxidized. The oxidation step comprises the phosphite triester is oxidized into a tetracoordinated phosphate triester, a protected precursor of the naturally occurring phosphate diester internucleoside linkage. In some instances, oxidation of the growing polynucleotide is achieved by treatment with iodine and water, optionally in the presence of a weak base (e.g., pyridine, lutidine, collidine). Oxidation may be carried out under anhydrous conditions using, e.g. tert-Butyl hydroperoxide or (1S)-(+)-(10-camphorsulfonyl)-oxaziridine (CSO). In some methods, a capping step is performed following oxidation. A second capping step allows for device drying, as residual water from oxidation that may persist can inhibit subsequent coupling. Following oxidation, the device and growing polynucleotide is optionally washed. In some instances, the step of oxidation is substituted with a sulfurization step to obtain polynucleotide phosphorothioates, wherein any capping steps can be performed after the sulfurization. Many reagents are capable of the efficient sulfur transfer, including but not limited to 3-(Dimethylaminomethylidene)amino)-3H-1,2,4-dithiazole-3-thione, DDTT, 3H-1,2-benzodithiol-3-one 1,1-dioxide, also known as Beaucage reagent, and N,N,N'N'-Tetraethylthiuram disulfide (TETD).

[0186] In order for a subsequent cycle of nucleoside incorporation to occur through coupling, the protected 5' end of the device bound growing polynucleotide is removed so that the primary hydroxyl group is reactive with a next nucleoside phosphoramidite. In some instances, the protecting group is DMT and deblocking occurs with trichloroacetic acid in dichloromethane. Conducting detritylation for an extended time or with stronger than recommended solutions of acids may lead to increased depurination of solid support-bound polynucleotide and thus reduces the yield of the desired full-length product. Methods and compositions of the disclosure described herein provide for controlled deblocking conditions limiting undesired depurination reactions. In some instances, the device bound polynucleotide is washed after deblocking. In some instances, efficient washing after deblocking contributes to synthesized polynucleotides having a low error rate.

[0187] Methods for the synthesis of polynucleotides typically involve an iterating sequence of the following steps: application of a protected monomer to an actively functionalized surface (e.g., locus) to link with either the activated surface, a linker or with a previously deprotected monomer; deprotection of the applied monomer so that it is reactive with a subsequently applied protected monomer; and application of another protected monomer for linking. One or more intermediate steps include oxidation or sulfurization. In some instances, one or more wash steps precede or follow one or all of the steps.

[0188] Methods for phosphoramidite-based polynucleotide synthesis comprise a series of chemical steps. In some instances, one or more steps of a synthesis method involve reagent cycling, where one or more steps of the method comprise application to the device of a reagent useful for the step. For example, reagents are cycled by a series of liquid deposition and vacuum drying steps. For substrates comprising three-dimensional features such as wells, microwells, channels and the like, reagents are optionally passed through one or more regions of the device via the wells and/or channels.

[0189] Methods and systems described herein relate to polynucleotide synthesis devices for the synthesis of polynucleotides. The synthesis may be in parallel. For example, at least or about at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 1000, 10000, 50000, 75000, 100000 or more polynucleotides can be synthesized in parallel. The total number polynucleotides that may be synthesized in parallel may be from 2-100000, 3-50000, 4-10000, 5-1000, 6-900, 7-850, 8-800, 9-750, 10-700, 11-650, 12-600, 13-550, 14-500, 15-450, 16-400, 17-350, 18-300, 19-250, 20-200, 21-150, 22-100, 23-50, 24-45, 25-40, 30-35. Those of skill in the art appreciate that the total number of polynucleotides synthesized in parallel may fall within any range bound by any of these values, for example 25-100. The total number of polynucleotides synthesized in parallel may fall within any range defined by any of the values serving as endpoints of the range. Total molar mass of polynucleotides synthesized within the device or the molar mass of each of the polynucleotides may be at least or at least about 10, 20, 30, 40, 50, 100, 250, 500, 750, 1000, 2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000, 10000, 25000, 50000, 75000, 100000 picomoles, or more. The length of each of the polynucleotides or average length of the polynucleotides within the device may be at least or about at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 100, 150, 200, 300, 400, 500 nucleotides, or more. The length of each of the polynucleotides or average length of the polynucleotides within the device may be at most or about at most 500, 400, 300, 200, 150, 100, 50, 45, 35, 30, 25, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10 nucleotides, or less. The length of each of the polynucleotides or average length of the polynucleotides within the device may fall from 10-500, 9-400, 11-300, 12-200, 13-150, 14-100, 15-50, 16-45, 17-40, 18-35, 19-25. Those of skill in the art appreciate that the length of each of the polynucleotides or average length of the polynucleotides within the device may fall within any range bound by any of these values, for example 100-300. The length of each of the polynucleotides or average length of the polynucleotides within the device may fall within any range defined by any of the values serving as endpoints of the range.

[0190] Methods for polynucleotide synthesis on a surface provided herein allow for synthesis at a fast rate. As an example, at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 55, 60, 70, 80, 90, 100, 125, 150, 175, 200 nucleotides per hour, or more are synthesized. Nucleotides include adenine, guanine, thymine, cytosine, uridine building blocks, or analogs/modified versions thereof. In some instances, libraries of polynucleotides are synthesized in parallel on substrate. For example, a device comprising about or at least about 100; 1,000; 10,000; 30,000; 75,000; 100,000; 1,000,000; 2,000,000; 3,000,000; 4,000,000; or 5,000,000 resolved loci is able to support the synthesis of at least the same number of distinct polynucleotides, wherein polynucleotide encoding a distinct sequence is synthesized on a resolved locus. In some instances, a library of polynucleotides is synthesized on a device with low error rates described herein in less than about three months, two months, one month, three weeks, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 days, 24 hours or less. In some instances, larger nucleic acids assembled from a polynucleotide library synthesized with low error rate using the substrates and methods described herein are prepared in less than about three months, two months, one month, three weeks, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 days, 24 hours or less.

[0191] In some instances, methods described herein provide for generation of a library of nucleic acids comprising variant nucleic acids differing at a plurality of codon sites. In some instances, a nucleic acid may have 1 site, 2 sites, 3 sites, 4 sites, 5 sites, 6 sites, 7 sites, 8 sites, 9 sites, 10 sites, 11 sites, 12 sites, 13 sites, 14 sites, 15 sites, 16 sites, 17 sites 18 sites, 19 sites, 20 sites, 30 sites, 40 sites, 50 sites, or more of variant codon sites.

[0192] In some instances, the one or more sites of variant codon sites may be adjacent. In some instances, the one or more sites of variant codon sites may not be adjacent and separated by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more codons.

[0193] In some instances, a nucleic acid may comprise multiple sites of variant codon sites, wherein all the variant codon sites are adjacent to one another, forming a stretch of variant codon sites. In some instances, a nucleic acid may comprise multiple sites of variant codon sites, wherein none the variant codon sites are adjacent to one another. In some instances, a nucleic acid may comprise multiple sites of variant codon sites, wherein some the variant codon sites are adjacent to one another, forming a stretch of variant codon sites, and some of the variant codon sites are not adjacent to one another.

[0194] Referring to the Figures, FIG. 2 illustrates an exemplary process workflow for synthesis of nucleic acids (e.g., genes) from shorter nucleic acids. The workflow is divided generally into phases: (1) de novo synthesis of a single stranded nucleic acid library, (2) joining nucleic acids to form larger fragments, (3) error correction, (4) quality control, and (5) shipment. Prior to de novo synthesis, an intended nucleic acid sequence or group of nucleic acid sequences is preselected. For example, a group of genes is preselected for generation.

[0195] Once large nucleic acids for generation are selected, a predetermined library of nucleic acids is designed for de novo synthesis. Various suitable methods are known for generating high density polynucleotide arrays. In the workflow example, a device surface layer is provided. In the example, chemistry of the surface is altered in order to improve the polynucleotide synthesis process. Areas of low surface energy are generated to repel liquid while areas of high surface energy are generated to attract liquids. The surface itself may be in the form of a planar surface or contain variations in shape, such as protrusions or microwells which increase surface area. In the workflow example, high surface energy molecules selected serve a dual function of supporting DNA chemistry, as disclosed in International Patent Application Publication WO/2015/021080, which is herein incorporated by reference in its entirety.

[0196] In situ preparation of polynucleotide arrays is generated on a solid support and utilizes single nucleotide extension process to extend multiple oligomers in parallel. A deposition device, such as a material deposition device 201, is designed to release reagents in a step wise fashion such that multiple polynucleotides extend, in parallel, one residue at a time to generate oligomers with a predetermined nucleic acid sequence 202. In some instances, polynucleotides are cleaved from the surface at this stage. Cleavage includes gas cleavage, e.g., with ammonia or methylamine.

[0197] The generated polynucleotide libraries are placed in a reaction chamber. In this exemplary workflow, the reaction chamber (also referred to as "nanoreactor") is a silicon coated well, containing PCR reagents and lowered onto the polynucleotide library 203. Prior to or after the sealing 204 of the polynucleotides, a reagent is added to release the polynucleotides from the substrate. In the exemplary workflow, the polynucleotides are released subsequent to sealing of the nanoreactor 205. Once released, fragments of single stranded polynucleotides hybridize in order to span an entire long range sequence of DNA. Partial hybridization 205 is possible because each synthesized polynucleotide is designed to have a small portion overlapping with at least one other polynucleotide in the pool.

[0198] After hybridization, a PCA reaction is commenced. During the polymerase cycles, the polynucleotides anneal to complementary fragments and gaps are filled in by a polymerase. Each cycle increases the length of various fragments randomly depending on which polynucleotides find each other. Complementarity amongst the fragments allows for forming a complete large span of double stranded DNA 206.

[0199] After PCA is complete, the nanoreactor is separated from the device 207 and positioned for interaction with a device having primers for PCR 208. After sealing, the nanoreactor is subject to PCR 209 and the larger nucleic acids are amplified. After PCR 210, the nanochamber is opened 211, error correction reagents are added 212, the chamber is sealed 213 and an error correction reaction occurs to remove mismatched base pairs and/or strands with poor complementarity from the double stranded PCR amplification products 214. The nanoreactor is opened and separated 215. Error corrected product is next subject to additional processing steps, such as PCR and molecular bar coding, and then packaged 222 for shipment 223.

[0200] In some instances, quality control measures are taken. After error correction, quality control steps include for example interaction with a wafer having sequencing primers for amplification of the error corrected product 216, sealing the wafer to a chamber containing error corrected amplification product 217, and performing an additional round of amplification 218. The nanoreactor is opened 219 and the products are pooled 220 and sequenced 221. After an acceptable quality control determination is made, the packaged product 222 is approved for shipment 223.

[0201] In some instances, a nucleic acid generate by a workflow such as that in FIG. 2 is subject to mutagenesis using overlapping primers disclosed herein. In some instances, a library of primers are generated by in situ preparation on a solid support and utilize single nucleotide extension process to extend multiple oligomers in parallel. A deposition device, such as a material deposition device, is designed to release reagents in a step wise fashion such that multiple polynucleotides extend, in parallel, one residue at a time to generate oligomers with a predetermined nucleic acid sequence 202.

[0202] Computer Systems

[0203] Any of the systems described herein, may be operably linked to a computer and may be automated through a computer either locally or remotely. In various instances, the methods and systems of the disclosure may further comprise software programs on computer systems and use thereof. Accordingly, computerized control for the synchronization of the dispense/vacuum/refill functions such as orchestrating and synchronizing the material deposition device movement, dispense action and vacuum actuation are within the bounds of the disclosure. The computer systems may be programmed to interface between the user specified base sequence and the position of a material deposition device to deliver the correct reagents to specified regions of the substrate.

[0204] The computer system 300 illustrated in FIG. 3 may be understood as a logical apparatus that can read instructions from media 311 and/or a network port 305, which can optionally be connected to server 309 having fixed media 312. The system, such as shown in FIG. 3 can include a CPU 301, disk drives 303, optional input devices such as keyboard 315 and/or mouse 316 and optional monitor 307. Data communication can be achieved through the indicated communication medium to a server at a local or a remote location. The communication medium can include any means of transmitting and/or receiving data. For example, the communication medium can be a network connection, a wireless connection or an internet connection. Such a connection can provide for communication over the World Wide Web. It is envisioned that data relating to the present disclosure can be transmitted over such networks or connections for reception and/or review by a party 322 as illustrated in FIG. 3.

[0205] FIG. 4 is a block diagram illustrating a first example architecture of a computer system 400 that can be used in connection with example instances of the present disclosure. As depicted in FIG. 4, the example computer system can include a processor 402 for processing instructions. Non-limiting examples of processors include: Intel Xeon.TM. processor, AMD Opteron.TM. processor, Samsung 32-bit RISC ARM 1176JZ(F)-S v1.0.TM. processor, ARM Cortex-A8 Samsung S5PC100.TM. processor, ARM Cortex-A8 Apple A4.TM. processor, Marvell PXA 930.TM. processor, or a functionally-equivalent processor. Multiple threads of execution can be used for parallel processing. In some instances, multiple processors or processors with multiple cores can also be used, whether in a single computer system, in a cluster, or distributed across systems over a network comprising a plurality of computers, cell phones, and/or personal data assistant devices.

[0206] As illustrated in FIG. 4, a high speed cache 404 can be connected to, or incorporated in, the processor 402 to provide a high speed memory for instructions or data that have been recently, or are frequently, used by processor 402. The processor 402 is connected to a north bridge 406 by a processor bus 408. The north bridge 406 is connected to random access memory (RAM) 410 by a memory bus 412 and manages access to the RAM 410 by the processor 402. The north bridge 406 is also connected to a south bridge 414 by a chipset bus 416. The south bridge 414 is, in turn, connected to a peripheral bus 418. The peripheral bus can be, for example, PCI, PCI-X, PCI Express, or other peripheral bus. The north bridge and south bridge are often referred to as a processor chipset and manage data transfer between the processor, RAM, and peripheral components on the peripheral bus 418. In some alternative architectures, the functionality of the north bridge can be incorporated into the processor instead of using a separate north bridge chip. In some instances, system 400 can include an accelerator card 422 attached to the peripheral bus 418. The accelerator can include field programmable gate arrays (FPGAs) or other hardware for accelerating certain processing. For example, an accelerator can be used for adaptive data restructuring or to evaluate algebraic expressions used in extended set processing.

[0207] Software and data are stored in external storage 424 and can be loaded into RAM 410 and/or cache 404 for use by the processor. The system 400 includes an operating system for managing system resources; non-limiting examples of operating systems include: Linux, Windows.TM., MACOS.TM., BlackBerry OS.TM., iOS.TM., and other functionally-equivalent operating systems, as well as application software running on top of the operating system for managing data storage and optimization in accordance with example instances of the present disclosure. In this example, system 400 also includes network interface cards (NICs) 420 and 421 connected to the peripheral bus for providing network interfaces to external storage, such as Network Attached Storage (NAS) and other computer systems that can be used for distributed parallel processing.

[0208] FIG. 5 is a diagram showing a network 500 with a plurality of computer systems 502a, and 502b, a plurality of cell phones and personal data assistants 502c, and Network Attached Storage (NAS) 504a, and 504b. In example instances, systems 502a, 502b, and 502c can manage data storage and optimize data access for data stored in Network Attached Storage (NAS) 504a and 504b. A mathematical model can be used for the data and be evaluated using distributed parallel processing across computer systems 502a, and 502b, and cell phone and personal data assistant systems 502c. Computer systems 502a, and 502b, and cell phone and personal data assistant systems 502c can also provide parallel processing for adaptive data restructuring of the data stored in Network Attached Storage (NAS) 504a and 504b. FIG. 5 illustrates an example only, and a wide variety of other computer architectures and systems can be used in conjunction with the various instances of the present disclosure. For example, a blade server can be used to provide parallel processing. Processor blades can be connected through a back plane to provide parallel processing. Storage can also be connected to the back plane or as Network Attached Storage (NAS) through a separate network interface. In some example instances, processors can maintain separate memory spaces and transmit data through network interfaces, back plane or other connectors for parallel processing by other processors. In other instances, some or all of the processors can use a shared virtual address memory space.

[0209] FIG. 6 is a block diagram of a multiprocessor computer system using a shared virtual address memory space in accordance with an example instance. The system includes a plurality of processors 602a-f that can access a shared memory subsystem 604. The system incorporates a plurality of programmable hardware memory algorithm processors (MAPs) 606a-f in the memory subsystem 604. Each MAP 606a-f can comprise a memory 608a-f and one or more field programmable gate arrays (FPGAs) 610a-f. The MAP provides a configurable functional unit and particular algorithms or portions of algorithms can be provided to the FPGAs 610a-f for processing in close coordination with a respective processor. For example, the MAPs can be used to evaluate algebraic expressions regarding the data model and to perform adaptive data restructuring in example instances. In this example, each MAP is globally accessible by all of the processors for these purposes. In one configuration, each MAP can use Direct Memory Access (DMA) to access an associated memory 608a-f, allowing it to execute tasks independently of, and asynchronously from the respective microprocessor 602a-f. In this configuration, a MAP can feed results directly to another MAP for pipelining and parallel execution of algorithms.

[0210] The above computer architectures and systems are examples only, and a wide variety of other computer, cell phone, and personal data assistant architectures and systems can be used in connection with example instances, including systems using any combination of general processors, co-processors, FPGAs and other programmable logic devices, system on chips (SOCs), application specific integrated circuits (ASICs), and other processing and logic elements. In some instances, all or part of the computer system can be implemented in software or hardware. Any variety of data storage media can be used in connection with example instances, including random access memory, hard drives, flash memory, tape drives, disk arrays, Network Attached Storage (NAS) and other local or distributed data storage devices and systems.

[0211] In example instances, the computer system can be implemented using software modules executing on any of the above or other computer architectures and systems. In other instances, the functions of the system can be implemented partially or completely in firmware, programmable logic devices such as field programmable gate arrays (FPGAs) as referenced in FIG. 4, system on chips (SOCs), application specific integrated circuits (ASICs), or other processing and logic elements. For example, the Set Processor and Optimizer can be implemented with hardware acceleration through the use of a hardware accelerator card, such as accelerator card 422 illustrated in FIG. 4.

[0212] The following examples are set forth to illustrate more clearly the principle and practice of embodiments disclosed herein to those skilled in the art and are not to be construed as limiting the scope of any claimed embodiments. Unless otherwise stated, all parts and percentages are on a weight basis.

EXAMPLES

[0213] The following examples are given for the purpose of illustrating various embodiments of the disclosure and are not meant to limit the present disclosure in any fashion. The present examples, along with the methods described herein are presently representative of preferred embodiments, are exemplary, and are not intended as limitations on the scope of the disclosure. Changes therein and other uses which are encompassed within the spirit of the disclosure as defined by the scope of the claims will occur to those skilled in the art.

Example 1: Functionalization of a Device Surface

[0214] A device was functionalized to support the attachment and synthesis of a library of polynucleotides. The device surface was first wet cleaned using a piranha solution comprising 90% H.sub.2SO.sub.4 and 10% H.sub.2O.sub.2 for 20 minutes. The device was rinsed in several beakers with DI water, held under a DI water gooseneck faucet for 5 min, and dried with N2. The device was subsequently soaked in NH.sub.4OH (1:100; 3 mL:300 mL) for 5 min, rinsed with DI water using a handgun, soaked in three successive beakers with DI water for 1 min each, and then rinsed again with DI water using the handgun. The device was then plasma cleaned by exposing the device surface to O.sub.2. A SAMCO PC-300 instrument was used to plasma etch O.sub.2 at 250 watts for 1 min in downstream mode.

[0215] The cleaned device surface was actively functionalized with a solution comprising N-(3-triethoxysilylpropyl)-4-hydroxybutyramide using a YES-1224P vapor deposition oven system with the following parameters: 0.5 to 1 torr, 60 min, 70.degree. C., 135.degree. C. vaporizer. The device surface was resist coated using a Brewer Science 200.times. spin coater. SPR.TM. 3612 photoresist was spin coated on the device at 2500 rpm for 40 sec. The device was pre-baked for 30 min at 90.degree. C. on a Brewer hot plate. The device was subjected to photolithography using a Karl Suss MA6 mask aligner instrument. The device was exposed for 2.2 sec and developed for 1 min in MSF 26A. Remaining developer was rinsed with the handgun and the device soaked in water for 5 min. The device was baked for 30 min at 100.degree. C. in the oven, followed by visual inspection for lithography defects using a Nikon L200. A descum process was used to remove residual resist using the SAMCO PC-300 instrument to O2 plasma etch at 250 watts for 1 min.

[0216] The device surface was passively functionalized with a 100 .mu.L solution of perfluorooctyltrichlorosilane mixed with 10 .mu.L light mineral oil. The device was placed in a chamber, pumped for 10 min, and then the valve was closed to the pump and left to stand for 10 min. The chamber was vented to air. The device was resist stripped by performing two soaks for 5 min in 500 mL NMP at 70.degree. C. with ultrasonication at maximum power (9 on Crest system). The device was then soaked for 5 min in 500 mL isopropanol at room temperature with ultrasonication at maximum power. The device was dipped in 300 mL of 200 proof ethanol and blown dry with N.sub.2. The functionalized surface was activated to serve as a support for polynucleotide synthesis.

Example 2: Synthesis of a 50-Mer Sequence on an Oligonucleotide Synthesis Device

[0217] A two dimensional oligonucleotide synthesis device was assembled into a flowcell, which was connected to a flowcell (Applied Biosystems (ABI394 DNA Synthesizer"). The two-dimensional oligonucleotide synthesis device was uniformly functionalized with N-(3-TRIETHOXYSILYLPROPYL)-4-HYDROXYBUTYRAMIDE (Gelest) was used to synthesize an exemplary polynucleotide of 50 bp ("50-mer polynucleotide") using polynucleotide synthesis methods described herein.

[0218] The sequence of the 50-mer was as described.

TABLE-US-00002 5'AGACAATCAACCATTTGGGGTGGACAGCCTTGAC CTCTAGACTTCGGCAT##TTTTTTTTTT3',

where # denotes Thymidine-succinyl hexamide CED phosphoramidite (CLP-2244 from ChemGenes), which is a cleavable linker enabling the release of oligos from the surface during deprotection.

[0219] The synthesis was done using standard DNA synthesis chemistry (coupling, capping, oxidation, and deblocking) according to the protocol in Table 2 and an ABI synthesizer.

TABLE-US-00003 TABLE 2 Synthesis protocols General DNA Synthesis Table 2 Process Name Process Step Time (sec) WASH (Acetonitrile Wash Acetonitrile System Flush 4 Flow) Acetonitrile to Flowcell 23 N2 System Flush 4 Acetonitrile System Flush 4 DNA BASE ADDITION Activator Manifold Flush 2 (Phosphoramidite + Activator Activator to Flowcell 6 Flow) Activator + Phosphoramidite 6 to Flowcell Activator to Flowcell 0.5 Activator + Phosphoramidite 5 to Flowcell Activator to Flowcell 0.5 Activator + Phosphoramidite 5 to Flowcell Activator to Flowcell 0.5 Activator + Phosphoramidite 5 to Flowcell Incubate for 25 sec 25 WASH (Acetonitrile Wash Acetonitrile System Flush 4 Flow) Acetonitrile to Flowcell 15 N2 System Flush 4 Acetonitrile System Flush 4 DNA BASE ADDITION Activator Manifold Flush 2 (Phosphoramidite + Activator Activator to Flowcell 5 Flow) Activator + Phosphoramidite 18 to Flowcell Incubate for 25 sec 25 WASH (Acetonitrile Wash Acetonitrile System Flush 4 Flow) Acetonitrile to Flowcell 15 N2 System Flush 4 Acetonitrile System Flush 4 CAPPING (CapA + B, 1:1, CapA + B to Flowcell 15 Flow) WASH (Acetonitrile Wash Acetonitrile System Flush 4 Flow) Acetonitrile to Flowcell 15 Acetonitrile System Flush 4 OXIDATION (Oxidizer Oxidizer to Flowcell 18 Flow) WASH (Acetonitrile Wash Acetonitrile System Flush 4 Flow) N2 System Flush 4 Acetonitrile System Flush 4 Acetonitrile to Flowcell 15 Acetonitrile System Flush 4 Acetonitrile to Flowcell 15 N2 System Flush 4 Acetonitrile System Flush 4 Acetonitrile to Flowcell 23 N2 System Flush 4 Acetonitrile System Flush 4 DEBLOCKING (Deblock Deblock to Flowcell 36 Flow) WASH (Acetonitrile Wash Acetonitrile System Flush 4 Flow) N2 System Flush 4 Acetonitrile System Flush 4 Acetonitrile to Flowcell 18 N2 System Flush 4.13 Acetonitrile System Flush 4.13 Acetonitrile to Flowcell 15

[0220] The phosphoramidite/activator combination was delivered similar to the delivery of bulk reagents through the flowcell. No drying steps were performed as the environment stays "wet" with reagent the entire time.

[0221] The flow restrictor was removed from the ABI 394 synthesizer to enable faster flow. Without flow restrictor, flow rates for amidites (0.1M in ACN), Activator, (0.25M Benzoylthiotetrazole ("BTT"; 30-3070-xx from GlenResearch) in ACN), and Ox (0.02M I2 in 20% pyridine, 10% water, and 70% THF) were roughly .about.100 uL/sec, for acetonitrile ("ACN") and capping reagents (1:1 mix of CapA and CapB, wherein CapA is acetic anhydride in THF/Pyridine and CapB is 16% 1-methylimidizole in THF), roughly .about.200 uL/sec, and for Deblock (3% dichloroacetic acid in toluene), roughly .about.300 uL/sec (compared to .about.50 uL/sec for all reagents with flow restrictor). The time to completely push out Oxidizer was observed, the timing for chemical flow times was adjusted accordingly and an extra ACN wash was introduced between different chemicals. After polynucleotide synthesis, the chip was deprotected in gaseous ammonia overnight at 75 psi. Five drops of water were applied to the surface to recover polynucleotides. The recovered polynucleotides were then analyzed on a BioAnalyzer small RNA chip.

Example 3: Synthesis of a 100-Mer Sequence on an Oligonucleotide Synthesis Device

[0222] The same process as described in Example 2 for the synthesis of the 50-mer sequence was used for the synthesis of a 100-mer polynucleotide ("100-mer polynucleotide"; 5' CGGGATCCTTATCGTCATCGTCGTACAGATCCCGACCCATTTGCTGTCCACCAGTCATGCTAGC CATACCATGATGATGATGATGATGAGAACCCCGCAT##TTTTTTTTTT3', where # denotes Thymidine-succinyl hexamide CED phosphoramidite (CLP-2244 from ChemGenes) on two different silicon chips, the first one uniformly functionalized with N-(3-TRIETHOXYSILYLPROPYL)-4-HYDROXYBUTYRAMIDE and the second one functionalized with 5/95 mix of 11-acetoxyundecyltriethoxysilane and n-decyltriethoxysilane, and the polynucleotides extracted from the surface were analyzed on a BioAnalyzer instrument.

[0223] All ten samples from the two chips were further PCR amplified using a forward (5'ATGCGGGGTTCTCATCATC3') and a reverse (5'CGGGATCCTTATCGTCATCG3') primer in a 50 uL PCR mix (25 uL NEB Q5 mastermix, 2.5 uL 10 uM Forward primer, 2.5 uL 10 uM Reverse primer, 1uL polynucleotide extracted from the surface, and water up to 50 uL) using the following thermalcycling program:

[0224] 98.degree. C., 30 sec

[0225] 98.degree. C., 10 sec; 63.degree. C., 10 sec; 72.degree. C., 10 sec; repeat 12 cycles

[0226] 72.degree. C., 2 min

[0227] The PCR products were also run on a BioAnalyzer, demonstrating sharp peaks at the 100-mer position. Next, the PCR amplified samples were cloned, and Sanger sequenced. Table 3 summarizes the results from the Sanger sequencing for samples taken from spots 1-5 from chip 1 and for samples taken from spots 6-10 from chip 2.

TABLE-US-00004 TABLE 3 Sequencing results Spot Error rate Cycle efficiency 1 1/763 bp 99.87% 2 1/824 bp 99.88% 3 1/780 bp 99.87% 4 1/429 bp 99.77% 5 1/1525 bp 99.93% 6 1/1615 bp 99.94% 7 1/531 bp 99.81% 8 1/1769 bp 99.94% 9 1/854 bp 99.88% 10 1/1451 bp 99.93%

[0228] Thus, the high quality and uniformity of the synthesized polynucleotides were repeated on two chips with different surface chemistries. Overall, 89% of the 100-mers that were sequenced were perfect sequences with no errors, corresponding to 233 out of 262.

[0229] Table 4 summarizes error characteristics for the sequences obtained from the polynucleotides samples from spots 1-10.

TABLE-US-00005 TABLE 4 Error characteristics Spot no. Sample ID OSA_0046/1 OSA_0047/2 OSA_0048/3 OSA_0049/4 OSA_0050/5 Total Sequences 32 32 32 32 32 Sequencing Quality 25 of 28 27 of 27 26 of 30 21 of 23 25 of 26 Oligo Quality 23 of 25 25 of 27 22 of 26 18 of 21 24 of 25 ROI Match Count 2500 2698 2561 2122 2499 ROI Mutation 2 2 1 3 1 ROI Multi Base 0 0 0 0 0 Deletion ROI Small Insertion 1 0 0 0 0 ROI Single Base 0 0 0 0 0 Deletion Large Deletion 0 0 1 0 0 Count Mutation: G > A 2 2 1 2 1 Mutation: T > C 0 0 0 1 0 ROI Error Count 3 2 2 3 1 ROI Error Rate Err: ~1 Err: ~1 Err: ~1 Err: ~1 Err: ~1 in 834 in 1350 in 1282 in 708 in 2500 ROI Minus Primer MP Err: ~1 MP Err: ~1 MP Err: ~1 MP Err: ~1 MP Err: ~1 Error Rate in 763 in 824 in 780 in 429 in 1525 Spot no. Sample ID OSA_0051/6 OSA_0052/7 OSA_0053/8 OSA_0054/9 OSA_0055/10 Total Sequences 32 32 32 32 32 Sequencing Quality 29 of 30 27 of 31 29 of 31 28 of 29 25 of 28 Oligo Quality 25 of 29 22 of 27 28 of 29 26 of 28 20 of 25 ROI Match Count 2666 2625 2899 2798 2348 ROI Mutation 0 2 1 2 1 ROI Multi Base 0 0 0 0 0 Deletion ROI Small Insertion 0 0 0 0 0 ROI Single Base 0 0 0 0 0 Deletion Large Deletion 1 1 0 0 0 Count Mutation: G > A 0 2 1 2 1 Mutation: T > C 0 0 0 0 0 ROI Error Count 1 3 1 2 1 ROI Error Rate Err: ~1 Err: ~1 Err: ~1 Err: ~1 Err: ~1 in 2667 in 876 in 2900 in 1400 in 2349 ROI Minus Primer MP Err: ~1 MP Err: ~1 MP Err: ~1 MP Err: ~1 MP Err: ~1 Error Rate in 1615 in 531 in 1769 in 854 in 1451

Example 4: Panning and Screening for Identification of Antibodies for SARS-CoV-2 and ACE2

[0230] This example describes identification of antibodies for SARS-CoV-2 and ACE2.

[0231] Phage displayed scFv, VHH, and Fab libraries were panned for binding to biotinylated SARS-CoV-2 S1 and human ACE2. FIG. 7 shows a schema of the panning strategy. Biotinylated antigen was bound to streptavidin coated magnetic beads at a density of 100 pmol antigen per mg of beads (Thermo Fisher #11206D). Phage libraries were blocked with 5% BSA in PBS. Following magnetic bead depletion for 1 hour at room temperature (RT), the beads were removed, and phage supernatant was transferred to 1 mg of antigen-bound beads in 1 ml PBS and incubated at RT with rotation for 1 hour. Non-binding clones were washed away by addition of 1 ml PBST, increasing the number of washes with each panning round. Trypsin was used to elute the phage bound to the antigen-bead complex. Phage were amplified in TG1 E. coli for the next round of selection. This selection strategy was repeated for four rounds, with successively lower amounts of antigen per round. Following all four selection rounds, 400 clones from each of round 2, 3, and 4 were selected for phage expression and phage ELISA screening. Data from the panning is seen in Table 5.

TABLE-US-00006 TABLE 5 Panning Data Antibody Titer Round 1 Round 2 Round 3 Round 4 Round 5 1 Input titer 1.5 .times. 10.sup.12 1.2 .times. 10.sup.13 4.4 .times. 10.sup.13 1.8 .times. 10.sup.13 -- Output titer 1.2 .times. 10.sup.6 1.5 .times. 10.sup.6 2.0 .times. 10.sup.6 1.4 .times. 10.sup.8 -- 2 Input titer 1.4 .times. 10.sup.12 2.6 .times. 10.sup.13 3.0 .times. 10.sup.13 1.0 .times. 10.sup.13 -- Output titer 9.5 .times. 10.sup.5 1.2 .times. 10.sup.6 2.2 .times. 10.sup.6 1.2 .times. 10.sup.8 -- 3 Input titer 1.7 .times. 10.sup.12 2.0 .times. 10.sup.13 2.8 .times. 10.sup.13 3.2 .times. 10.sup.13 -- Output titer 1.5 .times. 10.sup.5 1.7 .times. 10.sup.6 1.5 .times. 10.sup.6 1.1 .times. 10.sup.8 -- 4 Input titer 1.2 .times. 10.sup.12 1.6 .times. 10.sup.13 3.6 .times. 10.sup.13 1.5 .times. 10.sup.13 -- Output titer 1.3 .times. 10.sup.5 2.2 .times. 10.sup.7 2.6 .times. 10.sup.7 2.5 .times. 10.sup.8 --

[0232] To test for binding to SARS-CoV-2 S1 and ACE2, phage were expressed from each picked colony by KO7 superinfection in 384 well microtiter plates. Phage containing supernatant was blocked by 1:1 addition of 4% non-fat milk (NFM). Assay plates were prepared by passive immobilization of 0.4 .mu.g antigen in 384-well Maxisorp plates (Thermo Fisher #464718) and then blocked with 4% NFM. Following 3.times. wash in PBST, blocked phage supernatant was incubated for 1 hour at RT. After 3.times. wash in PBST, 0.3 .mu.g/ml anti-M13-HRP (Sino Biological #11973-MM05T-H) was aliquoted for 1 hour incubation at room temperature. Binding of phage-displayed antibody was determined by absorbance at 450 nm with 3,3',5,5'-tetramethylbenzidine (Thermo Fisher #34029). Phage that bound to antigen with 3.times. over background of human Fc protein were identified as potential binders for sequencing analysis. DNA was amplified by rolling circle amplification from glycerol stocks of each clone and submitted for Sanger sequencing (Genewiz) to capture the VH and VL domains. FIGS. 8A-8D shows phage ELISA data from round 4 of SARS-CoV-2 S1 (subunit 1) protein panning for antibody 1 (FIGS. 8A-8B) and antibody 2 (FIGS. 8C-8D). FIGS. 9A-9D shows phage ELISA data from round 4 of ACE2 protein panning for antibody 3 (FIGS. 9A-9B) and antibody 4 (FIGS. 9C-9D).

[0233] SARS-CoV-2 variants were tested for specificity using a phage ELISA as described above. The antigens used included Acro COVID S1 (S1N-C82E8), COVID S1 RBD Fc fusion (Antigen 1), and COVID S1 RBM Fc fusion (Antigen 2). Data from the phage ELISA is seen in Table 6A. Table 6A shows screening ELISA mean, fold over background (column A), specificity ELISA, fold over background (column B), and specificity ELISA, percent binding relative to binding to Acro S1 (column C). As seen in Table 6A, nearly all receptor binding domain (RBD) specific clones show good binding to full length subunit 1 (S1) and produced S1 RBD Fc. None of the S1 RBD variants were found to bind to S1 RBM Fc.

TABLE-US-00007 TABLE 6A SARS-CoV-2 Phage ELISA Column A Column B Column C ELISA S1- S1- S1- S1- Variant (Avg) Acro S1 RBD-Fc S1-Fc RBM-Fc RBD-Fc S1-Fc RBM-Fc 1-21 47.6 19.5 14.8 1.4 1.4 75.7% 7.2% 7.0% 1-22 40.6 32.7 26.5 2.5 1.5 81.2% 7.6% 4.7% 1-30 29.5 16.8 1.7 5.6 1.4 9.8% 33.3% 8.5% 1-35 28.6 21.6 1.8 1.4 1.6 8.2% 6.5% 7.3% 1-17 27.4 25.1 20.1 1.6 1.3 79.8% 6.2% 5.2% 1-27 27.2 1.5 1.9 1.3 1.6 124.5% 84.8% 108.8% 1-37 27.0 11.6 2.0 5.4 1.4 17.7% 46.7% 12.3% 1-12 25.7 1.7 1.7 1.3 1.7 104.0% 79.6% 102.5% 1-2 24.2 1.8 1.9 1.7 1.7 103.3% 95.4% 93.5% 1-3 23.9 1.6 1.8 1.5 1.5 109.3% 91.2% 91.9% 1-23 23.1 5.1 3.6 1.6 1.6 70.9% 31.1% 32.0% 1-7 22.5 6.8 3.3 1.7 1.6 48.7% 24.8% 23.0% 1-31 20.7 30.4 1.3 15.7 1.2 4.3% 51.6% 3.8% 1-4 20.6 1.0 1.4 0.9 1.1 137.5% 90.8% 105.3% 1-38 20.2 1.1 1.5 0.9 1.2 127.9% 82.8% 100.9% 1-8 19.3 12.0 11.2 1.1 1.2 92.9% 8.8% 10.3% 1-9 18.5 10.7 9.8 0.9 1.0 91.1% 8.7% 9.3% 1-32 17.9 11.5 1.5 4.0 1.1 13.1% 35.3% 9.5% 1-33 17.6 7.1 1.5 3.0 1.0 21.1% 42.1% 14.6% 1-24 32.9 12.9 11.0 1.1 1.3 85.4% 8.9% 10.3% 1-39 24.4 18.6 11.6 2.5 1.3 62.5% 13.2% 6.7% 1-40 22.9 18.7 14.3 1.3 1.1 76.7% 7.1% 6.0% 1-5 20.6 1.5 1.6 1.2 1.4 107.8% 82.9% 92.0% 1-41 18.1 4.5 2.7 1.3 1.2 58.8% 28.9% 26.3% 1-28 17.7 1.0 1.1 1.1 1.2 112.9% 109.7% 124.1% 1-10 16.9 17.4 17.4 1.3 1.1 100.5% 7.3% 6.2% 2-1 45.3 39.3 36.8 20.2 1.5 93.7% 51.3% 3.9% 2-10 43.8 38.9 39.9 9.4 1.2 102.7% 24.1% 3.1% 2-5 30.8 38.3 35.9 24.3 1.1 93.7% 63.3% 3.0% 2-2 23.4 39.4 39.6 4.7 1.1 100.4% 12.0% 2.8% 3-10 17.4 1.2 1.2 1.2 1.1 97.2% 99.6% 93.3% 1-26 19.5 1.4 1.1 1.3 1.0 76.8% 98.0% 74.7% 1-42 34.5 22.7 20.8 1.4 1.0 91.4% 6.4% 4.2% 1-13 28.2 4.8 4.3 0.9 1.2 89.3% 18.4% 24.2% 1-43 21.9 6.7 5.8 3.9 1.0 87.3% 58.3% 14.5% 1-44 24.6 10.4 8.2 1.0 0.8 78.6% 9.6% 7.6% 1-14 21.7 16.8 13.5 1.1 0.9 80.6% 6.7% 5.4% 1-6 20.8 1.8 1.3 1.1 0.8 69.6% 60.5% 45.4% 1-45 24.0 12.1 10.3 1.2 1.0 85.3% 9.6% 8.3% 1-46 21.7 4.6 3.1 1.1 0.9 66.6% 24.5% 19.8% 1-20 26.0 5.7 3.9 1.0 0.8 67.3% 17.0% 14.5% 1-47 22.6 8.1 5.5 1.2 0.9 68.9% 14.6% 11.1% 1-29 23.8 1.1 0.9 1.0 0.9 81.4% 94.0% 78.3% 1-1 32.5 4.5 4.0 1.6 1.1 90.7% 35.3% 24.5% 1-19 22.3 24.2 23.9 1.5 1.2 98.7% 6.4% 4.9% 1-16 22.1 3.4 3.1 1.0 0.9 89.7% 29.5% 27.3% 1-34 28.7 7.5 3.1 1.8 1.0 41.3% 24.5% 13.3% 1-48 22.6 2.5 2.1 0.8 0.8 84.7% 31.5% 30.3% 1-49 27.6 1.0 1.0 0.8 0.8 99.3% 85.6% 78.8% 1-18 22.7 9.8 7.0 1.1 0.8 71.0% 11.0% 8.0% 1-11 33.2 4.8 4.8 0.9 1.0 99.5% 18.7% 20.6% 1-50 21.1 13.9 12.4 1.2 0.8 88.9% 8.8% 5.9% 1-25 27.9 3.6 2.7 1.0 0.8 75.4% 28.1% 22.3% 1-36 23.6 10.1 1.2 1.1 0.8 11.5% 10.6% 8.4% 1-15 24.8 2.5 1.4 1.0 0.8 55.4% 41.5% 32.1% 2-4 15.5 37.7 38.8 7.2 1.2 102.7% 19.0% 3.1% 2-6 22.1 11.1 12.8 1.8 1.1 115.8% 16.4% 9.5% 2-11 28.1 1.1 1.0 1.2 0.9 86.3% 103.4% 76.1% 2-12 18.2 39.8 40.3 14.7 1.1 101.3% 37.0% 2.9% 2-13 19.1 27.3 32.1 3.7 0.9 117.5% 13.4% 3.1% 2-14 17.2 31.7 32.9 4.2 0.9 103.9% 13.3% 2.8% 2-7 25.3 37.2 37.3 7.7 0.9 100.3% 20.6% 2.4% 2-8 32.4 35.9 36.5 5.4 1.1 101.8% 15.0% 3.1% 2-15 13.7 31.0 28.1 3.8 0.9 90.6% 12.4% 3.0% 2-9 14.1 24.1 24.3 3.0 0.8 100.7% 12.2% 3.5%

[0234] Tables 6B-6C show Carterra SPR kinetics for SARS-CoV-2 variant antibodies ranked by off-rate (Table 6B) and by K.sub.D (Table 6C). FIG. 10 shows that ACE2 binds to S1-RBD-Fc and S1-Fc variants.

TABLE-US-00008 TABLE 6B SARS-CoV-2 Carterra SPR Kinetics Ranked by Off-Rate S1- S1- ka K.sub.D IgG Acro S1 RBD-Fc S1-Fc RBM-Fc (M-1 s-1) (s-1) 2-10 38.9 39.9 9.4 1.2 2.08E+05 1.15E-04 2-5 38.3 35.9 24.3 1.1 9.39E+04 2.59E-04 1-31 30.4 1.3 15.7 1.2 2.05E+04 7.62E-04 2-2 39.4 39.6 4.7 1.1 7.74E+04 9.06E-04 1-13 4.8 4.3 0.9 1.2 2.17E+05 1.38E-03 1-30 16.8 1.7 5.6 1.4 4.39E+04 1.64E-03 1-29 1.1 0.9 1.0 0.9 5.35E+02 1.97E-03 1-27 1.5 1.9 1.3 1.6 2.27E+05 2.85E-03 1-35 21.6 1.8 1.4 1.6 5.90E+04 5.43E-03 1-36 10.1 1.2 1.1 0.8 1.14E+05 7.85E-03 1-67 18.6 11.6 2.5 1.3 7.36E+04 8.86E-03 1-2 1.8 1.9 1.7 1.7 1.58E+03 2.72E-02 1-5 1.5 1.6 1.2 1.4 2.15E+03 5.40E-02 1-68 6.7 5.8 3.9 1.0 2.46E+06 8.75E-02 1-69 1.1 1.5 0.9 1.2 3.08E+05 1.23E-01 1-4 1.0 1.4 0.9 1.1 4.20E+04 1.24E-01 1-12 1.7 1.7 1.3 1.7 3.59E+05 1.34E-01 1-11 4.8 4.8 0.9 1.0 5.92E+05 1.43E-01 1-10 17.4 17.4 1.3 1.1 1.04E+06 1.47E-01 1-7 4.5 2.7 1.3 1.2 2.09E+05 1.55E-01 1-15 2.5 1.4 1.0 0.8 4.49E+05 1.56E-01 1-25 3.6 2.7 1.0 0.8 1.98E+06 1.56E-01 1-23 5.1 3.6 1.6 1.6 5.06E+05 1.59E-01 1-7 6.8 3.3 1.7 1.6 1.34E+06 1.70E-01 1-47 8.1 5.5 1.2 0.9 6.32E+03 2.40E-01 1-3 1.6 1.8 1.5 1.5 1.42E+06 3.04E-01 1-32 11.5 1.5 4.0 1.1 5.49E+06 3.17E-01 1-20 5.7 3.9 1.0 0.8 5.17E+02 6.95E-01 1-28 1.0 1.1 1.1 1.2 1.23E+08 9.05E+00 1-48 2.5 2.1 0.8 0.8 5.56E+07 9.11E+00 1-24 12.9 11.0 1.1 1.3 1.94E+08 1.46E+01 1-6 1.8 1.3 1.1 0.8 4.49E+08 2.08E+01 1-17 25.1 20.1 1.6 1.3 3.92E+08 2.63E+01 1-49 1.0 1.0 0.8 0.8 6.00E+08 3.22E+01 1-71 11.6 2.0 5.4 1.4 3.69E+08 4.03E+01 1-42 22.7 20.8 1.4 1.0 9.10E+08 1.03E+02

TABLE-US-00009 TABLE 6C SARS-CoV-2 Carterra SPR Kinetics Ranked by K.sub.D S1- S1- ka kd K.sub.D Rmax IgG Acro S1 RBD-Fc S1-Fc RBM-Fc (M-1 s-1) (s-1) (nM) (RU) 2-10 38.9 39.9 9.4 1.2 2.08E+05 1.15E-04 0.6 20 2-5 38.3 35.9 24.3 1.1 9.39E+04 2.59E-04 2.8 39 1-13 4.8 4.3 0.9 1.2 2.17E+05 1.38E-03 6.4 23 2-2 39.4 39.6 4.7 1.1 7.74E+04 9.06E-04 11.7 131 1-27 1.5 1.9 1.3 1.6 2.27E+05 2.85E-03 12.5 39 1-68 6.7 5.8 3.9 1.0 2.46E+06 8.75E-02 35.6 73 1-30 16.8 1.7 5.6 1.4 4.39E+04 1.64E-03 37.2 98 1-31 30.4 1.3 15.7 1.2 2.05E+04 7.62E-04 37.2 256 1-6 1.8 1.3 1.1 0.8 4.49E+08 2.08E+01 46.3 87 1-49 1.0 1.0 0.8 0.8 6.00E+08 3.22E+01 53.6 72 1-32 11.5 1.5 4.0 1.1 5.49E+06 3.17E-01 57.8 112 1-17 25.1 20.1 1.6 1.3 3.92E+08 2.63E+01 67.1 46 1-36 10.1 1.2 1.1 0.8 1.14E+05 7.85E-03 68.9 150 1-28 1.0 1.1 1.1 1.2 1.23E+08 9.05E+00 73.5 58 1-24 12.9 11.0 1.1 1.3 1.94E+08 1.46E+01 75.5 48 1-25 3.6 2.7 1.0 0.8 1.98E+06 1.56E-01 78.9 46 1-35 21.6 1.8 1.4 1.6 5.90E+04 5.43E-03 91.9 341 1-71 11.6 2.0 5.4 1.4 3.69E+08 4.03E+01 109.3 113 1-42 22.7 20.8 1.4 1.0 9.10E+08 1.03E+02 113.4 68 1-67 18.6 11.6 2.5 1.3 7.36E+04 8.86E-03 120.4 22 1-7 6.8 3.3 1.7 1.6 1.34E+06 1.70E-01 127.1 31 1-10 17.4 17.4 1.3 1.1 1.04E+06 1.47E-01 141.7 27 1-48 2.5 2.1 0.8 0.8 5.56E+07 9.11E+00 163.8 64 1-3 1.6 1.8 1.5 1.5 1.42E+06 3.04E-01 214.6 87 1-11 4.8 4.8 0.9 1.0 5.92E+05 1.43E-01 240.9 53 1-23 5.1 3.6 1.6 1.6 5.06E+05 1.59E-01 314.6 128 1-15 2.5 1.4 1.0 0.8 4.49E+05 1.56E-01 346.9 79 1-12 1.7 1.7 1.3 1.7 3.59E+05 1.34E-01 372.5 112 1-69 1.1 1.5 0.9 1.2 3.08E+05 1.23E-01 398.4 66 1-7 4.5 2.7 1.3 1.2 2.09E+05 1.55E-01 742.5 160 1-4 1.0 1.4 0.9 1.1 4.20E+04 1.24E-01 2946.4 385 1-29 1.1 0.9 1.0 0.9 5.35E+02 1.97E-03 3684.3 1206 1-2 1.8 1.9 1.7 1.7 1.58E+03 2.72E-02 17228.5 1652 1-5 1.5 1.6 1.2 1.4 2.15E+03 5.40E-02 25170.1 4457 1-47 8.1 5.5 1.2 0.9 6.32E+03 2.40E-01 37971.0 5497 1-20 5.7 3.9 1.0 0.8 5.17E+02 6.95E-01 1344113.2 64406

Example 5. SARS-CoV-2 and ACE Variants

[0235] SARS-CoV-2 and ACE variant antibodies were tested for specificity and affinity.

[0236] Recombinant S1 Protein (Acros Biosystems Cat. No. S1N-S52H5) was passively immobilized on a 384 well ELISA plate and blocked with BSA. The S1 Panel antibodies were diluted from 50 nM to 0.0076 nM and incubated with the blocked plate. Antibody binding was detected using Goat-anti-Human-HRP secondary and developed with HRP substrate (list here). The absorbance signal was plotted as % of maximal binding and fitted to determine the EC50 of each antibody using GraphPad Prism.

[0237] Exemplary data for affinity of SARS-CoV-2 variant 2-6 is seen in FIGS. 11A-11B. The binding of SARS-CoV-2 panel of antibodies was measured as seen in FIG. 12 and Tables 7A-7F below.

TABLE-US-00010 TABLE 7A SARS-CoV-2 Variants EC50 Antibody EC50 (nM) 1-31 0.03139 2-6 0.03364 ACRO 0.04831 1-34 0.06522 2-2 0.07992 1-27 0.09283 2-8 0.1029 1-22 0.1248 1-32 0.1406 1-16 0.1435 1-12 0.1585 2-5 0.1615 CR3022 0.1657 1-53 0.1691 1-30 0.2084 1-28 0.2224 1-71 0.2673 1-20 0.3236 1-4 0.4216 1-35 0.4922 1-47 0.5893 1-5 0.774 2-4 0.8792 1-3 0.9724 1-21 1.003 2-19 1.257 1-51 1.465 1-19 1.706 1-42 1.742 2-2 1.789 2-1 1.894 1-33 3.006 2-13 5.139 2-11 6.921 2-15 8.509 2-7 10.09 1-26 11.93 1-24 12.86 1-49 13.04 1-10 18.31 1-1 21.87 1-8 25.09 1-7 26.94 1-72 29.13 1-17 33.17 1-36 34.86 1-73 43.58 2-10 46.43 1-9 46.88 2-17 51.86 1-52 57.88 2-18 74.71 1-29 83.41 2-12 95.94 1-25 107 2-9 118.3 1-23 123.9 1-48 296 2-14 854.7

TABLE-US-00011 TABLE 7B SARS-CoV-2 Variants Frequency and ELISA Data IgG Freq. ELISA (Avg) 1-21 1 47.6 1-22 3 40.6 1-30 1 29.5 1-35 3 28.6 1-17 79 27.4 1-27 1 27.2 1-12 2 25.7 1-2 14 24.2 1-3 2 23.9 1-23 1 23.1 1-7 4 22.5 1-31 1 20.7 1-4 1 20.6 1-8 2 19.3 1-9 2 18.5 1-32 1 17.9 1-33 1 17.6 1-24 1 32.9 1-5 1 20.6 1-28 2 17.7 1-10 1 16.9 1-26 1 19.5 1-13 1 28.2 1-14 1 21.7 1-6 1 20.8 1-20 3 26.0 1-29 1 23.8 1-1 1 32.5 1-19 1 22.3 1-16 1 22.1 1-34 1 28.7 1-18 1 22.7 1-11 1 33.2 1-25 1 27.9 1-36 1 23.6 1-15 1 24.8 1-51 1 7.1 1-52 1 3.5 1-53 1 21.7

TABLE-US-00012 TABLE 7C SARS-CoV-2 S1 Variants DB/S1 DB/S-T DC/S1 DC/S-T Inhibitor Fc/S1 Fc/S-T ELISA K.sub.D K.sub.D K.sub.D K.sub.D IC50 K.sub.D K.sub.D IgG Freq (Avg) (nM) (nM) (nM) (nM) (nM) (nM) (nM)f 1-21 1 47.6 6.7 1-22 3 40.6 73.2 1-30 1 29.5 37.2 4.7 475861.6 25.3 1-35 3 28.6 91.9 569.8 47.5 16.7 209.2 139.4 0.5 1-17 79 27.4 67.1 6649.2 10.0 1-27 1 27.2 12.5 5519.6 9.6 9.6 1-12 2 25.7 372.5 10.6 33.0 6.1 14.0 1-2 14 24.2 17228.5 304.3 1-3 2 23.9 214.6 423.0 252.8 5306.9 15.7 10.0 1-23 1 23.1 314.6 1-7 4 22.5 127.1 1-31 1 20.7 37.2 14.4 9.2 17.5 1-4 1 20.6 2946.4 6.6 659.2 129.2 25.5 12.3 1-8 2 19.3 97.3 1-9 2 18.5 282.4 1-32 1 17.9 57.8 14.8 2979.8 1-33 1 17.6 8.1 1739312.4 1-24 1 32.9 75.5 2043.7 1-40 2 22.9 1-5 1 20.6 25170.1 1155.7 1-28 2 17.7 73.5 13.4 520.3 96.6 3236.7 8.6 1-10 1 16.9 141.7 17.7 1-26 1 19.5 8.0 1-13 1 28.2 6.4 1-14 1 21.7 8.1 1-6 1 20.8 46.3 684.2 1-20 3 26.0 1344113.2 34.4 145.0 10.3 17.3 1-29 1 23.8 3684.3 36.1 19.3 1-1 1 32.5 1-19 1 22.3 85.4 0.0 14.3 18.6 1-16 1 22.1 2282.0 4487.3 1.7 178.8 2.2 1-34 1 28.7 8.2 623.6 13.4 1.4 1-18 1 22.7 1-11 1 33.2 240.9 30.2 1-25 1 27.9 78.9 3.0 6.1 1-36 1 23.6 68.9 3.9 9.3 33.2 1-15 1 24.8 346.9 1-51 1 7.1 1-52 1 3.5 739.8 1-53 1 21.7 1426.0 2-16 1 7.1 433.4 2-17 1 3.5 2-18 1 43.0 2-19 1 21.7 2-2 1 12.8

TABLE-US-00013 TABLE 7D SARS-CoV-2 S1 Variants Frequency and ELISA Data IgG Freq. ELISA(Avg) 2-1 1 45.3 2-10 1 43.8 2-5 46 30.8 2-2 2 23.4 2-4 1 15.5 2-6 5 22.1 2-11 3 28.1 2-12 1 18.2 2-13 1 19.1 2-14 1 17.2 2-7 1 25.3 2-8 1 32.4 2-15 1 13.7 2-9 1 14.1 2-16 1 7.1 2-17 1 3.5 2-18 1 43.0 2-19 1 21.7 2-2 1 12.8

TABLE-US-00014 TABLE 7E SARS-CoV-2 S1 Variants DB/S1 DB/S-T DC/S1 DC/S-T Inhibitor Fc/S1 Fc/S-T ELISA K.sub.D K.sub.D K.sub.D K.sub.D IC50 K.sub.D K.sub.D IgG Freq (Avg) (nM) (nM) (nM) (nM) (nM) (nM) (nM) 2-10 1 43.8 0.6 125.6 2-5 46 30.8 2.8 17.3 4.2 1.9 90.2 2-2 2 23.4 11.7 1.2 1.4 3.6 58.3 0.8 2-4 1 15.5 4337.7 2-6 5 22.1 3.0 563.8 0.4 32.3 0.01 2-11 3 28.1 3.1 90.0 284.5 2-12 1 18.2 6.4 63.8 1.0 3.2 2-13 1 19.1 45.0 2-14 1 17.2 2.5 34.8 2-7 1 25.3 252.5 2-8 1 32.4 115.1 33.4 47.4 12.2 52.8 2-15 1 13.7 3.5 4.7 2-9 1 14.1 23.2 23582.5

TABLE-US-00015 TABLE 7F Antibody Panel ELISA Binding Titrations (EC50) ANTIBODY EC50 (nM) 2-8 0.08001 1-35 0.09604 1-3 0.133 2-5 0.1332 1-27 0.1479 1-31 0.2035 2-6 0.283 1-2 0.523 1-34 0.5584 2-2 0.612 1-67 0.9402 1-16 1.409 1-12 2.15 1-28 2.284 1-4 2.559 1-1 4.157 1-19 4.413 1-22 6.548 1-5 7.833 1-42 7.92 2-15 7.92 1-49 8.669 1-53 10.25 2-9 12.58 1-33 17.5 1-26 48.46 2-29 63.43 1-7 95.66 1-25 95.66 1-51 98.17 2-17 100 2-2 100

[0238] Data for competition ELISA for a first set of SARS-CoV-2 S1 RBD and ACE2 variant antibodies is seen in FIGS. 13A-13B and FIG. 14A. SARS-CoV-2 variant antibodies with high potency in order of potency included variant 2-2, Acro mAb (1.5333), variant 2-5, variant 1-12, and variant 2-9. ACE variant antibodies with high potency in order of potency included variant 4-52, variant 4-17, variant 4-39, Acro mAb (1.533), variant 4-54, and variant 3.5. Data for competition ELISA for a second set of ACE2 variant antibodies is seen in FIG. 14B. Variant antibodies with high potency in order of potency included variant 4-101, variant 4-140, variant 4-121, variant 4-118, and Acro mAb (2.76 nM). FIGS. 14C-14D show the SARS-CoV-2 variant antibodies show potent neutralization.

[0239] Inhibition assays were also performed as seen in FIG. 15.

[0240] SARS-CoV-2 variant antibodies were assayed for Vero inhibition using FACS. Briefly, Vero cells stripped with Cell Stripper (.about.20 minutes with 90% viability after removal). Cells were plated at 0.1.times.10.sup.6 cells per well. Stock solution of the variant antibodies were at 200 nM titrated 1:3. SARS-CoV-2 S protein RBD, SPD-C5259 were made up at 6 ug/mL. Variant antibody titrations were mixed 1:1 with 6 ug/mL S protein (50 uL IgG: 50 uL S protein). 100 uL of the mixture were added to cells and then incubated on ice for 1 hour. The cells were washed 1.times. followed by addition of 50 uL of goat anti-mouse secondary made up at 1:200. The cells were then incubated on ice for 1 hour in the dark, washed three times, and the plates were then read. Data for SARS-CoV-2 variant antibodies is seen in FIGS. 16A-16D, FIGS. 17A-17D, and Tables 8 and 9. As seen in the data, several variant antibodies blocked labeled S1 RBD from binding to ACE2 on the Vero cells including variants 2-8, 2-5, 2-2, 2-4, and 1-63.

TABLE-US-00016 TABLE 8 Antibody IC50 (nM) Acro Anti-S1 2.7 1-30 NC 1-35 NC 1-12 NC 1-31 NC 1-63 106.6 2-5 4.4 2-2 3.0 2-4 46.3 2-6 NC 2-8 19.5

TABLE-US-00017 TABLE 9 S1 Monomer (nM) S Trimer (nM) 1-31 0.22 0.80 1-30 0.67 4.02 1-35 0.15 0.76 1-12 2.08 0.61 1-63 1.40 14.39 2-8 1.52 7.08 2-5 0.17 0.59 2-2 0.13 0.64 2-4 1.58 10.18 2-6 0.07 0.43

[0241] A summary of epitope binning for SARS-CoV-2 variant antibodies is seen in Table 10 below.

TABLE-US-00018 TABLE 10 SARS-CoV-2 Epitope Binning Acro Abcam ID mAb 2-2 CR3022 2-5 2-8 2-11 1-32 1-16 2-6 1-35 *Acro 0 0 2 1 1 1 1 1 1 1 mAb *2-2 0 0 0 0 0 0 2 0 2 1 Abcam 2 0 0 0 0 1 1 2 2 2 CR3022 *2-5 1 0 0 0 0 1 1 1 1 1 *2-8 1 0 0 0 0 1 1 1 1 1 2-11 1 0 0 0 0 0 1 2 1 1 **1-32 2 1 3 1 2 1 0 0 1 1 1-16 1 1 2 2 1 1 1 0 0 0 2-6 2 2 3 2 2 2 1 0 0 0 1-35 1 1 2 2 1 1 1 0 0 0 *Anti-S1 inhibiting IgG in FACS (Vero E6) **Anti-S1 inhibiting IgG in ELISA (soluble ACE2)

[0242] The variant antibodies were also measured in binding against other coronaviruses. Data shows that the variant antibodies do not bind significantly to S1 HCoV-229E (Sino), S1 HCoV-HKU1 (Sino), S1 HCoV-NL63 (Sino), or S1 HCoV-OC43 (Sino) (data not shown).

[0243] The data shows that the SARS-CoV-2 and ACE2 variant antibodies have high specificity and affinity to their antigen targets with affinities in the picomolar to nanomolar range.

Example 6. SARS-CoV-2 S1 Variants

[0244] VHH-Fc antibodies targeting S1 were titrated 1:3 starting at 200 nM and mixed 1:1 with SARS-COV2-S1 RBD (mouse IgG2Fc tag). The RBD/VHH-Fc complex was added to Vero E6 cells expressing endogenous ACE2 receptor and incubated. Cells were subsequently washed and an anti-mouse secondary was used to measure binding of S1 RBD to ACE2, thus assessing the inhibition of S1. Over 60 clones demonstrated potent inhibition. Data is seen in FIGS. 18A-18C and Tables 11 and 12.

TABLE-US-00019 TABLE 11 Sample IC.sub.50 [nM] 2-2 0.56 5-56 0.68 5-1 0.75 5-67 0.76 5-47 0.80 5-8 0.94 5-38 0.96 5-37 1.01 5-34 1.21 5-20 1.23 5-55 1.45 5-46 1.52 5-50 1.61 5-5 1.79 2-5 2.146 5-60 2.15 5-15 2.19 5-29 2.19 Acro Anti S1 3.80 5-49 5.61 5-44 11.73

TABLE-US-00020 TABLE 12 Sample IC.sub.50 [nM] 6-85 0.2044 2-2 0.56 6-63 0.74 6-3 0.74 6-78 0.7427 6-20 0.76 6-91 0.89 6-44 0.97 6-55 0.97 6-73 1.01 6-26 1.07 6-76 1.11 6-45 1.16 6-60 1.31 6-40 1.36 6-81 1.383 6-10 1.44 6-7 1.53 6-39 1.53 6-109 1.60 6-38 1.94 2-5 2.146 6-30 2.94 6-57 3.13 Acro Anti S1 3.49 6-67 3.80 6-77 4.041 6-100 5.07 6-47 5.86 6-41 6.60 6-88 7.118 6-105 7.82 6-34 8.24 6-54 8.90 6-18 12.29 6-1 15.76 6-65 37.47

[0245] Antibody kinetics were measured for variants 2-5, 2-2, and 2-6 (FIG. 19A) and variants 1-12, 1-42, 1-20, and 1-19 (FIG. 19B). Data is seen in FIGS. 19A-19B. The data shows that the antibodies bind with nanomolar affinities. FIG. 19C shows percent neutralization for variants 1-12, 1-42 and 1-20. FIG. 19D shows percent neutralization for variants 1-12, 1-42 and 1-20 using live virus.

Example 7. Neutralization of Live Virus

[0246] VHH-Fc antibodies targeting S1 were titrated 1:3 starting at 200 nM and mixed 1:1 with SARS-COV2-S1 RBD (mouse IgG2Fc tag). The RBD/VHH-Fc complex was added to Vero E6 cells expressing endogenous ACE2 receptor and incubated. Cells were subsequently washed and an anti-mouse secondary was used to measure binding of S1 RBD to ACE2, thus assessing the inhibition of S1. Over 60 clones demonstrated potent inhibition. The data is seen in FIGS. 20A-20B and Table 13.

TABLE-US-00021 TABLE 13 Antibody EC50 (ug/mL) 6-63 0.06 6-3 0.06 2165mAb* 0.08 5-1 0.10 6-60 0.15 6-55 0.21 5-20 0.27 1-20 0.37 5-34 0.54 6-85 0.84 6-76 1.08 6-73 1.46 1-42 2.03 1-12 2.10 6-26 2.97 6-20 5.03 6-78 8.26 2-6 11.77 2-5 18.31 2-2 67.57 1-63 106.90

[0247] FIG. 20B shows that variant 6-2 showed higher neutralization versus IgG in live virus. Variants 6-63, 6-3, and 5-1 showed comparable neutralization versus 2165 mAb derived from a COVID-19 subject. FIGS. 20C-20E and Table 14 show data from VHH single domain antibodies in VSV-pseudotype SARS-CoV-2 neutralization assays. Variants 5-1, 6-3, and 6-63 showed improved neutralization in pseudovirus testing including in live virus FRNT (FIG. 20E). Variants 6-3, 6-60, 6-63, and 6-76 showed potent neutralization in live virus PRNT as seen in Table 15 and FIG. 20F. Data as seen in Table 16 and FIGS. 20G-20H show that variants 6-3, 6-63, and 1-20 exhibited potent neutralization in live virus PRNT.

TABLE-US-00022 TABLE 14 Antibody NC50 (ug/mL) 6-63 0.06 6-3 0.06 5-1 0.10 6-60 0.15 6-55 0.21 5-20 0.27 1-20 0.37 5-34 0.54 6-85 0.84 6-76 1.08 6-73 1.46 1-42 2.03 1-12 2.10 6-26 2.97 6-20 5.03 6-78 8.26 2-6 11.77 2-5 18.31 2-2 67.57 1-63 106.90

TABLE-US-00023 TABLE 15 Antibody PRNT90 (ng/mL) 5-1 15.6 5-20 3.9 5-34 15.6 6-26 62.5 6-60 <0.98 6-63 3.9 6-3 <0.98 6-55 62.5 6-76 3.9 6-78 250 6-20 15.6 6-73 250 6-85 62.5

TABLE-US-00024 TABLE 16 Antibody EC80 (ug/mL) 6-63 0.057861 6-3 0.115234 1-20 0.171875 6-60 0.236816 5-20 0.376 6-76 0.425781 6-55 0.445313 5-34 0.570313 6-42 0.734375 5-1 0.810547 1-12 0.855469 6-85 1.0625 5-38 1.5 5-67 1.566406 1-42 1.78125 6-73 2.015625 6-20 2.3125 5-47 2.457031 1-19 2.78125 6-44 3.15625 6-26 3.609375 6-45 4.015625 5-37 12.4375 6-78 13.75 5-63 14.1875 5-8 15.8125 6-6 24.375 6-13 25.6875 6-24 31.375 1-63 50.5 6-32 60.625 2-6 72.34043 6-22 103.25 5-56 104.75 2-5 106.5 6-82 107.75 5-32 180.1418 6-91 240.5 2-2 354.6099 5-51 387.9433

[0248] The variants were also tested in pseudovirus neutralization and live virus PRNT studies. Variants 5-20, 6-60, 6-63, and 6-3 showed potent neutralization in live virus PRNT as seen in FIG. 20I.

Example 8. In Vivo Evaluation of Variant Coronavirus Immunoglobulins

[0249] This Example assesses the variant coronavirus immunoglobulins in a Syrian hamster model (immunosuppressed) of COVID-19 disease.

[0250] 8-10 week-old female Syrian hamsters were immunosuppressed using cyclophosphamide (140 mg/kg day 3 days before challenge and then 100 mg/kg every 4 days by i.p. route). Eleven groups of six hamsters per group were injected with antibody on day -1 relative to challenge by the intraperitoneal route (i.p.). On Day 0 all hamster were challenged with 1,000 PFU SARS CoV-2 Washington isolate by the intranasal route and weighed daily. % Weight change relative to starting weight was calculated. Pharyngeal swabs were collected on Days -1, 1, 4, 7, 9. Day 9 lungs were collected and homogenized for viral load. Groups are shown in Table 17.

TABLE-US-00025 TABLE 17 Groups Diluent/volume Group injected i.p. Convalescent plasma NA/2.5 mL Negative control MAb c7d11 PBS/2.5 mL 6-63 PBS/2.5 mL 6-3 PBS/2.5 mL 6-36 PBS/2.5 mL NA = not applicable

[0251] Animals injected intraperitonealy (i.p.) with the Negative Control antibody lost weight starting losing significant amounts of weight between Days 5 and 6 and continued to decline until the end of the experiment on Day 9. The maximum mean weight loss of the group was -11.7%. In contrast, animals injected with positive control human convalescent plasma maintained weight within -3.2% of their weight on Day 0 indicating this plasma protected against disease manifested by weight loss (FIG. 21A).

[0252] Groups of six animals were injected i.p. with 10, 5, or 1 mg/kg of monoclonal antibody 6-63 diluted in PBS. All groups maintained their weight at or above starting weight indicating the antibody protected against disease resulting weight loss (FIG. 21B).

[0253] Groups of six animals were injected i.p. with 10, 5, or 1 mg/kg of monoclonal antibody 6-3 diluted in PBS. The 1 and 10 mg/kg groups maintained their weight at or above starting weight at all time points. The 5 mg/kg group weight dipped slightly below the convalescent control on Days 7-9 but clearly was different from the Negative Control antibody. Together, these data indicate the antibody decreased weight loss associated with disease (FIG. 21C).

[0254] Groups of six animals were injected i.p. with 10, 5, or 1 mg/kg of monoclonal antibody 6-36 diluted in PBS. The 10 and 5 mg/kg groups maintained their weight at levels similar to the positive control at all time points. The 1 mg/kg group weight dropped significantly similar to the Negative Control. These data indicate antibody 6-36 at 1 mg/kg is insufficient to provide benefit, but a 5-fold or greater dose is adequate to reduce disease as determined by weight loss (FIG. 21D).

[0255] FIG. 3421E shows data from the variant antibodies grouped by dose. FIG. 21F shows graphs of percent weight change for antibodies 6-3, 6-63, and 1-20.

[0256] In wild type hamsters, virus is typically cleared by Day 7. However, in the cyclophosphamide model, viral levels are not suppressed unless there is intervention (e.g. protective antibodies administered) or the cyclophosphamide is discontinued to allow immune response and clearance. In this experiment the positive control human convalescent serum eliminated virus from the lungs from all except one hamster. In contrast, all but one of the hamsters injected with negative control antibody still had infectious virus in the lungs. Interestingly, hamsters prophylactically treated (24 hour previous to exposure) with any of the three antibodies at the highest dose (10 mg/kg) had infectious virus in the lungs of at least half the animals assessed 9 days later. Paradoxically, 6-63 and 6-3 at the lower doses (5 and 1 mg/kg) had animals with relatively less infectious virus in the lungs. 4 of 6 animals injected with 1-20 at 5 mg/kg dose animals had no detectable virus in the lungs. When the doses of that antibody was reduced to 1 mg/kg, all but one animal had infectious virus. Data is seen in FIGS. 21G-21H.

[0257] Lung pathology inflammation and edema scores from three animals were added per group and plotted (FIG. 21I). These were the same lungs used to score ISH. The convalescent sera positive control median score was 2 and the negative control was 4. The only groups with a median score lower than the negative control group were 1 and 5 mg/kg 6-63, 10 and 5 mg/kg 6-3, and 5 mg/kg 1-20. The highest median pathology scores were the 1 and 10 mg/kg 1-20 groups. The lowest median pathology score was the 5 mg/kg 6-63 group.

Example 9. VSV-Pseudotype Neutralization Analysis of Antibodies for SARS-CoV-2 B.135 (South African Strain)

[0258] Antibodies described herein were tested in a VSV-pseudotype neutralization assay for SARS-CoV-2 B.135 (South African strain).

[0259] Briefly, aerial semi-log dilutions of all test antibodies (TA) and control were prepared and mixed with the VSV-pseudotype virus in a 1:1 ratio for 1 h at RT followed by incubation over Vero cells (ATCC.RTM. CCL-81.TM.) seeded at 60,000 cells per well at 37.degree. C. The cells were lysed the following day and luciferase activity was measured to assess the potency of each TA to block viral entry into the Vero cells. All samples will be run in triplicate. Data analysis is conducted using XLFit and Graphpad Prism. The testing concentrations and plate plan are seen in Table 18A.

TABLE-US-00026 TABLE 18A Testing Concentrations and Plate Plan Stock Target In plate Samples (mg/mL) conc/dilution concentration 1 6-63 6.39 100 ug/mL 50.00 ug/mL 2 6-3 10.05 100 ug/mL 50.00 ug/mL 3 1-12 2.24 100 ug/mL 50.00 ug/mL 4 mouse 1 1:25 1:50 pAb

[0260] Data is seen in FIGS. 22A-22B. FIG. 22A illustrates positive control pAb has an NT50 of 1: 14, 993 dilution as expected. FIG. 22B illustrates antibodies 6-63 and 6-3 neutralize VSV-SARS B.135 strain with IC50s of .about.3.07 ug/mL and 0.143 ug/mL, respectively. Antibody 1-12 failed to neutralize VSV-SARS B.135 strain.

Example 10. VSV-Pseudotype Neutralization Analysis of Antibodies for SARS-CoV-2 D614G Variant

[0261] Antibodies described herein were tested in a VSV-pseudotype neutralization assay for SARS-CoV-2 SARS CoV-2 S D614G variant.

[0262] Briefly, serial semi-log dilutions of all test antibodies (TA) and control were prepared and mixed with the VSV-pseudotype virus in a 1:1 ratio for 1 h at RT followed by incubation over Vero cells (ATCC.RTM. CCL-81.TM.) seeded at 60,000 cells per well at 37.degree. C. The cells were lysed the following day and luciferase activity was measured to assess the potency of each TA to block viral entry into the Vero cells. All samples will be run in triplicate. Data analysis is conducted using XLFit and Graphpad Prism.

[0263] Data is seen in FIGS. 23A-23C. FIG. 23A shows the positive control.

Example 11. Antibody Cocktails for Treating SARS-CoV-2 in Syrian Hamsters

[0264] This Example demonstrates pre- and post-exposure efficacy of antibody cocktails in Syrian hamsters.

[0265] Methods

[0266] In this study the hamsters were transiently immunosuppressed using cyclophosphamide. As a strategy to de-risk selecting viruses with neutralization escape mutations a cocktail of a nanobody (nAb) and a monoclonal antibody (MAb) known to bind different spike protein epitopes were combined and used. The combined dose was 20 mg/Kg in this proof-of-concept experiment. The cocktail consisted of 10 mg/Kg of VHH nanobody 6-63 and 10 mg/Kg of monoclonal antibody 1-20. An equal number of male and female animals were used in each group.

[0267] Seventy-eight hamsters were used for this experiment according to Table 18B. On Day 0, animals were exposed via intranasal (IN) instillation to 1,000 pfu of SARS-CoV-2 virus in 50 .mu.L volume. The volume was distributed between both nares. To transiently immunosuppress, all animals were treated with cyclophosphamide starting on Day -3 (140 mg/kg dose) followed by additional doses (100 mg/kg) on Days 1, 5, and 9.

[0268] On the indicated day post exposure, MAb/nAb cocktail or c7D11 was administered via the intraperitoneal (IP) route. On Day 0 blood samples were collected from Group I for hematology to confirm immunosuppression. Group I was also the control for any adverse effects of cyclophosphamide treatment on the hamsters. Clinical scores and individual animal weights were recorded daily. Pharyngeal swabs and other key events were determined. Animals in Groups A-I were euthanized on day 14 and lungs were collected for virology and pathology. Group J animals were used for a serial pathology component of this study. Two animals from Group J (2 male and 2 female) were euthanized starting on Day 1 and then each day up to and including Day 6.

TABLE-US-00027 TABLE 18B Experimental design Number of Virus Hamsters (Pain Exposure.sup.a Group Category) (Day 0) Treatment Treatment Day A 6 (3 male, 3 SARS Cocktail.sup.b 20 -1 female) (D) CoV-2 mg/Kg B 6 (3 male, 3 Cocktail.sup.b 20 +1 female) (D) mg/Kg C 6 (3 male, 3 Cocktail.sup.b 20 +2 female) (D) mg/Kg D 6 (3 male, 3 Cocktail.sup.b 20 +3 female) (D) mg/Kg E 6 (3 male, 3 Cocktail.sup.b 20 +4 female) (D) mg/Kg F 6 (3 male, 3 Cocktail.sup.b 20 +5 female) (D) mg/Kg G 6 (3 male, 3 Cocktail.sup.b 20 +6 female) (E) mg/Kg H 6 (3 male, 3 Neg IgG +1 female) (E) control I 6 (3 male, 3 No virus none Cyclophosphamide female)(C) control J 24 (12 male, 12 SARS none No treatment- female) (E) CoV-2 pathology control.sup.d 78 Syrian hamsters .sup.achallenge with 1,000 pfu of virus in 50 microliter volume .sup.bcocktail = 6-63 combined with 1-20 1:1 w/v delivered 2.5 mL per animal by i.p. route .sup.c negative control 20 mg/kg .sup.dTwo animals (2 male and 2 female) from Group J were euthanized for pathology/virology on Days 1, 2, 3, 4, 5, 6

[0269] Results

[0270] Cyclophosphamide treatment in uninfected animals does not result in weight loss. Control animals (CYP Controls, Group I), that were treated with CYP but not challenged gained weight overtime.

[0271] Negative control antibody c7D11 at 20 mg/kg, Group H, does not protect against disease associated weight loss. Hamsters in Group H lost weight starting on Day 6 (FIG. 24A). Weight loss continued until Day 10 when it leveled off Animals were still below 10% of their starting weight on the last day of the experiment (Day 14).

[0272] The cocktail administered one day prior to exposure protected against weight loss. Hamsters in Group A maintained their weight and stayed within 1% of starting weight (FIG. 24A). This confirmed that treatment with neutralizing antibodies before exposure was sufficient to protect against significant weight loss.

[0273] Post-exposure treatment of CYP hamster model of COVID19 produces variable weight loss effects/patterns. A onetime treatment of a cocktail containing 1-20 and 6-63 at final dose of 20 mg/Kg was administered on Days 1 (B), 2 (C), 3 (D), 4 (E), 5 (F), and 6 (G). The percent weight change relative to Day 0 are shown in FIG. 24A. Arrows and dotted vertical lines indicate the day of treatment specific for the treatment regimen being compared. The same data is shown collectively in FIG. 24B. Note that there were two animals in Group B (Day 1) that dropped weight atypically during the experiment and one animal succumbed on Day 12. That animal had a necrotic/hemorrhaging testicle due to an apparent torsion event and was excluded from analysis. No assignable cause was identified for the second animal so that animal was not excluded from analysis. Statistical analysis was performed to compare both the CYP Control (Group I) and the negative control antibody (c7d11, Group H) to all other groups. The significance between groups at individual timepoints and differences in area under the curve (AOC) were determined. Treatment with the cocktail one day after exposure (Group B) results were confounded by the outlier animal There was not a significant differences in AOC between Group B and Group H suggesting no protection; however, there was also no significant difference in the AOC between Group A and Group I indicating Group B weight loss was not significantly different from the CYP control group that was not exposed. Treatment with the cocktail two days after exposure (Group C) clearly protected. There was significant differences in AOC between Group C and Group H; and no significant difference in the AOC between Group C and Group I. Treatment after three days (Day 3 Group D) did not result in a significant difference in AOC between Group D and H. However, treatment on day 4 or 5 after exposure (Groups E and F, respectively) did significant reduce the AOC relative to Group H. Treatment on day 6 (Group G) was similar to treatment on day 3 where no significant difference in AOR between Group G and H. Although there was no significance in the AOC for the Day 6 treatment group, the last three timepoints weight loss was significantly less than the negative control group. Interestingly, groups administered antibody on Days 3, 4, 5, or 6 started to gain weight starting on Day 9 whereas the negative control antibody treated animals did not. This suggests that there was a benefit of all cocktail treatment even at as late as 6 days post-exposure.

[0274] Infectious virus in lungs (Day 14/15). In wild type hamsters, virus is typically cleared by Day 7. However, in the cyclophosphamide model virus is not suppressed unless there is intervention (e.g. protective antibodies administered) or the cyclophosphamide is discontinued to allow immune response and clearance. Here, our controls demonstrate that unexposed hamsters were negative for virus (Cyp Cont), whereas all hamsters exposed to virus and treated with an off-target monoclonal antibody (Neg Cont) had more than 10,000 pfu of virus per gram of lung tissue. Most of the hamsters treated with the Cocktail one day prior or one day post virus exposure had detectable levels of virus in lung samples collected on Day 14 (Groups A and B). However, almost all of the hamsters treated with antibody .gtoreq.2 day after exposure had undetectable levels of antibody in their lungs. There was only a single animal exception in the Day 2, 3, 4 and 6 treated groups. All of the hamsters treated on Day 5 had lungs that were free of infectious virus. See FIG. 24C.

[0275] Sequential Sampling. Hamsters immunosuppressed and exposed to virus on Day 0 were sampled overtime to monitor the infection. Infectious virus was detected in the lungs of 3 of 4 hamsters on Day 1. Levels of infectious virus then increased more than 4 logs by Day 2. Levels of virus then leveled off and stayed between 7-9 log 10 through the last sampling timepoint (Day 6) analyzed to-date. Thus, animals administered the cocktail after Day 1 likely had very high levels of infectious virus present in their lungs before treatment with the antibody. See FIG. 24D.

CONCLUSION

[0276] The data demonstrates that when administered at or before Day 2 relative to virus exposure, the combination of antibody and nanobody at 20 mg/kg was sufficient to provide convincing benefit as determined by the disease parameters analyzed. When treated after Day 2, animals still developed weight loss but recovered in approximately 4 days. Two weeks after virus exposure, more infectious virus was detected in the lungs of hamsters receiving antibody early (Day -1 or 1) than day 2 or later. Day 2 (or later) treatment of exposed animals occurred at a time when viral burden in the lungs was already remarkably high. CYP, by itself, does not induce weight loss or clinical signs of disease.

Example 12. Immunity Conferred by SARS-CoV-2 and ACE2 Antibodies

[0277] Antibodies described in Examples 4-6 are used to confer immunity in a subject. A subject is passively immunized with a SARS-CoV-2 or ACE2 antibody. The subject is then exposed to SARS-CoV-2 after immunization with the SARS-CoV-2 or ACE2 antibody. Exposure can be within a few days or within a few months. The subject can also receive the SARS-CoV-2 or ACE2 antibody immediately following exposure with SARS-CoV-2. Although the subject is exposed to SARS-CoV-2, the subject has developed an immunity against SARS-CoV-2 and infection is prevented.

Example 13. Sequences

[0278] Tables 19-25 show exemplary sequences for CDRH1-H3 and CDRL1-L3 as well as variant heavy chains and variant light chains for the SARS-CoV-2 and ACE2 variants.

TABLE-US-00028 TABLE 19 SARS-CoV-2 S1 Variable Heavy Chain CDRs SEQ SEQ SEQ Vari- ID ID ID ant NO CDRH1 NO CDRH2 NO CDRH3 1-1 1 FTFSSHAMY 37 SAISGSA 73 CAHDTKDFW GSTYYA SGYCIFDPW 1-2 2 FTFSSQAMS 38 SAISGSG 74 CAKDRRFGE GGTYYA FDPW 1-3 3 FTFSSQAMS 39 SAISGSG 75 CAKDRRFGE GGTYYA FDPW 1-4 4 FTFSSQAMS 40 SAISGSG 76 CAKDRRFGE GGTYYA FDPW 1-5 5 FTFSSQAMS 41 SAISGSG 77 CAKDRRFGE GGTYYA FDPW 1-6 6 FTFSSQAMS 42 SAISGSG 78 CAKDRRFGE GGTYYA FDPW 1-7 7 FTFSSYDMS 43 SVISGSG 79 CAKGPLV GSTYYA GWYFDLW 1-8 8 FTFSSYDMS 44 SVISGSG 80 CAKGPLV GSTYYA GWYFDLW 1-9 9 FTFSSYDMS 45 SVISGSG 81 CAKGPLV GSTYYA GWYFDLW 1-10 10 FTFSSYDMS 46 SVISGSG 82 CAKGPLVGW GSTYYA YFDLW 1-11 11 ITFSSYAMS 47 SGISGSG 83 CAKHGSGT GSTYYA IFGVVIAK YYFDYC 1-12 12 ITFSSYAMS 48 SGISGSG 84 CAKHGSGTI GSTYYA FGVVIAKYY FDYW 1-13 13 VTFSSYAMS 49 SAITGSG 85 CAKHGSGT GSTYYA IFGVVIAK YYFDYW 1-14 14 ITFSSYAMS 50 SGISGSG 86 CANHGSGT GSTYYA IFGVVIAK YYFDYW 1-15 15 FTFSSHAMY 51 SAISGSA 87 CARDTKD GSTYYA FWSGYSI FDPW 1-16 16 FTFSSYAMY 52 SAISGSA 88 CARDT GSTYYA NDFW 1-17 17 FTFSSYAMY 53 SAISGSA 89 CARDTND GSTYYA FWSGYSI FDPW 1-18 18 FTFSSYAMY 54 SAISGSA 90 CARDTND GSTYYA FWSGYSI FDPW 1-19 19 FTFTSYAMY 55 SAISGSA 91 CARDTNDF GSTYYA WSGYSIF DPW 1-20 20 FTFSSYAMY 56 SAISGSA 92 CARDTND GSTYYA FWSGYSI FHPW 1-21 21 FTFSSYTMS 57 SIISGSG 93 CAREGYR GSTYYA DYLWYFD LW 1-22 22 FTFSSYAMN 58 SIISGSG 94 CAREGYR GSTYYA DYLWYF DLW 1-23 23 FTFSSYAIS 59 SIISGSG 95 CAREGYR GSTYYA DYLWYFD LW 1-24 24 FTFSSYAMN 60 SIISGSG 96 CAREGYR GSTYYA DYLWYF DLW 1-25 25 FTFSDYAMN 61 SIISGSG 97 CAREGYR GSTYYA DYLWYFDLW 1-26 26 FTFSSYAIS 62 SAISGSG 98 CARGAP YSTYYA DSSGYYFQ GEVYFDYW 1-27 27 FTFSSYAMT 63 SAISGSG 99 CASSSSWQ GGTYYA FDYW 1-28 28 FTFSSYGMS 64 SAISGSG 100 CASSSSWQ GGTYYA FDYW 1-29 29 FTFSSYAMT 65 SAISGSG 101 CASSSSWQ GGTYYA FDYW 1-30 30 FTFSSYAMT 66 SAISGSG 102 CTRPPYGDY GSTFYA GDYW 1-31 31 FTFSSYAMN 67 SAISGSG 103 CTRPPYGDY GSTFYA GDYW 1-32 32 FTFSSYAMY 68 SAISGSG 104 CTRPPYGD GSTFYA YGDYW 1-33 33 FTFSSYAMI 69 SAISGSG 105 CTRPPYGD GSTFYA YGDYW 1-34 34 FTFSSYAMY 70 SAISSSG 106 CTRPPYG GSTYYA DYGDYW 1-35 35 FTFSNYAMS 71 SDISGSG 107 CVKGTI GSTYYA PIFGVI RSAFDYW 1-36 36 LTFSSYAMS 72 SDISGSG 108 CVKGTIP GSTYYA IFGVIRS AFDYW

TABLE-US-00029 TABLE 20 SARS-CoV-2 S1 Variable Light Chain CDRs SEQ SEQ SEQ ID ID ID Variant NO CDRL1 NO CDRL2 NO CDRL3 1-1 109 TGTSSDI 145 EGTKRPS 181 CCSYAGS GSYNLVS RTYVF 1-2 110 TGTSSGV 146 EGIKRPS 182 CCSYAGS GSYNLVS SSFVVF 1-3 111 TGISSDV 147 EGTKRPS 183 CCSYAGS GSYNLVS SSFVVF 1-4 112 TGTSSDV 148 EGSQRPS 184 CCSYAGS GTYNLVS SSF VVF 1-5 113 TGTSSGV 149 EASKRPS 185 CCSYAGS GSYNLVS YTF AVF 1-6 114 TGTSSGV 150 EGIKRPS 186 CCSYAGS GSYNLVS SSFVVF 1-7 115 TGTSSDF 151 EGNKRPS 187 CCSYAGS GSYNLVS STFVVF 1-8 116 TGTSNDV 152 EGSKRPS 188 CCSYAGS GSYNLVS RYVVF 1-9 117 TGTSSDV 153 EGSNRPS 189 CCSYAGS GDYNLVS SSFVVF 1-10 118 TGTSSNV 154 EGTKRPS 190 CCSYAGS GSYNLVS SSFVVF 1-11 119 TGTSSDV 155 EGTKRPS 191 CCSYAGS GHYNLVS SSFVVF 1-12 120 TGTSSDV 156 EGTKRPS 192 CCSYAGS GHYNLVS SSFVVF 1-13 121 TGTSSDV 157 EGGKRPS 193 CCSYASS GRYNLVS STLVF 1-14 122 TGTSSDV 158 EGTKRPS 194 CCSYAGS GHYNLVS SSFVVF 1-15 123 TGTSSDI 159 EGTNRPS 195 CCSYAGS GSYNLVS RTYVF 1-16 124 TGTSSDI 160 EGTKRPS 196 CCSYAGS GSYNLVS RTYVF 1-17 125 TGTSSDI 161 EGTKRPS 197 CCSYAGS GSYNLVS RTYVF 1-18 126 TGTSSDI 162 EGTKRPS 198 CCSYAGS GSYNLVS RTYVF 1-19 127 TGTSSDI 163 EGTKRPS 199 CCSYAGS GSYNLVS RTYVF 1-20 128 TGTSSDI 164 EGTKRPS 200 CCSYAGS GSYNLVS RTYVF 1-21 129 TGTSSDV 165 EGNKRPS 201 CCSYAGS GSNNLVS VVF 1-22 130 TGTSTDV 166 EGSQRPS 202 CCSYAGS GSYNLVS STVF 1-23 131 TGTSNDV 167 EGNKRPS 203 CCSYAGS GSYNLVS YTVF 1-24 132 TGTSSDV 168 EGNKRPS 204 CCSYAGG GYYNLVS SVVF 1-25 133 SGTSSDV 169 EASKRPS 205 CCSYAGS GSYNLVS STVF 1-26 134 TGTSSDV 170 EGTKRPS 206 CCSFVRS GGYNLVS SAHVVF 1-27 135 TGTSSYV 171 EGSRRPS 207 CCSYAGS GHYNLVS YTHYVF 1-28 136 TGTSSGV 172 EGSQRPS 208 CCSYAGS GSYNLVS STHYVF 1-29 137 TGTSSYV 173 EGSRRPS 209 CCSYAGS GHYNLVS YTHYVF 1-30 138 TGTSRDV 174 EGTKRPS 210 CCSYAGS GSYNLVS RTPVVF 1-31 139 TGTSSDV 175 EGSQRPS 211 CCSYAGS GKYNLVS RTPVVF 1-32 140 TGTSSDV 176 EGNKRPS 212 CCSYAGS GGYNLVS STFPV VF 1-33 141 TGTSSDV 177 EASKRPS 213 CCSYAGS GSYNLLS RTPVVF 1-34 142 TGTSSDV 178 EASKRPS 214 CCSYAGS GGYNLVS YIPVVF 1-35 143 TGTSSDV 179 EGTKRPS 215 CCSYAGS GSYSLVS YSYVVF 1-36 144 TGTSSDV 180 EGDKRPS 216 CCSYAGS GSYSLVS YSYVVF

TABLE-US-00030 TABLE 21 SARS-CoV-2 S1 Variable Heavy Chain CDRs SEQ SEQ SEQ ID ID ID Name NO CDRH1 NO CDRH2 NO CDRH3 1-21 217 FTFSSYTMS 283 SIISGSG 349 CAREGYR GSTYYA DYLWYFD LW 1-22 218 FTFSSYAMN 284 SIISGSG 350 CAREGYR GSTYYA DYLWYFD LW 1-30 219 FTFSSYAMT 285 SAISGSG 351 CTRPPYG GSTFYA DYGDYW 1-35 220 FTFSNYAMS 286 SDISGSG 352 CVKGTIP GSTYYA IFGVIRS AFDYW 1-17 221 FTFSSYAMY 287 SAISGSA 353 CARDTND GSTYYA FWSGYSI FDPW 1-27 222 FTFSSYAMT 288 SAISGSG 354 CASSSSW GGTYYA QFDYW 1-12 223 ITFSSYAMS 289 SGISGSG 355 CAKHGSG GSTYYA TIFGVVI AKYYFDY W 1-2 224 FTFSSQAMS 290 SAISGSG 356 CAKDRRF GGTYYA GEFDPW 1-3 225 FTFSSQAMS 291 SAISGSG 357 CAKDRRF GGTYYA GEFDPW 1-23 226 FTFSSYAIS 292 SIISGSG 358 CAREGYR GSTYYA DYLWYFD LW 1-7 227 FTFSSYDMS 293 SVISGSG 359 CAKGPLV GSTYYA GWYFDLW 1-31 228 FTFSSYAMN 294 SAISGSG 360 CTRPPYG GSTFYA DYGDYW 1-4 229 FTFSSQAMS 295 SAISGSG 361 CAKDRRF GGTYYA GEFDPW 1-8 230 FTFSSYDMS 296 SVISGSG 362 CAKGPLV GSTYYA GWYFDLW 1-9 231 FTFSSYDMS 297 SVISGSG 363 CAKGPLV GSTYYA GWYFDLW 1-32 232 FTFSSYAMY 298 SAISGSG 364 CTRPPYG GSTFYA DYGDYW 1-33 233 FTFSSYAMI 299 SAISGSG 365 CTRPPYG GSTFYA DYGDYW 1-24 234 FTFSSYAMN 300 SIISGSG 366 CAREGYR GSTYYA DYLWYFD LW 1-40 235 FTFSSYAMY 301 SAISGSA 367 CARDTND GSTYYA FWSGYSI FDPW 1-5 236 FTFSSQAMS 302 SAISGSG 368 CAKDRRF GGTYYA GEFDPW 1-28 237 FTFSSYGMS 303 SAISGSG 369 CASSSSW GGTYYA QFDYW 1-10 238 FTFSSYDMS 304 SVISGSG 370 CAKGPLV GSTYYA GWYFDLW 1-26 239 FTFSSYAIS 305 SAISGSG 371 CARGAPD YSTYYA SSGYYFQ GEVYFDY W 1-42 240 VTFSSYAMS 306 SAITGSG 372 CAKHGSG GSTYYA TIFGVVI AKYYFDY W 1-13 241 FTFSSHAMS 307 SAISGSA 373 CARDTKD GSTYYA FWSGYCI FDPW 1-14 242 FTFTSYAMS 308 SAISGSG 374 CANDTND GSTYYA FWFGYWI FDPW 1-6 243 FTFSSQAMS 309 TAISGSG 375 CAKDTIF GGTYYA GEFYPW 1-20 244 ITFSSYAMS 310 SGISGSG 376 CANHGSG GSTYYA TIFGVVI AKYYFDY W 1-47 245 FTFSSQAMS 311 SAISGSG 377 CAKDRRF GGTYYA GEFDPW 1-29 246 FTFSSYAMY 312 SAISGSA 378 CARDTND GSTYYA FWSGYSI FDPW 1-1 247 FTFSSHAMY 313 SAISGSA 379 CARDTKD GSTYYA FWSGYSI FDPW 1-19 248 ITFSSYAMS 314 SGISGSG 380 CAKHGSG GSTYYA TIFGVVI AKYYFDY C 1-16 249 LTFSSYAMS 315 SDISGSG 381 CVKGTIP GSTYYA IFGVIRS AFDYW 1-34 250 FTFSSYAMT 316 SAISGSG 382 CASSSSW GGTYYA QFDYW 1-48 251 FTFSSHAMY 317 SAISGSA 383 CAHDTKD GSTYYA FWSGYCI FDPW 1-49 252 FTFSSYAMY 318 SAISGSA 384 CARDTND GSTYYA FW 1-18 253 FTFSSHAMS 319 SAISGSA 385 CAHDTKD GSTYYA FWSGYCI FDPW 1-11 254 FTFSSYDMS 320 SAISGSG 386 CARGPLD GTTYYA FW 1-25 255 FTFTSYAMY 321 SAISGSA 387 CARDTND GSTYYA FWSGYSI FDPW 1-36 256 FTFSDYAMN 322 SIISGSG 388 CAREGYR GSTYYA DYLWYFD LW 1-15 257 ITFSSHAMS 323 SGISGSG 389 CAKHGSG GSTYYA TIFGVVI AKYYFDY W 1-51 258 FTFSSYAMS 324 SVISGSG 390 CAREGYR GSTYYA DYLWYFD LW 1-52 259 FTFSNYAMS 325 SAISGSA 391 CARVRQG GSTYYA LRRTWYY FDYW 1-53 260 FTFSSYTMS 326 SVISGSG 392 CAREGYR GSTYYA DYLWYFD LW 1-54 261 FTFSSYAMY 327 SAISGSA 393 CARDTND GSTYYA FWSGYSI FDPW 1-55 262 FTFSSYAMA 328 SAISGSG 394 CASSSSW SSTYYA QFDYW 1-56 263 FTFSSYAMY 329 SAISGSA 395 CARDTND GSTYYA FWSGYSI FDPW 1-57 264 FTFSSYAMT 330 SAISGSG 396 CTRPPYG GSTFYA DYGDYW 1-58 265 FTFSSYAMG 331 SAISTSG 397 CAKGLWF GSTYYA GGGGFDP W 1-59 266 FTFSSYAMN 332 SVISGSG 398 CAREGYR GSTYYA DYLWYFD LW 1-6 267 FTFSSYAMY 333 SAISSSG 399 CTRPPYG GSTYYA DYGDYW 1-61 268 FTFSSYAVS 334 SDISGSG 400 CVKGTIP GSTYYA IFGVIRS AFDYW 1-62 269 FRFSSYAMS 335 SAISGSG 401 CAKDFHG GTTYYA IAAAGID YW 1-63 270 FMFSSYAMS 336 SAISGSG 402 CAKDGAS GSTYYT GWPNWHF DLW 1-64 271 FAFSSYAMS 337 SAISGSG 403 CAHSRDS GDTYYA SSWYVDY W 1-37 272 FTFTSYAMN 338 TAISGSG 404 CTRPPYG GSTFYA DYGDYW 1-38 273 ITFSSYAMS 339 SGISGSG 405 CAKHGSG GSTYYA TIFGVVI AKYYFDY W 1-39 274 FTFSSYAMY 340 TAISGSG 406 CTRPPYG GSTFYA YYGDYW 1-41 275 FTFSSYDMS 341 SVISGSG 407 CAKGPLV GSTYYA GWYFDLW 1-43 276 FTFSSQAMS 342 TAISGSG 408 CAKDTIF GGTYYA GEFYPW 1-44 277 FTFSSQAMS 343 TAISGSG 409 CAKDRKF GGTYYA GEFDPW 1-45 278 FTFSSYAMS 344 SIISGSA 410 CARDGYK GSTYYA YCLW 1-46 279 FTFTSYAMS 345 SAISGSG 411 CANDTSD GSTYYA FCFGYWI FDPW 1-50 280 FTFSSYDMS 346 SAISGSG 412 CARGPLD GTTYYA FW 1-65 281 FTFSSHAMS 347 SAISGSA 413 CARDTKD GSTYYA FWSGYCI FDPW 1-66 282 FTFTSYAMS 348 SAISGSG 414 CANDTND GSTYYA FWFGYWI FDPW

TABLE-US-00031 TABLE 22 SARS-CoV-2 S1 Variable Light Chain CDRs SEQ SEQ SEQ NO NO NO Name ID CDRL1 ID CDRL2 ID CDRL3 1-21 415 TGTSSDVGSNNLVS 474 EGNKRPS 533 CCSYAGSVVF 1-22 416 TGTSTDVGSYNLVS 475 EGSQRPS 534 CCSYAGSSTVF 1-30 417 TGTSRDVGSYNLVS 476 EGTKRPS 535 CCSYAGSRTPVVF 1-35 418 TGTSSDVGSYSLVS 477 EGTKRPS 536 CCSYAGSYSYVVF 1-17 419 TGTSSDIGSYNLVS 478 EGTKRPS 537 CCSYAGSRTYVF 1-27 420 TGTSSYVGHYNLVS 479 EGSRRPS 538 CCSYAGSYTHYVF 1-12 421 TGTSSDVGHYNLVS 480 EGTKRPS 539 CCSYAGSSSFVVF 1-2 422 TGTSSGVGSYNLVS 481 EGIKRPS 540 CCSYAGSSSFVVF 1-3 423 TGISSDVGSYNLVS 482 EGTKRPS 541 CCSYAGSSSFVVF 1-23 424 TGTSNDVGSYNLVS 483 EGNKRPS 542 CCSYAGSYTVF 1-7 425 TGTSSDFGSYNLVS 484 EGNKRPS 543 CCSYAGSSTFVVF 1-31 426 TGTSSDVGKYNLVS 485 EGSQRPS 544 CCSYAGSRTPVVF 1-4 427 TGTSSDVGTYNLVS 486 EGSQRPS 545 CCSYAGSSSFVVF 1-8 428 TGTSNDVGSYNLVS 487 EGSKRPS 546 CCSYAGSRYVVF 1-9 429 TGTSSDVGDYNLVS 488 EGSNRPS 547 CCSYAGSSSFVVF 1-32 430 TGTSSDVGGYNLVS 489 EGNKRPS 548 CCSYAGSST FPVVF 1-33 431 TGTSSDVGSYNLLS 490 EASKRPS 549 CCSYAGSRTPVVF 1-24 432 TGTSSDVGYYNLVS 491 EGNKRPS 550 CCSYAGGSVVF 1-5 433 TGTSSGVGSYNLVS 492 EASKRPS 551 CCSYAGSYTFAVF 1-28 434 TGTSSGVGSYNLVS 493 EGSQRPS 552 CCSYAGSSTHYVF 1-10 435 TGTSSNVGSYNLVS 494 EGTKRPS 553 CCSYAGSSSFVVF 1-26 436 TGTSSDVGGYNLVS 495 EGTKRPS 554 CCSFVRSSAHVVF 1-42 437 TGTSSDVGRYNLVS 496 EGGKRPS 555 CCSYASSSTLVF 1-20 438 TGTSSDVGHYNLVS 497 EGTKRPS 556 CCSYAGSSSFVVF 1-47 439 TGTSSGVGSYNLVS 498 EGIKRPS 557 CCSYAGSSSFVVF 1-29 440 TGTSSDIGSYNLVS 499 EGTKRPS 558 CCSYAGSRTYVF 1-1 441 TGTSSDIGSYNLVS 500 EGTNRPS 559 CCSYAGSRTYVF 1-19 442 TGTSSDVGHYNLVS 501 EGTKRPS 560 CCSYAGSSSFVVF 1-16 443 TGTSSDVGSYSLVS 502 EGDKRPS 561 CCSYAGSYSYVVF 1-34 444 TGTSSYVGHYNLVS 503 EGSRRPS 562 CCSYAGSYTHYVF 1-48 445 TGTSSDIGSYNLVS 504 EGTKRPS 563 CCSYAGSRTYVF 1-49 446 TGTSSDIGSYNLVS 505 EGTKRPS 564 CCSYAGSRTYVF 1-25 447 TGTSSDIGSYNLVS 506 EGTKRPS 565 CCSYAGSRTYVF 1-36 448 SGTSSDVGSYNLVS 507 EASKRPS 566 CCSYAGSSTVF 1-51 449 TGTSSDVGSYDLVS 508 EGNKRPS 567 CCSYAGSSVVF 1-52 450 TGTSSDVGSSNLVS 509 EGSKRPS 568 CCSYAGSLYVF 1-53 451 TGTSTDVGSYNLVS 510 EGTKRPS 569 CCSYAGSYTSVVF 1-54 452 TGTSSDIGSYNLVS 511 EGTKRPS 570 CCYHSRTRTHVF 1-55 453 TGTSSDLGSYNIVS 512 EGSRRPS 571 CCSYAGSYTHYVF 1-56 454 TGTSSDIGSYNLVS 513 EGTKRPS 572 CCYHSRTRTHVS 1-57 455 TGTSSDVGKYNLVS 514 EGVKRPS 573 CCSYAGSRTPVVF 1-58 456 TGTRSDVGSYNLVS 515 EVSKRPS 574 CCSYAGDSFPYVF 1-59 457 TGTSSDVGSFNLVS 516 EVSKRPS 575 CCSYAGSSVVF 1-6 458 TGTSSDVGGYNLVS 517 EASKRPS 576 CCSYAGSYIPVVF 1-61 459 TGTSSDVGSYSLVS 518 EGGKRPS 577 CCSYAGSYSYVVF 1-62 460 TGTSSDVGSHNLVS 519 EGGKRPS 578 CCSYSGRYTYVF 1-63 461 TGTSSDVGSYYLVS 520 EGDKRPS 579 CCSHAGRYPYVF 1-64 462 TGTSSGVGSYNLVS 521 AGSKRPS 580 CCSYLGSGTF DVLF 1-37 463 TGTSSDIGSYNLVS 522 EGTKRPS 581 CCSYAGSRTYVF 1-38 464 TGTSSDIGSYNLVS 523 EGTKRPS 582 CCSYAGSRTYVF 1-39 465 TGTSSDIGSYNLVS 524 EGTKRPS 583 CCSYAGSRTYVF 1-41 466 TGTSSDIGSYNLVS 525 EGTKRPS 584 CCSYAGSRTYVF 1-43 467 TGTSSDIGSYNLVS 526 EGTKRPS 585 CCSYAGSRTYVF 1-44 468 TGTSSDIGSYNLVS 527 EGTKRPS 586 CCSYAGSRTYVF 1-45 469 TGTSSDIGSYNLVS 528 EGTKRPS 587 CCSYAGSRTYVF 1-46 470 TGTSSDIGSYNLVS 529 EGTKRPS 588 CCSYAGSRTYVF 1-50 471 TGTSSDIGSYNLVS 530 EGTKRPS 589 CCSYAGSRTYVF 1-65 472 TGTSSDIGSYNLVS 531 EGTKRPS 590 CCSYAGSRTYVF 1-66 473 TGTSSDIGSYNLVS 532 EGTKRPS 591 CCSYAGSRTYVF

TABLE-US-00032 TABLE 23 SARS-CoV-2 S1 Variant Sequences Variable Heavy Chain Name SEQ ID Amino Acid Sequence 1-21 592 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYTMSWVRQAPGKGLEWVSI ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAREG YRDYLWYFDLWGQGTLVTVSS 1-22 593 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMNWVRQAPGKGLEWVSI ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAREG YRDYLWYFDLWGQGTLVTVSS 1-30 594 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMTWVRQAPGKGLEWVSA ISGSGGSTFYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCTRPP YGDYGDYWGQGTLVTVSS 1-35 595 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSNYAMSWVRQAPGKGLEWVSD ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCVKGT IPIFGVIRSAFDYWGQGTLVTVSS 1-17 596 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMYWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARDT NDFWSGYSIFDPWGQGTLVTVSS 1-27 597 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMTWVRQAPGKGLEWVSA ISGSGGGTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCASSS SWQFDYWGQGTLVTVSS 1-12 598 EVQLLESGGGLVQPGGSLRLSCAAS GITFSSYAMSWVRQAPGKGLEWVSG ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKHG SGTIFGVVIAKYYFDYWGQGTLVTV SS 1-2 599 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSQAMSWVRQAPGKGLEWVSA ISGSGGGTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKDR RFGEFDPWGQGTLVTVSS 1-3 600 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSQAMSWVRQAPGKGLEWVSA ISGSGGGTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKDR RFGEFDPWGQGTLVTVSS 1-23 601 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAISWVRQAPGKGLEWVSI ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAREG YRDYLWYFDLWGQGTLVTVSS 1-7 602 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYDMSWVRQAPGKGLEWVSV ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKGP LVGWYFDLWGQGTLVTVSS 1-31 603 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMNWVRQAPGKGLEWVSA ISGSGGSTFYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCTRPP YGDYGDYWGQGTLVTVSS 1-4 604 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSQAMSWVRQAPGKGLEWVSA ISGSGGGTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKDR RFGEFDPWGQGTLVTVSS 1-8 605 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYDMSWVRQAPGKGLEWVSV ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKGP LVGWYFDLWGQGTLVTVSS 1-9 606 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYDMSWVRQAPGKGLEWVSV ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKGP LVGWYFDLWGQGTLVTVSS 1-32 607 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMYWVRQAPGKGLEWVSA ISGSGGSTFYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCTRPP YGDYGDYWGQGTLVTVSS 1-33 608 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMIWVRQAPGKGLEWVSA ISGSGGSTFYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCTRPP YGDYGDYWGQGTLVTVSS 1-24 609 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMNWVRQAPGKGLEWVSI ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAREG YRDYLWYFDLWGQGTLVTVSS 1-40 610 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMYWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARDT NDFWSGYSIFDPWGQGTLVTVSS 1-5 611 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSQAMSWVRQAPGKGLEWVSA ISGSGGGTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKDR RFGEFDPWGQGTLVTVSS 1-28 612 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYGMSWVRQAPGKGLEWVSA ISGSGGGTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCASSS SWQFDYWGQGTLVTVSS 1-10 613 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYDMSWVRQAPGKGLEWVSV ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKGP LVGWYFDLWGQGTLVTVSS 1-26 614 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAISWVRQAPGKGLEWVSA ISGSGYSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARGA PDSSGYYFQGEVYFDYWGQGTLVTV SS 1-42 615 EVQLLESGGGLVQPGGSLRLSCAAS GVTFSSYAMSWVRQAPGKGLEWVSA ITGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKHG SGTIFGVVIAKYYFDYWGQGTLVTV SS 1-13 616 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSHAMSWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARDT KDFWSGYCIFDPWGQGTLVTVSS 1-14 617 EVQLLESGGGLVQPGGSLRLSCAAS GFTFTSYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCANDT NDFWFGYWIFDPWGQGTLVTVSS 1-6 618 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSQAMSWVRQAPGKGLEWVTA ISGSGGGTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKDT IFGEFYPWGQGTLVTVSS 1-20 619 EVQLLESGGGLVQPGGSLRLSCAAS GITFSSYAMSWVRQAPGKGLEWVSG ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCANHG SGTIFGVVIAKYYFDYWGQGTLVTV SS 1-47 620 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSQAMSWVRQAPGKGLEWVSA ISGSGGGTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKDR RFGEFDPWGQGTLVTVSS 1-29 621 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMYWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARDT NDFWSGYSIFDPWGQGTLVTVSS 1-1 622 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSHAMYWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARDT KDFWSGYSIFDPWGQGTLVTVSS 1-19 623 EVQLLESGGGLVQPGGSLRLSCAAS GITFSSYAMSWVRQAPGKGLEWVSG ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKHG SGTIFGVVIAKYYFDYCGQGTLVTV SS 1-16 624 EVQLLESGGGLVQPGGSLRLSCAAS GLTFSSYAMSWVRQAPGKGLEWVSD ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCVKGT IPIFGVIRSAFDYWGQGTLVTVSS 1-34 625 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMTWVRQAPGKGLEWVSA ISGSGGGTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCASSS SWQFDYWGQGTLVTVSS 1-48 626 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSHAMYWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAHDT KDFWSGYCIFDPWGQGTLVTVSS 1-49 627 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMYWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARDT NDFWGQGTLVTVSS 1-18 628 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSHAMSWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAHDT KDFWSGYCIFDPWGQGTLVTVSS 1-11 629 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYDMSWVRQAPGKGLEWVSA ISGSGGTTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARGP LDFWGQGTLVTVSS 1-25 630 EVQLLESGGGLVQPGGSLRLSCAAS GFTFTSYAMYWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARDT NDFWSGYSIFDPWGQGTLVTVSS 1-36 631 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSDYAMNWVRQAPGKGLEWVSI ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAREG YRDYLWYFDLWGQGTLVTVSS

1-15 632 EVQLLESGGGLVQPGGSLRLSCAAS GITFSSHAMSWVRQAPGKGLEWVSG ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKHG SGTIFGVVIAKYYFDYWGQGTLVTV SS 1-51 633 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMSWVRQAPGKGLEWVSV ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAREG YRDYLWYFDLWGQGTLVTVSS 1-52 634 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSNYAMSWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARVR QGLRRTWYYFDYWGQGTLVTVSS 1-53 635 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYTMSWVRQAPGKGLEWVSV ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAREG YRDYLWYFDLWGQGTLVTVSS 1-54 636 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMYWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARDT NDFWSGYSIFDPWGQGTLVTVSS 1-55 637 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMAWVRQAPGKGLEWVSA ISGSGSSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCASSS SWQFDYWGQGTLVTVSS 1-56 638 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMYWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARDT NDFWSGYSIFDPWGQGTLVTVSS 1-57 639 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMTWVRQAPGKGLEWVSA ISGSGGSTFYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCTRPP YGDYGDYWGQGTLVTVSS 1-58 640 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMGWVRQAPGKGLEWVSA ISTSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKGL WFGGGGFDPWGQGTLVTVSS 1-59 641 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMNWVRQAPGKGLEWVSV ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAREG YRDYLWYFDLWGQGTLVTVSS 1-6 642 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMYWVRQAPGKGLEWVSA ISSSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCTRPP YGDYGDYWGQGTLVTVSS 1-61 643 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAVSWVRQAPGKGLEWVSD ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCVKGT IPIFGVIRSAFDYWGQGTLVTVSS 1-62 644 EVQLLESGGGLVQPGGSLRLSCAAS GFRFSSYAMSWVRQAPGKGLEWVSA ISGSGGTTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKDF HGIAAAGIDYWGQGTLVTVSS 1-63 645 EVQLLESGGGLVQPGGSLRLSCAAS GFMFSSYAMSWVRQAPGKGLEWVSA ISGSGGSTYYTDSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKDG ASGWPNWHFDLWGQGTLVTVSS 1-64 646 EVQLLESGGGLVQPGGSLRLSCAAS GFAFSSYAMSWVRQAPGKGLEWVSA ISGSGGDTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAHSR DSSSWYVDYWGQGTLVTVSS 1-37 647 EVQLLESGGGLVQPGGSLRLSCAAS GFTFTSYAMNWVRQAPGKGLEWVTA ISGSGGSTFYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCTRPP YGDYGDYWGQGTLVTVSS 1-38 648 EVQLLESGGGLVQPGGSLRLSCAAS GITFSSYAMSWVRQAPGKGLEWVSG ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKHG SGTIFGVVIAKYYFDYWGQGTLVTV SS 1-39 649 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMYWVRQAPGKGLEWVTA ISGSGGSTFYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCTRPP YGYYGDYWGQGTLVTVSS 1-41 650 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYDMSWVRQAPGKGLEWVSV ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKGP LVGWYFDLWGQGTLVTVSS 1-43 651 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSQAMSWVRQAPGKGLEWVTA ISGSGGGTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKDT IFGEFYPWGQGTLVTVSS 1-44 652 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSQAMSWVRQAPGKGLEWVTA ISGSGGGTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKDR KFGEFDPWGQGTLVTVSS 1-45 653 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMSWVRQAPGKGLEWVSI ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARDG YKYCLWGQGTLVTVSS 1-46 654 EVQLLESGGGLVQPGGSLRLSCAAS GFTFTSYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCANDT SDFCFGYWIFDPWGQGTLVTVSS 1-50 655 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYDMSWVRQAPGKGLEWVSA ISGSGGTTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARGP LDFWGQGTLVTVSS 1-65 656 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSHAMSWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARDT KDFWSGYCIFDPWGQGTLVTVSS 1-66 657 EVQLLESGGGLVQPGGSLRLSCAAS GFTFTSYAMSWVRQAPGKGLEWVSA ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCANDT NDFWFGYWIFDPWGQGTLVTVSS

TABLE-US-00033 TABLE 24 SARS-CoV-2 S1 Variant Sequences Variable Light Chain Name ID NO SEQ Amino Acid Sequence 1-21 658 QSALTQPASVSGSPGQSITISCTGTSSDVGSNNLVSWYQQHPGKAPKLMIYEGNKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSVVFGGGTKLTVL 1-22 659 QSALTQPASVSGSPGQSITISCTGTSTDVGSYNLVSWYQQHPGKAPKLMIYEGSQR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSSTVFGGGTKLTVL 1-30 660 QSALTQPASVSGSPGQSITISCTGTSRDVGSYNLVSWYQQHPGKAPKLMIYEGTKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTPVVFGGGTKLTVL 1-35 661 QSALTQPASVSGSPGQSITISCTGTSSDVGSYSLVSWYQQHPGKAPKLMIYEGTKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYSYVVFGGGTKLTVL 1-17 662 QSALTQPASVSGSPGQSITISCTGTSSDIGSYNLVSWYQQHPGKAPKLMIYEGTKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTYVFGGGTKLTVL 1-27 663 QSALTQPASVSGSPGQSITISCTGTSSYVGHYNLVSWYQQHPGKAPKLMIYEGSRR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYTHYVFGGGTKLTVL 1-12 664 QSALTQPASVSGSPGQSITISCTGTSSDVGHYNLVSWYQQHPGKAPKLMIYEGTKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSSSFVVFGGGTKLTVL 1-2 665 QSALTQPASVSGSPGQSITISCTGTSSGVGSYNLVSWYQQHPGKAPKLMIYEGIKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSSSFVVFGGGTKLTVL 1-3 666 QSALTQPASVSGSPGQSITISCTGISSDVGSYNLVSWYQQHPGKAPKLMIYEGTKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSSSFVVFGGGTKLTVL 1-23 667 QSALTQPASVSGSPGQSITISCTGTSNDVGSYNLVSWYQQHPGKAPKLMIYEGNKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYTVFGGGTKLTVL 1-7 668 QSALTQPASVSGSPGQSITISCTGTSSDFGSYNLVSWYQQHPGKAPKLMIYEGNKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSSTFVVFGGGTKLTVL 1-31 669 QSALTQPASVSGSPGQSITISCTGTSSDVGKYNLVSWYQQHPGKAPKLMIYEGSQR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTPVVFGGGTKLTVL 1-4 670 QSALTQPASVSGSPGQSITISCTGTSSDVGTYNLVSWYQQHPGKAPKLMIYEGSQR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSSSFVVFGGGTKLTVL 1-8 671 QSALTQPASVSGSPGQSITISCTGTSNDVGSYNLVSWYQQHPGKAPKLMIYEGSKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRYVVFGGGTKLTVL 1-9 672 QSALTQPASVSGSPGQSITISCTGTSSDVGDYNLVSWYQQHPGKAPKLMIYEGSNR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSSSFVVFGGGTKLTVL 1-32 673 QSALTQPASVSGSPGQSITISCTGTSSDVGGYNLVSWYQQHPGKAPKLMIYEGNKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSSTFPVVFGGGTKLTVL 1-33 674 QSALTQPASVSGSPGQSITISCTGTSSDVGSYNLLSWYQQHPGKAPKLMIYEASKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTPVVFGGGTKLTVL 1-24 675 QSALTQPASVSGSPGQSITISCTGTSSDVGYYNLVSWYQQHPGKAPKLMIYEGNKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGGSVVFGGGTKLTVL 1-5 676 QSALTQPASVSGSPGQSITISCTGTSSGVGSYNLVSWYQQHPGKAPKLMIYEASKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYTFAVFGGGTKLTVL 1-28 677 QSALTQPASVSGSPGQSITISCTGTSSGVGSYNLVSWYQQHPGKAPKLMIYEGSQR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSSTHYVFGGGTKLTVL 1-10 678 QSALTQPASVSGSPGQSITISCTGTSSNVGSYNLVSWYQQHPGKAPKLMIYEGTKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSSSFVVFGGGTKLTVL 1-26 679 QSALTQPASVSGSPGQSITISCTGTSSDVGGYNLVSWYQQHPGKAPKLMIYEGTKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSFVRSSAHVVFGGGTKLTVL 1-42 680 QSALTQPASVSGSPGQSITISCTGTSSDVGRYNLVSWYQQHPGKAPKLMIYEGGKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYASSSTLVFGGGTKLTVL 1-20 681 QSALTQPASVSGSPGQSITISCTGTSSDVGHYNLVSWYQQHPGKAPKLMIYEGTKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSSSFVVFGGGTKLTVL 1-47 682 QSALTQPASVSGSPGQSITISCTGTSSGVGSYNLVSWYQQHPGKAPKLMIYEGIKRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSSSFVVFGGGTKLTVL 1-29 683 QSALTQPASVSGSPGQSITISCTGTSSDIGSYNLVSWYQQHPGKAPKLMIYEGTKRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTYVFGGGTKLTVL 1-1 684 QSALTQPASVSGSPGQSITISCTGTSSDIGSYNLVSWYQQHPGKAPKLMIYEGTNRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTYVFGGGTKLTVL 1-19 685 QSALTQPASVSGSPGQSITISCTGTSSDVGHYNLVSWYQQHPGKAPKLMIYEGTKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSSSFVVFGGGTKLTVL 1-16 686 QSALTQPASVSGSPGQSITISCTGTSSDVGSYSLVSWYQQHPGKAPKLMIYEGDKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYSYVVFGGGTKLTVL 1-34 687 QSALTQPASVSGSPGQSITISCTGTSSYVGHYNLVSWYQQHPGKAPKLMIYEGSRR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYTHYVFGGGTKLTVL 1-48 688 QSALTQPASVSGSPGQSITISCTGTSSDIGSYNLVSWYQQHPGKAPKLMIYEGTKRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTYVFGGGTKLTVL 1-49 689 QSALTQPASVSGSPGQSITISCTGTSSDIGSYNLVSWYQQHPGKAPKLMIYEGTKRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTYVFGGGTKLTVL 1-25 690 QSALTQPASVSGSPGQSITISCTGTSSDIGSYNLVSWYQQHPGKAPKLMIYEGTKRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTYVFGGGTKLTVL 1-36 691 QSALTQPASVSGSPGQSITISCSGTSSDVGSYNLVSWYQQHPGKAPKLMIYEASKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSSTVFGGGTKLTVL 1-51 692 QSALTQPASVSGSPGQSITISCTGTSSDVGSYDLVSWYQQHPGKAPKLMIYEGNKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSSVVFGGGTKLTVL 1-52 693 QSALTQPASVSGSPGQSITISCTGTSSDVGSSNLVSWYQQHPGKAPKLMIYEGSKRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSLYVFGGGTKLTVL 1-53 694 QSALTQPASVSGSPGQSITISCTGTSTDVGSYNLVSWYQQHPGKAPKLMIYEGTKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYTSVVFGGGTKLTVL 1-54 695 QSALTQPASVSGSPGQSITISCTGTSSDIGSYNLVSWYQQHPGKAPKLMIYEGTKRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCYHSRTRTHVFGGGTKLTVL 1-55 696 QSALTQPASVSGSPGQSITISCTGTSSDLGSYNIVSWYQQHPGKAPKLMIYEGSRRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYTHYVFGGGTKLTVL 1-56 697 QSALTQPASVSGSPGQSITISCTGTSSDLGSYNIVSWYQQHPGKAPKLMIYEGSRRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYTHYVFGGGTKLTVL 1-57 698 QSALTQPASVSGSPGQSITISCTGTSSDLGSYNIVSWYQQHPGKAPKLMIYEGSRRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYTHYVFGGGTKLTVL 1-58 699 QSALTQPASVSGSPGQSITISCTGTSSDLGSYNIVSWYQQHPGKAPKLMIYEGSRRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYTHYVFGGGTKLTVL 1-59 700 QSALTQPASVSGSPGQSITISCTGTSSDLGSYNIVSWYQQHPGKAPKLMIYEGSRRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYTHYVFGGGTKLTVL 1-6 701 QSALTQPASVSGSPGQSITISCTGTSSDLGSYNIVSWYQQHPGKAPKLMIYEGSRRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYTHYVFGGGTKLTVL 1-61 702 QSALTQPASVSGSPGQSITISCTGTSSDLGSYNIVSWYQQHPGKAPKLMIYEGSRRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYTHYVFGGGTKLTVL 1-62 703 QSALTQPASVSGSPGQSITISCTGTSSDVGSHNLVSWYQQHPGKAPKLMIYEGGKR PSGVSNRFSgSKSGNTaslTISGLQAEDEADYYCCSYSGRYTYVFGGGtKLTVL 1-63 704 QSALTQPASVSGSPGQSITISCTGTSSDVGSYYLVSWYQQHPGKAPKLMIYEGDKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSHAGRYPYVFGGGTKLTVL 1-64 705 QSALTQPASVSGSPGQSITISCTGTSSGVGSYNLVSWYQQHPGKAPKLMIYAGSKR PSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYLGSGTFDVLFGGGTKLTVL 1-37 706 QSALTQPASVSGSPGQSITISCTGTSSDIGSYNLVSWYQQHPGKAPKLMIYEGTKRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTYVFGGGTKLTVL 1-38 707 QSALTQPASVSGSPGQSITISCTGTSSDIGSYNLVSWYQQHPGKAPKLMIYEGTKRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTYVFGGGTKLTVL 1-39 708 QSALTQPASVSGSPGQSITISCTGTSSDIGSYNLVSWYQQHPGKAPKLMIYEGTKRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTYVFGGGTKLTVL 1-41 709 QSALTQPASVSGSPGQSITISCTGTSSDIGSYNLVSWYQQHPGKAPKLMIYEGTKRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTYVFGGGTKLTVL 1-43 710 QSALTQPASVSGSPGQSITISCTGTSSDIGSYNLVSWYQQHPGKAPKLMIYEGTKRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTYVFGGGTKLTVL 1-44 711 QSALTQPASVSGSPGQSITISCTGTSSDIGSYNLVSWYQQHPGKAPKLMIYEGTKRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTYVFGGGTKLTVL 1-45 712 QSALTQPASVSGSPGQSITISCTGTSSDIGSYNLVSWYQQHPGKAPKLMIYEGTKRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTYVFGGGTKLTVL 1-46 713 QSALTQPASVSGSPGQSITISCTGTSSDIGSYNLVSWYQQHPGKAPKLMIYEGTKRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTYVFGGGTKLTVL 1-50 714 QSALTQPASVSGSPGQSITISCTGTSSDIGSYNLVSWYQQHPGKAPKLMIYEGTKRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTYVFGGGTKLTVL 1-65 715 QSALTQPASVSGSPGQSITISCTGTSSDIGSYNLVSWYQQHPGKAPKLMIYEGTKRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTYVFGGGTKLTVL 1-66 716 QSALTQPASVSGSPGQSITISCTGTSSDIGSYNLVSWYQQHPGKAPKLMIYEGTKRP SGVSNRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSRTYVFGGGTKLTVL

TABLE-US-00034 TABLE 25 Reformatted SARS-CoV-2 S1 Variant Sequences SEQ ID Amino Acid Name NO Sequence 1-H1 717 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYTMSWVRQAPGKGLEWVSI ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAREG YRDYLWYFDLWGQGTLVTVSS 1-H2 718 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMNWVRQAPGKGLEWVSI ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAREG YRDYLWYFDLWGQGTLVTVSS 1-H3 719 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMTWVRQAPGKGLEWVSA ISGSGGSTFYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCTRPP YGDYGDYWGQGTLVTVSS 1-H4 720 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSNYAMSWVRQAPGKGLEWVSD ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCVKGT IPIFGVIRSAFDYWGQGTLVTVSS 1-H5 721 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMYWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARDT NDFWSGYSIFDPWGQGTLVTVSS 1-H6 722 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMTWVRQAPGKGLEWVSA ISGSGGGTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCASSS SWQFDYWGQGTLVTVSS 1-H8 723 EVQLLESGGGLVQPGGSLRLSCAAS GITFSSYAMSWVRQAPGKGLEWVSG ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKHG SGTIFGVVIAKYYFDYWGQGTLVTV SS 1-H9 724 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSQAMSWVRQAPGKGLEWVSA ISGSGGGTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKDR RFGEFDPWGQGTLVTVSS 1-H10 725 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSQAMSWVRQAPGKGLEWVSA ISGSGGGTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKDR RFGEFDPWGQGTLVTVSS 1-H11 726 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAISWVRQAPGKGLEWVSI ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAREG YRDYLWYFDLWGQGTLVTVSS 1-H12 727 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYDMSWVRQAPGKGLEWVSV ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKGP LVGWYFDLWGQGTLVTVSS 1-H13 728 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMNWVRQAPGKGLEWVSA ISGSGGSTFYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCTRPP YGDYGDYWGQGTLVTVSS 1-H14 729 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSQAMSWVRQAPGKGLEWVSA ISGSGGGTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKDR RFGEFDPWGQGTLVTVSS 1-H16 730 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYDMSWVRQAPGKGLEWVSV ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKGP LVGWYFDLWGQGTLVTVSS 1-H17 731 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYDMSWVRQAPGKGLEWVSV ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKGP LVGWYFDLWGQGTLVTVSS 1-H18 732 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMYWVRQAPGKGLEWVSA ISGSGGSTFYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCTRPP YGDYGDYWGQGTLVTVSS 1-H19 733 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMIWVRQAPGKGLEWVSA ISGSGGSTFYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCTRPP YGDYGDYWGQGTLVTVSS 1-H20 734 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMNWVRQAPGKGLEWVSI ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAREG YRDYLWYFDLWGQGTLVTVSS 1-H23 735 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSQAMSWVRQAPGKGLEWVSA ISGSGGGTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKDR RFGEFDPWGQGTLVTVSS 1-H25 736 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYGMSWVRQAPGKGLEWVSA ISGSGGGTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCASSS SWQFDYWGQGTLVTVSS 1-H26 737 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYDMSWVRQAPGKGLEWVSV ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKGP LVGWYFDLWGQGTLVTVSS 1-H27 738 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAISWVRQAPGKGLEWVSA ISGSGYSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARGA PDSSGYYFQGEVYFDYWGQGTLVTV SS 1-H28 739 EVQLLESGGGLVQPGGSLRLSCAAS GVTFSSYAMSWVRQAPGKGLEWVSA ITGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKHG SGTIFGVVIAKYYFDYWGQGTLVTV SS 1-H31 740 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMYWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARDT NDFWSGYSIFHPWGQGTLVTVSS 1-H36 741 EVQLLESGGGLVQPGGSLRLSCAAS GITFSSYAMSWVRQAPGKGLEWVSG ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCANHG SGTIFGVVIAKYYFDYWGQGTLVTV SS 1-H37 742 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSQAMSWVRQAPGKGLEWVSA ISGSGGGTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKDR RFGEFDPWGQGTLVTVSS 1-H38 743 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMYWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARDT NDFWSGYSIFDPWGQGTLVTVSS 1-H39 744 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSHAMYWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARDT KDFWSGYSIFDPWGQGTLVTVSS 1-H40 745 EVQLLESGGGLVQPGGSLRLSCAAS GITFSSYAMSWVRQAPGKGLEWVSG ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAKHG SGTIFGVVIAKYYFDYCGQGTLVTV SS 1-H41 746 EVQLLESGGGLVQPGGSLRLSCAAS GLTFSSYAMSWVRQAPGKGLEWVSD ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCVKGT IPIFGVIRSAFDYWGQGTLVTVSS 1-H42 747 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMTWVRQAPGKGLEWVSA ISGSGGGTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCASSS SWQFDYWGQGTLVTVSS 1-H43 748 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSHAMYWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAHDT KDFWSGYCIFDPWGQGTLVTVSS 1-H44 749 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMYWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARDT NDFWGQGTLVTVSS 1-H47 750 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMYWVRQAPGKGLEWVSA ISSSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCTRPP YGDYGDYWGQGTLVTVSS 1-H48 751 EVQLLESGGGLVQPGGSLRLSCAAS GFTFTSYAMYWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARDT NDFWSGYSIFDPWGQGTLVTVSS 1-H49 752 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSDYAMNWVRQAPGKGLEWVSI ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAREG YRDYLWYFDLWGQGTLVTVSS 1-L1 753 QSALTQPASVSGSPGQSITISCTGT SSDVGSNNLVSWYQQHPGKAPKLMI YEGNKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSVVFG GGTKLTVL 1-L2 754 QSALTQPASVSGSPGQSITISCTGT STDVGSYNLVSWYQQHPGKAPKLMI YEGSQRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSSTVF GGGTKLTVL 1-L3 755 QSALTQPASVSGSPGQSITISCTGT SRDVGSYNLVSWYQQHPGKAPKLMI YEGTKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSRTPV VFGGGTKLTVL 1-L4 756 QSALTQPASVSGSPGQSITISCTGT SSDVGSYSLVSWYQQHPGKAPKLMI YEGTKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSYSYV

VFGGGTKLTVL 1-L5 757 QSALTQPASVSGSPGQSITISCTGT SSDIGSYNLVSWYQQHPGKAPKLMI YEGTKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSRTYV FGGGTKLTVL 1-L6 758 QSALTQPASVSGSPGQSITISCTGT SSYVGHYNLVSWYQQHPGKAPKLMI YEGSRRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSYTHY VFGGGTKLTVL 1-L8 759 QSALTQPASVSGSPGQSITISCTGT SSDVGHYNLVSWYQQHPGKAPKLMI YEGTKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSSSFV VFGGGTKLTVL 1-L9 760 QSALTQPASVSGSPGQSITISCTGT SSGVGSYNLVSWYQQHPGKAPKLMI YEGIKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSSSFV VFGGGTKLTVL 1-L10 761 QSALTQPASVSGSPGQSITISCTGI SSDVGSYNLVSWYQQHPGKAPKLMI YEGTKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSSSFV VFGGGTKLTVL 1-L11 762 QSALTQPASVSGSPGQSITISCTGT SNDVGSYNLVSWYQQHPGKAPKLMI YEGNKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSYTVF GGGTKLTVL 1-L12 763 QSALTQPASVSGSPGQSITISCTGT SSDFGSYNLVSWYQQHPGKAPKLMI YEGNKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSSTFV VFGGGTKLTVL 1-L13 764 QSALTQPASVSGSPGQSITISCTGT SSDVGKYNLVSWYQQHPGKAPKLMI YEGSQRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSRTPV VFGGGTKLTVL 1-L14 765 QSALTQPASVSGSPGQSITISCTGT SSDVGTYNLVSWYQQHPGKAPKLMI YEGSQRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSSSFV VFGGGTKLTVL 1-L16 766 QSALTQPASVSGSPGQSITISCTGT SNDVGSYNLVSWYQQHPGKAPKLMI YEGSKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSRYVV FGGGTKLTVL 1-L17 767 QSALTQPASVSGSPGQSITISCTGT SSDVGDYNLVSWYQQHPGKAPKLMI YEGSNRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSSSFV VFGGGTKLTVL 1-L18 768 QSALTQPASVSGSPGQSITISCTGT SSDVGGYNLVSWYQQHPGKAPKLMI YEGNKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSSTFP VVFGGGTKLTVL 1-L19 769 QSALTQPASVSGSPGQSITISCTGT SSDVGSYNLLSWYQQHPGKAPKLMI YEASKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSRTPV VFGGGTKLTVL 1-L20 770 QSALTQPASVSGSPGQSITISCTGT SSDVGYYNLVSWYQQHPGKAPKLMI YEGNKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGGSVVF GGGTKLTVL 1-L23 771 QSALTQPASVSGSPGQSITISCTGT SSGVGSYNLVSWYQQHPGKAPKLMI YEASKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSYTFA VFGGGTKLTVL 1-L25 772 QSALTQPASVSGSPGQSITISCTGT SSGVGSYNLVSWYQQHPGKAPKLMI YEGSQRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSSTHY VFGGGTKLTVL 1-L26 773 QSALTQPASVSGSPGQSITISCTGT SSNVGSYNLVSWYQQHPGKAPKLMI YEGTKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSSSFV VFGGGTKLTVL 1-L27 774 QSALTQPASVSGSPGQSITISCTGT SSDVGGYNLVSWYQQHPGKAPKLMI YEGTKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSFVRSSAHV VFGGGTKLTVL 1-L28 775 QSALTQPASVSGSPGQSITISCTGT SSDVGRYNLVSWYQQHPGKAPKLMI YEGGKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYASSSTLV FGGGTKLTVL 1-L31 776 QSALTQPASVSGSPGQSITISCTGT SSDIGSYNLVSWYQQHPGKAPKLMI YEGTKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSRTYV FGGGTKLTVL 1-L36 777 QSALTQPASVSGSPGQSITISCTGT SSDVGHYNLVSWYQQHPGKAPKLMI YEGTKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSSSFV VFGGGTKLTVL 1-L37 778 QSALTQPASVSGSPGQSITISCTGT SSGVGSYNLVSWYQQHPGKAPKLMI YEGIKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSSSFV VFGGGTKLTVL 1-L38 779 QSALTQPASVSGSPGQSITISCTGT SSDIGSYNLVSWYQQHPGKAPKLMI YEGTKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSRTYV FGGGTKLTVL 1-L39 780 QSALTQPASVSGSPGQSITISCTGT SSDIGSYNLVSWYQQHPGKAPKLMI YEGTNRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSRTYV FGGGTKLTVL 1-L40 781 QSALTQPASVSGSPGQSITISCTGT SSDVGHYNLVSWYQQHPGKAPKLMI YEGTKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSSSFV VFGGGTKLTVL 1-L41 782 QSALTQPASVSGSPGQSITISCTGT SSDVGSYSLVSWYQQHPGKAPKLMI YEGDKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSYSYV VFGGGTKLTVL 1-L42 783 QSALTQPASVSGSPGQSITISCTGT SSYVGHYNLVSWYQQHPGKAPKLMI YEGSRRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSYTHY VFGGGTKLTVL 1-L43 784 QSALTQPASVSGSPGQSITISCTGT SSDIGSYNLVSWYQQHPGKAPKLMI YEGTKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSRTYV FGGGTKLTVL 1-L44 785 QSALTQPASVSGSPGQSITISCTGT SSDIGSYNLVSWYQQHPGKAPKLMI YEGTKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSRTYV FGGGTKLTVL 1-L47 786 QSALTQPASVSGSPGQSITISCTGT SSDVGGYNLVSWYQQHPGKAPKLMI YEASKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSYIPV VFGGGTKLTVL 1-L48 787 QSALTQPASVSGSPGQSITISCTGT SSDIGSYNLVSWYQQHPGKAPKLMI YEGTKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSRTYV FGGGTKLTVL 1-L49 788 QSALTQPASVSGSPGQSITISCSGT SSDVGSYNLVSWYQQHPGKAPKLMI YEASKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAGSSTVF GGGTKLTVL 1-H51 789 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYAMSWVRQAPGKGLEWVSV ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAREG YRDYLWYFDLWGQGTLVTVSS 1-H52 790 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSNYAMSWVRQAPGKGLEWVSA ISGSAGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARVR QGLRRTWYYFDYWGQGTLVTVSS 1-H53 791 EVQLLESGGGLVQPGGSLRLSCAAS GFTFSSYTMSWVRQAPGKGLEWVSV ISGSGGSTYYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCAREG YRDYLWYFDLWGQGTLVTVSS 1-L51 792 QSALTQPASVSGSPGQSITISCTGT SSDVGSYDLVSWYQQHPGKAPKLMI YEGNKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYAG- SSVVFGGGTKLTVL 1-L52 793 QSALTQPASVSGSPGQSITISCTGT SSDVGSSNLVSWYQQHPGKAPKLMI YEGSKRPSGVSNRFSGSKSGNTASL TISGLQAEDEADYYCCSYA- GSLYVFGGGTKLTVL 1-L53 794 QSALTQPASVSGSPGQSITISCTGT STDVGSYNLVSWYQQHPGKAPKLMI YEGTKRPSGVSNRFSGSKSGNTASL TISGLQAZDEADYYCCSYAGSYTSV VFGGGTKLTVL

[0279] While preferred embodiments of the present disclosure have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the disclosure. It should be understood that various alternatives to the embodiments of the disclosure described herein may be employed in practicing the disclosure. It is intended that the following claims define the scope of the disclosure and that methods and structures within the scope of these claims and their equivalents be covered thereby.

Sequence CWU 1

1

79819PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 1Phe Thr Phe Ser Ser His Ala Met Tyr1 529PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 2Phe Thr Phe Ser Ser Gln Ala Met Ser1 539PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 3Phe Thr Phe Ser Ser Gln Ala Met Ser1 549PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 4Phe Thr Phe Ser Ser Gln Ala Met Ser1 559PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 5Phe Thr Phe Ser Ser Gln Ala Met Ser1 569PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 6Phe Thr Phe Ser Ser Gln Ala Met Ser1 579PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 7Phe Thr Phe Ser Ser Tyr Asp Met Ser1 589PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 8Phe Thr Phe Ser Ser Tyr Asp Met Ser1 599PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 9Phe Thr Phe Ser Ser Tyr Asp Met Ser1 5109PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 10Phe Thr Phe Ser Ser Tyr Asp Met Ser1 5119PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 11Ile Thr Phe Ser Ser Tyr Ala Met Ser1 5129PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 12Ile Thr Phe Ser Ser Tyr Ala Met Ser1 5139PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 13Val Thr Phe Ser Ser Tyr Ala Met Ser1 5149PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 14Ile Thr Phe Ser Ser Tyr Ala Met Ser1 5159PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 15Phe Thr Phe Ser Ser His Ala Met Tyr1 5169PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 16Phe Thr Phe Ser Ser Tyr Ala Met Tyr1 5179PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 17Phe Thr Phe Ser Ser Tyr Ala Met Tyr1 5189PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 18Phe Thr Phe Ser Ser Tyr Ala Met Tyr1 5199PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 19Phe Thr Phe Thr Ser Tyr Ala Met Tyr1 5209PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 20Phe Thr Phe Ser Ser Tyr Ala Met Tyr1 5219PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 21Phe Thr Phe Ser Ser Tyr Thr Met Ser1 5229PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 22Phe Thr Phe Ser Ser Tyr Ala Met Asn1 5239PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 23Phe Thr Phe Ser Ser Tyr Ala Ile Ser1 5249PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 24Phe Thr Phe Ser Ser Tyr Ala Met Asn1 5259PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 25Phe Thr Phe Ser Asp Tyr Ala Met Asn1 5269PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 26Phe Thr Phe Ser Ser Tyr Ala Ile Ser1 5279PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 27Phe Thr Phe Ser Ser Tyr Ala Met Thr1 5289PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 28Phe Thr Phe Ser Ser Tyr Gly Met Ser1 5299PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 29Phe Thr Phe Ser Ser Tyr Ala Met Thr1 5309PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 30Phe Thr Phe Ser Ser Tyr Ala Met Thr1 5319PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 31Phe Thr Phe Ser Ser Tyr Ala Met Asn1 5329PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 32Phe Thr Phe Ser Ser Tyr Ala Met Tyr1 5339PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 33Phe Thr Phe Ser Ser Tyr Ala Met Ile1 5349PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 34Phe Thr Phe Ser Ser Tyr Ala Met Tyr1 5359PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 35Phe Thr Phe Ser Asn Tyr Ala Met Ser1 5369PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 36Leu Thr Phe Ser Ser Tyr Ala Met Ser1 53713PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 37Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 103813PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 38Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala1 5 103913PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 39Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala1 5 104013PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 40Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala1 5 104113PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 41Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala1 5 104213PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 42Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala1 5 104313PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 43Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 104413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 44Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 104513PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 45Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 104613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 46Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 104713PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 47Ser Gly Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 104813PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 48Ser Gly Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 104913PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 49Ser Ala Ile Thr Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 105013PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 50Ser Gly Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 105113PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 51Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 105213PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 52Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 105313PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 53Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 105413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 54Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 105513PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 55Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 105613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 56Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 105713PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 57Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 105813PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 58Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 105913PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 59Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 106013PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 60Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 106113PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 61Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 106213PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 62Ser Ala Ile Ser Gly Ser Gly Tyr Ser Thr Tyr Tyr Ala1 5 106313PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 63Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala1 5 106413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 64Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala1 5 106513PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 65Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala1 5 106613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 66Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala1 5 106713PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 67Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala1 5 106813PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 68Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala1 5 106913PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 69Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala1 5 107013PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 70Ser Ala Ile Ser Ser Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 107113PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 71Ser Asp Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 107213PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 72Ser Asp Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 107318PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 73Cys Ala His Asp Thr Lys Asp Phe Trp Ser Gly Tyr Cys Ile Phe Asp1 5 10 15Pro Trp7413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 74Cys Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp1 5 107513PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 75Cys Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp1 5 107613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 76Cys Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp1 5 107713PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 77Cys Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp1 5 107813PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 78Cys Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp1 5 107914PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 79Cys Ala Lys Gly Pro Leu Val Gly Trp Tyr Phe Asp Leu Trp1 5 108014PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 80Cys Ala Lys Gly Pro Leu Val Gly Trp Tyr Phe Asp Leu Trp1 5 108114PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 81Cys Ala Lys Gly Pro Leu Val Gly Trp Tyr Phe Asp Leu Trp1 5 108214PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 82Cys Ala Lys Gly Pro Leu Val Gly Trp Tyr Phe Asp Leu Trp1 5 108322PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 83Cys Ala Lys His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys1 5 10 15Tyr Tyr Phe Asp Tyr Cys 208422PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 84Cys Ala Lys His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys1 5 10 15Tyr Tyr Phe Asp Tyr Trp 208522PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 85Cys Ala Lys His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys1 5 10 15Tyr Tyr Phe Asp Tyr Trp 208622PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 86Cys Ala Asn His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys1 5 10 15Tyr Tyr Phe Asp Tyr Trp 208718PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 87Cys Ala Arg Asp Thr Lys Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp1 5 10 15Pro Trp889PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 88Cys Ala Arg Asp Thr Asn Asp Phe Trp1 58918PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 89Cys Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp1 5 10 15Pro Trp9018PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 90Cys Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp1 5 10 15Pro Trp9118PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 91Cys Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp1 5 10 15Pro Trp9218PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 92Cys Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe His1 5 10 15Pro Trp9316PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 93Cys Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp1 5 10 159416PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 94Cys Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp1 5 10 159516PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 95Cys Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp1 5 10 159616PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 96Cys Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp1 5 10 159716PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 97Cys Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp1 5 10 159822PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 98Cys Ala Arg Gly Ala Pro Asp Ser Ser Gly Tyr Tyr Phe Gln Gly Glu1 5 10 15Val Tyr Phe Asp Tyr Trp 209912PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 99Cys Ala Ser Ser Ser Ser Trp Gln Phe Asp Tyr Trp1 5 1010012PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 100Cys Ala Ser Ser Ser Ser Trp Gln Phe Asp Tyr Trp1 5 1010112PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 101Cys Ala Ser Ser Ser Ser Trp Gln Phe Asp Tyr Trp1 5 1010213PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 102Cys Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp1 5 1010313PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 103Cys Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp1 5 1010413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 104Cys Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp1

5 1010513PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 105Cys Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp1 5 1010613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 106Cys Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp1 5 1010719PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 107Cys Val Lys Gly Thr Ile Pro Ile Phe Gly Val Ile Arg Ser Ala Phe1 5 10 15Asp Tyr Trp10819PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 108Cys Val Lys Gly Thr Ile Pro Ile Phe Gly Val Ile Arg Ser Ala Phe1 5 10 15Asp Tyr Trp10914PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 109Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1011014PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 110Thr Gly Thr Ser Ser Gly Val Gly Ser Tyr Asn Leu Val Ser1 5 1011114PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 111Thr Gly Ile Ser Ser Asp Val Gly Ser Tyr Asn Leu Val Ser1 5 1011214PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 112Thr Gly Thr Ser Ser Asp Val Gly Thr Tyr Asn Leu Val Ser1 5 1011314PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 113Thr Gly Thr Ser Ser Gly Val Gly Ser Tyr Asn Leu Val Ser1 5 1011414PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 114Thr Gly Thr Ser Ser Gly Val Gly Ser Tyr Asn Leu Val Ser1 5 1011514PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 115Thr Gly Thr Ser Ser Asp Phe Gly Ser Tyr Asn Leu Val Ser1 5 1011614PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 116Thr Gly Thr Ser Asn Asp Val Gly Ser Tyr Asn Leu Val Ser1 5 1011714PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 117Thr Gly Thr Ser Ser Asp Val Gly Asp Tyr Asn Leu Val Ser1 5 1011814PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 118Thr Gly Thr Ser Ser Asn Val Gly Ser Tyr Asn Leu Val Ser1 5 1011914PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 119Thr Gly Thr Ser Ser Asp Val Gly His Tyr Asn Leu Val Ser1 5 1012014PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 120Thr Gly Thr Ser Ser Asp Val Gly His Tyr Asn Leu Val Ser1 5 1012114PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 121Thr Gly Thr Ser Ser Asp Val Gly Arg Tyr Asn Leu Val Ser1 5 1012214PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 122Thr Gly Thr Ser Ser Asp Val Gly His Tyr Asn Leu Val Ser1 5 1012314PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 123Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1012414PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 124Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1012514PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 125Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1012614PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 126Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1012714PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 127Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1012814PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 128Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1012914PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 129Thr Gly Thr Ser Ser Asp Val Gly Ser Asn Asn Leu Val Ser1 5 1013014PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 130Thr Gly Thr Ser Thr Asp Val Gly Ser Tyr Asn Leu Val Ser1 5 1013114PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 131Thr Gly Thr Ser Asn Asp Val Gly Ser Tyr Asn Leu Val Ser1 5 1013214PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 132Thr Gly Thr Ser Ser Asp Val Gly Tyr Tyr Asn Leu Val Ser1 5 1013314PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 133Ser Gly Thr Ser Ser Asp Val Gly Ser Tyr Asn Leu Val Ser1 5 1013414PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 134Thr Gly Thr Ser Ser Asp Val Gly Gly Tyr Asn Leu Val Ser1 5 1013514PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 135Thr Gly Thr Ser Ser Tyr Val Gly His Tyr Asn Leu Val Ser1 5 1013614PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 136Thr Gly Thr Ser Ser Gly Val Gly Ser Tyr Asn Leu Val Ser1 5 1013714PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 137Thr Gly Thr Ser Ser Tyr Val Gly His Tyr Asn Leu Val Ser1 5 1013814PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 138Thr Gly Thr Ser Arg Asp Val Gly Ser Tyr Asn Leu Val Ser1 5 1013914PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 139Thr Gly Thr Ser Ser Asp Val Gly Lys Tyr Asn Leu Val Ser1 5 1014014PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 140Thr Gly Thr Ser Ser Asp Val Gly Gly Tyr Asn Leu Val Ser1 5 1014114PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 141Thr Gly Thr Ser Ser Asp Val Gly Ser Tyr Asn Leu Leu Ser1 5 1014214PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 142Thr Gly Thr Ser Ser Asp Val Gly Gly Tyr Asn Leu Val Ser1 5 1014314PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 143Thr Gly Thr Ser Ser Asp Val Gly Ser Tyr Ser Leu Val Ser1 5 1014414PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 144Thr Gly Thr Ser Ser Asp Val Gly Ser Tyr Ser Leu Val Ser1 5 101457PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 145Glu Gly Thr Lys Arg Pro Ser1 51467PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 146Glu Gly Ile Lys Arg Pro Ser1 51477PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 147Glu Gly Thr Lys Arg Pro Ser1 51487PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 148Glu Gly Ser Gln Arg Pro Ser1 51497PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 149Glu Ala Ser Lys Arg Pro Ser1 51507PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 150Glu Gly Ile Lys Arg Pro Ser1 51517PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 151Glu Gly Asn Lys Arg Pro Ser1 51527PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 152Glu Gly Ser Lys Arg Pro Ser1 51537PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 153Glu Gly Ser Asn Arg Pro Ser1 51547PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 154Glu Gly Thr Lys Arg Pro Ser1 51557PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 155Glu Gly Thr Lys Arg Pro Ser1 51567PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 156Glu Gly Thr Lys Arg Pro Ser1 51577PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 157Glu Gly Gly Lys Arg Pro Ser1 51587PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 158Glu Gly Thr Lys Arg Pro Ser1 51597PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 159Glu Gly Thr Asn Arg Pro Ser1 51607PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 160Glu Gly Thr Lys Arg Pro Ser1 51617PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 161Glu Gly Thr Lys Arg Pro Ser1 51627PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 162Glu Gly Thr Lys Arg Pro Ser1 51637PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 163Glu Gly Thr Lys Arg Pro Ser1 51647PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 164Glu Gly Thr Lys Arg Pro Ser1 51657PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 165Glu Gly Asn Lys Arg Pro Ser1 51667PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 166Glu Gly Ser Gln Arg Pro Ser1 51677PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 167Glu Gly Asn Lys Arg Pro Ser1 51687PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 168Glu Gly Asn Lys Arg Pro Ser1 51697PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 169Glu Ala Ser Lys Arg Pro Ser1 51707PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 170Glu Gly Thr Lys Arg Pro Ser1 51717PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 171Glu Gly Ser Arg Arg Pro Ser1 51727PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 172Glu Gly Ser Gln Arg Pro Ser1 51737PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 173Glu Gly Ser Arg Arg Pro Ser1 51747PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 174Glu Gly Thr Lys Arg Pro Ser1 51757PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 175Glu Gly Ser Gln Arg Pro Ser1 51767PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 176Glu Gly Asn Lys Arg Pro Ser1 51777PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 177Glu Ala Ser Lys Arg Pro Ser1 51787PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 178Glu Ala Ser Lys Arg Pro Ser1 51797PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 179Glu Gly Thr Lys Arg Pro Ser1 51807PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 180Glu Gly Asp Lys Arg Pro Ser1 518112PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 181Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1018213PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 182Cys Cys Ser Tyr Ala Gly Ser Ser Ser Phe Val Val Phe1 5 1018313PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 183Cys Cys Ser Tyr Ala Gly Ser Ser Ser Phe Val Val Phe1 5 1018413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 184Cys Cys Ser Tyr Ala Gly Ser Ser Ser Phe Val Val Phe1 5 1018513PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 185Cys Cys Ser Tyr Ala Gly Ser Tyr Thr Phe Ala Val Phe1 5 1018613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 186Cys Cys Ser Tyr Ala Gly Ser Ser Ser Phe Val Val Phe1 5 1018713PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 187Cys Cys Ser Tyr Ala Gly Ser Ser Thr Phe Val Val Phe1 5 1018812PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 188Cys Cys Ser Tyr Ala Gly Ser Arg Tyr Val Val Phe1 5 1018913PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 189Cys Cys Ser Tyr Ala Gly Ser Ser Ser Phe Val Val Phe1 5 1019013PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 190Cys Cys Ser Tyr Ala Gly Ser Ser Ser Phe Val Val Phe1 5 1019113PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 191Cys Cys Ser Tyr Ala Gly Ser Ser Ser Phe Val Val Phe1 5 1019213PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 192Cys Cys Ser Tyr Ala Gly Ser Ser Ser Phe Val Val Phe1 5 1019312PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 193Cys Cys Ser Tyr Ala Ser Ser Ser Thr Leu Val Phe1 5 1019413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 194Cys Cys Ser Tyr Ala Gly Ser Ser Ser Phe Val Val Phe1 5 1019512PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 195Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1019612PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 196Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1019712PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 197Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1019812PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 198Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1019912PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 199Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1020012PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 200Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1020110PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 201Cys Cys Ser Tyr Ala Gly Ser Val Val Phe1 5 1020211PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 202Cys Cys Ser Tyr Ala Gly Ser Ser Thr Val Phe1 5 1020311PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 203Cys Cys Ser Tyr Ala Gly Ser Tyr Thr Val Phe1 5 1020411PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 204Cys Cys Ser Tyr Ala Gly Gly Ser Val Val Phe1 5 1020511PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 205Cys Cys Ser Tyr Ala Gly Ser Ser Thr Val Phe1 5 1020613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 206Cys Cys Ser Phe Val Arg Ser Ser Ala His Val Val Phe1 5 1020713PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 207Cys Cys Ser Tyr Ala Gly Ser Tyr Thr His Tyr Val Phe1 5 1020813PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 208Cys Cys Ser Tyr Ala Gly Ser Ser Thr His Tyr Val Phe1 5 1020913PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 209Cys Cys Ser Tyr Ala Gly Ser Tyr Thr His Tyr Val Phe1 5 1021013PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 210Cys Cys Ser Tyr Ala Gly Ser Arg Thr Pro Val Val Phe1 5 1021113PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 211Cys Cys Ser Tyr Ala Gly Ser Arg Thr Pro Val Val Phe1 5 1021214PRTArtificial SequenceDescription of Artificial Sequence Synthetic

peptide 212Cys Cys Ser Tyr Ala Gly Ser Ser Thr Phe Pro Val Val Phe1 5 1021313PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 213Cys Cys Ser Tyr Ala Gly Ser Arg Thr Pro Val Val Phe1 5 1021413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 214Cys Cys Ser Tyr Ala Gly Ser Tyr Ile Pro Val Val Phe1 5 1021513PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 215Cys Cys Ser Tyr Ala Gly Ser Tyr Ser Tyr Val Val Phe1 5 1021613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 216Cys Cys Ser Tyr Ala Gly Ser Tyr Ser Tyr Val Val Phe1 5 102179PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 217Phe Thr Phe Ser Ser Tyr Thr Met Ser1 52189PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 218Phe Thr Phe Ser Ser Tyr Ala Met Asn1 52199PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 219Phe Thr Phe Ser Ser Tyr Ala Met Thr1 52209PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 220Phe Thr Phe Ser Asn Tyr Ala Met Ser1 52219PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 221Phe Thr Phe Ser Ser Tyr Ala Met Tyr1 52229PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 222Phe Thr Phe Ser Ser Tyr Ala Met Thr1 52239PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 223Ile Thr Phe Ser Ser Tyr Ala Met Ser1 52249PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 224Phe Thr Phe Ser Ser Gln Ala Met Ser1 52259PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 225Phe Thr Phe Ser Ser Gln Ala Met Ser1 52269PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 226Phe Thr Phe Ser Ser Tyr Ala Ile Ser1 52279PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 227Phe Thr Phe Ser Ser Tyr Asp Met Ser1 52289PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 228Phe Thr Phe Ser Ser Tyr Ala Met Asn1 52299PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 229Phe Thr Phe Ser Ser Gln Ala Met Ser1 52309PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 230Phe Thr Phe Ser Ser Tyr Asp Met Ser1 52319PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 231Phe Thr Phe Ser Ser Tyr Asp Met Ser1 52329PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 232Phe Thr Phe Ser Ser Tyr Ala Met Tyr1 52339PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 233Phe Thr Phe Ser Ser Tyr Ala Met Ile1 52349PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 234Phe Thr Phe Ser Ser Tyr Ala Met Asn1 52359PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 235Phe Thr Phe Ser Ser Tyr Ala Met Tyr1 52369PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 236Phe Thr Phe Ser Ser Gln Ala Met Ser1 52379PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 237Phe Thr Phe Ser Ser Tyr Gly Met Ser1 52389PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 238Phe Thr Phe Ser Ser Tyr Asp Met Ser1 52399PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 239Phe Thr Phe Ser Ser Tyr Ala Ile Ser1 52409PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 240Val Thr Phe Ser Ser Tyr Ala Met Ser1 52419PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 241Phe Thr Phe Ser Ser His Ala Met Ser1 52429PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 242Phe Thr Phe Thr Ser Tyr Ala Met Ser1 52439PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 243Phe Thr Phe Ser Ser Gln Ala Met Ser1 52449PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 244Ile Thr Phe Ser Ser Tyr Ala Met Ser1 52459PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 245Phe Thr Phe Ser Ser Gln Ala Met Ser1 52469PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 246Phe Thr Phe Ser Ser Tyr Ala Met Tyr1 52479PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 247Phe Thr Phe Ser Ser His Ala Met Tyr1 52489PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 248Ile Thr Phe Ser Ser Tyr Ala Met Ser1 52499PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 249Leu Thr Phe Ser Ser Tyr Ala Met Ser1 52509PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 250Phe Thr Phe Ser Ser Tyr Ala Met Thr1 52519PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 251Phe Thr Phe Ser Ser His Ala Met Tyr1 52529PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 252Phe Thr Phe Ser Ser Tyr Ala Met Tyr1 52539PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 253Phe Thr Phe Ser Ser His Ala Met Ser1 52549PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 254Phe Thr Phe Ser Ser Tyr Asp Met Ser1 52559PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 255Phe Thr Phe Thr Ser Tyr Ala Met Tyr1 52569PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 256Phe Thr Phe Ser Asp Tyr Ala Met Asn1 52579PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 257Ile Thr Phe Ser Ser His Ala Met Ser1 52589PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 258Phe Thr Phe Ser Ser Tyr Ala Met Ser1 52599PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 259Phe Thr Phe Ser Asn Tyr Ala Met Ser1 52609PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 260Phe Thr Phe Ser Ser Tyr Thr Met Ser1 52619PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 261Phe Thr Phe Ser Ser Tyr Ala Met Tyr1 52629PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 262Phe Thr Phe Ser Ser Tyr Ala Met Ala1 52639PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 263Phe Thr Phe Ser Ser Tyr Ala Met Tyr1 52649PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 264Phe Thr Phe Ser Ser Tyr Ala Met Thr1 52659PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 265Phe Thr Phe Ser Ser Tyr Ala Met Gly1 52669PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 266Phe Thr Phe Ser Ser Tyr Ala Met Asn1 52679PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 267Phe Thr Phe Ser Ser Tyr Ala Met Tyr1 52689PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 268Phe Thr Phe Ser Ser Tyr Ala Val Ser1 52699PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 269Phe Arg Phe Ser Ser Tyr Ala Met Ser1 52709PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 270Phe Met Phe Ser Ser Tyr Ala Met Ser1 52719PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 271Phe Ala Phe Ser Ser Tyr Ala Met Ser1 52729PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 272Phe Thr Phe Thr Ser Tyr Ala Met Asn1 52739PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 273Ile Thr Phe Ser Ser Tyr Ala Met Ser1 52749PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 274Phe Thr Phe Ser Ser Tyr Ala Met Tyr1 52759PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 275Phe Thr Phe Ser Ser Tyr Asp Met Ser1 52769PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 276Phe Thr Phe Ser Ser Gln Ala Met Ser1 52779PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 277Phe Thr Phe Ser Ser Gln Ala Met Ser1 52789PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 278Phe Thr Phe Ser Ser Tyr Ala Met Ser1 52799PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 279Phe Thr Phe Thr Ser Tyr Ala Met Ser1 52809PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 280Phe Thr Phe Ser Ser Tyr Asp Met Ser1 52819PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 281Phe Thr Phe Ser Ser His Ala Met Ser1 52829PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 282Phe Thr Phe Thr Ser Tyr Ala Met Ser1 528313PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 283Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1028413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 284Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1028513PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 285Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala1 5 1028613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 286Ser Asp Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1028713PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 287Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 1028813PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 288Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala1 5 1028913PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 289Ser Gly Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1029013PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 290Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala1 5 1029113PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 291Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala1 5 1029213PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 292Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1029313PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 293Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1029413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 294Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala1 5 1029513PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 295Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala1 5 1029613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 296Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1029713PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 297Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1029813PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 298Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala1 5 1029913PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 299Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala1 5 1030013PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 300Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1030113PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 301Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 1030213PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 302Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala1 5 1030313PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 303Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala1 5 1030413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 304Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1030513PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 305Ser Ala Ile Ser Gly Ser Gly Tyr Ser Thr Tyr Tyr Ala1 5 1030613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 306Ser Ala Ile Thr Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1030713PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 307Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 1030813PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 308Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1030913PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 309Thr Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala1 5 1031013PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 310Ser Gly Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1031113PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 311Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala1 5 1031213PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 312Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 1031313PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 313Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 1031413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 314Ser Gly Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1031513PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 315Ser Asp Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1031613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 316Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala1 5 1031713PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 317Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 1031813PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 318Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 1031913PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 319Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 1032013PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 320Ser Ala Ile Ser Gly Ser Gly Gly Thr Thr Tyr Tyr Ala1 5 1032113PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 321Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 1032213PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 322Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1032313PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 323Ser Gly Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1032413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 324Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1032513PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 325Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5

1032613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 326Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1032713PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 327Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 1032813PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 328Ser Ala Ile Ser Gly Ser Gly Ser Ser Thr Tyr Tyr Ala1 5 1032913PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 329Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 1033013PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 330Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala1 5 1033113PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 331Ser Ala Ile Ser Thr Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1033213PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 332Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1033313PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 333Ser Ala Ile Ser Ser Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1033413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 334Ser Asp Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1033513PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 335Ser Ala Ile Ser Gly Ser Gly Gly Thr Thr Tyr Tyr Ala1 5 1033613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 336Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Thr1 5 1033713PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 337Ser Ala Ile Ser Gly Ser Gly Gly Asp Thr Tyr Tyr Ala1 5 1033813PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 338Thr Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala1 5 1033913PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 339Ser Gly Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1034013PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 340Thr Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala1 5 1034113PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 341Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1034213PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 342Thr Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala1 5 1034313PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 343Thr Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala1 5 1034413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 344Ser Ile Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 1034513PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 345Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1034613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 346Ser Ala Ile Ser Gly Ser Gly Gly Thr Thr Tyr Tyr Ala1 5 1034713PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 347Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala1 5 1034813PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 348Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala1 5 1034916PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 349Cys Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp1 5 10 1535016PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 350Cys Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp1 5 10 1535113PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 351Cys Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp1 5 1035219PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 352Cys Val Lys Gly Thr Ile Pro Ile Phe Gly Val Ile Arg Ser Ala Phe1 5 10 15Asp Tyr Trp35318PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 353Cys Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp1 5 10 15Pro Trp35412PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 354Cys Ala Ser Ser Ser Ser Trp Gln Phe Asp Tyr Trp1 5 1035522PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 355Cys Ala Lys His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys1 5 10 15Tyr Tyr Phe Asp Tyr Trp 2035613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 356Cys Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp1 5 1035713PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 357Cys Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp1 5 1035816PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 358Cys Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp1 5 10 1535914PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 359Cys Ala Lys Gly Pro Leu Val Gly Trp Tyr Phe Asp Leu Trp1 5 1036013PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 360Cys Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp1 5 1036113PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 361Cys Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp1 5 1036214PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 362Cys Ala Lys Gly Pro Leu Val Gly Trp Tyr Phe Asp Leu Trp1 5 1036314PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 363Cys Ala Lys Gly Pro Leu Val Gly Trp Tyr Phe Asp Leu Trp1 5 1036413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 364Cys Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp1 5 1036513PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 365Cys Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp1 5 1036616PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 366Cys Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp1 5 10 1536718PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 367Cys Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp1 5 10 15Pro Trp36813PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 368Cys Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp1 5 1036912PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 369Cys Ala Ser Ser Ser Ser Trp Gln Phe Asp Tyr Trp1 5 1037014PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 370Cys Ala Lys Gly Pro Leu Val Gly Trp Tyr Phe Asp Leu Trp1 5 1037122PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 371Cys Ala Arg Gly Ala Pro Asp Ser Ser Gly Tyr Tyr Phe Gln Gly Glu1 5 10 15Val Tyr Phe Asp Tyr Trp 2037222PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 372Cys Ala Lys His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys1 5 10 15Tyr Tyr Phe Asp Tyr Trp 2037318PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 373Cys Ala Arg Asp Thr Lys Asp Phe Trp Ser Gly Tyr Cys Ile Phe Asp1 5 10 15Pro Trp37418PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 374Cys Ala Asn Asp Thr Asn Asp Phe Trp Phe Gly Tyr Trp Ile Phe Asp1 5 10 15Pro Trp37513PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 375Cys Ala Lys Asp Thr Ile Phe Gly Glu Phe Tyr Pro Trp1 5 1037622PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 376Cys Ala Asn His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys1 5 10 15Tyr Tyr Phe Asp Tyr Trp 2037713PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 377Cys Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp1 5 1037818PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 378Cys Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp1 5 10 15Pro Trp37918PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 379Cys Ala Arg Asp Thr Lys Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp1 5 10 15Pro Trp38022PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 380Cys Ala Lys His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys1 5 10 15Tyr Tyr Phe Asp Tyr Cys 2038119PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 381Cys Val Lys Gly Thr Ile Pro Ile Phe Gly Val Ile Arg Ser Ala Phe1 5 10 15Asp Tyr Trp38212PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 382Cys Ala Ser Ser Ser Ser Trp Gln Phe Asp Tyr Trp1 5 1038318PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 383Cys Ala His Asp Thr Lys Asp Phe Trp Ser Gly Tyr Cys Ile Phe Asp1 5 10 15Pro Trp3849PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 384Cys Ala Arg Asp Thr Asn Asp Phe Trp1 538518PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 385Cys Ala His Asp Thr Lys Asp Phe Trp Ser Gly Tyr Cys Ile Phe Asp1 5 10 15Pro Trp3869PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 386Cys Ala Arg Gly Pro Leu Asp Phe Trp1 538718PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 387Cys Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp1 5 10 15Pro Trp38816PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 388Cys Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp1 5 10 1538922PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 389Cys Ala Lys His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys1 5 10 15Tyr Tyr Phe Asp Tyr Trp 2039016PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 390Cys Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp1 5 10 1539118PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 391Cys Ala Arg Val Arg Gln Gly Leu Arg Arg Thr Trp Tyr Tyr Phe Asp1 5 10 15Tyr Trp39216PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 392Cys Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp1 5 10 1539318PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 393Cys Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp1 5 10 15Pro Trp39412PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 394Cys Ala Ser Ser Ser Ser Trp Gln Phe Asp Tyr Trp1 5 1039518PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 395Cys Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp1 5 10 15Pro Trp39613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 396Cys Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp1 5 1039715PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 397Cys Ala Lys Gly Leu Trp Phe Gly Gly Gly Gly Phe Asp Pro Trp1 5 10 1539816PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 398Cys Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp1 5 10 1539913PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 399Cys Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp1 5 1040019PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 400Cys Val Lys Gly Thr Ile Pro Ile Phe Gly Val Ile Arg Ser Ala Phe1 5 10 15Asp Tyr Trp40116PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 401Cys Ala Lys Asp Phe His Gly Ile Ala Ala Ala Gly Ile Asp Tyr Trp1 5 10 1540217PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 402Cys Ala Lys Asp Gly Ala Ser Gly Trp Pro Asn Trp His Phe Asp Leu1 5 10 15Trp40315PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 403Cys Ala His Ser Arg Asp Ser Ser Ser Trp Tyr Val Asp Tyr Trp1 5 10 1540413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 404Cys Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp1 5 1040522PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 405Cys Ala Lys His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys1 5 10 15Tyr Tyr Phe Asp Tyr Trp 2040613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 406Cys Thr Arg Pro Pro Tyr Gly Tyr Tyr Gly Asp Tyr Trp1 5 1040714PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 407Cys Ala Lys Gly Pro Leu Val Gly Trp Tyr Phe Asp Leu Trp1 5 1040813PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 408Cys Ala Lys Asp Thr Ile Phe Gly Glu Phe Tyr Pro Trp1 5 1040913PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 409Cys Ala Lys Asp Arg Lys Phe Gly Glu Phe Asp Pro Trp1 5 1041011PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 410Cys Ala Arg Asp Gly Tyr Lys Tyr Cys Leu Trp1 5 1041118PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 411Cys Ala Asn Asp Thr Ser Asp Phe Cys Phe Gly Tyr Trp Ile Phe Asp1 5 10 15Pro Trp4129PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 412Cys Ala Arg Gly Pro Leu Asp Phe Trp1 541318PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 413Cys Ala Arg Asp Thr Lys Asp Phe Trp Ser Gly Tyr Cys Ile Phe Asp1 5 10 15Pro Trp41418PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 414Cys Ala Asn Asp Thr Asn Asp Phe Trp Phe Gly Tyr Trp Ile Phe Asp1 5 10 15Pro Trp41514PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 415Thr Gly Thr Ser Ser Asp Val Gly Ser Asn Asn Leu Val Ser1 5 1041614PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 416Thr Gly Thr Ser Thr Asp Val Gly Ser Tyr Asn Leu Val Ser1 5 1041714PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 417Thr Gly Thr Ser Arg Asp Val Gly Ser Tyr Asn Leu Val Ser1 5 1041814PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 418Thr Gly Thr Ser Ser Asp Val Gly Ser Tyr Ser Leu Val Ser1

5 1041914PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 419Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1042014PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 420Thr Gly Thr Ser Ser Tyr Val Gly His Tyr Asn Leu Val Ser1 5 1042114PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 421Thr Gly Thr Ser Ser Asp Val Gly His Tyr Asn Leu Val Ser1 5 1042214PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 422Thr Gly Thr Ser Ser Gly Val Gly Ser Tyr Asn Leu Val Ser1 5 1042314PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 423Thr Gly Ile Ser Ser Asp Val Gly Ser Tyr Asn Leu Val Ser1 5 1042414PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 424Thr Gly Thr Ser Asn Asp Val Gly Ser Tyr Asn Leu Val Ser1 5 1042514PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 425Thr Gly Thr Ser Ser Asp Phe Gly Ser Tyr Asn Leu Val Ser1 5 1042614PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 426Thr Gly Thr Ser Ser Asp Val Gly Lys Tyr Asn Leu Val Ser1 5 1042714PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 427Thr Gly Thr Ser Ser Asp Val Gly Thr Tyr Asn Leu Val Ser1 5 1042814PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 428Thr Gly Thr Ser Asn Asp Val Gly Ser Tyr Asn Leu Val Ser1 5 1042914PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 429Thr Gly Thr Ser Ser Asp Val Gly Asp Tyr Asn Leu Val Ser1 5 1043014PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 430Thr Gly Thr Ser Ser Asp Val Gly Gly Tyr Asn Leu Val Ser1 5 1043114PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 431Thr Gly Thr Ser Ser Asp Val Gly Ser Tyr Asn Leu Leu Ser1 5 1043214PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 432Thr Gly Thr Ser Ser Asp Val Gly Tyr Tyr Asn Leu Val Ser1 5 1043314PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 433Thr Gly Thr Ser Ser Gly Val Gly Ser Tyr Asn Leu Val Ser1 5 1043414PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 434Thr Gly Thr Ser Ser Gly Val Gly Ser Tyr Asn Leu Val Ser1 5 1043514PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 435Thr Gly Thr Ser Ser Asn Val Gly Ser Tyr Asn Leu Val Ser1 5 1043614PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 436Thr Gly Thr Ser Ser Asp Val Gly Gly Tyr Asn Leu Val Ser1 5 1043714PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 437Thr Gly Thr Ser Ser Asp Val Gly Arg Tyr Asn Leu Val Ser1 5 1043814PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 438Thr Gly Thr Ser Ser Asp Val Gly His Tyr Asn Leu Val Ser1 5 1043914PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 439Thr Gly Thr Ser Ser Gly Val Gly Ser Tyr Asn Leu Val Ser1 5 1044014PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 440Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1044114PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 441Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1044214PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 442Thr Gly Thr Ser Ser Asp Val Gly His Tyr Asn Leu Val Ser1 5 1044314PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 443Thr Gly Thr Ser Ser Asp Val Gly Ser Tyr Ser Leu Val Ser1 5 1044414PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 444Thr Gly Thr Ser Ser Tyr Val Gly His Tyr Asn Leu Val Ser1 5 1044514PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 445Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1044614PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 446Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1044714PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 447Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1044814PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 448Ser Gly Thr Ser Ser Asp Val Gly Ser Tyr Asn Leu Val Ser1 5 1044914PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 449Thr Gly Thr Ser Ser Asp Val Gly Ser Tyr Asp Leu Val Ser1 5 1045014PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 450Thr Gly Thr Ser Ser Asp Val Gly Ser Ser Asn Leu Val Ser1 5 1045114PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 451Thr Gly Thr Ser Thr Asp Val Gly Ser Tyr Asn Leu Val Ser1 5 1045214PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 452Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1045314PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 453Thr Gly Thr Ser Ser Asp Leu Gly Ser Tyr Asn Ile Val Ser1 5 1045414PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 454Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1045514PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 455Thr Gly Thr Ser Ser Asp Val Gly Lys Tyr Asn Leu Val Ser1 5 1045614PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 456Thr Gly Thr Arg Ser Asp Val Gly Ser Tyr Asn Leu Val Ser1 5 1045714PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 457Thr Gly Thr Ser Ser Asp Val Gly Ser Phe Asn Leu Val Ser1 5 1045814PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 458Thr Gly Thr Ser Ser Asp Val Gly Gly Tyr Asn Leu Val Ser1 5 1045914PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 459Thr Gly Thr Ser Ser Asp Val Gly Ser Tyr Ser Leu Val Ser1 5 1046014PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 460Thr Gly Thr Ser Ser Asp Val Gly Ser His Asn Leu Val Ser1 5 1046114PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 461Thr Gly Thr Ser Ser Asp Val Gly Ser Tyr Tyr Leu Val Ser1 5 1046214PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 462Thr Gly Thr Ser Ser Gly Val Gly Ser Tyr Asn Leu Val Ser1 5 1046314PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 463Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1046414PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 464Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1046514PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 465Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1046614PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 466Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1046714PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 467Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1046814PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 468Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1046914PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 469Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1047014PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 470Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1047114PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 471Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1047214PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 472Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 1047314PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 473Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr Asn Leu Val Ser1 5 104747PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 474Glu Gly Asn Lys Arg Pro Ser1 54757PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 475Glu Gly Ser Gln Arg Pro Ser1 54767PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 476Glu Gly Thr Lys Arg Pro Ser1 54777PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 477Glu Gly Thr Lys Arg Pro Ser1 54787PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 478Glu Gly Thr Lys Arg Pro Ser1 54797PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 479Glu Gly Ser Arg Arg Pro Ser1 54807PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 480Glu Gly Thr Lys Arg Pro Ser1 54817PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 481Glu Gly Ile Lys Arg Pro Ser1 54827PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 482Glu Gly Thr Lys Arg Pro Ser1 54837PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 483Glu Gly Asn Lys Arg Pro Ser1 54847PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 484Glu Gly Asn Lys Arg Pro Ser1 54857PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 485Glu Gly Ser Gln Arg Pro Ser1 54867PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 486Glu Gly Ser Gln Arg Pro Ser1 54877PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 487Glu Gly Ser Lys Arg Pro Ser1 54887PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 488Glu Gly Ser Asn Arg Pro Ser1 54897PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 489Glu Gly Asn Lys Arg Pro Ser1 54907PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 490Glu Ala Ser Lys Arg Pro Ser1 54917PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 491Glu Gly Asn Lys Arg Pro Ser1 54927PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 492Glu Ala Ser Lys Arg Pro Ser1 54937PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 493Glu Gly Ser Gln Arg Pro Ser1 54947PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 494Glu Gly Thr Lys Arg Pro Ser1 54957PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 495Glu Gly Thr Lys Arg Pro Ser1 54967PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 496Glu Gly Gly Lys Arg Pro Ser1 54977PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 497Glu Gly Thr Lys Arg Pro Ser1 54987PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 498Glu Gly Ile Lys Arg Pro Ser1 54997PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 499Glu Gly Thr Lys Arg Pro Ser1 55007PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 500Glu Gly Thr Asn Arg Pro Ser1 55017PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 501Glu Gly Thr Lys Arg Pro Ser1 55027PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 502Glu Gly Asp Lys Arg Pro Ser1 55037PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 503Glu Gly Ser Arg Arg Pro Ser1 55047PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 504Glu Gly Thr Lys Arg Pro Ser1 55057PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 505Glu Gly Thr Lys Arg Pro Ser1 55067PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 506Glu Gly Thr Lys Arg Pro Ser1 55077PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 507Glu Ala Ser Lys Arg Pro Ser1 55087PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 508Glu Gly Asn Lys Arg Pro Ser1 55097PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 509Glu Gly Ser Lys Arg Pro Ser1 55107PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 510Glu Gly Thr Lys Arg Pro Ser1 55117PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 511Glu Gly Thr Lys Arg Pro Ser1 55127PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 512Glu Gly Ser Arg Arg Pro Ser1 55137PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 513Glu Gly Thr Lys Arg Pro Ser1 55147PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 514Glu Gly Val Lys Arg Pro Ser1 55157PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 515Glu Val Ser Lys Arg Pro Ser1 55167PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 516Glu Val Ser Lys Arg Pro Ser1 55177PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 517Glu Ala Ser Lys Arg Pro Ser1 55187PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 518Glu Gly Gly Lys Arg Pro Ser1 55197PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 519Glu Gly Gly Lys Arg Pro Ser1 55207PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 520Glu Gly Asp Lys Arg Pro Ser1 55217PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 521Ala Gly Ser Lys Arg Pro Ser1 55227PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 522Glu Gly Thr Lys Arg Pro Ser1 55237PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 523Glu Gly Thr Lys Arg Pro Ser1 55247PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 524Glu Gly Thr Lys Arg Pro Ser1 55257PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 525Glu Gly Thr Lys Arg Pro Ser1 55267PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 526Glu Gly Thr Lys Arg Pro Ser1 55277PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 527Glu Gly Thr Lys Arg Pro Ser1 55287PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 528Glu Gly Thr Lys Arg Pro Ser1 55297PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 529Glu Gly Thr Lys Arg Pro Ser1 55307PRTArtificial SequenceDescription of Artificial Sequence Synthetic

peptide 530Glu Gly Thr Lys Arg Pro Ser1 55317PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 531Glu Gly Thr Lys Arg Pro Ser1 55327PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 532Glu Gly Thr Lys Arg Pro Ser1 553310PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 533Cys Cys Ser Tyr Ala Gly Ser Val Val Phe1 5 1053411PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 534Cys Cys Ser Tyr Ala Gly Ser Ser Thr Val Phe1 5 1053513PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 535Cys Cys Ser Tyr Ala Gly Ser Arg Thr Pro Val Val Phe1 5 1053613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 536Cys Cys Ser Tyr Ala Gly Ser Tyr Ser Tyr Val Val Phe1 5 1053712PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 537Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1053813PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 538Cys Cys Ser Tyr Ala Gly Ser Tyr Thr His Tyr Val Phe1 5 1053913PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 539Cys Cys Ser Tyr Ala Gly Ser Ser Ser Phe Val Val Phe1 5 1054013PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 540Cys Cys Ser Tyr Ala Gly Ser Ser Ser Phe Val Val Phe1 5 1054113PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 541Cys Cys Ser Tyr Ala Gly Ser Ser Ser Phe Val Val Phe1 5 1054211PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 542Cys Cys Ser Tyr Ala Gly Ser Tyr Thr Val Phe1 5 1054313PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 543Cys Cys Ser Tyr Ala Gly Ser Ser Thr Phe Val Val Phe1 5 1054413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 544Cys Cys Ser Tyr Ala Gly Ser Arg Thr Pro Val Val Phe1 5 1054513PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 545Cys Cys Ser Tyr Ala Gly Ser Ser Ser Phe Val Val Phe1 5 1054612PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 546Cys Cys Ser Tyr Ala Gly Ser Arg Tyr Val Val Phe1 5 1054713PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 547Cys Cys Ser Tyr Ala Gly Ser Ser Ser Phe Val Val Phe1 5 1054814PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 548Cys Cys Ser Tyr Ala Gly Ser Ser Thr Phe Pro Val Val Phe1 5 1054913PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 549Cys Cys Ser Tyr Ala Gly Ser Arg Thr Pro Val Val Phe1 5 1055011PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 550Cys Cys Ser Tyr Ala Gly Gly Ser Val Val Phe1 5 1055113PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 551Cys Cys Ser Tyr Ala Gly Ser Tyr Thr Phe Ala Val Phe1 5 1055213PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 552Cys Cys Ser Tyr Ala Gly Ser Ser Thr His Tyr Val Phe1 5 1055313PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 553Cys Cys Ser Tyr Ala Gly Ser Ser Ser Phe Val Val Phe1 5 1055413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 554Cys Cys Ser Phe Val Arg Ser Ser Ala His Val Val Phe1 5 1055512PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 555Cys Cys Ser Tyr Ala Ser Ser Ser Thr Leu Val Phe1 5 1055613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 556Cys Cys Ser Tyr Ala Gly Ser Ser Ser Phe Val Val Phe1 5 1055713PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 557Cys Cys Ser Tyr Ala Gly Ser Ser Ser Phe Val Val Phe1 5 1055812PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 558Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1055912PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 559Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1056013PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 560Cys Cys Ser Tyr Ala Gly Ser Ser Ser Phe Val Val Phe1 5 1056113PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 561Cys Cys Ser Tyr Ala Gly Ser Tyr Ser Tyr Val Val Phe1 5 1056213PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 562Cys Cys Ser Tyr Ala Gly Ser Tyr Thr His Tyr Val Phe1 5 1056312PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 563Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1056412PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 564Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1056512PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 565Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1056611PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 566Cys Cys Ser Tyr Ala Gly Ser Ser Thr Val Phe1 5 1056711PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 567Cys Cys Ser Tyr Ala Gly Ser Ser Val Val Phe1 5 1056811PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 568Cys Cys Ser Tyr Ala Gly Ser Leu Tyr Val Phe1 5 1056913PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 569Cys Cys Ser Tyr Ala Gly Ser Tyr Thr Ser Val Val Phe1 5 1057012PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 570Cys Cys Tyr His Ser Arg Thr Arg Thr His Val Phe1 5 1057113PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 571Cys Cys Ser Tyr Ala Gly Ser Tyr Thr His Tyr Val Phe1 5 1057212PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 572Cys Cys Tyr His Ser Arg Thr Arg Thr His Val Ser1 5 1057313PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 573Cys Cys Ser Tyr Ala Gly Ser Arg Thr Pro Val Val Phe1 5 1057413PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 574Cys Cys Ser Tyr Ala Gly Asp Ser Phe Pro Tyr Val Phe1 5 1057511PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 575Cys Cys Ser Tyr Ala Gly Ser Ser Val Val Phe1 5 1057613PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 576Cys Cys Ser Tyr Ala Gly Ser Tyr Ile Pro Val Val Phe1 5 1057713PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 577Cys Cys Ser Tyr Ala Gly Ser Tyr Ser Tyr Val Val Phe1 5 1057812PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 578Cys Cys Ser Tyr Ser Gly Arg Tyr Thr Tyr Val Phe1 5 1057912PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 579Cys Cys Ser His Ala Gly Arg Tyr Pro Tyr Val Phe1 5 1058014PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 580Cys Cys Ser Tyr Leu Gly Ser Gly Thr Phe Asp Val Leu Phe1 5 1058112PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 581Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1058212PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 582Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1058312PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 583Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1058412PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 584Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1058512PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 585Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1058612PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 586Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1058712PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 587Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1058812PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 588Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1058912PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 589Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1059012PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 590Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 1059112PRTArtificial SequenceDescription of Artificial Sequence Synthetic peptide 591Cys Cys Ser Tyr Ala Gly Ser Arg Thr Tyr Val Phe1 5 10592121PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 592Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Thr Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115 120593121PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 593Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115 120594118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 594Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Thr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115595124PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 595Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Asp Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Val Lys Gly Thr Ile Pro Ile Phe Gly Val Ile Arg Ser Ala Phe Asp 100 105 110Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120596123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 596Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120597117PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 597Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Thr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ser Ser Ser Ser Trp Gln Phe Asp Tyr Trp Gly Gln Gly Thr Leu 100 105 110Val Thr Val Ser Ser 115598127PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 598Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ile Thr Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Gly Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys Tyr 100 105 110Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 125599118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 599Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Gln 20 25

30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115600118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 600Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Gln 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115601121PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 601Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Ile Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115 120602119PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 602Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Asp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Gly Pro Leu Val Gly Trp Tyr Phe Asp Leu Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser 115603118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 603Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115604118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 604Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Gln 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115605119PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 605Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Asp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Gly Pro Leu Val Gly Trp Tyr Phe Asp Leu Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser 115606119PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 606Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Asp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Gly Pro Leu Val Gly Trp Tyr Phe Asp Leu Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser 115607118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 607Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115608118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 608Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Ile Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115609121PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 609Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115 120610123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 610Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120611118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 611Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Gln 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115612117PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 612Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Gly Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ser Ser Ser Ser Trp Gln Phe Asp Tyr Trp Gly Gln Gly Thr Leu 100 105 110Val Thr Val Ser Ser 115613119PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 613Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Asp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Gly Pro Leu Val Gly Trp Tyr Phe Asp Leu Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser 115614127PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 614Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Ile Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Tyr Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Gly Ala Pro Asp Ser Ser Gly Tyr Tyr Phe Gln Gly Glu Val 100 105 110Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 125615127PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 615Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Val Thr Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Thr Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys Tyr 100 105 110Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 125616123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 616Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser His 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Lys Asp Phe Trp Ser Gly Tyr Cys Ile Phe Asp Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120617123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 617Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Asn Asp Thr Asn Asp Phe Trp Phe Gly Tyr Trp Ile Phe Asp Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120618118PRTArtificial

SequenceDescription of Artificial Sequence Synthetic polypeptide 618Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Gln 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Thr Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Asp Thr Ile Phe Gly Glu Phe Tyr Pro Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115619127PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 619Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ile Thr Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Gly Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Asn His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys Tyr 100 105 110Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 125620118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 620Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Gln 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115621123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 621Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120622123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 622Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser His 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Lys Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120623127PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 623Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ile Thr Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Gly Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys Tyr 100 105 110Tyr Phe Asp Tyr Cys Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 125624124PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 624Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Leu Thr Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Asp Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Val Lys Gly Thr Ile Pro Ile Phe Gly Val Ile Arg Ser Ala Phe Asp 100 105 110Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120625117PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 625Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Thr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ser Ser Ser Ser Trp Gln Phe Asp Tyr Trp Gly Gln Gly Thr Leu 100 105 110Val Thr Val Ser Ser 115626123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 626Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser His 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala His Asp Thr Lys Asp Phe Trp Ser Gly Tyr Cys Ile Phe Asp Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120627114PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 627Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Asn Asp Phe Trp Gly Gln Gly Thr Leu Val Thr Val 100 105 110Ser Ser628123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 628Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser His 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala His Asp Thr Lys Asp Phe Trp Ser Gly Tyr Cys Ile Phe Asp Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120629114PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 629Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Asp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Thr Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Gly Pro Leu Asp Phe Trp Gly Gln Gly Thr Leu Val Thr Val 100 105 110Ser Ser630123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 630Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Ser Tyr 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120631121PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 631Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asp Tyr 20 25 30Ala Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115 120632127PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 632Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ile Thr Phe Ser Ser His 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Gly Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys Tyr 100 105 110Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 125633121PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 633Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115 120634123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 634Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Val Arg Gln Gly Leu Arg Arg Thr Trp Tyr Tyr Phe Asp Tyr 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120635121PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 635Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Thr Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115 120636123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 636Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser

Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120637117PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 637Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Ala Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Ser Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ser Ser Ser Ser Trp Gln Phe Asp Tyr Trp Gly Gln Gly Thr Leu 100 105 110Val Thr Val Ser Ser 115638123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 638Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120639118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 639Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Thr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115640120PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 640Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Gly Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Thr Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Gly Leu Trp Phe Gly Gly Gly Gly Phe Asp Pro Trp Gly Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser 115 120641121PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 641Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115 120642118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 642Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Ser Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115643124PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 643Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Val Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Asp Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Val Lys Gly Thr Ile Pro Ile Phe Gly Val Ile Arg Ser Ala Phe Asp 100 105 110Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120644121PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 644Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Arg Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Thr Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Asp Phe His Gly Ile Ala Ala Ala Gly Ile Asp Tyr Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115 120645122PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 645Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Met Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Thr Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Asp Gly Ala Ser Gly Trp Pro Asn Trp His Phe Asp Leu Trp 100 105 110Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120646120PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 646Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Ala Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Asp Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala His Ser Arg Asp Ser Ser Ser Trp Tyr Val Asp Tyr Trp Gly Gln 100 105 110Gly Thr Leu Val Thr Val Ser Ser 115 120647118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 647Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Ser Tyr 20 25 30Ala Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Thr Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115648127PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 648Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ile Thr Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Gly Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys Tyr 100 105 110Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 125649118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 649Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Thr Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Thr Arg Pro Pro Tyr Gly Tyr Tyr Gly Asp Tyr Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115650119PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 650Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Asp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Gly Pro Leu Val Gly Trp Tyr Phe Asp Leu Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser 115651118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 651Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Gln 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Thr Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Asp Thr Ile Phe Gly Glu Phe Tyr Pro Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115652118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 652Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Gln 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Thr Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Asp Arg Lys Phe Gly Glu Phe Asp Pro Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115653116PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 653Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ile Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Gly Tyr Lys Tyr Cys Leu Trp Gly Gln Gly Thr Leu Val 100 105 110Thr Val Ser Ser 115654123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 654Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Asn Asp Thr Ser Asp Phe Cys Phe Gly Tyr Trp Ile Phe Asp Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120655114PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 655Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1

5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Asp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Thr Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Gly Pro Leu Asp Phe Trp Gly Gln Gly Thr Leu Val Thr Val 100 105 110Ser Ser656123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 656Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser His 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Lys Asp Phe Trp Ser Gly Tyr Cys Ile Phe Asp Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120657123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 657Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Asn Asp Thr Asn Asp Phe Trp Phe Gly Tyr Trp Ile Phe Asp Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120658108PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 658Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Ser Asn 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Asn Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105659109PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 659Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Thr Asp Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Gln Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Thr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105660111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 660Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Arg Asp Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Pro Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110661111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 661Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Ser Tyr 20 25 30Ser Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Ser Tyr Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110662110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 662Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110663111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 663Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Tyr Val Gly His Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Arg Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Thr His Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110664111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 664Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly His Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Ser Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110665111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 665Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Gly Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ile Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Ser Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110666111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 666Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Ile Ser Ser Asp Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Ser Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110667109PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 667Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Asn Asp Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Asn Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Thr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105668111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 668Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Phe Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Asn Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Thr Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110669111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 669Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Lys Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Gln Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Pro Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110670111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 670Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Thr Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Gln Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Ser Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110671110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 671Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Asn Asp Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Tyr Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110672111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 672Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Asp Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Asn Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Ser Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110673112PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 673Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Gly Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Asn Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Thr Phe Pro Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110674111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 674Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Ser Tyr 20 25 30Asn Leu Leu Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Ala Ser Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Pro Val Val Phe Gly Gly Gly Thr Lys

Leu Thr Val Leu 100 105 110675109PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 675Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Tyr Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Asn Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Gly 85 90 95Ser Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105676111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 676Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Gly Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Ala Ser Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Thr Phe Ala Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110677111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 677Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Gly Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Gln Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Thr His Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110678111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 678Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asn Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Ser Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110679111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 679Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Gly Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Phe Val Arg Ser 85 90 95Ser Ala His Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110680110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 680Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Arg Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Gly Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Ser Ser 85 90 95Ser Thr Leu Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110681111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 681Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly His Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Ser Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110682111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 682Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Gly Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ile Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Ser Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110683110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 683Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110684110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 684Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Asn Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110685111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 685Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly His Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Ser Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110686111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 686Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Ser Tyr 20 25 30Ser Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Asp Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Ser Tyr Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110687111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 687Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Tyr Val Gly His Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Arg Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Thr His Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110688110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 688Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110689110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 689Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110690110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 690Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110691109PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 691Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Ser Gly Thr Ser Ser Asp Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Ala Ser Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Thr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105692109PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 692Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Ser Tyr 20 25 30Asp Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Asn Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105693109PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 693Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Ser Ser 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Leu Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105694111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 694Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Thr Asp Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90

95Tyr Thr Ser Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110695110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 695Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Tyr His Ser Arg Thr 85 90 95Arg Thr His Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110696111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 696Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Leu Gly Ser Tyr 20 25 30Asn Ile Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Arg Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Thr His Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110697111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 697Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Leu Gly Ser Tyr 20 25 30Asn Ile Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Arg Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Thr His Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110698111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 698Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Leu Gly Ser Tyr 20 25 30Asn Ile Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Arg Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Thr His Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110699111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 699Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Leu Gly Ser Tyr 20 25 30Asn Ile Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Arg Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Thr His Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110700111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 700Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Leu Gly Ser Tyr 20 25 30Asn Ile Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Arg Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Thr His Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110701111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 701Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Leu Gly Ser Tyr 20 25 30Asn Ile Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Arg Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Thr His Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110702111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 702Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Leu Gly Ser Tyr 20 25 30Asn Ile Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Arg Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Thr His Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110703110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 703Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Ser His 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Gly Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ser Gly Arg 85 90 95Tyr Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110704110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 704Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Ser Tyr 20 25 30Tyr Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Asp Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser His Ala Gly Arg 85 90 95Tyr Pro Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110705112PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 705Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Gly Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Ala Gly Ser Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Leu Gly Ser 85 90 95Gly Thr Phe Asp Val Leu Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110706110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 706Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110707110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 707Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110708110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 708Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110709110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 709Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110710110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 710Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110711110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 711Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110712110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 712Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110713110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 713Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110714110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 714Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65

70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110715110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 715Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110716110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 716Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110717121PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 717Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Thr Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115 120718121PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 718Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115 120719118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 719Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Thr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115720124PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 720Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Asp Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Val Lys Gly Thr Ile Pro Ile Phe Gly Val Ile Arg Ser Ala Phe Asp 100 105 110Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120721123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 721Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120722117PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 722Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Thr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ser Ser Ser Ser Trp Gln Phe Asp Tyr Trp Gly Gln Gly Thr Leu 100 105 110Val Thr Val Ser Ser 115723127PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 723Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ile Thr Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Gly Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys Tyr 100 105 110Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 125724118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 724Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Gln 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115725118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 725Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Gln 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115726121PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 726Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Ile Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115 120727119PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 727Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Asp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Gly Pro Leu Val Gly Trp Tyr Phe Asp Leu Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser 115728118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 728Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115729118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 729Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Gln 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115730119PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 730Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Asp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Gly Pro Leu Val Gly Trp Tyr Phe Asp Leu Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser 115731119PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 731Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Asp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Gly Pro Leu Val Gly Trp Tyr Phe Asp Leu Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser 115732118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 732Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115733118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 733Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Ile Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Ser Thr Phe Tyr Ala Asp Ser Val 50

55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115734121PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 734Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115 120735118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 735Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Gln 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115736117PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 736Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Gly Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ser Ser Ser Ser Trp Gln Phe Asp Tyr Trp Gly Gln Gly Thr Leu 100 105 110Val Thr Val Ser Ser 115737119PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 737Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Asp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Gly Pro Leu Val Gly Trp Tyr Phe Asp Leu Trp Gly Gln Gly 100 105 110Thr Leu Val Thr Val Ser Ser 115738127PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 738Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Ile Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Tyr Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Gly Ala Pro Asp Ser Ser Gly Tyr Tyr Phe Gln Gly Glu Val 100 105 110Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 125739127PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 739Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Val Thr Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Thr Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys Tyr 100 105 110Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 125740123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 740Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe His Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120741127PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 741Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ile Thr Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Gly Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Asn His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys Tyr 100 105 110Tyr Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 125742118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 742Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Gln 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys Asp Arg Arg Phe Gly Glu Phe Asp Pro Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115743123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 743Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120744123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 744Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser His 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Lys Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120745127PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 745Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Ile Thr Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Gly Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Lys His Gly Ser Gly Thr Ile Phe Gly Val Val Ile Ala Lys Tyr 100 105 110Tyr Phe Asp Tyr Cys Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 125746124PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 746Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Leu Thr Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Asp Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Val Lys Gly Thr Ile Pro Ile Phe Gly Val Ile Arg Ser Ala Phe Asp 100 105 110Tyr Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120747117PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 747Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Thr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Gly Gly Gly Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Ser Ser Ser Ser Trp Gln Phe Asp Tyr Trp Gly Gln Gly Thr Leu 100 105 110Val Thr Val Ser Ser 115748123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 748Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser His 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala His Asp Thr Lys Asp Phe Trp Ser Gly Tyr Cys Ile Phe Asp Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120749114PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 749Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Asn Asp Phe Trp Gly Gln Gly Thr Leu Val Thr Val 100 105 110Ser Ser750118PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 750Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Ser Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Thr Arg Pro Pro Tyr Gly Asp Tyr Gly Asp Tyr Trp Gly Gln Gly Thr 100 105 110Leu Val Thr Val Ser Ser 115751123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 751Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Thr Ser Tyr 20 25 30Ala Met Tyr Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Asp Thr Asn Asp Phe Trp Ser Gly Tyr Ser Ile Phe Asp Pro 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120752121PRTArtificial

SequenceDescription of Artificial Sequence Synthetic polypeptide 752Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asp Tyr 20 25 30Ala Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ile Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115 120753108PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 753Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Ser Asn 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Asn Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105754109PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 754Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Thr Asp Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Gln Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Thr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105755111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 755Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Arg Asp Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Pro Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110756111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 756Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Ser Tyr 20 25 30Ser Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Ser Tyr Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110757110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 757Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110758111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 758Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Tyr Val Gly His Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Arg Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Thr His Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110759111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 759Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly His Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Ser Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110760111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 760Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Gly Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ile Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Ser Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110761111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 761Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Ile Ser Ser Asp Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Ser Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110762109PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 762Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Asn Asp Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Asn Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Thr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105763111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 763Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Phe Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Asn Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Thr Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110764111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 764Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Lys Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Gln Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Pro Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110765111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 765Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Thr Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Gln Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Ser Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110766110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 766Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Asn Asp Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Tyr Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110767111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 767Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Asp Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Asn Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Ser Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110768112PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 768Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Gly Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Asn Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Thr Phe Pro Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110769111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 769Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Ser Tyr 20 25 30Asn Leu Leu Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Ala Ser Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Pro Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110770109PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 770Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Tyr Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Asn Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Gly 85 90 95Ser Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105771111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 771Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Gly Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Ala Ser Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Thr Phe Ala Val Phe Gly Gly Gly Thr Lys Leu Thr

Val Leu 100 105 110772111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 772Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Gly Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Gln Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Thr His Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110773111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 773Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asn Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Ser Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110774111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 774Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Gly Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Phe Val Arg Ser 85 90 95Ser Ala His Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110775110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 775Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Arg Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Gly Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Ser Ser 85 90 95Ser Thr Leu Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110776110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 776Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110777111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 777Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly His Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Ser Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110778111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 778Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Gly Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ile Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Ser Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110779110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 779Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110780110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 780Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Asn Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110781111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 781Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly His Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Ser Phe Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110782111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 782Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Ser Tyr 20 25 30Ser Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Asp Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Ser Tyr Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110783111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 783Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Tyr Val Gly His Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Arg Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Thr His Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110784110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 784Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110785110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 785Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110786111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 786Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Gly Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Ala Ser Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Ile Pro Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110787110PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 787Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Ile Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Arg Thr Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 110788109PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 788Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Ser Gly Thr Ser Ser Asp Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Ala Ser Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Thr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105789121PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 789Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115 120790123PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 790Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Asn Tyr 20 25 30Ala Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Ala Ile Ser Gly Ser Ala Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55 60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Val Arg Gln Gly Leu Arg Arg Thr Trp Tyr Tyr Phe Asp Tyr 100 105 110Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120791121PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 791Glu Val Gln Leu Leu Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30Thr Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45Ser Val Ile Ser Gly Ser Gly Gly Ser Thr Tyr Tyr Ala Asp Ser Val 50 55

60Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95Ala Arg Glu Gly Tyr Arg Asp Tyr Leu Trp Tyr Phe Asp Leu Trp Gly 100 105 110Gln Gly Thr Leu Val Thr Val Ser Ser 115 120792109PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 792Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Ser Tyr 20 25 30Asp Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Asn Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Ser Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105793109PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 793Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Ser Asp Val Gly Ser Ser 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Ser Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glu Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Leu Tyr Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105794111PRTArtificial SequenceDescription of Artificial Sequence Synthetic polypeptide 794Gln Ser Ala Leu Thr Gln Pro Ala Ser Val Ser Gly Ser Pro Gly Gln1 5 10 15Ser Ile Thr Ile Ser Cys Thr Gly Thr Ser Thr Asp Val Gly Ser Tyr 20 25 30Asn Leu Val Ser Trp Tyr Gln Gln His Pro Gly Lys Ala Pro Lys Leu 35 40 45Met Ile Tyr Glu Gly Thr Lys Arg Pro Ser Gly Val Ser Asn Arg Phe 50 55 60Ser Gly Ser Lys Ser Gly Asn Thr Ala Ser Leu Thr Ile Ser Gly Leu65 70 75 80Gln Ala Glx Asp Glu Ala Asp Tyr Tyr Cys Cys Ser Tyr Ala Gly Ser 85 90 95Tyr Thr Ser Val Val Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 11079562DNAArtificial SequenceDescription of Artificial Sequence Synthetic oligonucleotidemodified_base(51)..(52)Thymidine-succinyl hexamide CED phosphoramidite 795agacaatcaa ccatttgggg tggacagcct tgacctctag acttcggcat tttttttttt 60tt 62796112DNAArtificial SequenceDescription of Artificial Sequence Synthetic polynucleotidemodified_base(101)..(102)Thymidine-succinyl hexamide CED phosphoramidite 796cgggatcctt atcgtcatcg tcgtacagat cccgacccat ttgctgtcca ccagtcatgc 60tagccatacc atgatgatga tgatgatgag aaccccgcat tttttttttt tt 11279719DNAArtificial SequenceDescription of Artificial Sequence Synthetic primer 797atgcggggtt ctcatcatc 1979820DNAArtificial SequenceDescription of Artificial Sequence Synthetic primer 798cgggatcctt atcgtcatcg 20

Claims

1. An antibody or antibody fragment comprising a variable domain, heavy chain region (VH) and a variable domain, light chain region (VL), wherein VH comprises complementarity determining regions CDRH1, CDRH2, and CDRH3, wherein VL comprises complementarity determining regions CDRL1, CDRL2, and CDRL3, and wherein (a) an amino acid sequence of CDRH1 is as set forth in any one of SEQ ID NOs: 1-36 or 217-282; (b) an amino acid sequence of CDRH2 is as set forth in any one of SEQ ID NOs: 37-72 or 283-348; (c) an amino acid sequence of CDRH3 is as set forth in any one of SEQ ID NOs: 73-108 or 349-414; (d) an amino acid sequence of CDRL1 is as set forth in any one of SEQ ID NOs: 109-144 or 415-473; (e) an amino acid sequence of CDRL2 is as set forth in any one of SEQ ID NOs: 145-180 or 415-473; and (f) an amino acid sequence of CDRL3 is as set forth in any one of SEQ ID NOs: 181-216 or 533-591.

2. The antibody or antibody fragment of claim 1, wherein (a) an amino acid sequence of CDRH1 is as set forth in SEQ ID NO: 30; (b) an amino acid sequence of CDRH2 is as set forth in SEQ ID NO: 66; (c) an amino acid sequence of CDRH3 is as set forth in SEQ ID NO: 102; (d) an amino acid sequence of CDRL1 is as set forth in SEQ ID NO: 138; (e) an amino acid sequence of CDRL2 is as set forth in SEQ ID NO: 174; and (f) an amino acid sequence of CDRL3 is as set forth in SEQ ID NO: 210.

3. The antibody or antibody fragment of claim 1, wherein (a) an amino acid sequence of CDRH1 is as set forth in SEQ ID NO: 35; (b) an amino acid sequence of CDRH2 is as set forth in SEQ ID NO: 71; (c) an amino acid sequence of CDRH3 is as set forth in SEQ ID NO: 107; (d) an amino acid sequence of CDRL1 is as set forth in SEQ ID NO: 143; (e) an amino acid sequence of CDRL2 is as set forth in SEQ ID NO: 179; and (f) an amino acid sequence of CDRL3 is as set forth in SEQ ID NO: 215.

4. The antibody or antibody fragment of claim 1, wherein (a) an amino acid sequence of CDRH1 is as set forth in SEQ ID NO: 12; (b) an amino acid sequence of CDRH2 is as set forth in SEQ ID NO: 48; (c) an amino acid sequence of CDRH3 is as set forth in SEQ ID NO: 84; (d) an amino acid sequence of CDRL1 is as set forth in SEQ ID NO: 120; (e) an amino acid sequence of CDRL2 is as set forth in SEQ ID NO: 156; and (f) an amino acid sequence of CDRL3 is as set forth in SEQ ID NO: 192.

5. The antibody or antibody fragment of claim 1, wherein (a) an amino acid sequence of CDRH1 is as set forth in SEQ ID NO: 31; (b) an amino acid sequence of CDRH2 is as set forth in SEQ ID NO: 67; (c) an amino acid sequence of CDRH3 is as set forth in SEQ ID NO: 103; (d) an amino acid sequence of CDRL1 is as set forth in SEQ ID NO: 139; (e) an amino acid sequence of CDRL2 is as set forth in SEQ ID NO: 175; and (f) an amino acid sequence of CDRL3 is as set forth in SEQ ID NO: 211.

6. The antibody or antibody fragment of claim 1, wherein (a) an amino acid sequence of CDRH1 is as set forth in SEQ ID NO: 240; (b) an amino acid sequence of CDRH2 is as set forth in SEQ ID NO: 306; (c) an amino acid sequence of CDRH3 is as set forth in SEQ ID NO: 372; (d) an amino acid sequence of CDRL1 is as set forth in SEQ ID NO: 437; (e) an amino acid sequence of CDRL2 is as set forth in SEQ ID NO: 496; and (f) an amino acid sequence of CDRL3 is as set forth in SEQ ID NO: 555.

7. The antibody or antibody fragment of claim 1, wherein (a) an amino acid sequence of CDRH1 is as set forth in SEQ ID NO: 244; (b) an amino acid sequence of CDRH2 is as set forth in SEQ ID NO: 310; (c) an amino acid sequence of CDRH3 is as set forth in SEQ ID NO: 376; (d) an amino acid sequence of CDRL1 is as set forth in SEQ ID NO: 437; (e) an amino acid sequence of CDRL2 is as set forth in SEQ ID NO: 496; and (f) an amino acid sequence of CDRL3 is as set forth in SEQ ID NO: 555.

8. The antibody or antibody fragment of claim 1, wherein (a) an amino acid sequence of CDRH1 is as set forth in SEQ ID NO: 270; (b) an amino acid sequence of CDRH2 is as set forth in SEQ ID NO: 336; (c) an amino acid sequence of CDRH3 is as set forth in SEQ ID NO: 402; (d) an amino acid sequence of CDRL1 is as set forth in SEQ ID NO: 461; (e) an amino acid sequence of CDRL2 is as set forth in SEQ ID NO: 520; and (f) an amino acid sequence of CDRL3 is as set forth in SEQ ID NO: 579.

9. The antibody or antibody fragment of claim 1, wherein the antibody or antibody fragment binds to a spike glycoprotein.

10. The antibody or antibody fragment of claim 1, wherein the antibody or antibody fragment binds to a receptor binding domain of the spike glycoprotein.

11. (canceled)

12. (canceled)

13. The antibody or antibody fragment of claim 1, wherein the antibody or antibody fragment comprises a K.sub.D of less than 10 nM.

14. The antibody or antibody fragment of claim 1, wherein the antibody or antibody fragment comprises a K.sub.D of less than 5 nM.

15. An antibody or antibody fragment comprising a variable domain, heavy chain region (VH) and a variable domain, light chain region (VL), wherein the VH comprises an amino acid sequence at least about 90% identical to a sequence as set forth in any one of SEQ ID NOs: 592-657, and wherein the VL comprises an amino acid sequence at least about 90% identical to a sequence as set forth in any one of SEQ ID NOs: 658-716.

16. The antibody or antibody fragment of claim 15, wherein the VH comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 594, and wherein the VL comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 660.

17. The antibody or antibody fragment of claim 15, wherein the VH comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 595, and wherein the VL comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 661.

18. The antibody or antibody fragment of claim 15, wherein the VH comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 598, and wherein the VL comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 664.

19. The antibody or antibody fragment of claim 15, wherein the VH comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 603, and wherein the VL comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 669.

20. The antibody or antibody fragment of claim 15, wherein the VH comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 615, and wherein the VL comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 680.

21. The antibody or antibody fragment of claim 15, wherein the VH comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 631, and wherein the VL comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 691.

22. The antibody or antibody fragment of claim 15, wherein the VH comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 645, and wherein the VL comprises an amino acid sequence at least about 90% identical to a sequence as set forth in SEQ ID NO: 704.

23.-47. (canceled)